2O1JA

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
44
structure length
44
Chain Sequence
IETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4
rcsb
source organism Rotavirus str.
molecule tags Viral protein
molecule keywords Nonstructural protein NSP4
total genus 16
structure length 44
sequence length 44
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o1jA00
2O1JA 1G1IA 4LLHA 2L5GB 1G1JA 2WITA 4WB4A 2O1KA 3MIWA 4C7RA 4DOJA 4WBAA 3CI9A 4HH2A
chains in the Genus database with same CATH superfamily
1M1JB 1OXZA 1EQ7A 2WSEH 3H1HE 3MIWA 3B8EB 4ASVA 3G3ZA 3A0BE 3VMZA 3Q5PA 4JQ0D 4OGQC 1FOSF 1BDCA 1XTCC 4H0LD 3L72D 4IFFA 4OGQD 5KLVJ 1SQQD 2AEFA 1L0LE 1M7LA 2JWAA 2IBZI 2E43A 2A45H 1NO4A 3TSIA 1SVFA 3U59A 5KAFH 1T2KD 1FDMA 4RKUJ 3L72J 3CD6P 1JMBA 3GHGC 1H89A 3B5ND 4M3LA 1NTZJ 1BGYG 2KNCA 3H1JD 1USDA 3RBZA 1T3UA 2FYZA 2AXTE 5AW2B 2W8ZA 1LT9A 4U7JA 1MKMA 1FE6A 2YXRB 1ZR4A 2K3RA 3M9QA 1JY3P 1T8ZA 3L74D 4IFDK 2QSIA 3EQ2A 3SWYA 3CLQA 5CJ0A 1EC5A 1L0ND 3FWLA 4IL6H 3RL0C 2W83C 1HJBA 5CJ4A 1SQXG 2IDBA 3TNUA 2KZIA 4I7ZB 3RL0D 4HYTB 1KILD 2HYNA 4Y28J 1AFOA 1BE3D 5BU5A 3C9IA 5DJUB 1SQXE 4YPCA 3A2AA 3RGUA 1X0TA 4H44B 1CI6B 1S1CX 3WUTA 1DH3A 5CCHA 2R44A 2HG5D 3ABVC 1VQOP 2LXBA 1MZ9A 2HFED 2ZYGA 3CXHE 1VQ4P 2IYPA 2C0WA 2OARA 1AQTA 1KQGB 5KJ7D 1G1IA 3V6IA 5AW6B 5B5EE 1ZR2A 1SQPK 3GF7A 1ZV8A 3L75E 2WPVB 1GZLA 1IZNB 3AEAC 1JY2N 1MV8A 1BE3G 1ZW0A 4BRYB 5KAIE 2M3BA 1W2BO 5EFWB 1VQ7P 1P84I 2JR8A 3VMXA 1K9MQ 5CCGD 2FXPA 2JJLA 5KLIC 1X8YA 3O8ZA 1KTMA 1ZN5A 2P2UA 3H1KD 1M57D 1YI2P 1SQQK 3HD7B 4CPGA 5KKZB 3MHVA 1NH4A 3RL0B 5CBOA 3KXDA 2N1TD 4L73A 1YJWP 3HTKA 1BE3J 1PGJA 1SQPJ 2WQYC 1E79H 4K35A 5AVUB 3WUUA 2NPSD 3R2PA 4EIJA 1U57A 3SFEC 1GL2D 3VYIA 1TU3F 4W7YA 2P10A 2ZYAA 4YTPC 3B5NC 2QG4A 3NTNA 2XV5A 3TF5A 1GL2C 2YXQB 1KILC 1JOCA 3H1HG 1LT1A 2OYOA 2R3CA 3RK2C 3A7OA 1H0TA 4U3FD 5AW5B 3H32B 3VN0A 4U3FJ 2G3AA 1M1KQ 1RE3A 1NKNA 3L37A 5APWA 1OZHA 1PGOA 1RQUA 2HLOA 3P8CD 3CPWO 4W7ZA 2QA4P 2J59M 3I5CA 1K04A 1N73A 1OW8A 3FX0A 1WRGA 3H1JJ 1EZVE 2AXCA 2YMKA 4HJGH 5AW7B 1J1DC 3L73E 5AW0B 3CWBJ 1H8AA 1PFIA 2FYUK 1KQFB 4GKGA 3AE8C 4H13B 3T97B 1PPJG 2W90A 3VP9A 2KS1A 2AXTH 2C0XA 2FXMA 4ZKUA 3CCUP 2YKQA 1P84E 3O6QB 3OJAB 2C9LY 3C8VA 1YTZT 3P7KA 2P58A 1EXIA 4PJ0E 1KB9D 1NAYA 4ASWA 4O9BA 3CCMP 2KZJA 2N9YB 4JYBA 1L0NJ 2PRRA 1LWUB 4EYYQ 2BCCG 3CX5D 5CCGC 3USSA 3Q2YA 1IO4A 3H1KE 2XZRA 3AE5C 2H7HA 1NHLA 3H1ID 3TNUB 2FFDA 1RQVA 1ZMEC 2QRXA 2H89C 1QGKB 2NPSC 2KLUA 4UB6E 3IF4A 3V2PA 2Y0CA 1JB0J 1VQ9P 3B4SA 2OTKE 5GTIH 1X79B 1SQVE 1S9KD 1RHZB 3EFGA 4DT0A 1SQXK 1KV4A 1IFDA 2Q3IA 3CXHH 3VMAA 1H0TB 3L70D 4GIFA 3L70E 1FJKA 4EI2A 2R32A 1AV1A 2ZVOB 3M91A 3F89A 3RK2D 3RK3C 4DJGA 1D7MA 4C7RA 3IAOA 1YITP 2C9NY 1L0LK 1URQD 3M9BA 4UB8E 2ZAEB 2KP8A 1NOHA 3M06A 4WY4B 1L0NE 3A3YB 2OYHC 1QL1A 1IK7A 1Q2NA 1QX8A 1FBMA 3CCRP 2E42A 1VPCA 1YYCA 4EDFA 1KILE 1S72P 3CMEP 1SFCC 1BCCD 1BCCE 3L74G 1LWUA 4LLHA 1BGYJ 3CMAP 1LTJB 2JEEA 2WSFJ 3PJSK 3JC22 1LJ2A 1P84D 2OQQA 1WT6A 2JP3A 3CXHI 1JY2O 1SFCA 4GDOA 4HKZH 4I6MC 1RY3A 4AYCA 5TISH 3V4QA 3PLNA 2XKMA 2D2CB 3Q5SA 2OYIA 2YKPA 3GHGA 1W2EA 1QVGO 1S4XA 3CWBG 1GK6A 2WPQA 2OYHA 1EZVD 2FKWB 1J1DB 2ZT9B 2WTYA 4H0LC 2IPPA 3PTZA 5AVYB 2B87A 2Q3EA 2O01J 1Y9BA 2O01H 5AVRB 3H6PA 1J1EC 3MUDC 1JCDA 3AE2C 2WSCJ 3L71E 1URQB 3E1IA 1SQVJ 2O3JA 1FZCB 1HJ0A 5APSA 3BCCE 1YJNP 1BE3E 3M0AA 1H88A 1HF9A 3K5BA 3L75G 1USEA 3AE1C 5H2FE 1P84H 3H25A 4I7ZC 4KT0J 3D71A 1RF1C 3I55P 4IL6X 4YXDC 5CCGA 4AQRD 2FYUJ 5C39A 3RBXA 5AVZB 2P7JA 1SP4A 3HD7C 3LIDA 4TT3H 3V4WA 1FZFA 4PV1C 1LT9B 2QM8A 2UWJE 3P8MC 3BCCJ 3II6A 1L0NG 1RE4C 1VF5C 2IBZE 3EWKA 2BEZF 4PV1D 1LTTC 3TDKA 3AEEC 2DW3A 2E5YA 3L71J 3PRJA 3MTUE 2OYHB 1NTKG 2ZT9D 1JMMA 1SFCD 3MUDA 2CPSA 3IFMA 4H13C 3GLMA 2I1KA 4IFMA 4JF7A 4XFJA 3L71D 3A0HE 1L4AD 