2O1EA

Crystal structure of the metal-dependent lipoprotein ycdh from bacillus subtilis, northeast structural genomics target sr583
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
282
structure length
266
Chain Sequence
KLHVVTTFYPMYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAEKSMGQGHAVFVNASKGIDLMEGHAMDPHVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEYGLKQVPIAGLSPDQEPSAASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTEVLNTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YcdH
publication title Crystal Structure of the Metal-dependent Lipoprotein YcdH from Bacillus subtilis, Northeast Structural Genomics Target SR583
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 75
structure length 266
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2o1eA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2o1eA02
1MIOA 3ZK7A 2YNMC 5I4KA 1N2ZA 4WNAA 3MINB 4LJSA 4G07A 4TKVB 4HN9A 3K1AA 5FLYA 4UTPA 1G21A 4FNAA 2Q8PA 3MWGA 1QH1A 2XV1A 1M1NB 3AETB 2XY4A 4GICA 2M6LA 3PDIB 3AEUA 4G09A 2OGWA 4TKUB 3HXPA 2OSVA 3AEUB 2X4LA 5CX1B 3U7QB 3CX3A 3R5TA 4MDYA 1TOAA 5JPDA 5BVGA 4HMPA 5JJ5A 2AFIB 3TNYA 4ND8A 5JOQA 1H1LA 1L5HA 1K0FA 1KAEA 1PQ4A 2WHYA 3AEKB 3TLKA 5HX7A 4PAGA 4MX8A 1K2VN 2AFHA 5KOHA 1MIOB 1N2CA 4WN9A 2PS0A 1EFDN 1K75A 3PSHA 4K3VA 1XVLA 4WNAB 5M3BA 5GGYA 3G9QA 2PHZA 4MLZA 2ETVA 3K1AB 1N2CB 5AFSA 1G21B 2YNMD 2XQVA 4UDOA 3UJPA 2OV1A 5M2QA 2PS3A 1QH1B 4LS3A 3AESA 2XDQA 1QH8A 1G20A 2M6KA 3EIXA 4OVKA 2RG7A 3LHSA 4OXQA 3MD9A 3HH8A 4HMQA 4INPA 3TEFA 4PM4A 3AEQA 1KAHA 4XPIA 3ZK8A 5M34A 5BVGB 1FP4A 3AERA 1PSZA 3ZKAA 4DBLE 4ND8B 1H1LB 1L5HB 3LI2A 5BVHA 4N01A 2R79A 1ESZA 3BE6A 2MINA 1M1YA 2OV3A 4WZBA 5KOJA 4IRMA 2AFHB 5KOHB 2O1EA 3PSAA 4WN9B 1M34A 3MFQA 4WESA 5M29A 5JG7A 5B58T 4MO9A 2XH8A 3ZTTA 4B8YA 3GI1A 4M7OA 2WI8A 2QI9F 3MINA 2PS9A 4FI3F 5HDQA 4TKVA 3AESB 3HJTA 1K7SN 4H0FA 2XDQB 3ZK9A 1QH8B 4H59A 1G20B 1M1NA 3AETA 4FKMA 4UDNA 1KARA 3MWFA 1QGUA 3PDIA 4UTOA 2R7AA 4NNPA 4TKUA 1N4DA 3AEQB 4XPIB 4INOA 5KHLB 1QGUB 1FP4B 3AERB 5CX1A 2Q8QA 3U7QA 4WZAA 5CR9A 5BVHB 2PRSA 3R5SA 4BBPA 4HMOA 2AFIA 3BE5A 3EIWA 3NU1A 1N4AA 2MINB 1M1YB 4WZBB 5KOJB 3AEKA 4WZAB 4OXRA 4CL2A 1M34B 5GGXA 4WESB 4FILA 2XUZA 4NNOA
chains in the Genus database with same CATH superfamily
5AKYA 2AJLI 5ITZA 5KTNA 4MKZA 4NAUA 4ZEMA 1GKYA 3QWAA 3ZLJA 2BVNA 4RVSA 1IUOA 2FPLA 2EC5A 5EINA 3RVQA 1CYDA 3QJYA 2VC2B 3QVMA 2QD3A 3B1YA 1ISPA 1CFJA 5DTIA 1FB5A 4KXNA 3NZEA 3S2GA 3PDIB 2I6GA 3LPCA 2Q6OA 3EGDB 2QJOA 2D1QA 2PMDA 3K20A 3KEMA 3DVQX 4RXUA 5K3CA 3KP1A 2QZ4A 2VRWA 2JHAA 3VUFA 2C4NA 1GCUA 3ETHA 3EFEA 4HH4A 1FRFS 1X7WB 1W0JD 4J1TC 4RHTA 4TUYB 5ER9A 2H54A 3H13A 3UXEA 1GVHA 1QO7A 2IEBA 3AOEC 1EK2A 3RAJA 1XMIA 4F46A 3ZV7A 2G83A 1S2DA 1JWBB 2VJLA 3A10A 5DI3A 3DKKA 3JQ8B 4GKJB 2ZJ4A 3E61A 4KZKA 2FZCA 1P74A 5JI2E 1O4VA 1VE3A 5CYOA 2OHGA 2G40A 2OORA 4EVRA 1B0AA 1N3LA 2V65A 3H04A 1HL7A 4YC7A 2K2QB 2NT4A 1C3XA 4CL3A 1KXJA 2XDYA 3WB2A 3KR9A 2QN1A 4F3KA 5KDOA 3G0HA 5E0OA 3FGNA 5KPJA 1JKFA 2HJVA 3DV9A 4GMXA 1BDBA 2H8KA 2C03A 3T5BA 3VMMA 1Q0PA 2FP4A 2BY4A 2WJ4A 1Z22A 2YS7A 4BGEA 4UEOA 2NXCA 3BAZA 3PNLA 1G3QA 4NBUA 1LV8A 1DC7A 4V0MA 4E07A 4DV7B 2X86A 1TTPB 5JSKA 2ZCJA 2FE1A 2O8CA 5J43A 3OICA 1XR3A 4I66A 4LK2A 3E8MA 5T4FA 5EE0A 1SIOA 4MQ4A 3D6FA 4E94A 3MJVA 3D8RA 3ER6A 1N2EA 3L7BA 1P2VA 5JZVA 3CWCA 3SLKA 1JEQA 1FYFA 4KMOA 2O54A 2FHSA 3DBRB 3K09A 1JAYA 1DO0A 1M2VB 3RV3A 2TRSB 3TIIA 1TAHA 1VJGA 4AROA 5ALWA 2BKAA 4CIBA 2ZRMA 5AJZA 3M70A 4LJYA 2YYAA 1ZWKA 3U6KA 4KFRA 5DX1A 4CEIB 1FP1D 2WW8A 4WK0B 1T3LA 1KQNA 1XPUA 4CF7A 1FP7A 1D6JA 3N0VA 1YS4A 3CE9A 5K2MA 5EJ4A 5BW4A 2VHTA 3EQ2A 3K1TA 4JU9A 3WB1A 2A1TR 2BMEA 1R8QA 5AUOB 3PWSA 1C4OA 1CDDA 2HRQA 3LF2A 4LX8A 5T5QA 3KFVA 3HI6A 4QUJA 4F1JA 2B2CA 2QB5A 2PRYA 1V25A 4YBZA 1UXHA 3EVZA 2DY0A 1GOTA 5KX5A 3CLSC 1K0UA 2C5SA 5GM1A 2O3RA 5D51S 1XJWA 1EP1B 1QDUA 4NAVA 2PUDA 2GNOA 1IZ7A 2PEYA 9MHTA 4R9SA 1OX4B 4HTFA 2RG1A 2UYYA 2MSKA 3R44A 3NM4A 3JQAA 4LCBA 3GA0A 1L2TA 3QXGA 4NJMB 4NENA 3HMKA 1E64A 4B6GA 1Q14A 3DFZA 3AG5A 4COKA 2OD7A 1RACA 2MHCA 1PSWA 3HY3A 3IVRA 2OYCA 5C0OE 1YL5A 3PCRB 5SZKB 5GGXA 5EA2A 2PGNA 2Q1WA 1Y6QA 4YJDA 1P2FA 3I32A 4LN1A 1Z08A 3IUQA 3TIFA 3VPAA 1IK4A 3OZFA 1JEYB 1T26A 2UZ4A 1Q74A 3ROGA 4KAJA 3QELB 4Q37A 3TFOA 1QP4A 2HHLA 2R66A 3GK3A 3ILHA 4WVLA 3H11A 1FFBA 3PNVA 5CB4F 5IM5A 4URXR 2RKWA 3KQTA 3TRKA 3F6CA 4JVNA 3KNZA 3PDWA 1O57A 1UBJS 3CUUA 2HPAA 1BEZA 3HG7A 4L16A 4B6SA 4DNXA 3TLAA 1KTVA 2PLFA 2PXXA 1YRAA 1PL0A 4PLTA 2C4TA 4Q7LA 1LV7A 2NIPA 3F8SA 4X8MA 1X14A 4B7AA 1CUZA 5E7QA 3ZDZB 4XCVA 1W4LA 3HY4A 1UDXA 5EHZA 1IB6A 4PIMA 4WFIA 1EFVB 2IBMA 3IR5A 3S8MA 4G6ZA 5WRFA 1GZ4A 2HSJA 1PRYA 4N6NA 1T6XA 3NPAA 5CAEB 1FFGA 4GIBA 4HN2A 2DKNA 2WF6A 3C85A 4LGCA 1MH1A 2C7OA 3DG9A 4FS3A 4PNHA 5EWMB 1QE0A 5TQ0A 1O97D 1X3SA 2PFKA 3KCNA 3OZVA 4XE5A 5ECYA 2FFRA 2C94A 1JEJA 2DTXA 2ZJ2A 5NULA 1ZM2A 4WHMA 3OWOA 4AF6A 2DWQA 2PUWA 2WU0A 1CUFA 3JQFA 3NDRA 5FPKA 1DE0A 3ECCA 3NHAA 1WOYA 1W76A 3FVQA 3RQIA 2Q6VA 5AFSA 1JDBC 2CNDA 2BHRA 1VG0B 2I3ZA 1QH1B 3I9MA 5MN6A 2PJZA 3LPNA 2VR1A 5K1ZA 3SYNA 