2O1JA

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
44
structure length
44
Chain Sequence
IETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4
rcsb
source organism Rotavirus str.
molecule tags Viral protein
molecule keywords Nonstructural protein NSP4
total genus 16
structure length 44
sequence length 44
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o1jA00
2O1KA 1G1JA 3CI9A 4WB4A 4DOJA 2WITA 1G1IA 2O1JA 4C7RA 4HH2A 2L5GB 4LLHA 4WBAA 3MIWA
chains in the Genus database with same CATH superfamily
2D2CD 2YO3A 5CCGC 2BCCG 2GUSA 2QJKB 2VRSA 4DOJA 1SQPG 1JY3N 1NTKG 5B66E 1SQPD 3NXSA 1G2CB 2KOGA 1SQVJ 4RO0A 4Y99C 2FFDC 2AEMA 5AW0B 1NAFA 2DW3A 2FY8A 2YXQB 2A06D 1M1JC 3VMZA 1GL2A 3CWBE 1LT1A 3H1HJ 3KYQA 4UB6E 1EXJA 2KYVA 3NTNA 2NZ2A 2P2UA 3Q3DA 3D70A 4B86A 2ZXXA 3RL0B 1Y9BA 3CL3D 1KN7A 2P7JA 3FXEA 3HUSB 2HFED 4JQ0D 2M0BA 1JUNA 5E79H 2QJPC 4H0LD 1VQ6P 1IFDA 3E1RA 1PPJG 2OGUA 1SFCD 1RF0C 3H1IG 4GODA 1HVVA 1BCCG 1KB9D 3A7OA 4H44D 1KB9I 4IL6H 4L75A 4WY4A 1Q86Q 3T97B 3LW5J 2B87B 1GTWA 1QL1A 4D6TG 3FX0A 4HJGH 5CJ0A 3SWKA 1S5LH 3BCCD 1KFNA 5APYA 3VMXA 1DD3A 1JM0A 4Y99B 2OTKE 5GTIE 2E74B 2E75B 2KZJA 3A3YB 3P32A 5TJHA 3WU2E 1LTIC 2W8ZA 3H1KG 1AVOA 4C7RA 3HD7C 2H88C 1SQVD 3K5BA 3USSA 3TNUB 3V2PA 4ZKPA 1N73A 3CC4P 1U7MA 2AXTE 2ZYGA 2QRXA 3TGUJ 3L70G 1H0TA 2SPZA 3CXHD 2L5GB 2XZRA 4JPZB 1L0ND 4W7ZA 5H2FH 4H44B 2AXTH 1BDDA 3B5NA 1JY3P 1LNQA 2Q3IA 3MTUE 1FBMA 1IFPA 1NTZK 5AW6B 4OGQD 3UIAA 5B66H 2LXBA 3H1JJ 1T2KD 3L71D 1NU1D 2Q9IA 1FS0E 4H13C 1L0NJ 3CX5E 4H44C 4PJ0E 2IYOA 2V4HA 3FGAD 3VMYA 2QIWA 1NU1G 3AE2C 2ZAEB 1FZFA 1ZN5A 1YJWP 2YNYA 3CCJP 3L71J 1KQFB 3L74D 3L72G 5KLVD 1MV8A 1M8OB 1KILD 1BGYJ 5AW3B 2E76B 3H1HG 3L72D 4MN4C 3V6IA 1PGOA 5AVVB 5KLVG 1NKNA 3I5CA 1AFOA 1P84I 1QVFO 1HUCA 1GU5A 2Z5HA 1N73C 1LTJA 1NVOA 4PD4E 3L73G 4OWFA 2E76C 4PV1D 4ASVA 1L0NK 4ASWA 1SQPK 4YXWH 3MZWB 2QG4A 3P7KA 1ZR2A 1S5LX 3P8MC 3CCRP 2C9LY 3B5NC 3SSUA 3CMEP 1KILB 2QJYB 1JCDA 2YMYA 1SQBG 3H1LE 3HE5A 1NWQA 3RK3B 1VDFA 1VQKP 1J1EC 5AW7B 3A0HH 1D7MA 3CWBG 3HTKA 1G1JA 1YHQP 1LTTC 4I1LA 3QH9A 5KKZB 4IL6X 2KK7A 2YO2A 4RKUJ 3NMDA 2E43A 4UB8H 2HPCB 4KT0J 1JCCA 1NHLA 2FYNC 1NYHA 1G2CA 2QSIA 3P8CD 3N7NA 2IPPA 1VQNP 1NTMD 5BVZA 1SQXE 1IK9A 2N1TA 2Y0DA 4OGQB 1RHZB 3TDKA 1N7LA 2WPSA 5K5GB 1KZUB 1K04A 1BGYD 2C0WA 2QM8A 3BCCE 1YQ3C 4OGQC 1YITP 4JBZA 3V2RA 1SLQA 5APXA 3A0BE 2AEFA 2N1TD 3GMAA 2Z5IA 2BCCD 1LT9A 3HUSA 1ZV8A 1LP1B 2FYUG 2QE7H 4XE5B 5EFWB 3WUUA 3IF4A 1YQ4C 1CW5A 1CI6B 1WRGA 1PZQA 1KQGB 2FYUD 2HLOA 3QWOC 3EQ2A 5CMZA 3CC2P 5CBNA 1RE4A 3AEDC 1KFMA 2KB7P 3CXHI 2CPSA 1N7SA 3H1JD 1NKZB 2LR2A 1FU1A 2A06G 3Q1MA 1GD2E 1AJYA 3H1KJ 3H25A 2QM7A 1QEXA 2P1JA 3O6QA 2FYNB 3OJAB 2OYIC 4GDOA 2KSJA 3L71E 4GOFA 1P84H 3AE3C 1S72P 1EC5A 1AA0A 2YIUC 4K3AA 3TGUG 1X8YA 5KLIB 2KUBA 1JMBA 1UIIA 2M5AA 1GMJA 1Q2NA 3U1AA 1L4AB 3LW5H 1GL2C 3G6EP 1KYOH 3RL0C 3RGUA 1R5LA 3W67A 3G9RA 1RE3A 1Y8AA 3MIWA 3IFMA 1SQQK 5GTHE 1RH5B 1CSBA 4JYCA 4U3FD 1L4AC 3TSIA 1KILE 1YI2P 4ZMDA 3CCEP 3L72E 3A5TA 1PGJA 3AEAC 1JO5A 5AW8B 4K35A 3FWLA 3HE4B 3BCCJ 3VMAA 5CCHC 3SWFA 1IFNA 1SQPE 1RE4C 2KXPB 1YTZT 1Z56A 3CX5H 1L0LG 3MD0A 4H13D 4WY4C 1FDIA 3TF5A 3JSVC 1NTMJ 3MUDC 2KSEA 1JNMA 2LKMA 1AV1A 2D2CB 3Q5RA 3A0HE 3H1LD 2IBZI 1L2PA 3PH0A 3PHLA 2AXCA 3L36A 1IZNB 1USEA 2IBZE 3CCUP 1GU4A 3IR9A 2O01N 3PJSK 4H0LC 4N78E 4O9BA 4XFJA 3VOPA 1NTMK 1RQVA 5DJUB 2YKQA 3AE1C 1URQB 3KDPB 1FZGA 1EDJA 3L75G 2W6BA 5KJ7C 2KZIA 3CD6P 1NTME 5AVQB 1SQXD 2IFNA 1LTBC 1N8RQ 1KYOI 3L75D 5AVXB 5GTIH 3Q2YA 1HBWA 1FE6A 3CPWO 1HJ0A 3CCMP 5AVRB 2W6JH 1T3JA 5B5EE 4L73A 2BCCJ 1JMMA 1BGYE 2N9YB 2R5DA 3L37A 1BCCD 1MKMA 1VF5B 1FZEA 3M06A 4TLFA 5AVWB 5C39A 4H13B 1N7SD 2R32A 3L72J 1HWTC 2P58A 3H6PA 1KC8Q 4AYCA 2Q3EA 1SQQD 2M3EA 1FJPA 1GK6A 2FFDB 2D2CC 1S1CX 1S3JA 1SQVE 2FYUE 