2PAJA 2H8PD 1HBWA 2K1AA 3HRNA 5KLVK 2FYNC 3H1LD 3L73J 1BDDA 1LP1B 3WU2E 1AVYA 1SQVG 2WWWA 2M0BA 1SS1A 1RE3C 1X22A 2R3SA 5APTA 2A06G 1RH5B 1AQ5A 2BEQD 4H44C 3M0DA 5K5GB 4JYCA 5AVTB 2KOGA 3P32A 2LXCB 4XE5B 4BRYA 3UIAA 1BGYE 1SQQG 1JEKA 2O1JA 1T2KC 1BCCJ 1LWUC 2IBZD 3V5BA 1NTZD 1M1JC 1CZQA 1QEXA 3HE4B 4D6TD 4ZNCA 1MFTA 1A02J 1NGMB 1SQPE 4BWNA 1SQPD 2HPCB 1VQ6P 1PGQA 3E1RA 3N7NA 1NU1K 3CCQP 2FYUE 1JTHB 1U7MA 2HPCA 3NMDA 2XNDH 5APQA 1HH0A 2N1TC 1JY3N 1PPJE 1JY3O 3R4YA 2W6JH 2P1JA 3HTKB 5KAIH 1GU4A 1W5CE 3W67A 3FXEA 2E5TA 2LR2A 3BCCD 3L70J 4HB1A 1QVFO 2ZFCA 3WMM0 2K9YA 2ZYDA 3L73G 4OVNF 3V2RA 3I56P 3G4SP 1YBKA 1VDFA 2WSEJ 1LNQA 2O01N 2HR3A 2G8YA 2GA1A 1N7LA 1L0LJ 3KPEA 4ZKPA 3RK3D 1DX7A 3FWNA 3MGNA 1QL2A 1L0LD 2D2CD 2QJPB 2ZT9C 1XTGB 1OIPA 1LTIC 1YQ3C 4H13D 4Y99B 1NU1G 1N7SD 2K37A 2RN0A 3S9OA 2V7QJ 1QLED 2PFXA 1SLQA 1NTMG 1GK4A 1Q86Q 1KQSO 2FFDC 3BCCG 1DIPA 2WSCH 3BVHA 2KS1B 3AEGC 3H1IE 3C1LA 1R8EA 2Q1KA 1YTZI 3CX5E 2WMMA 2YO3A 2ZJSE 2QIWA 1FDOA 1FJPA 4H44D 1EDJA 3OAKA 1M90Q 1IFMA 4PD4E 1PP9G 2QE7H 4JPZB 1VQNP 1Q81Q 2QEXP 3CWBE 3KYQA 4XA4A 3AEFC 3H1JE 4HH2A 5GTHH 1KORA 3AE9C 3CC2P 3VP8A 2WSFH 1N2DC 1IC2A 3KDPB 2Q7CA 1KZUB 1KYOD 1SQBD 3LW5J 3W68A 4DCKA 1BSHA 2B9BA 2KSJA 3A0HH 4PJ0H 4I1LA 1S3JA 3PP5A 2OGUA 5AVSB 3P8CE 1UIIA 3WU2H 1VQKP 3H1LG 1VQLP 1GL2A 2QM7A 3SSUA 1YHQP 1YIJP 1Y47A 2V7QH 1PP9D 4L76A 2D2CC 2WITA 3B5NB 3HUSA 1L4AC 3N4XA 3VTPC 4OGQB 2W6AA 1FZCA 5KLVE 5KLVG 3CC4P 5KTBA 1L0NK 2AEMA 5AVVB 2E76D 1GTWA 2MKVA 1Z56A 2PP6A 3G9RA 2PGDA 4WVZA 1NAFA 4D6TJ 5M1BA 2CPBA 3H1KJ 4GODA 1NTKK 1NWQA 1SFCB 4R4MA 1IJDB 4A7PA 1E5WA 1RE4A 4L74A 2FY8A 3CCVP 2RMZA 1EXJA 2Z5HA 1LTAC 2ITAA 2R5BA 1DEEG 4TLFA 1JM0A 1KYOH 3L75J 5E79E 1SQVK 3D6ZA 3LW5H 2OYIB 1U7JA 2ZVNB 4RJTA 4UB8H 4KJMA 3U1AA 1CI6A 2QJYB 2QJPC 2Q9IA 1ZLLA 5B66E 3IR9A 4WB4A 1NJIQ 1KFNA 1FS0E 1ZRTD 3KZIE 1HVVA 3L73D 3NFQA 1OVVA 2E76B 3E7KA 3H32A 4R4LA 3Q3DA 2FXOA 1MUUA 3CL3D 4QMAA 2LKMA 1FU1A 1RF0C 1KQLA 3TGUJ 3RK3E 1J2JB 2FBWC 2GUSA 2NRGA 4U3FE 3TGUD 1R5LA 2A45I 2XU6A 3G6EP 1KB9I 2BCCD 3OW2O 1PP9J 1YJ9P 2POHA 3CWBD 3PH0A 2OTLP 4GT1A 2O1KA 1IFNA 3VMYA 2Y0EA 3A0BH 5BU8B 1GU5A 3RL0g 1GD2E 1AJYA 1NU1E 1NTME 2IX7C 2WPSA 1G2CB 1VL2A 1FZAA 2KB7P 1SQBG 3JCUE 4I2LC 4Z1MH 2M3EA 3GG2A 2OYIC 2B89A 2QJKC 1KB9E 2E74D 4L75A 1BCCG 3L74E 3A5TA 1NVOA 2KLVA 1LT9C 2QVAA 2KIKA 2RH0A 4PD4H 2A06D 2YO2A 3AE4C 3HD7D 1DEBA 1PIXA 2K88A 3BATA 5APYA 1JNMA 1NKZB 1KD1Q 1JO5A 1NTZE 2IFNA 2WSSH 1CSBA 2JWDA 4OH8B 1Q7YQ 1YQ4C 5AW8B 2JO1A 3AECC 1OVUA 1NU1D 1KMIZ 2MJZA 3MZWB 1S2EA 2JDIH 2R5DA 1GMJA 1NTMK 2GUVA 3GHGB 3M9HA 4U3FG 5H2FH 3U1CA 1FDIA 3BRVB 1LP1A 3L70G 1PGPA 1SQBK 1N73B 1S5LH 3EFFK 3CXHD 4Y99C 2Y9ZA 3RK2B 2I8DA 3IN6A 1OW6A 1HTLC 4N6JA 4WBAA 1SQQE 2YIUB 4N78D 2WT7B 3T97A 3H1HJ 2GM4A 5DJTB 2Q6QA 2Y9YA 1SQXJ 1EZVI 1ZXGA 3ITKA 3HE5A 3ZDMA 2NPSA 1LTBC 4WY4A 1IFPA 3H1KG 2OTJP 2A06E 2E74B 4JBZA 1OMIA 2SPZA 3S1KA 4D6TG 2IZ0A 1G2CA 2QJKB 1JTHA 5CBNA 1Q82Q 3CCSP 1GDTA 3D70A 1Y8AA 4C7NA 5B5EH 1DD4A 5CHXA 1K73Q 1L4AA 2E74C 2E75D 2L91A 3HUSC 5KLIB 1FZCC 2HODB 4WWIA 2H43A 1VQ8P 3L36A 4LGDE 5KLVD 1KN7A 1NTKE 1SQQJ 4B86A 2P67A 4N3YB 2KYVA 1NTZG 4RO0A 2B87B 3D6YA 1N7SA 1EZVG 2IBZG 3KZIH 1VQMP 2FFDB 1WMKA 1BSNA 3GW6A 3H1LE 1X9VA 4K3AA 3V2QA 1KC8Q 1AVOA 1M56D 2A45G 3L72E 3BASA 3SWKA 1N73C 3TGUG 3OA7A 1SQBE 3GF3A 4NPEA 3FXDA 1SQXD 3H1HD 2E76C 1N8RQ 1N7SC 2YNYA 1S5LX 2IFMA 3TYYA 5L8RJ 1G1JA 3Q5RA 1VQ5P 1LTJA 3SWFA 1Q90D 1KILA 5APXA 2Z4EA 1NYHA 2B88A 1NTKJ 2KK7A 3B5NA 2M8RA 3HUSB 2ZXXA 2M5AB 3L71G 4RESB 3JCUH 1K8AQ 1NTZK 2W27A 1MFZA 2N1TB 4OWFA 1FAVA 5AW9B 4DZOA 3CCLP 1K05A 3L4FA 1KB9H 1FOSE 2IZ1A 3S4RA 4PV1B 4PD4D 1JCCA 1NU1J 3G71P 2KI7B 2V4HA 1ZP0C 3F5HA 2WPRA 3CCEP 3AE6C 5KJ7A 3AE7C 3LIEA 1FZGA 1LGHB 2HODA 4C7NB 3CI9A 1OFCX 1NTMD 1L4AB 2KSEA 4ZMDA 