1O87A 2QNBA 4OYHA 2E7ZA 2XTNA 3RWMB 2J5KA 3EZ7A 3H99A 2DWCA 1AA9A 2QHXA 3HKCA 3RJ9A 4A8JA 1Z73A 1EWQA 4KNYA 4DV4B 2F17A 1L5ZA 1ZUNB 2GCIA 3LHDA 1VZ2A 3P2IA 4Q9KA 2VJKA 1RI5A 4IKPA 4N0DA 3SEZA 5KSOA 4AS1A 3LI2A 1NT4A 3BHNA 4MV8A 3WLPA 2ZIFA 4PZUA 4QFBA 5AM5A 1YZKA 2EF0A 4Z6KA 2GN8A 3KOUA 2E1PA 2B4YA 3WGHA 4E3ZA 5C18A 2V9PA 1KQFA 2P9TA 4OHPA 5HA5A 3T3IA 3WB9A 1JI0A 3T7CA 2QIOA 3F8TA 3BMXA 4YRTA 5B1EA 5HRUA 2CKDA 5EIFA 4KSBA 3NUZA 1E59A 3ORSA 5LMUB 2VT3A 3CR8A 1HDIA 3IR7A 5B3KA 5CYFA 4RPJA 2OBLA 3SSOA 3V9AA 4GDMA 1DCKA 2L42A 4JBLA 3EG9B 1E98A 4D41A 1VL5A 2J0UB 4UHHA 2ZT5A 1CERA 3SF8B 2VAVA 3EGIA 2X1HA 1WDTA 3AKEA 4JP2A 3HKEA 3FTCA 3SZOA 3VU0A 1H4QA 4JXZA 2WM9B 5BVHB 5IAAA 4MYDA 3EEBA 3AVQA 4FD2A 3RYFA 2R1ZA 2VSXA 2YW2A 3BSSA 2I2XB 4F2GA 3LSTA 4L22A 2C2MA 4RS3A 2AF3C 5IVDA 4D02A 4YUYA 3VVCA 3U31A 4MVXA 5H83A 2H0RA 1GKLA 1K7CA 2RHDA 2A9OA 4NDNE 3ZYZA 1DKLA 2J3IA 5DM2A 1WHSB 1E7YA 4DC0A 1R6TA 4C7BA 3E5RA 4FDTA 3NBAA 2HM7A 3BL8A 4LJ4A 5TC4A 1U8FO 1G3MA 1PBNA 1V4NA 1ZM9A 5IH3A 2AUNA 1C9NA 2GCOB 1TM1E 3SC3A 3BDIA 5IJ9A 4ME6A 5I9LA 3LCVB 2ANBA 3GCZA 3O75A 2PMEA 5B4UA 4EABA 4MW5A 1SEVA 1A27A 1JSCA 1PZXA 1QHEA 1UPUA 1XKXA 2JH9A 2N75A 1KYVA 3UN1A 4DJ5X 5L4LA 3SZRA 4NZ9A 2XUPA 5AW1A 4DT1A 1V8FA 2JS7A 3NDIA 2RAUA 2HRDA 3THSA 4JJ4A 5HRCA 2F48A 2NZVG 3TCXB 3HGMA 5F2EA 5ULLA 4BVLA 2CWDA 3LQ1A 2VSOA 1GZ3A 1RVV1 4HSGA 3P9IA 4PYNA 3W6PA 4ARBA 4ZOQI 3RTDA 3C74A 2ZRDA 3LDGA 1CY2A 4OK3A 2IEIA 1ENYA 4PO3X 1SG0A 2ZRAA 1THMA 3IUPA 3LO5A 4I99A 3GAMA 3HYSA 3DZFA 4PGFA 4LC9A 2AXQA 4GU5A 4UPEA 5JU6A 1U81A 4WOKA 2Q9UA 4HRVA 4OUKX 4P6VF 4F04A 1MORA 1EVEA 5KNCA 3LZDA 4QOGA 3BD9A 1XZNA 3NWPA 4IS3A 3RK1A 1PEAA 1V95A 2OCPA 3IEXA 5ENZA 3N53A 3WYDA 2P75A 3GMDA 2P1DA 2YCLA 4HB3A 3ERCA 2Q3CA 2XSZD 2A5DA 1E8DA 3DHVA 2HPVA 3T3HA 4IDPA 4KAXA 2D1YA 5AQEA 5A5GA 3OCYA 4EPYA 2UZ1A 2VRCA 3BJZA 3NONA 2JGLA 1TKAA 2PK3A 2Y0CA 4HUQB 4C76A 4XPIA 5L3QB 4M8SA 1G2OA 2QUJA 3N07A 3JSAA 3WIEA 3D5QA 1GU7A 3SJBA 1VP9A 4DDHA 2G1UA 2XW6A 4BQQA 1AK1A 3LNTA 1UINA 4NNJA 2FGJA 1ZR4A 2EFEB 2R6ZA 3BE6A 1DEOA 1A8IA 1GYRA 2NZUG 3BB4A 3CS3A 2ZUWA 1EBUA 2AD5A 3RBZA 2VCEA 3IQIX 4JX9A 4DDUA 3EDRA 3JCZA 2FY8A 2ZZKA 4OQDA 3GG2A 2PWAA 3VPCA 1G9TA 3D31A 4B4OA 3GLHE 5JC8A 1FP2A 3Q7QA 2A7QA 1QRRA 4YMWA 5I51A 1YH3A 4HB0A 2PS9A 2FSPA 2Z5LA 5HDQA 4DNOA 3BRWD 3I01M 2ZVQX 4LDPA 4R83A 4FYWA 1T6NA 4EY6A 2R4UA 2JHGA 1D5CA 1KVQA 2QRQA 1T8TA 2ZFUA 3WNBA 1RPZA 4DZTA 2GZ2A 1QC5B 4KQJA 3R76A 3SSMA 5C8YA 4C3ZA 3I9JA 4TTJA 1CUHA 2HF2A 2QMQA 2QP4A 2ZS8A 3B6KA 3F2IA 1ABFA 2B5OA 3H7IA 3L3BA 4UXHA 3RKUA 3X1ZA 4KV9A 5K6TA 3COJA 3GT4A 3E9MA 4YUXA 1RABA 3RROA 1KJQA 4MWGA 2VJAA 5G41A 2FPIB 1MFPA 3K4PA 4R81A 4TV8F 1VHJA 2NVUB 4CI0B 3PEWA 3U48A 1XTPA 1I24A 2CKMA 3VO8A 1AV6A 4IAOA 3N5CA 1NSFA 2YJ4A 1M72A 2BC9A 1ZHFA 3QXXA 4TV8A 4BVJA 2NU8B 1GKIA 3I4FA 1SKMA 3PYXA 3Q2OA 1YS2X 2G0AA 1DXHA 4L74A 5REQB 1BIFA 3DZCA 1GA1A 1K3UB 2RGYA 4YWJA 1ZI8A 2ZRNA 4MWEA 4AP9A 4F3RA 1MAHA 5EGSA 1T6BY 3TZEA 3ZD7A 1FFWA 4A6EA 1OZGA 3SR0A 2OZLB 4R8SA 3WGTA 1GFWA 2EJWA 1ID1A 4OOEA 3AF3A 4KB5A 4XUEA 2ZM5A 1Y4SA 1ADJA 4XTRA 4AJEA 3BFPA 2HXYA 3A11A 1QAMA 1S96A 3HJRA 4G9GA 4PPGA 3J81k 3D02A 4OX9B 1ISHA 3FAKA 3W3AA 3QKIA 4L2IB 3RS8A 3OF5A 4LY6A 5GIOE 3Q8KA 5LOVB 2G7MC 1GLGA 3M1YA 1H2RS 3K9GA 2NP6A 4GSLA 5ERXA 1PQPA 2QPLA 3QV2A 3B3QA 2VHCA 1WB6A 1AZWA 2XUFA 4TROA 1EP9A 3DMDA 1PD0A 3F7MA 4F72A 1TPYA 5TPZD 3BTSA 5DP2A 1S8OA 3AHHA 3NAMA 4I0WB 1HE4A 4RABA 3UV3A 4KBFA 1O2DA 5L40A 1BX1A 3CUSA 4KO8A 1WSBA 2I99A 2IYNA 2ZR0A 5FPPA 4CCYA 3LM8A 4KNWA 3WNVA 4JLPA 5ADVA 2QNIA 2XQGA 1LTKA 4A0RA 4P22A 3DWFA 3ZDRA 3GLRA 3OTWA 1BYIA 5HGXA 4IYRA 3S8EA 3BXZA 4RDIA 2OVFA 5AMXA 4KAFA 3WDSA 5ADWA 4K87A 3EOZA 4BRWA 4JKOA 3FCXA 4CR8A 3G23A 1CJMA 4EGJA 1J1IA 1S89A 3NRJA 2R1UA 4TSFD 3V1NA 2FRDC 5ITSA 1CR1A 3DVAB 1I5RA 3CJRA 3SFZA 3W5VA 1YB5A 3WK4A 3IP9A 4AS2A 1BMFD 2OENG 3I1IA 1DELA 3L46A 3WDMA 1RWBA 2PMBA 4QNRA 4DG8A 2CLKB 4PLWA 1V3TA 2JLSA 3DVLA 2I71A 2WWRA 3E9NA 3FWPA 5CFZA 5JADA 5TDHA 3U6BA 4KGVA 1N5DA 5JG7A 3RVJA 3RRZA 1BMQA 4EKGA 3OUTA 1CW2B 4II7A 5C32A 3HU1A 2A30A 3BZBA 3GUZA 3S2YA 1U9YA 2R11A 3IAUA 2DWPA 1HEYA 3MEQA 4RKYA 1WNTA 4AJ9A 3LKBA 3U61B 1OUMA 3AGPA 1L4KA 3LWNA 3WGOA 3X43A 1EFHA 4MH0R 3RADC 1I33A 4G0PA 4XYMA 3QYFA 4NYMR 5J2UB 4UDXX 3ZC3A 2H7VA 1WKVA 2Y77A 4DLZA 2KMLA 1ZINA 1I3MA 1JJBA 2WWGA 3LY5A 1J5EB 5JWRA 4TMKA 1Z38A 2G6BA 1NYLA 1U2PA 4L5AA 1F2UB 3GMTA 3OQPA 2NVOA 1U1IA 3W90A 4Y0AA 2QE6A 4JLAA 1X7YA 3T4XA 4AKIA 3DA8A 3IHWA 4HY3A 4DYHA 1XNHA 2IOQA 3C14C 3HCNA 1VQ1A 4OCZA 1NMZA 4H3KB 4MVJP 1P1CA 4L07A 1UBFA 2HOQA 2IZ7A 2W6JA 3VC7A 3D7MA 2NYUA 4RSMA 1UMCA 3AK4A 4ZJPA 4BWFB 3KQLA 2D0OB 4CG2A 5K3AA 5ADUS 2C5BA 2XWSA 2Q5IA 2FN4A 2V7EA 3IKVA 4XGQA 3PVZA 1IOZA 4QL3A 4WXRA 1R74A 1JE0A 2A0YA 1XU7A 1WSWA 5CFLA 2XUJA 3RIXA 1U2TA 2VJCA 2ZLBA 4BBAA 2H0QA 4BFCA 2CN1A 5AK0A 2CXTA 3RK0A 4IGAA 3W7BA 4HDNB 4TVBA 5FKJA 3W4KA 3X1DA 4URFA 1RQRA 2CYBA 2JD1A 2ZROA 1VB3A 5LQNA 5GONF 2C9YA 2O3JA 3F5SA 1Q0UA 3FPCA 4ARSA 2JDIA 3EEYA 4PICA 3U4DA 1XD9A 5GONA 3DTNA 2V7VA 3CRRA 2EP8A 3F49S 4TX1A 4C01A 4YCJA 3H87A 4E33A 3WBJA 4DIEA 4DYVA 