1BCCJ 1H88A 2I1JA 3PRJA 3M0DC 3CC7P 3H1KD 1LWUC 3E1IA 3EWKA 2K9JA 3M9QA 3MP7B 2ZT9D 3H1JE 1N73B 1NTKK 1PFIA 1L0NE 3E7KA 1BSNA 2Q1KA 3B8EB 2JWAA 2PP6A 2R44A 1SQXK 2FYUJ 2K9YA 3L70E 1RY3A 4KJMA 2WT7B 3G4SP 2WT7A 1MZ9A 2WWWA 4WY4D 3S9OA 3RBZA 3WUVA 1LT9B 3H32A 1J1EB 2NPSD 3CX5I 1LP1A 3CX5D 4YPCA 3TK1A 1M7LA 3WU2H 1ZMEC 1CI6A 2B89A 3MHVA 3ITKA 1SQXJ 2FYUK 3AECC 2QJKC 4JF7A 4R4LA 5AVZB 1FZCC 2N9BA 4JYBA 5CHXA 1G1IA 2HR3A 1IC2A 4GT1A 1GW3A 3L74E 2ZT9B 1W2BO 4WBAA 1NTKJ 2V7QH 3FWNA 4NPEA 1KQLA 2E42A 4HKZH 1AQ5A 1BE3G 2C0XA 2NPSA 2XDJA 3KPEA 1KYOE 1LWUB 2RN0A 2WSFJ 1FC2C 1LWUA 2MJZA 3B5ND 1IFMA 3H1LJ 3R4YA 2WPRA 2GUVA 2QA4P 3PLNA 1NTKE 3PTZA 1A02J 1H0TB 3PP5A 1L0LE 1PP9J 4ZNCA 2H7HA 2J59M 1DEEG 1T8ZA 2IX7C 5CCGA 3GF7A 1Q81Q 2IBZD 5H2FE 5KLIC 1IK7A 1KILA 3HE5B 4EI2A 1K73Q 3OAKA 3U59A 3CWBJ 4C7NA 3HTKB 3Q5SA 4BWNA 1VQPP 4C7NB 1SQQJ 2A45G 1Y47A 3F89A 1HH0A 1JY2N 4U7JA 3GLMA 4DCKA 5APWA 1FZCA 5KLVK 2K1AA 5AW4B 2JKVA 1EZVE 1GZLA 1SS1A 4AUWA 3P8CE 2XKMA 1FAVA 2BASA 2W90A 3KZIE 3MGNA 3L73J 3L75E 4XA4A 4KHXA 5L8RJ 1OVRA 3A0BH 2E74C 1OMIA 2ITAA 1IFJA 2AEJA 2R3SA 3H1IE 2WTYA 4OH8B 1BCCE 3SFDC 1JY3O 1IFIA 1NU1K 1NTZG 4U3FJ 3HUSC 5DJTB 3S1KA 4AQRD 4IFDK 1FDMA 1T6AA 2J5UA 2B9BA 2CPBA 1NTZD 1PGPA 1SQQE 1ZXGA 2BCCE 1UIXA 2OARA 1M1JB 1ZRTE 2RMZA 2KS1A 1VL2A 3CLQA 3H1KE 4UB8E 4DZOA 1SQVG 1OZHA 2E75D 2YXRB 1NJIQ 1OVVA 1PP9E 2KNCA 4EDFA 2JO1A 3RBXA 1AQTA 2PRRA 3L70D 4EIJA 2OYIB 2GM4A 3VP8A 2YKOA 1L0NG 3BASA 4WY4B 2CK3H 1BSHA 3GF3A 3HD7A 2WPQA 1ZLLA 2ZYAA 1S9KE 3HD7B 2XV5A 1R8EA 3AE5C 1M90Q 2I1KA 2JEEA 2RKLA 2OYHB 5M1BA 3AEBC 1PGQA 1X22A 4CPGA 1RF0A 3AE8C 3L71G 4H0LB 5CJ4A 3B71A 4WWIA 2W27A 1MFTA 4OVNF 1QX8A 3TNUA 3U1CA 1U7JA 4YTPC 1JTHA 2HYNA 3CI9A 5CCGD 1NGMB 2NRGA 1JTHB 2WSFH 4GIFA 1EQ7A 1FZAA 1X79B 5APVA 2GA1A 3WUTA 4DT0A 4UB6H 3HD7D 2W83C 4EYYQ 1LGHB 5CCHA 1M1KQ 1ZOYC 1DIPA 1KV4A 2G8YA 3AE6C 4IFMA 1GL2D 4D6TE 4WB4A 1IJDB 3KZIH 1NTZJ 4U3FG 5KJ7A 1WMKA 1Q90D 4WVZA 4PD4I 4EOTA 2W6AA 3RK3E 1E5WA 1T2KC 3IAOA 2PGDA 3KHUA 3GHGC 2O01H 5TISH 4NPFX 1Q82Q 3B4SA 2WSCJ 2ZXEB 4ZKUA 1KMIZ 2L91A 5CCHD 3M91A 4W7YA 1J2JB 1DH3A 1SFCB 4GKGA 2BEZF 3G3ZA 3ABVC 4N78D 3CXHH 1SQBE 3C1LA 3H1LG 3LIDA 2FBWC 3C8VA 2WQYC 1HJBA 1U57A 1X0TA 2IDBA 3M0DA 1VQMP 3EFFK 3RL0D 1OIPA 2JWDA 2K3RA 3L35A 3W68A 2A45I 1EZVI 1SP4A 3H1IJ 2WITA 3TYYA 2WMMA 1N86A 2Y9YA 1LTJB 3GG2A 3II6A 2FXPA 3M9BA 1GW4A 1ZP0C 5CBOA 2QVAA 1PPJE 1HGVA 1JY2O 1SQXG 1YBKA 5GTHH 1HGZA 5AW1B 4LGDE 5KTBA 3D6YA 1GK4A 4R4MA 3V4QA 1NO4A 3OA7A 5AVYB 1BGYG 3D71A 1NTZE 2H89C 2RH0A 2ZT9C 1ZRTD 5AW9B 1FZCB 1QVGO 5AVTB 1DD4A 1P84E 2IFMA 2Q6QA 2HPCA 2I8DA 4IOIH 2OYOA 1NU1J 3N4XA 2POHA 1PP9D 2JP3A 2K9JB 2FKWB 2YIUB 3NFQA 3HRNA 2NPSC 5KAFH 1GDTA 1PP9G 2N1TB 1LT9C 2WSEJ 1X9VA 3H1JG 3VTPC 1YIJP 2IBZG 1GL2B 1VQ7P 2A06E 2WSCH 1EDLA 2ZVNB 1S2EA 4PD4H 1SVFA 3FXDA 3CWBD 3M0AA 3RK2B 3G71P 4HH2A 3AEFC 1M1JA 4IFFA 1K9MQ 1RF1C 4I6MC 2KS1B 2PFXA 5KJ7D 2XNDH 3KQGA 1IO4A 1KILC 2QJYC 1PL5A 5AVSB 2KNCB 2O3JA 4L76A 1EDIA 2G3AA 3AEGC 3Q5PA 2OYIA 1USDA 3RK2D 2IYPA 4D6TD 3T97A 2B87A 1YTZI 1ZW0A 1E79H 2PAJA 2QJPB 1LTGC 1S4XA 2R5BA 1KYOD 5E79E 2OTLP 3H1HE 2OYHA 1WT6A 2K37A 3CCLP 3AE4C 1BE3D 2E76D 2A45H 4PV1C 1NTKD 2Y0CA 3ZDMA 1AVYA 1NH4A 1L0LD 1L4AA 1PV3A 1SQBJ 2KP8A 1EXIA 1VF5D 2M5AB 1CZQA 1OW7A 2JDIH 2WVRA 3L75J 3KXDA 3L73E 3AE9C 5BU5A 1URQC 4TT3H 3O8ZA 1ZR4A 1N2DC 1KQSO 1LJ2A 5APTA 1R5SA 2P10A 1RF1B 4M3LA 1RF1A 3CCVP 2LXCB 1VQ9P 1OWAA 3CCSP 1URQD 1FDOA 1YJ9P 2WSEH 2XU6A 1EZVD 3HE4A 1T3UA 3TGUE 1RE3C 1VF5C 4N6JA 1EZVG 1NU1E 1XTCC 3WMM0 1NOHA 4W80A 1PPJD 3AEEC 1EDKA 1VPCA 2OQQA 4IL6E 3H1ID 1SQBK 5AW5B 2YMKA 1VQ5P 3L74G 1NAYA 1DX7A 3V4WA 2WSSH 3BATA 2OYHC 2IZ0A 1KTMA 1KORA 2O01J 3IN6A 4PV1B 2E75C 3OW2O 1JB0J 1VQLP 2M8RA 3VYIA 3R2PA 3C9IA 1HF9A 3BCCG 4Z1MH 3MUDA 4BRYA 1SQQG 