5CMZA 2YMYA 3CX5H 3QWOC 4N78E 3TGUE 4C46A 1IK9A 3MP7B 4KHXA 1URQA 1PL5A 1T3JA 3GMAA 3L72G 3L75D 2E75C 3PHLA 2KXPB 4GOFA 1URQC 5KAFE 3Q1MA 2Q5UA 1KYOI 1S5LE 2KUBA 4PD4I 3CCJP 1ZRTE 4NPDA 1DD3A 2FYNB 1R5SA 2NZ2A 1OVRA 3AE3C 5CCHD 5KJ7C 2N1TA 5APVA 4YXWH 5CCHC 5GTHE 2BCCJ 2M5AA 2QJYC 2Y0DA 4AUWA 2J5UA 2WZ7A 4LC1A 1GW4A 5AW1B 2WVRA 1KILB 2RKLA 3JSVC 4UB6H 3SFDC 2WT7A 4EOTA 2FYUG 2XNXA 3MD0A 1M1JA 5GTIE 1UIXA 4W80A 1PPJD 1VF5B 1A02F 1JUNA 1HUCA 1LTSC 1SQPG 2VRSA 2XDJA 2ZXEB 2YKOA 3KHUA 3WUVA 4IL6E 4D6TE 1IFIA 1EDLA 3O6QA 4IOIH 1LTJC 1PZQA 2K9JA 2JKVA 3L74J 3M0DC 2BASA 5TJHA 5BVZA 1FZBA 1RF1B 1ZOYC 1VQPP 4BXLA 1JY2P 1SQBJ 4DOJA 1CW5A 1N7SB 3H1JG 1NTMJ 2H88C 1BGYD 1FC2C 3AEBC 2BCCE 3B71A 1OW7A 3KQGA 5AW4B 4GOEA 3TK1A 3QH9A 2YIUC 3H1LJ 5AVWB 4H0LB 4NPFX 1PP9E 1SQVD 2Z5IA 3BRTB 3RK3B 1S9KE 1LTGC 2E75B 1J1EB 3V2NA 1HGZA 1GL2B 1OWAA 2AEJA 1HGVA 1L2PA 1RF0A 3FGAD 3CC7P 1KYOE 1L0LG 1FZEA 5E79H 5TISE 5B66H 1M8OB 1NTKD 1PV3A 3H1IG 5AVXB 2J58A 2W6BA 2L5GB 1EDIA 1N86A 3HE5B 4MN4C 2IYOA 2NPSB 2N9BA 3HD7A 1VF5D 5KKZC 1AA0A 3AEDC 1EDKA 5APUA 3NXSA 2I1JA 1IFJA 2FYUD 1T6AA 2KNCB 3L35A 1RF1A 1HWTC 3CX5I 4WY4D 2K9JB 3HE4A 1GW3A 5AW3B 1KFMA 4WY4C 3VOPA 5AVQB 1OX3A 3H1IJ 2CK3H
chains in the Genus database with same CATH topology
1M1JB 1OXZA 1EQ7A 2WSEH 3MIWA 3B8EB 3G3ZA 1FOSF 3VMZA 1XTCC 4IFFA 1M7LA 2E43A 2A45H 1NO4A 3TSIA 1SVFA 3U59A 1T2KD 1FDMA 3GHGC 1H89A 3B5ND 4M3LA 1T3UA 2FYZA 5AW2B 1LT9A 1ZR4A 3M9QA 1JY3P 1T8ZA 4IFDK 3SWYA 3EQ2A 3CLQA 5CJ0A 3RL0C 5CJ4A 3TNUA 3RL0D 4HYTB 1KILD 2HYNA 1AFOA 5BU5A 3C9IA 3A2AA 1DH3A 1CI6B 5CCHA 2HG5D 1MZ9A 2HFED 2C0WA 2OARA 5KJ7D 1ZR2A 1G1IA 5AW6B 1SQPK 1ZV8A 1GZLA 1JY2N 1MV8A 2M3BA 3VMXA 5CCGD 2JJLA 1X8YA 3O8ZA 1ZN5A 2P2UA 1SQQK 3HD7B 1NH4A 3RL0B 2N1TD 3HTKA 5AVUB 4EIJA 2NPSD 3R2PA 1HJBA 3VYIA 1GL2D 4W7YA 3B5NC 3NTNA 2XV5A 1GL2C 1KILC 1JOCA 3RK2C 2R3CA 3A7OA 5AW5B 3H32B 3VN0A 1RE3A 1NKNA 3L37A 5APWA 3P8CD 2HLOA 4W7ZA 2J59M 3I5CA 1N73A 1WRGA 5AW7B 1J1DC 5AW0B 1PFIA 1H8AA 2FYUK 4GKGA 3VP9A 2C0XA 2FXMA 4ZKUA 2YKQA 3OJAB 2C9LY 3P7KA 1YTZT 4O9BA 4JYBA 1LWUB 5CCGC 1IO4A 2XZRA 2H7HA 1NHLA 2FFDA 3TNUB 2NPSC 3V2PA 1X79B 1S9KD 3EFGA 1SQXK 1IFDA 2Q3IA 4GIFA 1FJKA 2R32A 3RK2D 3M91A 3RK3C 4C7RA 2C9NY 1L0LK 1URQD 3M9BA 2OYHC 2KP8A 1NOHA 3M06A 4WY4B 3A3YB 1QL1A 1FBMA 2E42A 1VPCA 1YYCA 1SFCC 1LWUA 4LLHA 1LTJB 2JEEA 1CW5A 1WT6A 1JY2O 1SFCA 4I6MC 1RY3A 4AYCA 3V4QA 2XKMA 2OYIA 2YKPA 3GHGA 1W2EA 1GK6A 2WPQA 2OYHA 2FKWB 1J1DB 2IPPA 5AVYB 2O01H 5AVRB 3H6PA 1J1EC 1JCDA 1URQB 3E1IA 1FZCB 5APSA 3M0AA 1H88A 1RF1C 5CCGA 4AQRD 5AVZB 2P7JA 1SP4A 3HD7C 3LIDA 3V4WA 1FZFA 1LT9B 2QM8A 3P8MC 3II6A 1RE4C 1LTTC 3MTUE 2OYHB 1JMMA 3MUDA 1SFCD 2CPSA 3IFMA 4IFMA 2I1KA 4JF7A 1L4AD 2PAJA 2H8PD 1HBWA 5KLVK 3HRNA 2WWWA 5APTA 1RE3C 1AQ5A 3M0DA 4JYCA 5AVTB 2KOGA 3P32A 4XE5B 3UIAA 1T2KC 2O1JA 1LWUC 3V5BA 1M1JC 1CZQA 3HE4B 1A02J 2HPCB 3N7NA 1NU1K 2HPCA 1JTHB 3NMDA 5APQA 1HH0A 2N1TC 1JY3N 1JY3O 2P1JA 3HTKB 1GU4A 2ZFCA 3WMM0 3V2RA 1VDFA 1N7LA 3KPEA 4ZKPA 1DX7A 3RK3D 3MGNA 1QL2A 1XTGB 4Y99B 1LTIC 1N7SD 2FFDC 1SLQA 1GK4A 2WSCH 3BVHA 1YTZI 2YO3A 1FJPA 3OAKA 1IFMA 3KYQA 4XA4A 4HH2A 3VP8A 2WSFH 1N2DC 1IC2A 3KDPB 2Q7CA 1KZUB 2KSJA 4I1LA 3PP5A 5AVSB 3P8CE 1GL2A 2QM7A 3VTPC 2WITA 3B5NB 3HUSA 1L4AC 3N4XA 1FZCA 2W6AA 5KTBA 1L0NK 5AVVB 1GTWA 1Z56A 2PP6A 1NAFA 2CPBA 1NTKK 1NWQA 1SFCB 1IJDB 1E5WA 1RE4A 2Z5HA 1LTAC 2R5BA 2OYIB 1SQVK 3LW5H 3U1AA 1CI6A 2Q9IA 1ZLLA 3IR9A 4WB4A 1KFNA 1HVVA 3NFQA 3H32A 1MUUA 3CL3D 2LKMA 1FU1A 1RF0C 1KQLA 1J2JB 2GUSA 2A45I 2XU6A 2POHA 4GT1A 2O1KA 1IFNA 3VMYA 5BU8B 1GU5A 1GD2E 2IX7C 2WPSA 1G2CB 1FZAA 2KB7P 4I2LC 2OYIC 3A5TA 2KLVA 1LT9C 3HD7D 2YO2A 1JNMA 1DEBA 3BATA 5APYA 1JO5A 1NKZB 2IFNA 1CSBA 4OH8B 5AW8B 2MJZA 2R5DA 1NTMK 2GUVA 3GHGB 3M9HA 3U1CA 3BRVB 1SQBK 1N73B 4Y99C 