4HK4A 5JFGA 2AFHE 1BGXT 3CEPB 5CLHA 4QYWA 1I32A 4ZQEA 2JBAB 4DA4A 3ONWA 1JKJB 2V98A 2BISA 2P2GA 3E6AA 4EEKA 1I10A 3GLGA 2B1GA 3UJDA 5A5FA 4ZJZA 3KEGA 1GLNA 3DLBA 1G38A 2CJWA 1GN8A 3HYRA 3MZ0A 4IX9A 2HU7A 1R4AA 3HKBB 3NV7A 4OJMX 5DBEX 4ZANA 4ENVA 4G5YA 3IEMA 1JLHA 5DM4A 2BELA 4F5YA 5HUQA 3FROA 3PV0A 3ZX5A 3GA7A 1YTUA 1TEHA 2IUTA 5E9AA 2Q7XA 3WL6A 5HF9A 1IY2A 1E6KA 3NLLA 2F9MA 1IJFA 3EDQA 1HGXA 4MW2A 1QQ5A 4OX9Y 4RKQA 2GHQA 4UCFA 1YQUA 5FBZA 3G5MA 3VPFA 3WQRA 3AR8A 3WQSB 2QVYX 5CJ2A 1OSNA 4YAEA 5IG2A 1SIUA 2B4KA 3MC1A 4MS4A 1Y1LA 4OGLA 3AERA 4BIIA 4F5ZA 3ZJTA 3DKIA 5G02A 2I7DA 1O96B 2R8PA 4BLVA 4DPKA 1QFZA 2FZ5A 1CRQA 3ZZUA 2X8WA 3NIBA 1HDZA 4FINA 3CB2A 4GPTA 4BMYA 2Y1WA 3GROA 2LCQA 4F3YA 3OUZA 5JFOA 3FTQA 1ZGGA 2H7CA 2Z4RA 2YV3A 1AB6A 2VLBA 1XNRB 3OZGA 3PEFA 2DHCA 2YJTD 3CSUA 1S3SA 3L6EA 3DULA 1P7YA 4BLWA 2OV4A 1JDUA 1XI2A 2W58A 4RF2A 1N5LA 1QKJA 4W5HA 4I1UA 1AUOA 2B6NA 4B2PA 4BXOA 1Y1SA 3HJTA 3TLXA 1CUBA 4KDEA 3AILA 3IFSA 3LX8A 1Q7RA 3HN7A 4EUKA 2X2FA 3ZHBA 1R6BX 3M6IA 4MI1A 4DL9A 1A4RA 2VEDA 4IGIA 1G7SA 1GPMA 1IFXA 3ECAA 3OTQA 1JX6A 2PX2A 3WWEA 4BMZA 5IEJA 1V1RA 2IS6A 1NMYA 4ECEA 1M0WA 1TUEA 2I6TA 3B6JA 5ITWA 4KEAA 4FFVA 1QRTA 4IICA 1PFGA 1WD7A 3BUSA 1Y7HA 1YD7A 3O8DA 4OUDB 4WCFC 1KVSA 5DFAA 3ZZTA 1EQ2A 1QWSA 1DJLA 2QM8A 4N8EA 5KOJB 1ZH2A 1LUAA 1TL7C 5AOVA 3RM3A 5IAOA 2CXPA 3P9SA 4I9NA 2AMJA 4MTLA 2B99A 3FN4A 5A4KA 1V41E 1GV1A 3PNMA 3IKJA 1GA6A 1EG7A 4GI3A 1QYXA 3JRNA 3WNQA 1UMDA 1U6IA 4HUTA 1JT9A 4HT3B 1BVHA 3NVDA 4DKXA 1GITA 4LK3A 5L9AA 1H85A 4TN5A 1W88B 5TY0A 4YRZA 3K1AA 3RYHA 4KQHA 4IIJF 4LGVA 3SFVA 4GZ5A 3Q0TA 4M89A 4HNAB 1ID8A 1YASA 1OXTA 2IF2A 3FFXA 4O4HB 5KVSA 2R6AA 1K8XB 2SBTA 2FWPA 4G1CA 2PUVA 1V2GA 5GVRA 1CHDA 1O03A 3G8BA 4W4TA 2ZRCA 3F7NA 3KPJA 1PFKA 1I4DD 3BQNB 2Q5OA 3NAQA 4TVOA 1JPJA 3EVTA 2HHAA 1ZVMA 2A0KA 2C58A 2VDWA 2JIQA 3GLVA 4L5JA 5FUWA 2QVGA 3AB8A 3RT1A 1E0AA 1Y7IA 3RRNA 3T35A 3Q3CA 4HBZA 4TM7A 3T7SA 1JSRA 2K4MA 4WEQA 5KTPA 2FXIA 2G7ZA 4DV0B 3K6KA 4TQUS 3PGXA 5A7FA 3GRCA 4PX5A 4W1PA 3R7WB 2R62A 5THKA 1MMFB 3KD2A 3KSMA 1ISMA 1X7ZA 3DLPX 3K1ZA 5F1OA 1HT3A 4L4XA 4TS9A 1Z7YA 2C0CA 2Y9MB 2AN5A 4FS8A 2OGUA 3NC1C 4RX1A 4YJGA 1SU4A 2C8VA 5DNWA 5ICMA 3K2QA 5B7NA 3P4XA 3TE6A 2BDTA 3HA2A 1QONA 1Z17A 1N34B 3EF3A 4FNMA 4BNHA 1OI3A 4UFOA 3VR4H 1NE2A 1YVEI 3W1WA 2J3EA 4BB6A 1E3WA 2JASA 2CNWA 4XVCA 4MUHA 1BDJA 3FTEA 4FBGA 2L82A 2GJ8A 2J6HA 3GXBA 1YR3A 5EP2A 1XCLA 1Y9JA 3BXPA 2E21A 4P0QB 4IJKA 2I7CA 1DAIA 3QJGA 4J3NA 1QP0A 2JCSA 5K8IA 3UAOA 4O2BF 3A6ZA 5E4YA 2ACWA 2H2IA 3UFXB 3PZRA 2ZUVA 5J9FA 1P8AA 2FU5C 1NUTA 4O2BA 4U7DA 4MIOA 5HS6A 4FCTA 1D8TA 1P19A 3C6YA 4QYMA 1SKUA 1M1YA 4JY7A 5KAPA 4B2LA 1Z39A 4H3VA 5KSPA 1VIYA 1JU3A 4C0XA 4TSKA 4CHGA 3P0IA 3WSWA 4E1AA 4ZYUA 3ZXYA 3CKYA 2ZJ1A 4PC1A 4B0OA 3C3EA 4G8BA 2R1VA 2DWUA 2WSYB 5G4KB 3KQUA 2JF0A 2ONKA 1KEKA 2V9ZA 4BUJA 1LQUA 5AHWA 3OVMA 3A9UA 1B15A 4XWTA 3QVUA 1G8HA 3B2EA 1ZI6A 3AHIA 3C4QA 1PYOA 4ZMBA 1XQYA 4MVWA 2PTGA 3T54A 2YWGA 3H05A 4D0LB 5FEUA 1N6PA 3DAHA 2HMYB 4Q1AA 1R0ZA 1HZZC 1TMGE 3PIRA 4MV4A 4WOBA 4BVAA 2YXDA 5CVUA 2W2KB 3TZBA 1PGJA 1Y34E 4JI4B 1U9IA 1JFFA 2ZVJA 3FBGA 3OT4A 1OE0A 2J5QA 4RD2A 3MELA 4S1PA 5D1HA 5GJVC 3WY9A 1KY4A 2WSIA 2VAMA 3JARB 4PQFA 1PJSA 1D1QA 1SIBE 1FQKA 2Q28A 4FX5A 3B6MA 2QWXA 3HCEA 5E7IA 2QLTA 2L0XA 1W8IA 4EX7A 1I80A 2QMEA 1FRNA 4M8KA 4UHDA 4Q9JA 2XOXA 3F90A 2RJOA 5KIAA 4C08A 1VIDA 5G1NA 1YVPA 1F9AA 4ZODA 4YV1A 3TMKA 3H17A 3BBPA 2C5HA 3LT1A 4DEVA 1UM9B 4P7FA 4M1TA 2UVPA 5J23A 3T5AA 1NQVA 2KQUA 1KI6A 1EJ2A 4JIMA 2UU9B 2FP3A 2OCIA 4EJ0A 1U2ZA 2YUIA 2B9EA 3EHEA 3F2VA 4C4PA 5JD4A 3QNUA 1IN4A 2WOOA 3L8DA 1L5VA 3I05A 1RRCA 2Z9CA 2FPPB 3DP9A 2KBFA 3I8OA 4G36A 3NJ8A 2YV5A 5K6AC 1LXCA 2A9JA 2V7QA 1TW3A 3JQAD 4FT2A 3RARA 1G5TA 3FH0A 3G2KA 1RHUA 1V7QA 3PPYA 2H5EA 1JWLA 2PL9A 4FEYA 2QUAA 5JNUA 4GEGA 3GLUA 3D64A 2QX8A 2GM3A 2O7SA 1RYMA 3JWPA 4YDHB 1UDAA 3ZHYA 5B1YA 3QK7A 4R1UA 4BFUA 1MAAA 3CZQA 4GM1A 4R1TA 5E3JA 2JJQA 1BXRB 2X9QA 4FXPA 4Q4HB 3D8NA 1QU2A 2DLDA 1SHTX 3DE5X 2VDOB 3NEJA 1F4LA 4G5GA 5L6MB 4N3GA 5EWLB 2RHMA 1CJSA 3VNAA 1HDXA 3T5DA 1TYBE 4CTMA 5IHPA 2MOKA 3HL0A 4CKEA 1C29B 4UCQA 4GP6A 4RZSA 4OVKA 2GILA 3PPWA 4E2YA 3G8YA 3WWYA 5JS6A 5LMZA 4DSAA 2XGMA 3CVYA 2X15A 4AJLA 2GOYA 3KQMA 1Q77A 1VYTA 3CTPA 3WFZA 2C2ZA 4N01A 1NUAA 3ABQB 1P7PA 1R8SA 3R5KA 3OETA 4MWOA 4A03A 1UJ5A 4IBOA 4NCAA 3DONA 2PA0A 3EAFA 1A7KA 5F5LA 3ZHXA 1TT5A 4MP3A 4UUMA 1GNSA 2QLBA 2P9GA 2ZIXB 2VNKA 3AJRA 3I01A 3L6BA 1ZCZA 3HU3A 3Q9NA 4U3JB 3WBFA 4D9KA 2PSHA 5CHEA 1OY1A 2XH8A 5HE9A 3H16A 3NAGA 1COWA 1ZLXA 6PFKA 3JZMA 4ROTA 2Q5HA 5NLLA 3O6VA 2FPUA 1QAOA 4CF3A 3VR6A 5C1PA 2JGRA 1G3RA 3KXKA 2DUUA 3BFXA 3DBLA 3OPYB 1SVIA 4H0FA 2PKWA 1ZSVA 4ND7A 4US1R 3EA4A 4YT5A 3ZK9A 3E35A 4F4JA 1L3IA 2O5RA 3N0TA 3NEPX 4ZCLA 1W1WA 4GSKA 3LCCA 1ZGZA 4HQOA 3SBEA 5EKXA 2C2BA 2PUJA 5HFAA 4IOLA 16PKA 4AD8A 1WV1A 3K70B 2NZWA 4INOA 4H18A 2LTAA 4MULA 1UQRA 2PSEA 1U0JA 4NMMA 4F38A 4J7CA 4ZMSA 5I9SA 2O8EB 3EJWA 4XCQA 5CG1A 3LVQE 3ELUA 4UM9B 4KPYA 1N5OX 1XEFA 2WMYA 1VPLA 3OX3A 4JGIA 1ATZA 6LDHA 5JLJA 1EDZA 4ZTZB 1UOPA 4XDHA 3TZCA 4Q66C 1ATIA 1EK0A 2OZVA 