1LTSC 1OW6A 1P84D 2H8PD 2ZYDA 3VP9A 4BRYB 4RJTA 3BVHA 1QL2A 1URQA 1M57D 3AE7C 2XNXA 2Y0EA 2WPVB 4PD4D 1PIXA 1LTAC 1VQ4P 2UWJE 2HODB 2Z4EA 1K8AQ 2HODA 5AW2B 3BRTB 2BEQD 4LC1A 3F5HA 2KI7B 1SFCC 3V2QA 5KAFE 2Y9ZA 3S4RA 3JC22 3GW6A 1BE3J 3L70J 1OFCX 2M3BA 2O1KA 2V7QJ 2KLUA 3VN0A 1OW8A 1L4AD 2H43A 2FFDA 1TU3F 1QLED 1BDCA 1DEBA 1FJKA 1NTMG 2E5YA 1J1DB 2O1JA 2WZ7A 4I7ZC 4C46A 1S9KD 4I2LC 2YKPA 5KAIE 1L0LK 3JCUE 4NPDA 5AVUB 1H8AA 5B5EH 1A02F 1M56D 1LTJC 1YJNP 1XTGB 3GHGB 1KB9E 5KAIH 1RQUA 3GHGA 2HG5D 5KLVJ 2MKVA 3H1HD 2FXOA 4QMAA 3RK3D 1HTLC 1OXZA 2B88A 1FZBA 3B5NB 4DJGA 1Q7YQ 1BE3E 2E74D 3H32B 2P67A 1W2EA 3RK3C 3V5BA 2Q5UA 2JR8A 4N3YB 4D6TJ 2Q7CA 3CCQP 1KD1Q 3A2AA 3L73D 1MUUA 3CMAP 3RK2C 2IZ1A 2ZFCA 2K88A 3BRVB 1JEKA 3V2NA 1MFZA 1N7SB 1SFCA 1L0LJ 1SQBD 2FXMA 5KKZC 1W5CE 1QGKB 2KIKA 3CXHE 4HYTB 2E5TA 4BXLA 3O6QB 5APUA 1VQ8P 2NPSB 2ZVOB 4GOEA 2N1TC 5TISE 3RL0g 5BU8B 3M9HA 4I7ZB 3TGUD 3D6ZA 1J1DC 1N7SC 4LLHA 3SWYA 2QEXP 1VQOP 1JY2P 1SQVK 2OTJP 1OVUA 2JJLA 3EFGA 3SFEC 5APSA 1OX3A 3L74J 2ZJSE 5APQA 2J58A 3L4FA 1S5LE 3LIEA 1YYCA 4A7PA 4YXDC 1JOCA 2KLVA 3JCUH 4L74A 1H89A 1KB9H 2C9NY 2R3CA 4RESB 2FYZA 4Y28J 1K05A 1SQPJ 3I56P 4U3FE 1FOSF 1FOSE 5KLVE 4HB1A 4PJ0H 3I55P
chains in the Genus database with same CATH topology
2YO3A 5CCGC 2GUSA 2VRSA 4DOJA 1JY3N 3NXSA 1G2CB 2KOGA 4Y99C 5AW0B 1NAFA 1M1JC 3VMZA 1GL2A 3KYQA 2KYVA 3NTNA 2P2UA 4B86A 3RL0B 3CL3D 2P7JA 3HUSB 2HFED 1JUNA 1IFDA 1SFCD 1RF0C 4WY4B 5APWA 1HVVA 3A7OA 4WY4A 1GTWA 1QL1A 5CJ0A 1KFNA 5APYA 3VMXA 3A5TA 4Y99B 3A3YB 3P32A 1LTIC 4C7RA 3HD7C 4ZKPA 3TNUB 3V2PA 1N73A 2L5GB 2XZRA 4W7ZA 3B5NA 1JY3P 2Q3IA 3UIAA 3MTUE 1FBMA 1NTZK 5AW6B 1FZGA 1T2KD 2Q9IA 3VMYA 1FZFA 1ZN5A 2YNYA 1MV8A 1KILD 5AW3B 1AFOA 5AVVB 1NKNA 3I5CA 1HUCA 1GU5A 2Z5HA 1N73C 1LTJA 1L0NK 1SQPK 3P7KA 1ZR2A 3P8MC 2C9LY 3B5NC 1KILB 3HE5A 1JCDA 2YMYA 1NWQA 3RK3B 1VDFA 1J1EC 5AW7B 3HTKA 1G1JA 1LTTC 4I1LA 2YO2A 2E43A 3NMDA 2HPCB 1JCCA 1NHLA 1G2CA 3P8CD 3N7NA 2IPPA 5BVZA 1IK9A 2N1TA 1N7LA 2WPSA 1KZUB 2C0WA 2QM8A 3V2RA 1SLQA 5APXA 2N1TD 2Z5IA 1LT9A 3HUSA 1ZV8A 4XE5B 1CW5A 1CI6B 1WRGA 2HLOA 3EQ2A 5CMZA 1RE4A 1KFMA 2KB7P 2CPSA 1N7SA 1NKZB 1FU1A 1GD2E 2QM7A 2P1JA 3OJAB 2OYIC 2KSJA 1X8YA 3U1AA 1L4AB 3LW5H 1GL2C 3RL0C 1RE3A 3MIWA 3IFMA 1SQQK 1CSBA 4JYCA 3TSIA 1L4AC 1JO5A 5AW8B 3HE4B 5CCHC 3SWFA 1IFNA 3MD0A 1RE4C 1YTZT 1Z56A 4WY4C 1JNMA 2LKMA 3L36A 1GU4A 3IR9A 4N78E 4O9BA 3VOPA 1NTMK 2YKQA 3KDPB 1URQB 5KJ7C 2W6BA 5AVQB 2IFNA 1LTBC 1HBWA 5AVXB 5AVRB 1T3JA 1JMMA 2R5DA 3L37A 5AVWB 2FFDC 3M06A 1FZEA 1HWTC 1N7SD 2R32A 3H6PA 4AYCA 1FJPA 1GK6A 2FFDB 1H88A 2I1JA 3M0DC 1LWUC 3E1IA 3M9QA 1N73B 1NTKK 1PFIA 3B8EB 2PP6A 1SQXK 2WT7B 1RY3A 2WT7A 1MZ9A 2WWWA 4WY4D 1LT9B 3H32A 1J1EB 2NPSD 3TK1A 1M7LA 1CI6A 2FYUK 1FZCC 4JF7A 5AVZB 2N9BA 4JYBA 5CHXA 1G1IA 1IC2A 4GT1A 1GW3A 4WBAA 1KQLA 2E42A 1AQ5A 2C0XA 2NPSA 3KPEA 2XDJA 1LWUB 3B5ND 2MJZA 1LWUA 1IFMA 2WPRA 2GUVA 1A02J 3PP5A 2H7HA 2J59M 1T8ZA 2IX7C 5CCGA 1KILA 3HE5B 3OAKA 3U59A 4C7NA 3HTKB 4C7NB 2A45G 1HH0A 1JY2N 1FZCA 5KLVK 5AW4B 1GZLA 3P8CE 2XKMA 1FAVA 2BASA 3MGNA 4XA4A 4KHXA 1IFJA 2WTYA 4OH8B 1JY3O 1IFIA 1NU1K 4IFDK 4AQRD 3HUSC 1FDMA 2CPBA 2OARA 1M1JB 4DZOA 3CLQA 2OYIB 2GM4A 4EIJA 3VP8A 2YKOA 3BASA 3HD7A 2WPQA 1ZLLA 3HD7B 2XV5A 2I1KA 2JEEA 2OYHB 5CJ4A 1RF0A 2W27A 3TNUA 3U1CA 1JTHA 2HYNA 3CI9A 5CCGD 2WSFH 1JTHB 4GIFA 5APVA 1EQ7A 1FZAA 1X79B 1S9KE 5CCHA 3HD7D 1LGHB 4IFMA 1GL2D 4WB4A 1IJDB 5KJ7A 4EOTA 2W6AA 1E5WA 1T2KC 3GHGC 2O01H 4ZKUA 2ZXEB 5CCHD 3M91A 4W7YA 1J2JB 1DH3A 1SFCB 4GKGA 3G3ZA 4N78D 3LIDA 1HJBA 3M0DA 3RL0D 3L35A 2A45I 1SP4A 2WITA 3TYYA 1N86A 1LTJB 3M9BA 3II6A 1GW4A 1HGVA 1JY2O 1HGZA 5AW1B 4LGDE 5KTBA 1GK4A 3V4QA 1NO4A 3OA7A 5AVYB 5AW9B 1FZCB 5AVTB 2IFMA 2HPCA 3N4XA 2POHA 2FKWB 3NFQA 3HRNA 2NPSC 1GDTA 2N1TB 4AUWA 1LT9C 1X9VA 