3RK2B 4N6JA 1HTLC 4WBAA 2WT7B 4N78D 2GM4A 3T97A 3HE5A 2NPSA 1LTBC 4WY4A 1GDTA 1G2CA 1JTHA 4C7NA 5CHXA 1L4AA 3HUSC 1FZCC 2HODB 2H43A 3L36A 4LGDE 4B86A 2P67A 4N3YB 2KYVA 1N7SA 2FFDB 3V2QA 1X9VA 2A45G 3BASA 1N73C 3OA7A 1N7SC 2YNYA 2IFMA 3TYYA 1G1JA 1LTJA 3SWFA 1KILA 5APXA 2Z4EA 3B5NA 2M8RA 3HUSB 4RESB 1NTZK 2W27A 1MFZA 2N1TB 4DZOA 1FAVA 5AW9B 3L4FA 1FOSE 1JCCA 2WPRA 5KJ7A 3LIEA 1FZGA 1LGHB 2HODA 4C7NB 3CI9A 1L4AB 5CMZA 2YMYA 4N78E 4C46A 1IK9A 4KHXA 1URQA 1T3JA 1URQC 2Q5UA 5CCHD 5KJ7C 2N1TA 5APVA 5CCHC 4AUWA 2WZ7A 4LC1A 1GW4A 5AW1B 2WT7A 1KILB 4EOTA 2XNXA 3MD0A 1M1JA 1A02F 1JUNA 4W80A 1HUCA 1LTSC 2VRSA 2XDJA 2ZXEB 2YKOA 1IFIA 1LTJC 3M0DC 2BASA 5BVZA 1FZBA 1RF1B 1JY2P 4DOJA 1N7SB 2WTYA 3KQGA 5AW4B 3TK1A 5AVWB 3RK3B 1S9KE 2Z5IA 3BRTB 1LTGC 1J1EB 3V2NA 1HGZA 1GL2B 1OWAA 1HGVA 1RF0A 1FZEA 5AVXB 2J58A 2W6BA 2L5GB 3HE5B 1N86A 2NPSB 2N9BA 3HD7A 5APUA 3NXSA 2I1JA 1IFJA 3L35A 1RF1A 1HWTC 4WY4D 3HE4A 1GW3A 5AW3B 1KFMA 4WY4C 3VOPA 5AVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1J A;  1G1I A;  4LLH A;  2L5G B;  1G1J A;  2WIT A;  4WB4 A;  2O1K A;  3MIW A;  4C7R A;  4DOJ A;  4WBA A;  3CI9 A;  4HH2 A; 
#chains in the Genus database with same CATH topology
 1M1J B;  1OXZ A;  1EQ7 A;  2WSE H;  3H1H E;  3MIW A;  3B8E B;  4ASV A;  3G3Z A;  3A0B E;  3VMZ A;  3Q5P A;  4JQ0 D;  4OGQ C;  1FOS F;  1BDC A;  1XTC C;  4H0L D;  3L72 D;  4IFF A;  4OGQ D;  5KLV J;  1SQQ D;  2AEF A;  1L0L E;  1M7L A;  2JWA A;  2IBZ I;  2E43 A;  2A45 H;  1NO4 A;  3TSI A;  1SVF A;  3U59 A;  5KAF H;  1T2K D;  1FDM A;  4RKU J;  3L72 J;  3CD6 P;  1JMB A;  3GHG C;  1H89 A;  3B5N D;  4M3L A;  1NTZ J;  1BGY G;  2KNC A;  3H1J D;  1USD A;  3RBZ A;  1T3U A;  2FYZ A;  2AXT E;  5AW2 B;  2W8Z A;  1LT9 A;  4U7J A;  1MKM A;  1FE6 A;  2YXR B;  1ZR4 A;  2K3R A;  3M9Q A;  1JY3 P;  1T8Z A;  3L74 D;  4IFD K;  2QSI A;  3EQ2 A;  3SWY A;  3CLQ A;  5CJ0 A;  1EC5 A;  1L0N D;  3FWL A;  4IL6 H;  3RL0 C;  2W83 C;  1HJB A;  5CJ4 A;  1SQX G;  2IDB A;  3TNU A;  2KZI A;  4I7Z B;  3RL0 D;  4HYT B;  1KIL D;  2HYN A;  4Y28 J;  1AFO A;  1BE3 D;  5BU5 A;  3C9I A;  5DJU B;  1SQX E;  4YPC A;  3A2A A;  3RGU A;  1X0T A;  4H44 B;  1CI6 B;  1S1C X;  3WUT A;  1DH3 A;  5CCH A;  2R44 A;  2HG5 D;  3ABV C;  1VQO P;  2LXB A;  1MZ9 A;  2HFE D;  2ZYG A;  3CXH E;  1VQ4 P;  2IYP A;  2C0W A;  2OAR A;  1AQT A;  1KQG B;  5KJ7 D;  1G1I A;  3V6I A;  5AW6 B;  5B5E E;  1ZR2 A;  1SQP K;  3GF7 A;  1ZV8 A;  3L75 E;  2WPV B;  1GZL A;  1IZN B;  3AEA C;  1JY2 N;  1MV8 A;  1BE3 G;  1ZW0 A;  4BRY B;  5KAI E;  2M3B A;  1W2B O;  5EFW B;  1VQ7 P;  1P84 I;  2JR8 A;  3VMX A;  1K9M Q;  5CCG D;  2FXP A;  2JJL A;  5KLI C;  1X8Y A;  3O8Z A;  1KTM A;  1ZN5 A;  2P2U A;  3H1K D;  1M57 D;  1YI2 P;  1SQQ K;  3HD7 B;  4CPG A;  5KKZ B;  3MHV A;  1NH4 A;  3RL0 B;  5CBO A;  3KXD A;  2N1T D;  4L73 A;  1YJW P;  3HTK A;  1BE3 J;  1PGJ A;  1SQP J;  2WQY C;  1E79 H;  4K35 A;  5AVU B;  3WUU A;  2NPS D;  3R2P A;  4EIJ A;  1U57 A;  3SFE C;  1GL2 D;  3VYI A;  1TU3 F;  4W7Y A;  2P10 A;  2ZYA A;  4YTP C;  3B5N C;  2QG4 A;  3NTN A;  2XV5 A;  3TF5 A;  1GL2 C;  2YXQ B;  1KIL C;  1JOC A;  3H1H G;  1LT1 A;  2OYO A;  2R3C A;  3RK2 C;  3A7O A;  1H0T A;  4U3F D;  5AW5 B;  3H32 B;  3VN0 A;  4U3F J;  2G3A A;  1M1K Q;  1RE3 A;  1NKN A;  3L37 A;  5APW A;  1OZH A;  1PGO A;  1RQU A;  2HLO A;  3P8C D;  3CPW O;  4W7Z A;  2QA4 P;  2J59 M;  3I5C A;  1K04 A;  1N73 A;  1OW8 A;  3FX0 A;  1WRG A;  3H1J J;  1EZV E;  2AXC A;  2YMK A;  4HJG H;  5AW7 B;  1J1D C;  3L73 E;  5AW0 B;  3CWB J;  1H8A A;  1PFI A;  2FYU K;  1KQF B;  4GKG A;  3AE8 C;  4H13 B;  3T97 B;  1PPJ G;  2W90 A;  3VP9 A;  2KS1 A;  2AXT H;  2C0X A;  2FXM A;  4ZKU A;  3CCU P;  2YKQ A;  1P84 E;  3O6Q B;  3OJA B;  2C9L Y;  3C8V A;  1YTZ T;  3P7K A;  2P58 A;  1EXI A;  4PJ0 E;  1KB9 D;  1NAY A;  4ASW A;  4O9B A;  3CCM P;  2KZJ A;  2N9Y B;  4JYB A;  1L0N J;  2PRR A;  1LWU B;  4EYY Q;  2BCC G;  3CX5 D;  5CCG C;  3USS A;  3Q2Y A;  1IO4 A;  3H1K E;  2XZR A;  3AE5 C;  2H7H A;  1NHL A;  3H1I D;  3TNU B;  2FFD A;  1RQV A;  1ZME C;  2QRX A;  2H89 C;  1QGK B;  2NPS C;  2KLU A;  4UB6 E;  3IF4 A;  3V2P A;  2Y0C A;  1JB0 J;  1VQ9 P;  3B4S A;  2OTK E;  5GTI H;  1X79 B;  1SQV E;  1S9K D;  1RHZ B;  3EFG A;  4DT0 A;  1SQX K;  1KV4 A;  1IFD A;  2Q3I A;  3CXH H;  3VMA A;  1H0T B;  3L70 D;  4GIF A;  3L70 E;  1FJK A;  4EI2 A;  2R32 A;  1AV1 A;  2ZVO B;  3M91 A;  3F89 A;  3RK2 D;  3RK3 C;  4DJG A;  1D7M A;  4C7R A;  3IAO A;  1YIT P;  2C9N Y;  1L0L K;  1URQ D;  3M9B A;  4UB8 E;  2ZAE B;  2KP8 A;  1NOH A;  3M06 A;  4WY4 B;  1L0N E;  3A3Y B;  2OYH C;  1QL1 A;  1IK7 A;  1Q2N A;  1QX8 A;  1FBM A;  3CCR P;  2E42 A;  1VPC A;  1YYC A;  4EDF A;  1KIL E;  1S72 P;  3CME P;  1SFC C;  1BCC D;  1BCC E;  3L74 G;  1LWU A;  4LLH A;  1BGY J;  3CMA P;  1LTJ B;  2JEE A;  2WSF J;  3PJS K;  3JC2 2;  1LJ2 A;  1P84 D;  2OQQ A;  1WT6 A;  2JP3 A;  3CXH I;  1JY2 O;  1SFC A;  4GDO A;  4HKZ H;  4I6M C;  1RY3 A;  4AYC A;  5TIS H;  3V4Q A;  3PLN A;  2XKM A;  2D2C B;  3Q5S A;  2OYI A;  2YKP A;  3GHG A;  1W2E A;  1QVG O;  1S4X A;  3CWB G;  1GK6 A;  2WPQ A;  2OYH A;  1EZV D;  2FKW B;  1J1D B;  2ZT9 B;  2WTY A;  4H0L C;  2IPP A;  3PTZ A;  5AVY B;  2B87 A;  2Q3E A;  2O01 J;  1Y9B A;  2O01 H;  5AVR B;  3H6P A;  1J1E C;  3MUD C;  1JCD A;  3AE2 C;  2WSC J;  3L71 E;  1URQ B;  3E1I A;  1SQV J;  2O3J A;  1FZC B;  1HJ0 A;  5APS A;  3BCC E;  1YJN P;  1BE3 E;  3M0A A;  1H88 A;  1HF9 A;  3K5B A;  3L75 G;  1USE A;  3AE1 C;  5H2F E;  1P84 H;  3H25 A;  4I7Z C;  4KT0 J;  3D71 A;  1RF1 C;  3I55 P;  4IL6 X;  4YXD C;  5CCG A;  4AQR D;  2FYU J;  5C39 A;  3RBX A;  5AVZ B;  2P7J A;  1SP4 A;  3HD7 C;  3LID A;  4TT3 H;  3V4W A;  1FZF A;  4PV1 C;  1LT9 B;  2QM8 A;  2UWJ E;  3P8M C;  3BCC J;  3II6 A;  1L0N G;  1RE4 C;  1VF5 C;  2IBZ E;  3EWK A;  2BEZ F;  4PV1 D;  1LTT C;  3TDK A;  3AEE C;  2DW3 A;  2E5Y A;  3L71 J;  3PRJ A;  3MTU E;  2OYH B;  1NTK G;  2ZT9 D;  1JMM A;  1SFC D;  3MUD A;  2CPS A;  3IFM A;  4H13 C;  3GLM A;  2I1K A;  4IFM A;  4JF7 A;  4XFJ A;  3L71 D;  3A0H E;  1L4A D;  2PAJ A;  2H8P D;  1HBW A;  2K1A A;  3HRN A;  5KLV K;  2FYN C;  3H1L D;  3L73 J;  1BDD A;  1LP1 B;  3WU2 E;  1AVY A;  1SQV G;  2WWW A;  2M0B A;  1SS1 A;  1RE3 C;  1X22 A;  2R3S A;  5APT A;  2A06 G;  1RH5 B;  1AQ5 A;  2BEQ D;  4H44 C;  3M0D A;  5K5G B;  4JYC A;  5AVT B;  2KOG A;  3P32 A;  2LXC B;  4XE5 B;  4BRY A;  3UIA A;  1BGY E;  1SQQ G;  1JEK A;  2O1J A;  1T2K C;  1BCC J;  1LWU C;  2IBZ D;  3V5B A;  1NTZ D;  1M1J C;  1CZQ A;  1QEX A;  3HE4 B;  4D6T D;  4ZNC A;  1MFT A;  1A02 J;  1NGM B;  1SQP E;  4BWN A;  1SQP D;  2HPC B;  1VQ6 P;  1PGQ A;  3E1R A;  3N7N A;  1NU1 K;  3CCQ P;  2FYU E;  1JTH B;  1U7M A;  2HPC A;  3NMD A;  2XND H;  5APQ A;  1HH0 A;  2N1T C;  1JY3 N;  1PPJ E;  1JY3 O;  3R4Y A;  2W6J H;  2P1J A;  3HTK B;  5KAI H;  1GU4 A;  1W5C E;  3W67 A;  3FXE A;  2E5T A;  2LR2 A;  3BCC D;  3L70 J;  4HB1 A;  1QVF O;  2ZFC A;  3WMM 0;  2K9Y A;  2ZYD A;  3L73 G;  4OVN F;  3V2R A;  3I56 P;  3G4S P;  1YBK A;  1VDF A;  2WSE J;  1LNQ A;  2O01 N;  2HR3 A;  2G8Y A;  2GA1 A;  1N7L A;  1L0L J;  3KPE A;  4ZKP A;  3RK3 D;  1DX7 A;  3FWN A;  3MGN A;  1QL2 A;  1L0L D;  2D2C D;  2QJP B;  2ZT9 C;  1XTG B;  1OIP A;  1LTI C;  1YQ3 C;  4H13 D;  4Y99 B;  1NU1 G;  1N7S D;  2K37 A;  2RN0 A;  3S9O A;  2V7Q J;  1QLE D;  2PFX A;  1SLQ A;  1NTM G;  1GK4 A;  1Q86 Q;  1KQS O;  2FFD C;  3BCC G;  1DIP A;  2WSC H;  3BVH A;  2KS1 B;  3AEG C;  3H1I E;  3C1L A;  1R8E A;  2Q1K A;  1YTZ I;  3CX5 E;  2WMM A;  2YO3 A;  2ZJS E;  2QIW A;  