5DM1A 3RIGA 1P4GA 1TVKA 4GMHA 4JIGA 4BO9A 2MTBA 3AU8A 4UPDA 2LIPA 1E1LA 1E4OA 4CLHA 2YNMC 3UVEA 2WQ7A 4LHXA 3ZDDA 5TVGA 1EB9A 3EXEB 1ULUA 3EGXB 5D3KA 3GELA 4BVFA 3U81A 1UR5A 2QXTA 1G21A 4DCNA 4HJXA 4KVZA 4DWWA 1GG5A 1JJIA 3EGCA 1ZO8A 1ODSA 2CHGA 3P9RA 4HB4A 3UKOA 2PJDA 1YV9A 3DPUA 1VG1A 4ISCA 4BQPA 3A3OA 5AW5A 3TSOA 1CR6A 4H6WA 2JG3A 3CLHA 2HK8A 3GOQA 1KHHA 4P4GA 3CY6A 1GKUB 1WUIS 1H69A 1HT0A 3AEUB 3BJEA 4Q3LA 3SM9A 3UK2A 4CQMB 1TRKA 3VX4A 1PHRA 3EARA 3R7NA 1IN1A 5JE8A 2G9VA 2ZJ8A 5KC8A 1U11A 4LCJA 4B6PA 5CLJA 2AFIB 1HUQA 1ZJZA 4E88A 5MFZA 1K0FA 2UZAA 3O4JA 1ZL2A 5CFOA 5DT2A 4AY6A 4OJQA 2B25A 3KYBA 5FXMA 2IELA 5CPFA 3ZUGA 2ODBA 3K1YA 1V1MA 5JISA 4LDQA 4YRRA 5A5DA 4GECA 4WJLA 4MMXB 1Z28A 1D7OA 1DPGA 1SXJD 2BZGA 3P97A 3TCNA 4DUPA 4PAWA 4ES6A 2ZANA 2HFKA 4R9NA 3P26A 1N0VC 4M0UA 1KSGA 3I0MA 2G4LA 3KYDA 1FFAA 2QRPA 3IV7A 4DR7B 2CLDX 1RC0A 1YTLA 4LYYA 1HT2E 3L40A 1ZOLA 1G20A 1BVRA 3KKOA 4QASA 2ZRPA 1E6CA 2JD2A 4EELA 3BZUA 4DREA 5C80A 2X0IA 4P81A 2QBYA 2N9UA 3CHYA 1RRVA 2PG3A 2JFOA 5E9JA 5ALSA 1WU8A 1R0CA 4ND8B 2VJMA 1VB5A 2PSFA 3PD0A 2PS1A 3ZZNA 4E5NA 2O7QA 1NQAO 1U6JA 3CLKA 1GL3A 4MYHA 3DZKA 5D86A 5DISB 3ZI4A 1CRPA 1QR6A 1IWBB 2WAMA 2QL9A 1CIPA 1TFUA 1M34E 3SKYA 4UAUA 2W6ZA 2ATIA 3IEUA 3NJRA 4H1HA 3I0NA 3W2EA 3CF4G 2IS2A 3HCDA 3DBOB 8MHTA 3KE8A 3A4TA 1XQ1A 1JLRA 3MINA 3O7MA 4Y1GA 4Z9FA 4B5LA 3C1AA 2AS0A 5AHXA 1EE2A 1KI9A 1RM5A 1Z5WA 4LV8B 2WE8A 4QOFA 3LQKA 1MJGA 2Y1FA 3JD0A 3UT5A 2BHNA 4DCCA 4EJSB 4J6EA 4QBFA 3DT9A 1X0VA 3IDFA 4EL0A 1EXVA 2WKRA 3F47A 3SQMA 1K9VF 1U0NA 1BHJA 2MYNA 2ZE5A 3MPUA 4CFZA 4YJ2B 3JVDA 3PGLA 2H2AA 1BOOA 1W85B 1P91A 4N4AA 2M6RA 2W43A 3W5CA 5IVKA 4N3AA 4K1XA 1DHTA 1HYEA 3FHCB 3PKIA 4QUIA 4EVSA 3HVRA 2O5VA 2CV2A 3BFKA 4XQ0A 3IBYA 1KC1A 4KN9S 1W2HA 4OREX 3O03A 3QU4A 1C2TA 1L5FA 1QF7A 2WVAA 1KF0A 5ELMA 4U7TB 3U3XA 4DLPA 1XAJA 1AUVA 4MYCA 2RHWA 4QECA 3A0UA 3ILVA 4IDBA 3BULA 1T2DA 2X4GA 5TT0A 5ERGB 2IHNA 2V1UA 3T41A 3F3MA 721PA 3THYA 5KWVA 2HMVA 4MYUA 3C3YA 1M67A 4LJSA 4ANFA 3GLIB 3DO5A 4QT4A 1H94A 4L4ZA 1FBTA 3D5TA 4XQEA 5LWHA 3R3YA 3WICA 1FYXA 1YZYA 1QANA 3IOCA 3W2FA 3C6QA 3GJ7A 5J2TF 2CHFA 2RKBA 2W6MA 3ZWQA 5B4VA 5CFRA 1CQIB 2YVQA 3JYLA 4I1VA 5AIAA 4DIKA 4P34A 5JMWA 5J2TA 5AJVB 2IH5A 3WTBA 1NU8A 3P20A 4DXAA 2VNAA 1LPOA 3KWFA 2H4FA 2IWHA 1BU5A 2GN6A 3NTXA 2DWOA 2YRFA 5AW8A 3KSDO 3KDPA 1CQZA 4RHYA 1ANKA 4XZ3A 2VJOA 4KLAA 4JXKA 2BEWA 3F98A 3FPLA 2GBLA 2PH7A 4PSVA 3GVHA 1VCMA 2WJAA 1VHTA 1ZNZA 3LJKA 2J08A 1IBCA 1SWWA 3W9SA 4RZ3A 4S0ZA 4FZVA 4CCAA 3CVWA 1G55A 4GYWA 1GFZA 2HEIA 4F5EA 5KSYA 3HBMA 4IKEA 3CRZA 1QIGA 1K98A 4AP6A 3IMFA 3ADOA 1XD2A 4J1NA 2NWQA 5KJFA 3AESA 4CL8A 1EEHA 4GC9A 2JFPA 2WWTA 2PVPA 3K0FB 1YHZA 1FPMA 4UU1A 2G9ZA 3ZCVA 5FQNA 3MK31 5BW6B 4E5KA 5B57C 2XVXA 1R4MB 1QIEA 2D0IA 2P2CA 1OXXK 4JVSB 3U37A 2FJ0A 2IU4A 3OM9A 4HC4A 3BSWA 3A9VA 1TTHA 2QMHA 4CLRB 5I7WA 3QU9A 3O4HA 1W1IA 1VJ5A 1BD4A 5DBIA 1O9BA 3W3AD 3ZUPA 4B6FA 3TVTA 3HZOA 3LXXA 4TWIA 4M38A 4OMFG 3V46A 4B40A 3B8EA 3SXPA 2XKJE 1OLSB 3BJIC 5EQDA 2IXGA 2KWIA 2DBYA 3MS7A 5CW1A 3UMMA 1PFVA 3UXYA 1MABB 1DAKA 5A4AA 4P3OA 1F8GA 5IF9A 1VP3A 1SCUB 3UWSA 4BNVA 4B6OA 1TTQB 3DF7A 1KNXA 3HN6A 2ZS7A 3BL5A 4B4KA 1FMJA 4QOIA 3AUTA 1BW9B 2RK6A 2I2DA 2OZPA 3DAFA 1W6UA 1VRCA 4PLFA 2ERYA 1F4PA 1KAMA 1OKKA 4TTRA 1BE6A 1GTMA 3DQQA 3DEJA 2GXUA 5FTWA 3RV4A 2X77A 4YHBA 2VJPA 4M1SA 3KQNA 2CT8A 1VLJA 2O0MA 3BERA 2GJ9A 4LYEA 4A2PA 2YXNA 2WK1A 4ZGGA 4BQOA 5GM2A 1PAUA 3UF0A 1ADBA 3HB7A 4LDAA 2GZAA 1K8YB 1EIZA 2DOKA 2OTCA 2C00A 3R5SA 1MVLA 5BQPA 4MB6A 4BBPA 3TLJA 4QNMA 3QKTA 3O8OA 5EUQB 1LLUA 1XQWA 4AX8A 1Y82A 1QQTA 2J0EA 1FTYA 1JUDA 1XALA 3MWYW 2OQVA 1JAXA 1L8XA 3ZV4A 3V4RA 3ZU3A 2RGRA 1PR0A 1UK6A 3ZVMA 3GRPA 4RWZA 1JLLA 3FGOA 1L7BA 2I4MA 3R0JA 4FTWA 1QHHB 1MQSA 1C7JA 2CSUA 3ICPA 9LDTA 5J58A 1ULHA 2JGFA 3ITEA 4AECA 1LBTA 1PEYA 5ALIA 1KBOA 2V6FA 1W59A 4G0MA 4QDZA 2CUNA 821PA 2OC4A 2BT4A 3B6EA 4URWR 2EL7A 2R86A 4U2EA 1D4AA 3DXZA 1Y7TA 4ZO8A 5C7IO 2W4IA 5GZ6A 3LH5A 2GK4A 4RH3A 5E4TA 6REQB 4A0SA 3M6WA 4Z5XA 1M2JA 2OUIA 1U2DA 2LZ0A 5DXJA 3PRJA 2GDJA 1SHZA 2ZJBA 4RPGA 2EXXA 2ZJ7A 2X8JB 3PJFA 2GKOA 1E5QA 2BI4A 1QSGA 1W46A 3O1JC 1D2AA 2C54A 4ARZA 1FFXA 1DTSA 3JAWA 5F21A 1BRMA 2VAWA 3DTYA 4L9AA 3V2UA 1LY1A 4Z7JA 3HC7A 4MWCA 2C98A 1FTGA 1V7ZA 2JGAA 1OI4A 2YFKA 1D9XA 3GD7A 2XF8A 2DUMA 4HVLA 5IRCD 1IMJA 3RSZA 3UV6A 5DSZA 2HMTA 2Z57A 1QLWA 2REQA 3LLMA 3SOZA 1LKZA 2WJZB 3ZU6A 1G19A 1FOEB 2BGRA 3UMVA 4LF5B 1R64A 1G8FA 1FVFA 1R5OA 1ECBA 4XR9A 4D6PA 4JLNA 2H92A 2CFOA 2WD7A 2R8BA 3H9JA 5J63A 2WOJA 2Y1OA 3D1JA 3OEEA 4ZCRA 1K4KA 3WS7A 4IDNA 1SC6A 3DNFA 5CEEA 2AVNA 4D4LA 5CVJA 1FDVA 3MTQA 1T9AA 4A36A 2B2XA 5FNVB 1AOXA 2WIFA 4R3NA 2P77A 3BIOA 1Q57A 3JX9A 4WLNA 3MLEA 2XGGA 4RY9A 3VKVA 4C5CA 4WX2B 2P8JA 3MWDA 5KVVA 1SQSA 4QSMA 1OILA 2YZNA 1P9OA 2JDID 1IM2A 1L6IA 2CF5A 4FDLA 2WEKA 2BFAA 1HT1E 4WADA 5FYDA 2FGKA 2YYYA 1Y8QA 1EWTA 3D0QA 2EJTA 2RAPA 3IQWA 1C0IA 4QQKA 1FDRA 1R8YA 3GUUA 1QTIA 3OLWA 4FOLA 4I2VA 3DMFA 4OB8A 2O07A 4RAQA 1B74A 4TLAA 3EWAA 3G0BA 1OI2A 1CFZA 4G89A 1JDBB 4H7PA 5DYWA 1UXIA 1BA3A 1U0EA 4KJZA 4ZVOA 1TUGA 3W0LB 1NW4A 2ZWPA 