3VTPC 1GL2B 2WSCH 1SVFA 3M0AA 3RK2B 4HH2A 1M1JA 4IFFA 1RF1C 4I6MC 5KJ7D 3KQGA 1IO4A 1KILC 5AVSB 2OYIA 3RK2D 3T97A 1YTZI 2PAJA 1LTGC 2R5BA 2OYHA 1WT6A 2A45H 1NH4A 1L4AA 2KP8A 1CZQA 5BU5A 1URQC 3O8ZA 1ZR4A 1N2DC 5APTA 1RF1B 4M3LA 1RF1A 1OWAA 1URQD 2WSEH 2XU6A 3HE4A 1T3UA 1RE3C 4N6JA 1XTCC 3WMM0 1NOHA 4W80A 1VPCA 1SQBK 5AW5B 1DX7A 3V4WA 3BATA 2OYHC 2M8RA 3VYIA 3R2PA 3C9IA 3MUDA 1LTSC 2H8PD 3VP9A 3BVHA 1QL2A 1URQA 2XNXA 1LTAC 2HODB 2Z4EA 2HODA 5AW2B 3BRTB 4LC1A 1SFCC 3V2QA 2M3BA 2O1KA 3VN0A 2H43A 1L4AD 2FFDA 1DEBA 1FJKA 2O1JA 1J1DB 2WZ7A 4C46A 1S9KD 4I2LC 2YKPA 1L0LK 5AVUB 1H8AA 1A02F 1LTJC 1XTGB 3GHGB 3GHGA 2HG5D 3RK3D 1HTLC 1OXZA 3B5NB 1FZBA 3V5BA 3H32B 2P67A 1W2EA 3RK3C 2Q5UA 4N3YB 2Q7CA 3A2AA 1MUUA 3RK2C 2ZFCA 3BRVB 3V2NA 1MFZA 1N7SB 1SFCA 2FXMA 4HYTB 5APUA 2NPSB 2N1TC 5BU8B 3M9HA 1J1DC 1N7SC 4LLHA 3SWYA 1JY2P 1SQVK 2JJLA 3EFGA 5APSA 5APQA 2J58A 3L4FA 3LIEA 1YYCA 1JOCA 2KLVA 1H89A 2C9NY 2R3CA 4RESB 2FYZA 1FOSF 1FOSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1K A;  1G1J A;  3CI9 A;  4WB4 A;  4DOJ A;  2WIT A;  1G1I A;  2O1J A;  4C7R A;  4HH2 A;  2L5G B;  4LLH A;  4WBA A;  3MIW A; 
#chains in the Genus database with same CATH topology
 2D2C D;  2YO3 A;  5CCG C;  2BCC G;  2GUS A;  2QJK B;  2VRS A;  4DOJ A;  1SQP G;  1JY3 N;  1NTK G;  5B66 E;  1SQP D;  3NXS A;  1G2C B;  2KOG A;  1SQV J;  4RO0 A;  4Y99 C;  2FFD C;  2AEM A;  5AW0 B;  1NAF A;  2DW3 A;  2FY8 A;  2YXQ B;  2A06 D;  1M1J C;  3VMZ A;  1GL2 A;  3CWB E;  1LT1 A;  3H1H J;  3KYQ A;  4UB6 E;  1EXJ A;  2KYV A;  3NTN A;  2NZ2 A;  2P2U A;  3Q3D A;  3D70 A;  4B86 A;  2ZXX A;  3RL0 B;  1Y9B A;  3CL3 D;  1KN7 A;  2P7J A;  3FXE A;  3HUS B;  2HFE D;  4JQ0 D;  2M0B A;  1JUN A;  5E79 H;  2QJP C;  4H0L D;  1VQ6 P;  1IFD A;  3E1R A;  1PPJ G;  2OGU A;  1SFC D;  1RF0 C;  3H1I G;  4GOD A;  1HVV A;  1BCC G;  1KB9 D;  3A7O A;  4H44 D;  1KB9 I;  4IL6 H;  4L75 A;  4WY4 A;  1Q86 Q;  3T97 B;  3LW5 J;  2B87 B;  1GTW A;  1QL1 A;  4D6T G;  3FX0 A;  4HJG H;  5CJ0 A;  3SWK A;  1S5L H;  3BCC D;  1KFN A;  5APY A;  3VMX A;  1DD3 A;  1JM0 A;  4Y99 B;  2OTK E;  5GTI E;  2E74 B;  2E75 B;  2KZJ A;  3A3Y B;  3P32 A;  5TJH A;  3WU2 E;  1LTI C;  2W8Z A;  3H1K G;  1AVO A;  4C7R A;  3HD7 C;  2H88 C;  1SQV D;  3K5B A;  3USS A;  3TNU B;  3V2P A;  4ZKP A;  1N73 A;  3CC4 P;  1U7M A;  2AXT E;  2ZYG A;  2QRX A;  3TGU J;  3L70 G;  1H0T A;  2SPZ A;  3CXH D;  2L5G B;  2XZR A;  4JPZ B;  1L0N D;  4W7Z A;  5H2F H;  4H44 B;  2AXT H;  1BDD A;  3B5N A;  1JY3 P;  1LNQ A;  2Q3I A;  3MTU E;  1FBM A;  1IFP A;  1NTZ K;  5AW6 B;  4OGQ D;  3UIA A;  5B66 H;  2LXB A;  3H1J J;  1T2K D;  3L71 D;  1NU1 D;  2Q9I A;  1FS0 E;  4H13 C;  1L0N J;  3CX5 E;  4H44 C;  4PJ0 E;  2IYO A;  2V4H A;  3FGA D;  3VMY A;  2QIW A;  1NU1 G;  3AE2 C;  2ZAE B;  1FZF A;  1ZN5 A;  1YJW P;  2YNY A;  3CCJ P;  3L71 J;  1KQF B;  3L74 D;  3L72 G;  5KLV D;  1MV8 A;  1M8O B;  1KIL D;  1BGY J;  5AW3 B;  2E76 B;  3H1H G;  3L72 D;  4MN4 C;  3V6I A;  1PGO A;  5AVV B;  5KLV G;  1NKN A;  3I5C A;  1AFO A;  1P84 I;  1QVF O;  1HUC A;  1GU5 A;  2Z5H A;  1N73 C;  1LTJ A;  1NVO A;  4PD4 E;  3L73 G;  4OWF A;  2E76 C;  4PV1 D;  4ASV A;  1L0N K;  4ASW A;  1SQP K;  4YXW H;  3MZW B;  2QG4 A;  3P7K A;  1ZR2 A;  1S5L X;  3P8M C;  3CCR P;  2C9L Y;  3B5N C;  3SSU A;  3CME P;  1KIL B;  2QJY B;  1JCD A;  2YMY A;  1SQB G;  3H1L E;  3HE5 A;  1NWQ A;  3RK3 B;  1VDF A;  1VQK P;  1J1E C;  5AW7 B;  3A0H H;  1D7M A;  3CWB G;  3HTK A;  1G1J A;  1YHQ P;  1LTT C;  4I1L A;  3QH9 A;  5KKZ B;  4IL6 X;  2KK7 A;  2YO2 A;  4RKU J;  3NMD A;  2E43 A;  4UB8 H;  2HPC B;  4KT0 J;  1JCC A;  1NHL A;  2FYN C;  1NYH A;  1G2C A;  2QSI A;  3P8C D;  3N7N A;  2IPP A;  1VQN P;  1NTM D;  5BVZ A;  1SQX E;  1IK9 A;  2N1T A;  2Y0D A;  4OGQ B;  1RHZ B;  3TDK A;  1N7L A;  2WPS A;  5K5G B;  1KZU B;  1K04 A;  1BGY D;  2C0W A;  2QM8 A;  3BCC E;  1YQ3 C;  4OGQ C;  1YIT P;  4JBZ A;  3V2R A;  1SLQ A;  5APX A;  3A0B E;  2AEF A;  2N1T D;  3GMA A;  2Z5I A;  2BCC D;  1LT9 A;  3HUS A;  1ZV8 A;  1LP1 B;  2FYU G;  2QE7 H;  4XE5 B;  5EFW B;  3WUU A;  3IF4 A;  1YQ4 C;  1CW5 A;  1CI6 B;  1WRG A;  1PZQ A;  1KQG B;  2FYU D;  2HLO A;  3QWO C;  3EQ2 A;  5CMZ A;  3CC2 P;  5CBN A;  1RE4 A;  3AED C;  1KFM A;  2KB7 P;  3CXH I;  2CPS A;  1N7S A;  3H1J D;  1NKZ B;  2LR2 A;  1FU1 A;  2A06 G;  3Q1M A;  1GD2 E;  1AJY A;  3H1K J;  3H25 A;  2QM7 A;  1QEX A;  2P1J A;  3O6Q A;  2FYN B;  3OJA B;  2OYI C;  4GDO A;  2KSJ A;  3L71 E;  4GOF A;  1P84 H;  3AE3 C;  1S72 P;  1EC5 A;  1AA0 A;  2YIU C;  4K3A A;  3TGU G;  1X8Y A;  5KLI B;  2KUB A;  1JMB A;  1UII A;  2M5A A;  1GMJ A;  1Q2N A;  3U1A A;  1L4A B;  3LW5 H;  1GL2 C;  3G6E P;  1KYO H;  3RL0 C;  3RGU A;  1R5L A;  3W67 A;  3G9R A;  1RE3 A;  1Y8A A;  3MIW A;  3IFM A;  1SQQ K;  5GTH E;  1RH5 B;  1CSB A;  4JYC A;  4U3F D;  1L4A C;  3TSI A;  1KIL E;  1YI2 P;  4ZMD A;  3CCE P;  3L72 E;  3A5T A;  1PGJ A;  3AEA C;  1JO5 A;  5AW8 B;  4K35 A;  3FWL A;  3HE4 B;  3BCC J;  3VMA A;  5CCH C;  3SWF A;  1IFN A;  1SQP E;  1RE4 C;  2KXP B;  1YTZ T;  1Z56 A;  3CX5 H;  1L0L G;  3MD0 A;  4H13 D;  4WY4 C;  1FDI A;  3TF5 A;  3JSV C;  1NTM J;  3MUD C;  2KSE A;  1JNM A;  2LKM A;  1AV1 A;  2D2C B;  3Q5R A;  3A0H E;  3H1L D;  2IBZ I;  1L2P A;  3PH0 A;  3PHL A;  2AXC A;  3L36 A;  1IZN B;  1USE A;  2IBZ E;  3CCU P;  1GU4 A;  3IR9 A;  2O01 N;  3PJS K;  4H0L C;  4N78 E;  4O9B A;  4XFJ A;  3VOP A;  1NTM K;  1RQV A;  5DJU B;  2YKQ A;  3AE1 C;  1URQ B;  3KDP B;  1FZG A;  1EDJ A;  3L75 G;  2W6B A;  5KJ7 C;  2KZI A;  3CD6 P;  1NTM E;  5AVQ B;  1SQX D;  2IFN A;  1LTB C;  1N8R Q;  1KYO I;  3L75 D;  5AVX B;  5GTI H;  3Q2Y A;  1HBW A;  1FE6 A;  3CPW O;  1HJ0 A;  3CCM P;  5AVR B;  2W6J H;  1T3J A;  5B5E E;  4L73 A;  2BCC J;  1JMM A;  1BGY E;  2N9Y B;  2R5D A;  3L37 A;  1BCC D;  1MKM A;  1VF5 B;  1FZE A;  3M06 A;  4TLF A;  5AVW B;  5C39 A;  4H13 B;  1N7S D;  2R32 A;  3L72 J;  1HWT C;  2P58 A;  3H6P A;  1KC8 Q;  4AYC A;  2Q3E A;  1SQQ D;  2M3E A;  1FJP A;  1GK6 A;  2FFD B;  2D2C C;  1S1C X;  1S3J A;  1SQV E;  2FYU E;  1BCC J;  1H88 A;  2I1J A;  3PRJ A;  3M0D C;  3CC7 P;  3H1K D;  1LWU C;  3E1I A;  3EWK A;  2K9J A;  3M9Q A;  3MP7 B;  2ZT9 D;  3H1J E;  1N73 B;  1NTK K;  1PFI A;  1L0N E;  3E7K A;  1BSN A;  2Q1K A;  3B8E B;  2JWA A;  2PP6 A;  2R44 A;  1SQX K;  2FYU J;  2K9Y A;  3L70 E;  1RY3 A;  4KJM A;  2WT7 B;  3G4S P;  2WT7 A;  1MZ9 A;  2WWW A;  4WY4 D;  3S9O A;  3RBZ A;  3WUV A;  1LT9 B;  3H32 A;  1J1E B;  2NPS D;  3CX5 I;  1LP1 A;  3CX5 D;  4YPC A;  3TK1 A;  1M7L A;  3WU2 H;  1ZME C;  1CI6 A;  2B89 A;  3MHV A;  3ITK A;  1SQX J;  2FYU K;  3AEC C;  2QJK C;  4JF7 A;  4R4L A;  5AVZ B;  1FZC C;  2N9B A;  4JYB A;  5CHX A;  1G1I A;  2HR3 A;  1IC2 A;  4GT1 A;  1GW3 A;  3L74 E;  2ZT9 B;  1W2B O;  4WBA A;  1NTK J;  2V7Q H;  3FWN A;  4NPE A;  1KQL A;  2E42 A;  4HKZ H;  1AQ5 A;  1BE3 G;  2C0X A;  2NPS A;  2XDJ A;  3KPE A;  1KYO E;  1LWU B;  2RN0 A;  2WSF J;  1FC2 C;  1LWU A;  2MJZ A;  3B5N D;  1IFM A;  3H1L J;  3R4Y A;  2WPR A;  2GUV A;  2QA4 P;  3PLN A;  1NTK E;  3PTZ A;  1A02 J;  1H0T B;  3PP5 A;  1L0L E;  1PP9 J;  4ZNC A;  2H7H A;  2J59 M;  1DEE G;  1T8Z A;  2IX7 C;  5CCG A;  3GF7 A;  1Q81 Q;  2IBZ D;  5H2F E;  5KLI C;  1IK7 A;  1KIL A;  3HE5 B;  4EI2 A;  1K73 Q;  3OAK A;  3U59 A;  3CWB J;  4C7N A;  3HTK B;  3Q5S A;  4BWN A;  1VQP P;  4C7N B;  1SQQ J;  2A45 G;  1Y47 A;  3F89 A;  1HH0 A;  1JY2 N;  4U7J A;  3GLM A;  4DCK A;  5APW A;  1FZC A;  5KLV K;  2K1A A;  5AW4 B;  2JKV A;  1EZV E;  1GZL A;  1SS1 A;  4AUW A;  3P8C E;  