1FDO A;  1FJP A;  4H44 D;  1EDJ A;  3OAK A;  1M90 Q;  1IFM A;  4PD4 E;  1PP9 G;  2QE7 H;  4JPZ B;  1VQN P;  1Q81 Q;  2QEX P;  3CWB E;  3KYQ A;  4XA4 A;  3AEF C;  3H1J E;  4HH2 A;  5GTH H;  1KOR A;  3AE9 C;  3CC2 P;  3VP8 A;  2WSF H;  1N2D C;  1IC2 A;  3KDP B;  2Q7C A;  1KZU B;  1KYO D;  1SQB D;  3LW5 J;  3W68 A;  4DCK A;  1BSH A;  2B9B A;  2KSJ A;  3A0H H;  4PJ0 H;  4I1L A;  1S3J A;  3PP5 A;  2OGU A;  5AVS B;  3P8C E;  1UII A;  3WU2 H;  1VQK P;  3H1L G;  1VQL P;  1GL2 A;  2QM7 A;  3SSU A;  1YHQ P;  1YIJ P;  1Y47 A;  2V7Q H;  1PP9 D;  4L76 A;  2D2C C;  2WIT A;  3B5N B;  3HUS A;  1L4A C;  3N4X A;  3VTP C;  4OGQ B;  2W6A A;  1FZC A;  5KLV E;  5KLV G;  3CC4 P;  5KTB A;  1L0N K;  2AEM A;  5AVV B;  2E76 D;  1GTW A;  2MKV A;  1Z56 A;  2PP6 A;  3G9R A;  2PGD A;  4WVZ A;  1NAF A;  4D6T J;  5M1B A;  2CPB A;  3H1K J;  4GOD A;  1NTK K;  1NWQ A;  1SFC B;  4R4M A;  1IJD B;  4A7P A;  1E5W A;  1RE4 A;  4L74 A;  2FY8 A;  3CCV P;  2RMZ A;  1EXJ A;  2Z5H A;  1LTA C;  2ITA A;  2R5B A;  1DEE G;  4TLF A;  1JM0 A;  1KYO H;  3L75 J;  5E79 E;  1SQV K;  3D6Z A;  3LW5 H;  2OYI B;  1U7J A;  2ZVN B;  4RJT A;  4UB8 H;  4KJM A;  3U1A A;  1CI6 A;  2QJY B;  2QJP C;  2Q9I A;  1ZLL A;  5B66 E;  3IR9 A;  4WB4 A;  1NJI Q;  1KFN A;  1FS0 E;  1ZRT D;  3KZI E;  1HVV A;  3L73 D;  3NFQ A;  1OVV A;  2E76 B;  3E7K A;  3H32 A;  4R4L A;  3Q3D A;  2FXO A;  1MUU A;  3CL3 D;  4QMA A;  2LKM A;  1FU1 A;  1RF0 C;  1KQL A;  3TGU J;  3RK3 E;  1J2J B;  2FBW C;  2GUS A;  2NRG A;  4U3F E;  3TGU D;  1R5L A;  2A45 I;  2XU6 A;  3G6E P;  1KB9 I;  2BCC D;  3OW2 O;  1PP9 J;  1YJ9 P;  2POH A;  3CWB D;  3PH0 A;  2OTL P;  4GT1 A;  2O1K A;  1IFN A;  3VMY A;  2Y0E A;  3A0B H;  5BU8 B;  1GU5 A;  3RL0 g;  1GD2 E;  1AJY A;  1NU1 E;  1NTM E;  2IX7 C;  2WPS A;  1G2C B;  1VL2 A;  1FZA A;  2KB7 P;  1SQB G;  3JCU E;  4I2L C;  4Z1M H;  2M3E A;  3GG2 A;  2OYI C;  2B89 A;  2QJK C;  1KB9 E;  2E74 D;  4L75 A;  1BCC G;  3L74 E;  3A5T A;  1NVO A;  2KLV A;  1LT9 C;  2QVA A;  2KIK A;  2RH0 A;  4PD4 H;  2A06 D;  2YO2 A;  3AE4 C;  3HD7 D;  1DEB A;  1PIX A;  2K88 A;  3BAT A;  5APY A;  1JNM A;  1NKZ B;  1KD1 Q;  1JO5 A;  1NTZ E;  2IFN A;  2WSS H;  1CSB A;  2JWD A;  4OH8 B;  1Q7Y Q;  1YQ4 C;  5AW8 B;  2JO1 A;  3AEC C;  1OVU A;  1NU1 D;  1KMI Z;  2MJZ A;  3MZW B;  1S2E A;  2JDI H;  2R5D A;  1GMJ A;  1NTM K;  2GUV A;  3GHG B;  3M9H A;  4U3F G;  5H2F H;  3U1C A;  1FDI A;  3BRV B;  1LP1 A;  3L70 G;  1PGP A;  1SQB K;  1N73 B;  1S5L H;  3EFF K;  3CXH D;  4Y99 C;  2Y9Z A;  3RK2 B;  2I8D A;  3IN6 A;  1OW6 A;  1HTL C;  4N6J A;  4WBA A;  1SQQ E;  2YIU B;  4N78 D;  2WT7 B;  3T97 A;  3H1H J;  2GM4 A;  5DJT B;  2Q6Q A;  2Y9Y A;  1SQX J;  1EZV I;  1ZXG A;  3ITK A;  3HE5 A;  3ZDM A;  2NPS A;  1LTB C;  4WY4 A;  1IFP A;  3H1K G;  2OTJ P;  2A06 E;  2E74 B;  4JBZ A;  1OMI A;  2SPZ A;  3S1K A;  4D6T G;  2IZ0 A;  1G2C A;  2QJK B;  1JTH A;  5CBN A;  1Q82 Q;  3CCS P;  1GDT A;  3D70 A;  1Y8A A;  4C7N A;  5B5E H;  1DD4 A;  5CHX A;  1K73 Q;  1L4A A;  2E74 C;  2E75 D;  2L91 A;  3HUS C;  5KLI B;  1FZC C;  2HOD B;  4WWI A;  2H43 A;  1VQ8 P;  3L36 A;  4LGD E;  5KLV D;  1KN7 A;  1NTK E;  1SQQ J;  4B86 A;  2P67 A;  4N3Y B;  2KYV A;  1NTZ G;  4RO0 A;  2B87 B;  3D6Y A;  1N7S A;  1EZV G;  2IBZ G;  3KZI H;  1VQM P;  2FFD B;  1WMK A;  1BSN A;  3GW6 A;  3H1L E;  1X9V A;  4K3A A;  3V2Q A;  1KC8 Q;  1AVO A;  1M56 D;  2A45 G;  3L72 E;  3BAS A;  3SWK A;  1N73 C;  3TGU G;  3OA7 A;  1SQB E;  3GF3 A;  4NPE A;  3FXD A;  1SQX D;  3H1H D;  2E76 C;  1N8R Q;  1N7S C;  2YNY A;  1S5L X;  2IFM A;  3TYY A;  5L8R J;  1G1J A;  3Q5R A;  1VQ5 P;  1LTJ A;  3SWF A;  1Q90 D;  1KIL A;  5APX A;  2Z4E A;  1NYH A;  2B88 A;  1NTK J;  2KK7 A;  3B5N A;  2M8R A;  3HUS B;  2ZXX A;  2M5A B;  3L71 G;  4RES