2QV0A 3PDIA 1OYVA 1WXIA 3AP2A 3EGDA 4LMAA 3T5GA 3OQNA 2G1JA 1QQBA 3H1AA 1Z0ZA 4I6JA 5EIBC 5C5CA 1FE8A 3KO8A 5H3LA 5FOQA 4EG6A 4HGPA 2Q62A 2R96A 1X7WA 2YXEA 1MX5A 3CJQA 3WRVA 3Q11A 4FFRA 4DGQA 5BV2P 2PBRA 2Q8QA 1CV2A 5A3QA 4YHHB 2IZZA 4WBNB 2K7FA 2XDAA 1P75A 3EIWA 5HPYB 4E4RA 1DS6A 1ZG3A 3SVTA 4XA8A 1QNLA 2GPSA 2VXBA 4WZAB 3AF4A 4YT2A 3ESAA 3M8KA 4F3NA 4C7OB 3LOPA 4DMFA 1DIBA 1QP7A 2OBBA 4CGZA 2NG1A 2XOEA 3UK1A 4OQQA 4BO1A 4INZA 4UAGA 1CQJB 4UBOA 4I2NA 5HZKA 4UM7A 4DR2B 2OHVA 1YRLA 2A9FA 2A0UA 4ZVQA 5DMHA 3CH6A 2HBQA 4XM1A 1AT1A 1NV8A 1OYWA 3GGOA 5FI0B 2AN3A 4HX5A 2R1TB 1P2BA 5CDHA 1IPHA 3EQZA 4AF7A 4WXMA 2GT1A 5B3LA 2Z5VA 5DLYA 4I9UA 1ITZA 3TW6A 3QPWA 4IZIA 4EHIA 1AS0A 1UXGA 5EHXA 5BUQA 4JI7B 3NVAA 3ZS8A 5CK5A 3CX3A 3OQIB 1QOZA 1UKEA 4JLJA 4R2IA 2FI1A 5I7AA 5JCOA 1DCMA 3L6DA 5KTKA 2RSLA 3RU3A 2C2WA 4DSOA 4CNQA 3DBRA 3UB2A 1M2VA 3CVXA 1JG7A 3OM1A 3TAXA 4ZDWA 4Q4CA 2J9FB 1GGJA 3Q0IA 5CW2A 5EL0A 2XR1A 1FA9A 1ICIA 4Q03A 2XADA 3A6KA 1MH9A 5TV2A 4RLHA 5GGYA 4YCNA 4LY3A 3LP8A 3WYGA 2IEAA 4OP1A 1ZPDA 3OUUA 4DAEA 3L84A 3LW7A 3VQTA 3DMTC 4PVDA 1EU1A 3R20A 2X19A 3J7TA 4WLUA 3RRMA 4ZYLA 5B6PA 5HNKA 4LF9B 5KTTA 1CWUA 3BXHA 1DBVO 3DEIA 1FSGA 3OX1A 4LYDA 2ZEJA 3QQ5A 3CF4A 3LHFA 5L3SB 4NYIQ 3T9AA 3LBFA 2ZYTX 2EZ8A 2ID4A 5K8UA 2Y3IA 1MJ5A 5JHHB 1SBZA 2F4NA 1MW9X 2R87A 5GWXA 4F85A 1TZBA 2FFBA 2RCNA 4LZPA 1ECGA 5TX7A 3CUVA 4H6XA 3MUEA 3K1JA 2XD9A 2GHRA 1CY4A 3GUYA 3K6SB 5IDXA 2BBTA 5COBA 1T4MA 1P2SA 2HIGA 1F0YA 3D6AA 4HEHA 4XYGA 3REOA 3S27A 4R3UC 5CDFE 3L05A 4KFUA 5DDIP 4KO3S 1K8ZB 2GBFA 4PFJA 2YL2A 3HO6A 1FFCA 1NQ5A 4EQZA 5TEWA 4G0ZA 1JEYA 3ZCUA 4PFSA 4JHXA 2FW6A 3QELA 5A2QA 1OGIA 5FTNA 4FN4A 1XZ8A 2GCPA 2QENA 3OCUA 3NP9A 5J1TB 3G3EA 2W6PA 4BAZA 1WA5A 4O63O 2CFRA 3NVKI 3AZOA 2OOSA 1MQAA 1UOQA 2VQSA 4XI9A 2CNWD 3JPWA 5DOZA 3W8DA 4E5UA 1KKUA 3ZI0A 1G17A 2WJVA 6AT1A 3DE2X 4Y9RA 4YR7A 5F98A 1YDWA 4DLXA 3B7WA 4P36A 3QV1A 1EFVA 1F6WA 2CLEB 5JDIA 4UNQA 1P6UA 3T38A 4ER5A 2IUYA 5I01A 5LZ8A 5CAEA 1X8KA 2DHQA 4QJIA 3B60A 3SBXA 3VHXA 3EF1A 4AJPA 4C0JA 2VPPA 3GP3A 3I61A 5FWNA 4HNTA 5EWMA 1Z6XA 4LIPD 2E55A 2JH3A 4IHAA 4MIEA 4X97A 5B3JA 1R2QA 2CL6X 4M0MA 5GMOA 4B82A 3B38A 4CKCA 4U9IS 3WHKA 1JPNA 1AC5A 2CZQA 3PXDA 5EHNA 1KI8A 1EXDA 1NONA 2YHSA 4CCSA 1O7JA 1ES9A 1SCQA 4G5QA 1DT5A 4DTCA 4LFAB 4KFSA 3ZDBA 1V7PC 4TLLB 2B78A 1AGRA 3F4BA 5AESA 4AYXA 5AQ1A 2FUKA 1AZSC 3C6ZA 5ES3A 1QH1A 5A3SA 1YU6A 3TSCA 1UAGA 1QCZA 5K4AA 2NACA 2P6NA 1U2GA 3HJUA 3G2LA 3L4BC 3KZXA 4RO0A 5EXDA 4ZTUB 5BMVB 4LXXA 1NX6A 3WYEA 3Q85A 4GX0A 4RPLA 3G5UA 3GLFE 3GB9A 1E4YA 4QHSA 3EMBA 5ALOA 4IRXA 4I4TB 4L8LA 1GTZA 5L7TA 1ZBDA 3VDXA 3W5UA 2C0QA 2J87A 4IXNA 4PYIA 3OZDA 1A76A 1RWXA 4K26A 5IWAB 2O7NA 3DQPA 3I1FA 4FZ5A 4K86A 2JKYA 4ZWNA 3D7KA 4LEIA 1KMCA 2O2CA 1Q17A 3C7AA 2BE9A 1A7UA 5BR1A 3HCRA 2VUIB 4JI3B 1SOMA 4MKFA 4OI0A 4P54A 1Z0UA 2YQ4A 2ZE7A 4PYMA 3WGVA 2WU8A 1H2ZA 3MBOA 4R41A 5BPFA 3AUFA 4CZ2A 1MHPA 1FJ2A 2C97A 4B8ZA 2RIPA 4RA9A 5LL6P 4IILA 1V5EA 4RK4A 1XZHA 4CCWA 2H31A 1E7SA 1UQUA 4KX5A 1XZPA 1IC6A 2PIDA 2X5OA 4JP1A 4BO5A 3A4NA 4LS3A 3P0RA 3QH4A 5AIBA 4TTQA 3JZIA 4EB6B 4E5MA 4PZAA 3W9BA 3IQGX 2PMKA 4MCIA 5HILA 4EI2A 3EG9A 1QOQB 1IHXA 4Q3NA 4QU8A 3S6JA 2H4ZA 4BLQA 1G3IA 1UL1X 1T36B 2J0UA 3N6RA 1DWQA 3OM8A 1EGVB 4WVFA 8AT1A 5BV1A 3I53A 3F6EX 4M1ZA 2R8YA 4MRNA 3SF8A 5CCEA 2XJ4A 2CUKA 3KPWA 5DW0A 1NW6A 3NHJA 4DBLE 1W34A 1UBKS 3VVMA 1U6KA 2IPXA 2SICE 1KO4A 4OQ4A 3VISA 3PGJA 5BVHA 3SJAA 1TPZA 3GQBB 1NVVQ 2BEJA 3TDNA 3BD6A 3LOUA 3QQPA 1YA6A 2CE2X 3V48A 4HCJA 4C43A 5F76A 3CIFA 5EIWA 4M36A 1K1EA 2OK8A 1J21A 1G8MA 2JLBA 4IS2A 2DLCX 1RYBA 1Y5RA 1WY5A 2R5NA 3TKAA 3VC1A 3BSFA 2WTMA 4WV3A 3LUAA 5FRDA 2BV3A 4UU0A 3OP4A 2GHIA 1TZKA 5KNBD 2CZGA 1SA0A 2GCOA 5HF8A 4ZKDA 2Y0EA 3IA2A 4YA6A 1UKBA 1P2TA 2OE2A 4FHDA 2J59A 1HSZA 4UFNA 3WV5A 4EAQA 3U7FB 3EFOA 3F5MA 4OLBA 1TA9A 2AW3A 2JAWA 2NO9A 3QVJA 2OXTA 4OAQA 3O3OB 4CDNA 2WZDA 3D7LA 1GWNA 4YLYA 2VP4A 1LTHR 4KQWA 4O29A 3TAHA 1JIQA 1DEXA 1TZ2A 2NUTB 1IQPA 4ZDKA 3NV9A 5JQGB 3K35A 3OE5A 1XPRA 4GZMA 2QR2A 4H15A 2A78A 5FTLA 4J0DA 4W63A 4EG8A 3AOGA 1IE3A 1M2OB 2GZRA 3U7HB 4HNQA 4KGXA 3QUAA 3HSKA 3WGZA 2QT1A 2C29D 2E89A 2UZ3A 4XFDA 1U3DA 3MT0A 3P19A 3PICA 4LXGA 4PXAA 3NB0A 2IU0A 4LFBB 4FNOA 2C42A 4OHVA 1Z26A 2M9MA 3E2MA 2VHEA 1G7TA 1VL6A 1COWD 3AY7A 3Q40A 4RHEA 4CMCA 4DFDA 4JB3A 3QU5A 5GY7A 3U7EB 2IYEA 3KL4A 4X6UA 4QEZA 2CWWA 1MA0A 5ARCA 3Q9SA 5D7BA 1CTQA 1GEGA 1T13A 1WMAA 2XWPA 3SHTA 1HFEL 4HWRA 2H1IA 3BWVA 1RAEA 3ZE2B 3OT1B 4QOSA 3GLTA 3ROFA 1TU3A 1H6CA 3RH0A 2CMKA 5AHKA 1E9AA 2BFCB 5JSYA 3Q0EA 4HUQA 2Q6TA 2QL5A 1OLXB 3CGGA 3ZDQA 5L3QA 3L8CA 4TZ0A 1ILWA 2FETA 3EISA 4JLUA 4YCLA 3M4JA 2ZDQA 3M5CA 3CT6A 2OECA 3FE2A 3ID6C 2WIJA 2QSUA 3S2IA 5EJIA 3IE1A 1COZA 3ZLUA 4ZU6X 2XODA 5CVVA 2O8VA 4IMRA 1K2VN 3G2PA 3MTJA 5JAOA 1J49A 1WQ1R 1DXQA 1X1TA 2VDPB 1CIVA 1UIMA 2CBZA 4ZAYA 1H8HA 2RH4A 1F2TA 2QW8A 3TJZA 4JEMA 4C89A 5CA1F 2G8LA 4M0DA 1WP9A 1BXGA 3EA0A 2AX4A 3EZLA 4IEIA 4LWQA 5JZBA 3L8FA 3VR4A 2JGIA 4W1RA 5CA1A 2C2OA 5FULA 1MB3A 4J6FA 1CY7A 1OBCA 3EPPA 4G25A 5LA6F 1E8NA 2RHBA 4D9MA 4ACAA 2R85A 3B1FA 1KH1A 1Y3AA 3AEZA 