2XKM A;  1FAV A;  2BAS A;  2W90 A;  3KZI E;  3MGN A;  3L73 J;  3L75 E;  4XA4 A;  4KHX A;  5L8R J;  1OVR A;  3A0B H;  2E74 C;  1OMI A;  2ITA A;  1IFJ A;  2AEJ A;  2R3S A;  3H1I E;  2WTY A;  4OH8 B;  1BCC E;  3SFD C;  1JY3 O;  1IFI A;  1NU1 K;  1NTZ G;  4U3F J;  3HUS C;  5DJT B;  3S1K A;  4AQR D;  4IFD K;  1FDM A;  1T6A A;  2J5U A;  2B9B A;  2CPB A;  1NTZ D;  1PGP A;  1SQQ E;  1ZXG A;  2BCC E;  1UIX A;  2OAR A;  1M1J B;  1ZRT E;  2RMZ A;  2KS1 A;  1VL2 A;  3CLQ A;  3H1K E;  4UB8 E;  4DZO A;  1SQV G;  1OZH A;  2E75 D;  2YXR B;  1NJI Q;  1OVV A;  1PP9 E;  2KNC A;  4EDF A;  2JO1 A;  3RBX A;  1AQT A;  2PRR A;  3L70 D;  4EIJ A;  2OYI B;  2GM4 A;  3VP8 A;  2YKO A;  1L0N G;  3BAS A;  4WY4 B;  2CK3 H;  1BSH A;  3GF3 A;  3HD7 A;  2WPQ A;  1ZLL A;  2ZYA A;  1S9K E;  3HD7 B;  2XV5 A;  1R8E A;  3AE5 C;  1M90 Q;  2I1K A;  2JEE A;  2RKL A;  2OYH B;  5M1B A;  3AEB C;  1PGQ A;  1X22 A;  4CPG A;  1RF0 A;  3AE8 C;  3L71 G;  4H0L B;  5CJ4 A;  3B71 A;  4WWI A;  2W27 A;  1MFT A;  4OVN F;  1QX8 A;  3TNU A;  3U1C A;  1U7J A;  4YTP C;  1JTH A;  2HYN A;  3CI9 A;  5CCG D;  1NGM B;  2NRG A;  1JTH B;  2WSF H;  4GIF A;  1EQ7 A;  1FZA A;  1X79 B;  5APV A;  2GA1 A;  3WUT A;  4DT0 A;  4UB6 H;  3HD7 D;  2W83 C;  4EYY Q;  1LGH B;  5CCH A;  1M1K Q;  1ZOY C;  1DIP A;  1KV4 A;  2G8Y A;  3AE6 C;  4IFM A;  1GL2 D;  4D6T E;  4WB4 A;  1IJD B;  3KZI H;  1NTZ J;  4U3F G;  5KJ7 A;  1WMK A;  1Q90 D;  4WVZ A;  4PD4 I;  4EOT A;  2W6A A;  3RK3 E;  1E5W A;  1T2K C;  3IAO A;  2PGD A;  3KHU A;  3GHG C;  2O01 H;  5TIS H;  4NPF X;  1Q82 Q;  3B4S A;  2WSC J;  2ZXE B;  4ZKU A;  1KMI Z;  2L91 A;  5CCH D;  3M91 A;  4W7Y A;  1J2J B;  1DH3 A;  1SFC B;  4GKG A;  2BEZ F;  3G3Z A;  3ABV C;  4N78 D;  3CXH H;  1SQB E;  3C1L A;  3H1L G;  3LID A;  2FBW C;  3C8V A;  2WQY C;  1HJB A;  1U57 A;  1X0T A;  2IDB A;  3M0D A;  1VQM P;  3EFF K;  3RL0 D;  1OIP A;  2JWD A;  2K3R A;  3L35 A;  3W68 A;  2A45 I;  1EZV I;  1SP4 A;  3H1I J;  2WIT A;  3TYY A;  2WMM A;  1N86 A;  2Y9Y A;  1LTJ B;  3GG2 A;  3II6 A;  2FXP A;  3M9B A;  1GW4 A;  1ZP0 C;  5CBO A;  2QVA A;  1PPJ E;  1HGV A;  1JY2 O;  1SQX G;  1YBK A;  5GTH H;  1HGZ A;  5AW1 B;  4LGD E;  5KTB A;  3D6Y A;  1GK4 A;  4R4M A;  3V4Q A;  1NO4 A;  3OA7 A;  5AVY B;  1BGY G;  3D71 A;  1NTZ E;  2H89 C;  2RH0 A;  2ZT9 C;  1ZRT D;  5AW9 B;  1FZC B;  1QVG O;  5AVT B;  1DD4 A;  1P84 E;  2IFM A;  2Q6Q A;  2HPC A;  2I8D A;  4IOI H;  2OYO A;  1NU1 J;  3N4X A;  2POH A;  1PP9 D;  2JP3 A;  2K9J B;  2FKW B;  2YIU B;  3NFQ A;  3HRN A;  2NPS C;  5KAF H;  1GDT A;  1PP9 G;  2N1T B;  1LT9 C;  2WSE J;  1X9V A;  3H1J G;  3VTP C;  1YIJ P;  2IBZ G;  1GL2 B;  1VQ7 P;  2A06 E;  2WSC H;  1EDL A;  2ZVN B;  1S2E A;  4PD4 H;  1SVF A;  3FXD A;  3CWB D;  3M0A A;  3RK2 B;  3G71 P;  4HH2 A;  3AEF C;  1M1J A;  4IFF A;  1K9M Q;  1RF1 C;  4I6M C;  2KS1 B;  2PFX A;  5KJ7 D;  2XND H;  3KQG A;  1IO4 A;  1KIL C;  2QJY C;  1PL5 A;  5AVS B;  2KNC B;  2O3J A;  4L76 A;  1EDI A;  2G3A A;  3AEG C;  3Q5P A;  2OYI A;  1USD A;  3RK2 D;  2IYP A;  4D6T D;  3T97 A;  2B87 A;  1YTZ I;  1ZW0 A;  1E79 H;  2PAJ A;  2QJP B;  1LTG C;  1S4X A;  2R5B A;  1KYO D;  5E79 E;  2OTL P;  3H1H E;  2OYH A;  1WT6 A;  2K37 A;  3CCL P;  3AE4 C;  1BE3 D;  2E76 D;  2A45 H;  4PV1 C;  1NTK D;  2Y0C A;  3ZDM A;  1AVY A;  1NH4 A;  1L0L D;  1L4A A;  1PV3 A;  1SQB J;  2KP8 A;  1EXI A;  1VF5 D;  2M5A B;  1CZQ A;  1OW7 A;  2JDI H;  2WVR A;  3L75 J;  3KXD A;  3L73 E;  3AE9 C;  5BU5 A;  1URQ C;  4TT3 H;  3O8Z A;  1ZR4 A;  1N2D C;  1KQS O;  1LJ2 A;  5APT A;  1R5S A;  2P10 A;  1RF1 B;  4M3L A;  1RF1 A;  3CCV P;  2LXC B;  1VQ9 P;  1OWA A;  3CCS P;  1URQ D;  1FDO A;  1YJ9 P;  2WSE H;  2XU6 A;  1EZV D;  3HE4 A;  1T3U A;  3TGU E;  1RE3 C;  1VF5 C;  4N6J A;  1EZV G;  1NU1 