B;  3JCU H;  1K8A Q;  1NTZ K;  2W27 A;  1MFZ A;  2N1T B;  4OWF A;  1FAV A;  5AW9 B;  4DZO A;  3CCL P;  1K05 A;  3L4F A;  1KB9 H;  1FOS E;  2IZ1 A;  3S4R A;  4PV1 B;  4PD4 D;  1JCC A;  1NU1 J;  3G71 P;  2KI7 B;  2V4H A;  1ZP0 C;  3F5H A;  2WPR A;  3CCE P;  3AE6 C;  5KJ7 A;  3AE7 C;  3LIE A;  1FZG A;  1LGH B;  2HOD A;  4C7N B;  3CI9 A;  1OFC X;  1NTM D;  1L4A B;  2KSE A;  4ZMD A;  5CMZ A;  2YMY A;  3CX5 H;  3QWO C;  4N78 E;  3TGU E;  4C46 A;  1IK9 A;  3MP7 B;  4KHX A;  1URQ A;  1PL5 A;  1T3J A;  3GMA A;  3L72 G;  3L75 D;  2E75 C;  3PHL A;  2KXP B;  4GOF A;  1URQ C;  5KAF E;  3Q1M A;  2Q5U A;  1KYO I;  1S5L E;  2KUB A;  4PD4 I;  3CCJ P;  1ZRT E;  4NPD A;  1DD3 A;  2FYN B;  1R5S A;  2NZ2 A;  1OVR A;  3AE3 C;  5CCH D;  5KJ7 C;  2N1T A;  5APV A;  4YXW H;  5CCH C;  5GTH E;  2BCC J;  2M5A A;  2QJY C;  2Y0D A;  4AUW A;  2J5U A;  2WZ7 A;  4LC1 A;  1GW4 A;  5AW1 B;  2WVR A;  1KIL B;  2RKL A;  3JSV C;  4UB6 H;  3SFD C;  2WT7 A;  4EOT A;  2FYU G;  2XNX A;  3MD0 A;  1M1J A;  5GTI E;  1UIX A;  4W80 A;  1PPJ D;  1VF5 B;  1A02 F;  1JUN A;  1HUC A;  1LTS C;  1SQP G;  2VRS A;  2XDJ A;  2ZXE B;  2YKO A;  3KHU A;  3WUV A;  4IL6 E;  4D6T E;  1IFI A;  1EDL A;  3O6Q A;  4IOI H;  1LTJ C;  1PZQ A;  2K9J A;  2JKV A;  3L74 J;  3M0D C;  2BAS A;  5TJH A;  5BVZ A;  1FZB A;  1RF1 B;  1ZOY C;  1VQP P;  4BXL A;  1JY2 P;  1SQB J;  4DOJ A;  1CW5 A;  1N7S B;  3H1J G;  1NTM J;  2H88 C;  1BGY D;  1FC2 C;  3AEB C;  2BCC E;  3B71 A;  1OW7 A;  3KQG A;  5AW4 B;  4GOE A;  3TK1 A;  3QH9 A;  2YIU C;  3H1L J;  5AVW B;  4H0L B;  4NPF X;  1PP9 E;  1SQV D;  2Z5I A;  3BRT B;  3RK3 B;  1S9K E;  1LTG C;  2E75 B;  1J1E B;  3V2N A;  1HGZ A;  1GL2 B;  1OWA A;  2AEJ A;  1HGV A;  1L2P A;  1RF0 A;  3FGA D;  3CC7 P;  1KYO E;  1L0L G;  1FZE A;  5E79 H;  5TIS E;  5B66 H;  1M8O B;  1NTK D;  1PV3 A;  3H1I G;  5AVX B;  2J58 A;  2W6B A;  2L5G B;  1EDI A;  1N86 A;  3HE5 B;  4MN4 C;  2IYO A;  2NPS B;  2N9B A;  3HD7 A;  1VF5 D;  5KKZ C;  1AA0 A;  3AED C;  1EDK A;  5APU A;  3NXS A;  2I1J A;  1IFJ A;  2FYU D;  1T6A A;  2KNC B;  3L35 A;  1RF1 A;  1HWT C;  3CX5 I;  4WY4 D;  2K9J B;  3HE4 A;  1GW3 A;  5AW3 B;  1KFM A;  4WY4 C;  3VOP A;  5AVQ B;  1OX3 A;  3H1I J;  2CK3 H; 
#chains in the Genus database with same CATH homology
 1M1J B;  1OXZ A;  1EQ7 A;  2WSE H;  3MIW A;  3B8E B;  3G3Z A;  1FOS F;  3VMZ A;  1XTC C;  4IFF A;  1M7L A;  2E43 A;  2A45 H;  1NO4 A;  3TSI A;  1SVF A;  3U59 A;  1T2K D;  1FDM A;  3GHG C;  1H89 A;  3B5N D;  4M3L A;  1T3U A;  2FYZ A;  5AW2 B;  1LT9 A;  1ZR4 A;  3M9Q A;  1JY3 P;  1T8Z A;  4IFD K;  3SWY A;  3EQ2 A;  3CLQ A;  5CJ0 A;  3RL0 C;  5CJ4 A;  3TNU A;  3RL0 D;  4HYT B;  1KIL D;  2HYN A;  1AFO A;  5BU5 A;  3C9I A;  3A2A A;  1DH3 A;  1CI6 B;  5CCH A;  2HG5 D;  1MZ9 A;  2HFE D;  2C0W A;  2OAR A;  5KJ7 D;  1ZR2 A;  1G1I A;  5AW6 B;  1SQP K;  1ZV8 A;  1GZL A;  1JY2 N;  1MV8 A;  2M3B A;  3VMX A;  5CCG D;  2JJL A;  1X8Y A;  3O8Z A;  1ZN5 A;  2P2U A;  1SQQ K;  3HD7 B;  1NH4 A;  3RL0 B;  2N1T D;  3HTK A;  5AVU B;  4EIJ A;  2NPS D;  3R2P A;  1HJB A;  3VYI A;  1GL2 D;  4W7Y A;  3B5N C;  3NTN A;  2XV5 A;  1GL2 C;  1KIL C;  1JOC A;  3RK2 C;  2R3C A;  3A7O A;  5AW5 B;  3H32 B;  3VN0 A;  1RE3 A;  1NKN A;  3L37 A;  5APW A;  3P8C D;  2HLO A;  4W7Z A;  2J59 M;  3I5C A;  1N73 A;  1WRG A;  5AW7 B;  1J1D C;  5AW0 B;  1PFI A;  1H8A A;  2FYU K;  4GKG A;  3VP9 A;  2C0X A;  2FXM A;  4ZKU A;  2YKQ A;  3OJA B;  2C9L Y;  3P7K A;  1YTZ T;  4O9B A;  4JYB A;  1LWU B;  5CCG C;  1IO4 A;  2XZR A;  2H7H A;  1NHL A;  2FFD A;  3TNU B;  2NPS C;  3V2P A;  1X79 B;  1S9K D;  3EFG A;  1SQX K;  1IFD A;  2Q3I A;  4GIF A;  1FJK A;  2R32 A;  3RK2 D;  3M91 A;  3RK3 C;  4C7R A;  2C9N Y;  1L0L K;  1URQ D;  3M9B A;  2OYH C;  2KP8 A;  1NOH A;  