4HO1X 4YGYA 1YHYA 1K5GA 3FYDA 5CLIA 3T1OA 5LKAA 1NN0A 1VYVA 2DPLA 1L5OA 3OQ1A 3PHGA 4MNTA 4QUEA 1HEIA 1QC5A 2XZDA 4KL8S 4BFSA 1AKUA 5M34A 1BO6A 1GRCA 3O3CA 3ZKAA 2HIHA 3AW8A 1BS1A 3PFFA 4I9FA 3PNKA 5KQSA 2QVBA 3T95A 3TJMA 4KLRA 3HB9A 3T3DA 2QRUA 5BNZA 2X4DA 2EIXA 2WJWA 2FPIA 3LYLA 2NVUA 3MUOA 3K30A 3SICE 4CQNA 2W83A 3NHYA 2VBCA 4JR0A 3JY6A 4IV8A 1KO5A 3TIVA 3TKLA 4BQSA 4ER7A 2NU8A 4ZK6A 2AHRA 3D8SA 3KHSA 1HE3A 1IAQA 4E1BA 2PBZA 1HQDA 2QKYA 5REQA 1RHRA 5A06A 5LP6C 1NAHA 3KK0A 2OB2A 1D03A 4LVCA 1LVGA 4ARAA 4Z0HO 5JVDF 2OCKA 2ZATA 4BGDA 5ECWA 4EY3A 2OZLA 1GSOA 4JL8A 3RAFC 4OJTA 2E48A 3U7RA 1V9LA 1ZMOA 1IPFA 4R2MA 2MSCB 1QGZA 4UE6A 3JALB 5F7OA 3PC8A 2GAFA 5J59A 2ORED 4DSTA 3MCVA 3ZNQA 5CG2A 3IDQA 1Q5PA 3D6NB 2Z2KA 2E4UA 4GHWA 3H2GA 3ONVA 3GEGA 5C51B 1CQWA 2JK1A 4L2IA 1Z18A 5KREA 4PS0A 5KVCA 3QA3E 1XB2A 1ZA2A 4GD3Q 1PTJC 1QKKA 2C84A 3O91A 4M4SA 5AM0A 1EFPB 1C1DB 4QG3A 3SOPA 4I36A 3V9PA 1LQTA 2I29A 521PA 4YEDA 1DX9A 2YJ5A 3EN0A 2I1LA 3HN2A 5DTEA 2P79A 4DR1B 1JYFA 1U8XX 4NH4A 1VJ0A 4Y98A 1PNRA 1P72A 1E89A 1BXZA 1HYBA 2HCRA 3R6DA 4PQRA 1UDBA 3R75A 5FYQA 1K3TA 1T0UA 3RDPA 1U8ZA 1JQJC 2C5EA 3UJBA 2QTHA 3AI3A 3R7SA 1BJRE 2VVTA 2ZOSA 1YMQA 2J4CA 2Q2VA 2XTZA 2V6GA 3FNBA 3VI3B 4B75A 1FIUA 3OZIA 4KDCA 1HETA 1EVLA 1XXLA 1VRVA 4CQLB 4AYWA 4FXOA 4ZRMA 1C5KA 4UJ5A 3ZHOA 1R00A 4LX0A 5CM2Z 2QY9A 2H1WA 3ZZ0A 1TOAA 4LVNA 4XDZA 3TTUA 2ZIAA 2A9VA 1NWCA 5KWIA 2C96A 3DVAA 5F1PA 3G02A 3TNJA 1E32A 2IOFK 3U4GA 3V6LA 1YB4A 3U7JA 1NATA 2KHZA 3AUSA 2AXNA 2G1KA 4Y9SA 3ZWKA 4DMKA 4ZYXA 3MJRA 2PE5A 3OCWA 1RP1A 3GAFA 2P4SA 2FOIA 3FXAA 4HI0E 2I3AA 1PI3A 4I9HA 4Q9DA 3CZMA 1RRGA 2AN4A 4UUOA 4YIKA 1ISJA 3BREA 4XRRA 2PHZA 2DQKA 5LMCA 5AHOA 3SVLA 3UGJA 4TMFA 1SUSA 4M86A 3NHLA 3TNLA 5G1OA 1Q3HA 2IITA 1K88A 5COAA 4K3UA 3THWB 2DHRA 1PR3A 1NJFA 1XEWY 3T9EA 4LJAA 1QV9A 2W2TA 4YMIA 5KO2A 2YY6A 4H1VA 2P41A 3KHUA 3HH8A 1XG5A 4V02A 5CH3A 1EB8A 5IDWA 4LBWA 5TPWB 1H5UA 3GG9A 2XB6A 5LQCA 4QVIA 4D8YA 3PK0A 4Q9HA 2G1AA 1PGNA 2A3NA 4OI2A 3S68A 4NKRA 1L7AA 1PFWA 2IDMA 3L9XA 1GCOA 4L0CA 1QM5A 5H81A 4TQAA 5LC1A 1JFRA 2WYIA 1FZTA 4TWRA 2BP7B 1WTCA 1EH5A 2IRWA 1E7RA 4ZDJA 4FMDF 2HHHB 2CLHB 1XMSA 3GRYA 4N39A 4IXWA 3UG6A 5FLXA 5FWYA 3EWSA 4JJAA 5LP1A 1VBKA 5IBCA 1K97A 2XNSA 3U40A 1HXHA 2J0VA 4I55B 4CM1A 3KKEA 5HKAA 5EMNA 1MVOA 4EYEA 2I80A 3DL7A 1IB0A 3D43A 4PNEA 4EB8A 1U1CA 3MAGA 2PANA 3NNDA 3LZ6A 2EARA 4R6WA 2VDQB 2WZQA 3F6BX 3H2YA 3OT5A 4LRQA 4RZXA 3KKQA 1VA5A 4YUAA 4IH4A 5BSRA 5AW0A 1NULA 4RFVA 5B7GA 4RULA 1YACA 3AIOA 1L4UA 3PRYA 5A9SA 1RC8A 2V3CC 1ONNA 3DE0X 3IOBA 1HL3A 3JYOA 5BWBA 3MMZA 3TLZA 5C52B 1FNSA 2NZ2A 3MIZA 1SGWA 1DEAA 3JQ7B 2DH6A 2P11A 1T5BA 3NORA 2CL5A 4OHFA 4EJMA 4QJ3A 1AQ6A 2GAOA 3H6GA 4WUVA 3D3WB 1ZJWA 2XQVA 2IVZA 1VE9A 2JBAA 3I2GA 4IHQA 1JKJA 3N59A 4KQ1A 4U7WA 4UHKA 1N2ZA 3U3DA 4ZOLF 4MZXA 3EXG1 1RYZA 4B2YA 5JDCC 5TLSA 4B4DA 5KYWB 1KQGA 1XLWA 1IZ8A 1BFDA 2AOXA 2LIVA 3HKBA 4ZOLA 5FLYA 3OIFA 4FNAA 1IUKA 2V7BA 1YDFA 5E9WA 4E1VA 5AW6A 1Z0KA 5T3UA 5AOBA 4G97A 2P9CA 1WJGA 4IVRA 2CXNA 1CUEA 1KEEB 3P9NA 5DGCA 3NBXX 1WVIA 1YB6A 2QRKA 3NHBA 1WDLA 3GJ5A 1SY7A 1FDSA 2IOFA 2I22A 1LLQA 1DWUA 1FX0B 3CZAA 3P0HA 1JQ5A 3LLUA 3TR0A 1MR3F 2XVYA 4JR2A 1HE8B 4HNSA 4ZI3A 3AL2A 3URKA 3C3WA 2QP9X 3QVKA 4XGKA 3PPVA 6YASA 2PAAA 3L4EA 1UKAA 4NPCA 4PGHA 1NJ8A 5P21A 5IS2A 1CJBA 2EFJA 4AWXA 3JQBC 1O96A 1KZYC 3C3MA 2GZMA 3DOFA 3HLTA 4R2HA 4P8RA 3GWZA 5JZSA 3PKJA 1SUWA 4C30A 4EB0A 2NXWA 4ZU1X 1N2CE 4I1RA 4J0QA 3WRXA 1I6KA 5B4TA 4D9IA 3D1VA 3Q3HA 3BWDD 3DM5A 2G70A 4OHRA 4DUGA 4EUHA 3G7UA 2XZPA 4XLTA 3BB3A 3RJZA 1BWQA 1T3GA 4LVOA 1QIJA 1RXCA 3WIBA 1ACMA 3DWEX 4N40A 2H17A 3C3JA 1S3IA 1QFMA 2E3JA 4KQ6A 3RVLA 3UJCA 2F1HA 5AOCA 2XA1A 1NN5A 4MA4A 2Z95A 2ZYUX 1T8RA 5KQMA 4AKEA 1Y6ZA 2W6ID 1F60A 4OMUA 4Y6LA 5IEBA 1SRQA 2WWWA 3HO1A 4F8EA 2A67A 4J4BA 4K81B 2BF7A 4JYPA 4LTDA 2OYRA 5BRAA 3BIFA 1NDQA 2BYTA 4AKTA 1O9HA 1JR3A 4KC0A 1HH4A 3I58A 4X7MA 3L0OA 1L4EA 5D1NA 4DBLC 1NVTA 3QPBA 4KJXA 1TF7A 4OOFA 3VR3A 1RI2A 1CUVA 1MX3A 3AUXA 4OUDA 4JVMA 1N0UA 3IX7A 2HMUA 1I3OA 4IJ6A 5KOJA 4Q00A 2Z58A 4NU5A 4XGIA 4E51A 2I0FA 3ORHA 4IR7A 2X6QA 4WN9B 2QU7A 4QFMA 1Z8DA 2FCRA 2FPMA 3EVFA 2HW8A 3OZWA 2A2ZA 3EBPA 1JR4A 121PA 1Z16A 4HLDA 3DE4X 4BE4A 1ORDA 3EAGA 4HQNA 4M9RA 2QI9F 5IPFA 3BGWA 1DKUA 3AMVA 1W88A 3ZQJA 3FMVA 1ZH8A 2I7TA 4NIMA 1S2IA 1W9HA 2XDQB 3IHKA 4O4HF 5EUBA 4HNAA 2JFXA 3O8CA 5LDHA 3PUZA 1YZGA 4O4HA 4B84A 5CBPA 1OH5A 3L4JA 3O90A 1AKVA 1Q20A 2QS9A 2IS1A 3FFWA 3NHSA 3R0VA 5A2GA 3QLJA 1GFIA 2C3MA 3ZWWA 4O4LF 2Z9BA 4MRMB 4E3WA 3LQ2A 4EL5A 1PL6A 2O8BB 3GUCA 1TRHA 3FTNA 4UTZA 3HP7A 3CXUA 1TCAA 2B7BA 1TF5A 5KHLB 5JXGA 3U3JA 1YA4A 4LFCB 2V1XA 5F7ZA 4KMSA 3ZU4A 1SVOA 5K8JB 4FFWA 2QN8A 2YJ3A 4ZZ0A 1H6BA 1WW2A 4PQGA 3I6QA 1KYYA 3ZGLA 1IBKB 5F9FA 2AR0A 2CHVA 2FW0A 2BGWA 4J0KA 1EZZA 1UBHS 5KQPA 4YCDA 4I4LA 4TXLA 2D0DA 5K20A 4UEWA 1R0WA 2Q8NA 4GPIB 3R7WA 1ZMXA 3CN9A 4AM8A 4NCBA 3FHLA 1XQ9A 1DAMA 1ZUWA 3OEHA 1DRWA 2ACKA 2V7WA 5CHYA 3H8SA 3RBAA 4C6TA 1IQ0A 1Z6GA 3IUEA 4WA8A 3OM0A 1SOUA 3NATA 2JFWA 5DM60 1JNYA 3MS4A 4FJ2A 2F3RA 2PL3A 4NCXA 1N0HA 2ZJFA 4P86A 4HFRA 5DX0A 2VZ8A 