E;  1XTC C;  3WMM 0;  1NOH A;  4W80 A;  1PPJ D;  3AEE C;  1EDK A;  1VPC A;  2OQQ A;  4IL6 E;  3H1I D;  1SQB K;  5AW5 B;  2YMK A;  1VQ5 P;  3L74 G;  1NAY A;  1DX7 A;  3V4W A;  2WSS H;  3BAT A;  2OYH C;  2IZ0 A;  1KTM A;  1KOR A;  2O01 J;  3IN6 A;  4PV1 B;  2E75 C;  3OW2 O;  1JB0 J;  1VQL P;  2M8R A;  3VYI A;  3R2P A;  3C9I A;  1HF9 A;  3BCC G;  4Z1M H;  3MUD A;  4BRY A;  1SQQ G;  1LTS C;  1OW6 A;  1P84 D;  2H8P D;  2ZYD A;  3VP9 A;  4BRY B;  4RJT A;  3BVH A;  1QL2 A;  1URQ A;  1M57 D;  3AE7 C;  2XNX A;  2Y0E A;  2WPV B;  4PD4 D;  1PIX A;  1LTA C;  1VQ4 P;  2UWJ E;  2HOD B;  2Z4E A;  1K8A Q;  2HOD A;  5AW2 B;  3BRT B;  2BEQ D;  4LC1 A;  3F5H A;  2KI7 B;  1SFC C;  3V2Q A;  5KAF E;  2Y9Z A;  3S4R A;  3JC2 2;  3GW6 A;  1BE3 J;  3L70 J;  1OFC X;  2M3B A;  2O1K A;  2V7Q J;  2KLU A;  3VN0 A;  1OW8 A;  1L4A D;  2H43 A;  2FFD A;  1TU3 F;  1QLE D;  1BDC A;  1DEB A;  1FJK A;  1NTM G;  2E5Y A;  1J1D B;  2O1J A;  2WZ7 A;  4I7Z C;  4C46 A;  1S9K D;  4I2L C;  2YKP A;  5KAI E;  1L0L K;  3JCU E;  4NPD A;  5AVU B;  1H8A A;  5B5E H;  1A02 F;  1M56 D;  1LTJ C;  1YJN P;  1XTG B;  3GHG B;  1KB9 E;  5KAI H;  1RQU A;  3GHG A;  2HG5 D;  5KLV J;  2MKV A;  3H1H D;  2FXO A;  4QMA A;  3RK3 D;  1HTL C;  1OXZ A;  2B88 A;  1FZB A;  3B5N B;  4DJG A;  1Q7Y Q;  1BE3 E;  2E74 D;  3H32 B;  2P67 A;  1W2E A;  3RK3 C;  3V5B A;  2Q5U A;  2JR8 A;  4N3Y B;  4D6T J;  2Q7C A;  3CCQ P;  1KD1 Q;  3A2A A;  3L73 D;  1MUU A;  3CMA P;  3RK2 C;  2IZ1 A;  2ZFC A;  2K88 A;  3BRV B;  1JEK A;  3V2N A;  1MFZ A;  1N7S B;  1SFC A;  1L0L J;  1SQB D;  2FXM A;  5KKZ C;  1W5C E;  1QGK B;  2KIK A;  3CXH E;  4HYT B;  2E5T A;  4BXL A;  3O6Q B;  5APU A;  1VQ8 P;  2NPS B;  2ZVO B;  4GOE A;  2N1T C;  5TIS E;  3RL0 g;  5BU8 B;  3M9H A;  4I7Z B;  3TGU D;  3D6Z A;  1J1D C;  1N7S C;  4LLH A;  3SWY A;  2QEX P;  1VQO P;  1JY2 P;  1SQV K;  2OTJ P;  1OVU A;  2JJL A;  3EFG A;  3SFE C;  5APS A;  1OX3 A;  3L74 J;  2ZJS E;  5APQ A;  2J58 A;  3L4F A;  1S5L E;  3LIE A;  1YYC A;  4A7P A;  4YXD C;  1JOC A;  2KLV A;  3JCU H;  4L74 A;  1H89 A;  1KB9 H;  2C9N Y;  2R3C A;  4RES B;  2FYZ A;  4Y28 J;  1K05 A;  1SQP J;  3I56 P;  4U3F E;  1FOS F;  1FOS E;  5KLV E;  4HB1 A;  4PJ0 H;  3I55 P; 
#chains in the Genus database with same CATH homology
 2YO3 A;  5CCG C;  2GUS A;  2VRS A;  4DOJ A;  1JY3 N;  3NXS A;  1G2C B;  2KOG A;  4Y99 C;  5AW0 B;  1NAF A;  1M1J C;  3VMZ A;  1GL2 A;  3KYQ A;  2KYV A;  3NTN A;  2P2U A;  4B86 A;  3RL0 B;  3CL3 D;  2P7J A;  3HUS B;  2HFE D;  1JUN A;  1IFD A;  1SFC D;  1RF0 C;  4WY4 B;  5APW A;  1HVV A;  3A7O A;  4WY4 A;  1GTW A;  1QL1 A;  5CJ0 A;  1KFN A;  5APY A;  3VMX A;  3A5T A;  4Y99 B;  3A3Y B;  3P32 A;  1LTI C;  4C7R A;  3HD7 C;  4ZKP A;  3TNU B;  3V2P A;  1N73 A;  2L5G B;  2XZR A;  4W7Z A;  3B5N A;  1JY3 P;  2Q3I A;  3UIA A;  3MTU E;  1FBM A;  1NTZ K;  5AW6 B;  1FZG A;  1T2K D;  2Q9I A;  3VMY A;  1FZF A;  1ZN5 A;  2YNY A;  1MV8 A;  1KIL D;  5AW3 B;  1AFO A;  5AVV B;  1NKN A;  3I5C A;  1HUC A;  1GU5 A;  2Z5H A;  1N73 C;  1LTJ A;  1L0N K;  1SQP K;  3P7K A;  1ZR2 A;  3P8M C;  2C9L Y;  3B5N C;  1KIL B;  3HE5 A;  1JCD A;  2YMY A;  1NWQ A;  3RK3 B;  1VDF A;  1J1E C;  5AW7 B;  3HTK A;  1G1J A;  1LTT C;  4I1L A;  2YO2 A;  2E43 A;  3NMD A;  2HPC B;  1JCC A;  1NHL A;  1G2C A;  3P8C D;  3N7N A;  2IPP A;  5BVZ A;  1IK9 A;  2N1T A;  1N7L A;  2WPS A;  1KZU B;  2C0W A;  2QM8 A;  3V2R A;  1SLQ A;  5APX A;  2N1T D;  2Z5I A;  1LT9 A;  3HUS A;  1ZV8 A;  4XE5 B;  1CW5 A;  1CI6 B;  1WRG A;  2HLO A;  3EQ2 A;  5CMZ A;  1RE4 A;  1KFM A;  2KB7 P;  2CPS A;  1N7S A;  1NKZ B;  1FU1 A;  1GD2 E;  2QM7 A;  2P1J A;  3OJA B;  2OYI C;  2KSJ A;  1X8Y A;  3U1A A;  1L4A B;  3LW5 H;  1GL2 C;  3RL0 C;  1RE3 A;  3MIW A;  3IFM A;  1SQQ K;  1CSB A;  