3M06 A;  4WY4 B;  3A3Y B;  1QL1 A;  1FBM A;  2E42 A;  1VPC A;  1YYC A;  1SFC C;  1LWU A;  4LLH A;  1LTJ B;  2JEE A;  1CW5 A;  1WT6 A;  1JY2 O;  1SFC A;  4I6M C;  1RY3 A;  4AYC A;  3V4Q A;  2XKM A;  2OYI A;  2YKP A;  3GHG A;  1W2E A;  1GK6 A;  2WPQ A;  2OYH A;  2FKW B;  1J1D B;  2IPP A;  5AVY B;  2O01 H;  5AVR B;  3H6P A;  1J1E C;  1JCD A;  1URQ B;  3E1I A;  1FZC B;  5APS A;  3M0A A;  1H88 A;  1RF1 C;  5CCG A;  4AQR D;  5AVZ B;  2P7J A;  1SP4 A;  3HD7 C;  3LID A;  3V4W A;  1FZF A;  1LT9 B;  2QM8 A;  3P8M C;  3II6 A;  1RE4 C;  1LTT C;  3MTU E;  2OYH B;  1JMM A;  3MUD A;  1SFC D;  2CPS A;  3IFM A;  4IFM A;  2I1K A;  4JF7 A;  1L4A D;  2PAJ A;  2H8P D;  1HBW A;  5KLV K;  3HRN A;  2WWW A;  5APT A;  1RE3 C;  1AQ5 A;  3M0D A;  4JYC A;  5AVT B;  2KOG A;  3P32 A;  4XE5 B;  3UIA A;  1T2K C;  2O1J A;  1LWU C;  3V5B A;  1M1J C;  1CZQ A;  3HE4 B;  1A02 J;  2HPC B;  3N7N A;  1NU1 K;  2HPC A;  1JTH B;  3NMD A;  5APQ A;  1HH0 A;  2N1T C;  1JY3 N;  1JY3 O;  2P1J A;  3HTK B;  1GU4 A;  2ZFC A;  3WMM 0;  3V2R A;  1VDF A;  1N7L A;  3KPE A;  4ZKP A;  1DX7 A;  3RK3 D;  3MGN A;  1QL2 A;  1XTG B;  4Y99 B;  1LTI C;  1N7S D;  2FFD C;  1SLQ A;  1GK4 A;  2WSC H;  3BVH A;  1YTZ I;  2YO3 A;  1FJP A;  3OAK A;  1IFM A;  3KYQ A;  4XA4 A;  4HH2 A;  3VP8 A;  2WSF H;  1N2D C;  1IC2 A;  3KDP B;  2Q7C A;  1KZU B;  2KSJ A;  4I1L A;  3PP5 A;  5AVS B;  3P8C E;  1GL2 A;  2QM7 A;  3VTP C;  2WIT A;  3B5N B;  3HUS A;  1L4A C;  3N4X A;  1FZC A;  2W6A A;  5KTB A;  1L0N K;  5AVV B;  1GTW A;  1Z56 A;  2PP6 A;  1NAF A;  2CPB A;  1NTK K;  1NWQ A;  1SFC B;  1IJD B;  1E5W A;  1RE4 A;  2Z5H A;  1LTA C;  2R5B A;  2OYI B;  1SQV K;  3LW5 H;  3U1A A;  1CI6 A;  2Q9I A;  1ZLL A;  3IR9 A;  4WB4 A;  1KFN A;  1HVV A;  3NFQ A;  3H32 A;  1MUU A;  3CL3 D;  2LKM A;  1FU1 A;  1RF0 C;  1KQL A;  1J2J B;  2GUS A;  2A45 I;  2XU6 A;  2POH A;  4GT1 A;  2O1K A;  1IFN A;  3VMY A;  5BU8 B;  1GU5 A;  1GD2 E;  2IX7 C;  2WPS A;  1G2C B;  1FZA A;  2KB7 P;  4I2L C;  2OYI C;  3A5T A;  2KLV A;  1LT9 C;  3HD7 D;  2YO2 A;  1JNM A;  1DEB A;  3BAT A;  5APY A;  1JO5 A;  1NKZ B;  2IFN A;  1CSB A;  4OH8 B;  5AW8 B;  2MJZ A;  2R5D A;  1NTM K;  2GUV A;  3GHG B;  3M9H A;  3U1C A;  3BRV B;  1SQB K;  1N73 B;  4Y99 C;  3RK2 B;  4N6J A;  1HTL C;  4WBA A;  2WT7 B;  4N78 D;  2GM4 A;  3T97 A;  3HE5 A;  2NPS A;  1LTB C;  4WY4 A;  1GDT A;  1G2C A;  1JTH A;  4C7N A;  5CHX A;  1L4A A;  3HUS C;  1FZC C;  2HOD B;  2H43 A;  3L36 A;  4LGD E;  4B86 A;  2P67 A;  4N3Y B;  2KYV A;  1N7S A;  2FFD B;  3V2Q A;  1X9V A;  2A45 G;  3BAS A;  1N73 C;  3OA7 A;  1N7S C;  2YNY A;  2IFM A;  3TYY A;  1G1J A;  1LTJ A;  3SWF A;  1KIL A;  5APX A;  2Z4E A;  3B5N A;  2M8R A;  3HUS B;  4RES B;  1NTZ K;  2W27 A;  1MFZ A;  2N1T B;  4DZO A;  1FAV A;  5AW9 B;  3L4F A;  1FOS E;  1JCC A;  2WPR A;  5KJ7 A;  3LIE A;  1FZG A;  1LGH B;  2HOD A;  4C7N B;  3CI9 A;  1L4A B;  5CMZ A;  2YMY A;  4N78 E;  4C46 A;  1IK9 A;  4KHX A;  1URQ A;  1T3J A;  1URQ C;  2Q5U A;  5CCH D;  5KJ7 C;  2N1T A;  5APV A;  5CCH C;  4AUW A;  2WZ7 A;  4LC1 A;  1GW4 A;  5AW1 B;  2WT7 A;  1KIL B;  4EOT A;  2XNX A;  3MD0 A;  1M1J A;  1A02 F;  1JUN A;  4W80 A;  1HUC A;  1LTS C;  2VRS A;  2XDJ A;  2ZXE B;  2YKO A;  1IFI A;  1LTJ C;  3M0D C;  2BAS A;  5BVZ A;  1FZB A;  1RF1 B;  1JY2 P;  4DOJ A;  1N7S B;  2WTY A;  3KQG A;  5AW4 B;  3TK1 A;  5AVW B;  3RK3 B;  1S9K E;  2Z5I A;  3BRT B;  1LTG C;  1J1E B;  3V2N A;  1HGZ A;  1GL2 B;  1OWA A;  1HGV A;  1RF0 A;  1FZE A;  5AVX B;  2J58 A;  2W6B A;  2L5G B;  3HE5 B;  1N86 A;  2NPS B;  2N9B A;  3HD7 A;  5APU A;  3NXS A;  2I1J A;  1IFJ A;  3L35 A;  1RF1 A;  1HWT C;  4WY4 D;  3HE4 A;  1GW3 A;  5AW3 B;  1KFM A;  4WY4 C;  3VOP A;  5AVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...