5TQ2B 3RF6A 3MCUA 4AZVA 3SIWA 1Q3TA 3U4QB 2CUZA 1L4NA 5AI5A 2A33A 1LVUA 4MKIA 4BMCA 2TSYB 3ZR4B 1U0HC 3BCHA 4EX6A 1O97C 3AFHA 3Q7PA 5DP1A 2OP0A 4OAPA 4ZV4A 5JIBA 3ZI7A 2EATA 3U39A 5SICE 2YJGA 3ESXA 3BOSA 5GVSA 2PGJA 2Q6LA 1VIMA 4JYZA 1BWSA 2GR9A 3N8GA 3FOBA 3ZBUA 3RIMA 3DGFC 1BS2A 3RWOA 3UFXA 5JOQA 1RQGA 3CLTD 1ULBA 3H75A 5AVTA 1PR5A 4A0GA 4I4CA 3PLAE 5H5JA 2V59A 3EHDA 3ZG6A 3WIDA 3PEVA 1GPWB 2XZOA 1QHXA 5A3RA 1T5TA 4LE1A 1L5MA 2Q1SA 5ALMA 2GAAA 3OOJA 5GINE 1TVMA 1YE3A 4KPFC 4RE5A 2YWEA 2RH5A 3RTBA 2XGJA 3SKVA 4RMIA 2OAP1 4PLYA 5G4KA 1W36B 1PR6A 3ZGXA 1WZUA 1XYYA 1E3DA 2NO4A 2ZBRA 1T9GS 4AY4A 4NECA 2IYVA 1F1BA 5DW3A 4K9QA 3RS0A 2GYYA 1KDZA 2YJZA 3OD1A 1NV9A 3GH1A 3GIWA 1H2HA 1DPFA 4B34A 4LRSB 1NVXQ 2VHXA 3HZZA 1DI0A 4LOIA 4TKLA 1TUBB 4N9WA 1A9XB 4PPFA 3WWCA 3VOBA 4B4VA 1AF7A 1U4SA 1DKOA 2Z0MA 1XC7A 2DU8A 2O7RA 4TRRA 2IS4A 1PT5A 4Y2JA 2HREA 3CZ5A 1H05A 3AY3A 4IQFA 4AN0A 3GZ4A 3WGLA 3PXBA 3JARA 4K0RA 2J6BA 5H68A 1ZI9A 3G2IA 3KZKA 1NW7A 1W73A 3LRPA 2AFHB 1ZCJA 3PRHA 5EIAA 1MTZA 5DEIA 3V2GA 1JDNA 4FYXA 4E0BA 2GJAA 4AQ7A 1NVDA 2GESA 2VBGA 3VDRA 3FHOA 4RNCA 1MVNA 4KPUB 4WNCA 2Q7DA 5F23A 1G6KA 2JAQA 3LY8A 1ESDA 5HIMA 1E6MA 4PZEA 4FI3F 3GMSA 4N76A 1UM9A 4WECA 2CLCX 4F71A 4QNNA 3WGJA 2HFJA 1J90A 3QJ5A 5ALQA 3NEYA 2WPDA 3EBLA 1AUQA 2ATXA 3QVTA 3H5LA 1FLAA 4C20A 1OZHA 2BONA 1TMOA 1E7WA 1PDVA 2PNJA 4EVIA 2WUGA 1SB9A 2JVJA 3LQQA 4IQ4A 2FPPA 3F74A 1ZWLA 3OEYA 3ROMA 4ALNA 4DABA 1HDEA 1NQXA 1Z4LA 2AOVA 1DADA 4Q4LA 3WMFA 2OLEA 2B98A 1DBPA 2X9LA 4KSYA 4PAMA 5EKTA 3WBBA 3C7KA 1FUYB 4MJ3A 4RXMA 4AFNA 1OLUB 1AKNA 1CU1A 1JIIA 1T3HA 4G1FA 3TLYA 2FLKA 1R0RE 1V71A 2OGZA 1TD9A 3A3PA 5LXTB 5EHGA 4GGOA 2XUZA 2QORA 4MVJG 5CT9A 2NNWB 3P0FA 4NG4A 3N7UA 2YKGA 4QXPA 4URHA 1IN5A 3ZV5A 2Z6QA 1KZ9A 3MW8A 4XARA 1A95A 1IN8A 4ZQFA 1U8YA 3V4OA 5EJ7A 4Z3KA 4MHSA 4Q4HA 1ZK2A 4LQLA 1T0PA 5LYJB 2GPTA 3GUVA 3EXHC 4CWAA 5EWLA 1IU9A 1RMTA 1WS6A 2JAHA 2GXAA 3Q9UA 5K7SA 3HZHA 2FEMA 2XNJA 3QNWA 4JLDA 3C0KA 1FW8A 5HJ7A 5T4EA 2QT0A 4R4JA 5ALJA 1M2GA 1Z2CA 3HLYA 2FW9A 1R5NA 3OPNA 4WXPA 1HTBA 5DGIA 4ZT2A 1J0CA 1Z45A 1V26A 2ZCUA 4M60A 3A31A 1DARA 3DKPA 5F9HA 5BUZA 2BKLA 2FFJA 4S04A 3ENVA 2OESA 1GTSA 1QIKA 1KFEB 4FOOA 4MUEA 1T6ZA 2GD1O 1XNGA 1PQYA 1Q7GA 2HMAA 3OLQA 4YP5A 4IF6A 2PLRA 1Z3CA 1N5KA 3DEAA 4MW6A 3LQ4A 3EW7A 1L1QA 3FLMA 1Z7EA 4MJXA 4E2ZA 4F6RB 1C7IA 1IDN1 2V7GA 1Z5UA 3FI0A 4G81A 2ZIXA 1JPVA 4IXDA 4WN3A 3R74A 3WVNA 4BJ6A 4DF3A 2NAPA 5JH7B 4U3JA 4DSNA 5CB6A 2XUDA 1T34A 2JLCA 1LC0A 4CRWB 4Y6OA 3VH3A 1NGSA 4ZCPA 4Q3BA 2AYYA 4EPWA 4UARA 3BX1A 3FOWA 2WM2A 5EG5A 3T1NA 3WAKA 3IELA 4L4YA 4L9RA 2QXUA 1ZGJA 2E1RA 2A58A 3E7XA 4S24A 1AHHA 1FQJA 2REOA 3UJNA 3RODA 4LJRA 5FNVA 2P9ZA 3FY4A 1UZUA 3SC4A 5A0TA 5TGZA 1QTNA 4PLHA 5HFNA 1X80A 3V6MA 1OIWA 4FP9A 4INPA 5JWOA 1JDJA 3DC2A 2WHXA 1C9JA 1FYWA 1GDHA 1D0VA 5BVGB 1F4VA 2J4FA 3PUWA 4GYKA 5JSUA 2WQ6A 1Y9ZA 1Y5MA 4KH0A 1U98A 3MCAA 2NU6A 5D2CA 1TADA 5FWAA 3N2KA 3TIXB 4P84A 4D3XA 3PUKA 2ENUA 2HWKA 4M0CA 3X0DA 1ZIYA 1J56A 3H0EA 3REFA 4CM3A 4DJTA 4DC1A 1OH6A 2F8TA 1SCBA 1QJCA 4MO9A 4KVFA 3RNOA 1NZFA 4M0LA 2H8GA 2CY0A 3GI1A 4YTEA 3EXEA 1RC1A 1UBSB 2JFFA 2QDXA 3OFSA 5DXAA 3WWDA 2KLHA 4EF4A 2IZ5A 3AWDA 2FMFA 4FYYA 1C7QA 2DLNA 2PXHA 2WT8A 2F9LA 3HY6A 2VTVA 1VCOA 4HGNA 1O0BA 1YCHA 2F90A 2YMLA 3HP1A 1NZJA 3C3DA 1EGHA 2WU4A 3JRXA 2ID7A 3K6RA 2A5GA 1CB7A 1LF0A 3L7OA 3OE1A 1C4WA 4NNPA 3RGGA 2IXDA 5SV2A 4IIHA 1B00A 2YOFA 1GR1A 5BR8B 3L2OB 4C0KA 4CQMA 2QGFA 2G08A 3QFFA 4RVHA 5SYNA 4JV5B 1X19A 4QOJA 1YHNA 3E8SA 4WCDA 1E2HA 2AFIA 1YQTA 2VJBA 3AY0A 3EGVA 3SQDA 3VSBA 3Q9LA 3LUKA 4WLOA 5BSTA 3NTUA 5L4SA 5ALXA 4GI7A 1Y6JA 4QHYA 2F67A 2RGAA 1MIHA 1CQXA 2C1XA 2LP4Y 4NBNA 3QOWA 3CJTA 4KOAA 3JYQA 5EQTA 5JANA 2C2YA 3DL0A 1TK2A 3GEMA 4JLBA 3SF0A 4U9HS 2ZUBA 4Q4AB 1CUDA 3NWBA 3II6X 3KJIA 3VSDA 5E8JA 5FR1A 4RXTA 4YK7A 1BDIA 2GD6A 3RW9A 1IRXA 5EE3A 4PG8A 4DKJA 3ZY4A 3AM1A 5AUPB 2CXRA 4BV8A 3ZN2A 4ITUA 3KPVA 4FQ5A 2VG8A 3LC1O 4NABA 4IO0A 3ELBA 4P7GA 4TWAA 5H8WA 3ZDYB 2IX9A 4OJYA 2D5AA 2UKDA 3Q2KA 2HV9A 5D3QA 3WK5A 2FSVC 5AW4A 4NWIA 3QRWA 1LGYA 3BHJA 2QXYA 4LF4B 2EQAA 3PFGA 4D57A 3ANMA 3PENA 3S40A 4PZYA 4UD6A 4ND8A 1AGNA 1QRUA 3ICWA 3BMCA 1SQ5A 4WBXC 5AR1A 2X8AA 5ESXA 4YCCA 1ULSA 3TPZA 1GTRA 1LBSA 4Y1RB 5ILQA 3TOSA 2EW2A 2BWJA 1J22A 3ND7A 3LT5A 1UWVA 4L1KA 5ALDA 4BFZA 2D74A 3IVAA 1JLSA 3KOYA 4OLJA 1SUFA 2C59A 2CW5A 5CJJA 3RE1A 5MGNA 1DAFA 2H63A 2R7NA 3GO4A 3KLBA 5HQTA 2X2EA 4JT9A 2ZIWB 1WLSA 1QG4A 3K9CA 4TMWA 1I3KA 3E7FA 5ALNA 3SJUA 4QLBA 3KAJA 1OWOA 4HRYA 4Q93A 1NYTA 2PS3A 3NHFA 4TYPA 1BN7A 1HYQA 2PZBA 1M7BA 1P5RA 3VI4B 4EJSA 3ER9A 4B4WA 1QV6A 3L1VA 4KMMA 2XB2A 4RIGA 3ZLVA 1YKFA 1NRXA 1R88A 4BV2A 2CJPA 1ULTA 1XV5A 3OY2A 4YJ2A 1RS0A 3TVDA 2WF9A 3B1VA 1W85A 1UT5A 4MCJA 2B0JA 5KYTA 4KHZA 1TJ3A 5INTA 1EUQA 3GJSA 4MRVA 4RYDA 3KXIA 3OZXA 2I6QA 1BHQ1 4JHLA 1XZEA 5C53B 5HJ2A 4W9NA 2HLPA 2ZIUB 1FPQA 1GA4A 4WZBE 2AFRA 4BGIA 2MYTA 4AG5A 4OHZA 4ZEXA 5KZMB 3Q4GA 3IBFA 3MTIA 5CIWA 3L6UA 4N48A 2RK3A 4RK5A 2NADA 5AVOA 1K3FA 6GPBA 3WL8A 5JXIA 4ZAFA 2XMQA 3M33A 2IH2A 4B3HA 4RYLA 3D2LA 3G0IA 3M1AA 4TKZA 1OTXA 1H8HD 1JMYA 1NY6A 4ZU3A 