4JYC A;  3TSI A;  1L4A C;  1JO5 A;  5AW8 B;  3HE4 B;  5CCH C;  3SWF A;  1IFN A;  3MD0 A;  1RE4 C;  1YTZ T;  1Z56 A;  4WY4 C;  1JNM A;  2LKM A;  3L36 A;  1GU4 A;  3IR9 A;  4N78 E;  4O9B A;  3VOP A;  1NTM K;  2YKQ A;  3KDP B;  1URQ B;  5KJ7 C;  2W6B A;  5AVQ B;  2IFN A;  1LTB C;  1HBW A;  5AVX B;  5AVR B;  1T3J A;  1JMM A;  2R5D A;  3L37 A;  5AVW B;  2FFD C;  3M06 A;  1FZE A;  1HWT C;  1N7S D;  2R32 A;  3H6P A;  4AYC A;  1FJP A;  1GK6 A;  2FFD B;  1H88 A;  2I1J A;  3M0D C;  1LWU C;  3E1I A;  3M9Q A;  1N73 B;  1NTK K;  1PFI A;  3B8E B;  2PP6 A;  1SQX K;  2WT7 B;  1RY3 A;  2WT7 A;  1MZ9 A;  2WWW A;  4WY4 D;  1LT9 B;  3H32 A;  1J1E B;  2NPS D;  3TK1 A;  1M7L A;  1CI6 A;  2FYU K;  1FZC C;  4JF7 A;  5AVZ B;  2N9B A;  4JYB A;  5CHX A;  1G1I A;  1IC2 A;  4GT1 A;  1GW3 A;  4WBA A;  1KQL A;  2E42 A;  1AQ5 A;  2C0X A;  2NPS A;  3KPE A;  2XDJ A;  1LWU B;  3B5N D;  2MJZ A;  1LWU A;  1IFM A;  2WPR A;  2GUV A;  1A02 J;  3PP5 A;  2H7H A;  2J59 M;  1T8Z A;  2IX7 C;  5CCG A;  1KIL A;  3HE5 B;  3OAK A;  3U59 A;  4C7N A;  3HTK B;  4C7N B;  2A45 G;  1HH0 A;  1JY2 N;  1FZC A;  5KLV K;  5AW4 B;  1GZL A;  3P8C E;  2XKM A;  1FAV A;  2BAS A;  3MGN A;  4XA4 A;  4KHX A;  1IFJ A;  2WTY A;  4OH8 B;  1JY3 O;  1IFI A;  1NU1 K;  4IFD K;  4AQR D;  3HUS C;  1FDM A;  2CPB A;  2OAR A;  1M1J B;  4DZO A;  3CLQ A;  2OYI B;  2GM4 A;  4EIJ A;  3VP8 A;  2YKO A;  3BAS A;  3HD7 A;  2WPQ A;  1ZLL A;  3HD7 B;  2XV5 A;  2I1K A;  2JEE A;  2OYH B;  5CJ4 A;  1RF0 A;  2W27 A;  3TNU A;  3U1C A;  1JTH A;  2HYN A;  3CI9 A;  5CCG D;  2WSF H;  1JTH B;  4GIF A;  5APV A;  1EQ7 A;  1FZA A;  1X79 B;  1S9K E;  5CCH A;  3HD7 D;  1LGH B;  4IFM A;  1GL2 D;  4WB4 A;  1IJD B;  5KJ7 A;  4EOT A;  2W6A A;  1E5W A;  1T2K C;  3GHG C;  2O01 H;  4ZKU A;  2ZXE B;  5CCH D;  3M91 A;  4W7Y A;  1J2J B;  1DH3 A;  1SFC B;  4GKG A;  3G3Z A;  4N78 D;  3LID A;  1HJB A;  3M0D A;  3RL0 D;  3L35 A;  2A45 I;  1SP4 A;  2WIT A;  3TYY A;  1N86 A;  1LTJ B;  3M9B A;  3II6 A;  1GW4 A;  1HGV A;  1JY2 O;  1HGZ A;  5AW1 B;  4LGD E;  5KTB A;  1GK4 A;  3V4Q A;  1NO4 A;  3OA7 A;  5AVY B;  5AW9 B;  1FZC B;  5AVT B;  2IFM A;  2HPC A;  3N4X A;  2POH A;  2FKW B;  3NFQ A;  3HRN A;  2NPS C;  1GDT A;  2N1T B;  4AUW A;  1LT9 C;  1X9V A;  3VTP C;  1GL2 B;  2WSC H;  1SVF A;  3M0A A;  3RK2 B;  4HH2 A;  1M1J A;  4IFF A;  1RF1 C;  4I6M C;  5KJ7 D;  3KQG A;  1IO4 A;  1KIL C;  5AVS B;  2OYI A;  3RK2 D;  3T97 A;  1YTZ I;  2PAJ A;  1LTG C;  2R5B A;  2OYH A;  1WT6 A;  2A45 H;  1NH4 A;  1L4A A;  2KP8 A;  1CZQ A;  5BU5 A;  1URQ C;  3O8Z A;  1ZR4 A;  1N2D C;  5APT A;  1RF1 B;  4M3L A;  1RF1 A;  1OWA A;  1URQ D;  2WSE H;  2XU6 A;  3HE4 A;  1T3U A;  1RE3 C;  4N6J A;  1XTC C;  3WMM 0;  1NOH A;  4W80 A;  1VPC A;  1SQB K;  5AW5 B;  1DX7 A;  3V4W A;  3BAT A;  2OYH C;  2M8R A;  3VYI A;  3R2P A;  3C9I A;  3MUD A;  1LTS C;  2H8P D;  3VP9 A;  3BVH A;  1QL2 A;  1URQ A;  2XNX A;  1LTA C;  2HOD B;  2Z4E A;  2HOD A;  5AW2 B;  3BRT B;  4LC1 A;  1SFC C;  3V2Q A;  2M3B A;  2O1K A;  3VN0 A;  2H43 A;  1L4A D;  2FFD A;  1DEB A;  1FJK A;  2O1J A;  1J1D B;  2WZ7 A;  4C46 A;  1S9K D;  4I2L C;  2YKP A;  1L0L K;  5AVU B;  1H8A A;  1A02 F;  1LTJ C;  1XTG B;  3GHG B;  3GHG A;  2HG5 D;  3RK3 D;  1HTL C;  1OXZ A;  3B5N B;  1FZB A;  3V5B A;  3H32 B;  2P67 A;  1W2E A;  3RK3 C;  2Q5U A;  4N3Y B;  2Q7C A;  3A2A A;  1MUU A;  3RK2 C;  2ZFC A;  3BRV B;  3V2N A;  1MFZ A;  1N7S B;  1SFC A;  2FXM A;  4HYT B;  5APU A;  2NPS B;  2N1T C;  5BU8 B;  3M9H A;  1J1D C;  1N7S C;  4LLH A;  3SWY A;  1JY2 P;  1SQV K;  2JJL A;  3EFG A;  5APS A;  5APQ A;  2J58 A;  3L4F A;  3LIE A;  1YYC A;  1JOC A;  2KLV A;  1H89 A;  2C9N Y;  2R3C A;  4RES B;  2FYZ A;  1FOS F;  1FOS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...