1EBBA 4CMKA 3NW9A 5C8VA 3GLIA 1ACJA 2QTWB 4AYTA 3MJCA 1N3IA 3P2EA 2YZGA 5AJXA 3VR4D 1L8OA 1MA3A 4IUCS 4QGSA 2AI3A 5DN6A 4KE8A 5E1DA 5C46F 1E4VA 4OU4A 4Z7OB 1TC2A 5HOEA 2GZHA 3EUAA 3B36A 3QLVA 4L5BA 1VPWA 1NVVR 3QWFA 2HGZA 4KXLA 2IYYA 4B81A 4RQUA 1QYCA 1DOHA 3VR2A 2RE8A 2QSYA 2R5FA 2OLJA 4CM9A 1OFTA 1EVYA 1WXWA 2DFLA 1LI4A 2VDRB 4DRYA 1U9CA 1DT3A 3LBNA 3CUYA 2PR7A 1L1EA 3EIFA 4OHWA 4PE5B 1OV6A 2DFPA 3BWYA 2B1QA 4DCGA 3B9QA 5EVJA 4BB5A 2H0AA 4RCVA 2ALJA 4BNJA 4OSOA 1FEZA 4GPD1 5K45A 1Q44A 1YJ8A 1R3DA 3ZV6A 2HLDA 2C4HA 3KHTA 4HDKB 3T3PB 2UYHA 1B7GO 4G67A 1YZHA 4MINA 2CHEA 3TOZA 3TS1A 4KE7A 5HJEA 1H2EA 4RGYA 1P1FA 3VO9A 1F6DA 3W05A 3GEEA 2BTEA 1MUUA 3MWGA 5H1YA 4R1QA 2E4XA 3A1NA 5EZYF 3ZHZA 1PGQA 3GLKA 4MOWA 3T61A 1ECCA 3IVXA 3QWBA 1KYIA 4FBMA 1EYZA 4F5WA 3K0FA 4KLCA 5EZYA 1ZJ4A 1K2WA 5HBGA 3TM4A 3HA3A 5EIOA 5CB4B 1YZVA 5KU7A 1YZTA 1UIRA 1MXFA 3MXOA 4DV1B 3O3MB 2A9PA 1IBSA 2WSSA 3EYWA 3O73A 1LA2A 2WVHA 2YHBA 1Z2DA 4FNGA 1JG4A 4CLRA 3NQ41 3GFTA 3TRIA 1P4HA 3AOEA 4B35A 4QAQA 3ZCQA 2FR0A 2QYTA 3N3BC 4JLVA 4EWLA 1SXJE 2QN6A 2WYVA 1PK8A 4J75A 3AEKB 3A4IA 4CKZA 2ZTSA 4LTNA 2G17A 1NI3A 2QQEA 3ROTA 1AF4A 3VPDA 1OLSA 1SBIA 3BMNA 3I72A 1RWMA 4W99A 1N92A 4I4NA 3QNMA 1PCXA 1MABA 2Q5CA 3A3KA 2B9VA 3EG5A 3FLAA 1TYCA 3LPMA 5LFAA 4OHYA 3DEKA 1MC8A 1P2DA 1SCUA 1SKAA 2J9XB 4OGGA 3QFHA 5AT1A 5CCDA 4L3VA 1BW9A 4QODA 4YMHA 1A50B 2WD9A 2HWUA 2OT3B 4IZ6A 2B5WA 2YRWA 2QL6A 1S7CA 4KWTA 3B9RA 3NRCA 5IZ4A 1XA3A 2A0WA 2RG7A 3PQFA 3R8FA 1JDPA 4RPHA 4PINA 1DQNA 1WLYA 3IJRA 4A8HA 1C3VA 3PR2B 2HJSA 2RH9B 4L95C 5EXSA 1PLKA 3KJEA 4AZWA 3KT3A 3QLUC 2YBDA 5GOZA 3I9NA 3PGKA 2R60A 2KYRA 4Y6QA 5K4GA 3PITA 1WUJS 5DTJA 4BEWA 4DA7A 1V6CA 2WKQA 3BWXA 2R6R1 3M6VA 3DW1X 4RTMA 2YHAA 1E8MA 1PNOA 4MGEA 1SR8A 2HA0A 1LPBB 5LBUA 4GP9A 3MFQA 3SZLA 4AJ4A 1KK0A 2H1OA 4NBTA 4RC9A 4H3HB 2QX9A 2XPCA 2H9AA 2WDZA 3IPYA 1HR0B 1LCIA 1QHHA 2QPOA 1GZSA 2VCYA 1ND6A 5ECDA 3RU9A 1RCUA 2VDLB 3N7TA 4TLEA 1EHCA 1WXFA 3USES 2ZAYA 3K7EA 1N2XA 1SCAA 3UAXA 3WLQA 2ZR7A 3ZCPA 1NNEA 3VSCA 1E3QA 4OG2A 3LWZA 4TWBA 1EVJA 3STTA 3GT3A 5IKXA 1ZRHA 3R1IA 4H0NA 3R3UA 4J43A 3U26A 3U4HA 3FUUA 3OQVA 1MJNA 6REQA 3U60B 4B8WA 1P0QA 3MQ2A 2GEUA 1UAYA 2P5UA 3HUUA 4M7RA 3KIPA 1FNMA 4M8IA 4FOTA 1U94A 4QTXA 1K89A 2X8JA 4P35A 1LU9A 3PQ6A 2P6OA 1POWA 1YQGA 2AWOA 1RXEA 1Z0DA 2GARA 1U0SY 1BC5A 1HOXA 4HZUB 5DTMA 4Q15A 3RBXA 1M34B 4EMUA 1UPFA 1JEAA 2HIMA 4YFVA 1M2WA 3BE4A 4X20B 4D4MA 2D4HA 4F6LA 1USWA 1VLQA 4QGHA 4JI1B 4UBKA 4PZLA 2QJFA 5B12A 2FLWA 5DVZA 4F0JA 4XVUA 4YUWA 3DTVB 4Z3DA 2OXIA 3HVIA 5JRZA 4JYAB 2FQ1A 4IINA 1YIDA 4ZT4A 1DINA 1GNTA 2XECA 3R6GA 4REOA 1GL9B 1Q19A 2DUJA 1BOFA 1G6HA 3OI7A 4FYMA 5CLGA 4ZQIA 4AY2A 3BTOA 3GNLA 5AICA 1A1SA 5FNVF 1QIHA 1XCMA 4LXYA 4O59O 3PUHA 1RZUA 4MCAA 3EZGA 1MQ9A 3I2JA 1Z5NA 2OSVA 1EKXA 2QTRA 2YINC 3HDVA 3BIJA 2VS1A 4L3WA 5AM3A 5C1IA 5BSFA 1EUDB 2OXEA 5EKDA 3TXYA 3HMQA 1XWWA 3CNQS 1K8QA 2ANCA 2HUPA 2PX4A 3CH4B 4KN5A 1S2MA 4J2TA 1Y1QA 4MPDA 4XOIA 1MAWA 2CV1A 3FOFC 3T5CA 2FK8A 1IY8A 1JBKA 1SK9A 1ZIPA 3OKPA 3AHJA 4HDMB 3SIRA 3BXFA 4DXHA 4WUTA 3ED1A 3E81A 2HY7A 2FOLA 5E2IA 2B8EA 2ZZMA 1DIAA 1RLTA 4AZ3B 4EYSA 2OSBA 1LNQA 1BKSB 4ZT6A 3ML1A 3TZKA 5K8CA 1U63A 3M2TA 5F5XA 5HCIA 5D6NA 2AZ4A 3KB8A 1WR8A 5DHQA 4NF2A 1R0BA 1Z7GA 5BR4A 4OFXA 1PWHA 1CG6A 4D0NA 1CZNA 4D8UA 1G63A 4LHZA 1XZFA 3KTOA 2B7CA 1M0TA 2ZIGA 3UKJA 3A37A 4FB4A 2WILA 2BMAA 1TC1A 4QA9A 2C8KA 2QR5A 5KAMA 1L8QA 2PVCA 3WLAA 4LRWA 4NZOA 3A6PC 2LW7A 2WQZA 3T06B 3KVRA 4JEHA 3I3SR 3E8XA 5HGJA 1SKBA 2OORC 2O0KA 3E0QA 4G56A 3FOEC 2XXJA 3GN1A 3QPUA 1JP7A 1Z4PX 2QUBA 3S7TA 1B6SA 1C0KA 1Y3BE 3FGZA 3A06A 4BNGA 3H3XA 4EAAA 2X23A 4DOMA 4UDYX 2R79A 4ALLA 1J7JA 4OFZA 1SG6A 1RWOA 2KW5A 3R2JA 1P80A 3A1TA 2GYVA 3H1GA 4QBHA 3C8HA 3K32A 4N7RA 4C7OA 1MTOA 3DT6A 2AEEA 2M98A 4MUBA 4FEEA 3A25A 1XWFA 2RGUA 3IQZA 3RTEA 3EPLA 5TT1A 2WMDA 1CQJA 4QSHA 4KTTE 3SS7X 3F1KA 3H7AA 4B46A 5EKSA 5CB0A 3QP9A 4A15A 3KYIB 4WL0A 4PSCA 5BQ3A 2CD9A 3KWLA 3C16C 4A8PA 4R5MA 3P9ZA 4EEZA 1QFJA 3MWLA 4N03A 4F9FA 2IF0A 2R1TA 5K0BA 1KIAA 3L0YA 2GWHA 2RGCA 2P65A 1H42A 3BD7A 5HG0A 3NBMA 1JTFA 1WE2A 3IAS6 3BHMA 4M9UA 2CLOB 3M4ZA 3I4LA 5EXPA 3A1EA 3EVNA 1EM8B 3GCGA 2RI0A 5CA0F 1O5IA 2BM0A 4G63A 2PRIA 3ISVA 1G3UA 3CW2A 1JR3D 3GRRA 3HEBA 3OQIA 5A4IS 1CLEA 1NPTO 3KR2A 3ZBPA 2IYFA 3IP7A 3RU7A 1CUYA 1PJQA 2C9DA 4X1IA 3VR3D 5JSQA 1W47A 4CIDA 2EZ9A 2P9YA 2BEKA 4LNUA 3KB2A 4RTOA 3AW9A 2J9FA 1L7MA 1ZRSA 1QHSA 4QD3A 1DEHA 2JARA 3UT6A 1GPBA 5JCXA 1RYYA 4B1FA 1FNNA 3KYJB 2DYKA 3AFMA 4TV8B 1K4MA 4LDNA 4DDKA 3K71B 4KKVA 1ZX1A 4HFJA 1AMOA 5IKPA 4JC8A 1DMSA 5K2OA 2FUEA 3DAPA 3PX7A 1VHLA 1RI3A 2JZOA 4K03A 3AGQA 5CRIA 3RU2A 4TRNA 3OMWA 1WDMA 1HLDA 1XWIA 4ZVKA 1T2NA 1IY0A 1Z6QA 3U9TA 4FT4A 5LZ2A 4GVPA 4LF6B 4IZOA 1T3TA 2XCIA 4OF4A 3WI7A 5L3SA 3FG9A 3HU5A 3L8MA 3R5FA 1D2RA 2M32A 4N5HX 3BB1A 2YJNA 4A5SA 1SOVA 3ICVA 2OQIA 4L28A 1U1GA 5JPDA 3IUSA 3WGKA 2ORIA 1L3BA 1D2EA 2D7CA 3RFXA 1WPXA 4Q48A 1X9GA 1YS9A 2ZREA 3A4VA 2EKZA 5IARA 4D9GA 3KJGA 2F3SA 2JLXA 4X45A 2GO1A 5B53A 1WBJB 1IVSA 4Q9NA 1FW6A 2WP8J 2YFQA 4H17A 2FEPA 5BXYA 1V3UA 4Q18A 1YONA 1TEVA 4PRYA