2O1JA

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
44
structure length
44
Chain Sequence
b'IETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural protein NSP4
molecule tags Viral protein
source organism Rotavirus str.
publication title Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4
rcsb
total genus 16
structure length 44
sequence length 44
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o1jA00
4DOJA 1G1IA 2O1JA 1G1JA 2O1KA 4WBAA 2L5GB 4LLHA 4WB4A 3MIWA 4C7RA 2WITA 4HH2A 3CI9A
chains in the Genus database with same CATH superfamily
3FXDA 1P84I 2B9BA 3TYYA 4ZKUA 2ZXEB 2FYUD 1T2KD 1VPCA 2D2CD 3N7NA 2V7QH 3H1IE 3TF5A 2E74B 2OYHC 1K73Q 2WQYC 3AE7C 4KT0J 3CC4P 1KZUB 4HH2A 1FJKA 1J1DB 4H0LB 4JQ0D 1JEKA 4PD4E 5AVRB 2B88A 1KMIZ 1Y9BA 1QGKB 3L72J 1SQBG 1GDTA 1ZR4A 5KLIB 1Z56A 2E75B 1SFCD 2YO2A 2JEEA 3HE5A 4UB6E 1AQ5A 3RK3B 2ZXXA 4Z1MH 3E1RA 3L72E 1G1IA 2O01H 2WPRA 1M1JC 4R4MA 1N7SB 1ZLLA 4DJGA 3CX5D 3EFFK 3TNUA 4W7YA 3L37A 1Q7YQ 2Z5IA 2WT7B 5KLVE 1ZP0C 2JJLA 1U57A 4PV1C 1NOHA 2E74D 4U7JA 3EWKA 1CZQA 3H1LD 1GK6A 2CPBA 3AEFC 3H1JE 2G8YA 1LT9A 3FX0A 2J5UA 2WWWA 1IZNB 2HODA 2JWAA 2C9LY 3RL0C 3G4SP 2IZ0A 3H1HE 3SWKA 1N7LA 1N86A 4GODA 2ZVNB 1L0LG 1FS0E 2HLOA 2P67A 2IFNA 2QRXA 4A7PA 1DD4A 1KILC 2HR3A 2WMMA 2BEZF 4RESB 1SS1A 3H1KJ 3HD7A 1SQVK 4GKGA 5CCGD 2AEJA 2YXRB 2AXTH 1NU1E 4GIFA 1VQMP 1MZ9A 4UB8H 1VQ4P 3G71P 4H44C 2XNDH 2ZFCA 1BCCD 1LTGC 1KILD 3CX5H 3H1LJ 5APSA 2E43A 1DEEG 2GUVA 4OGQC 1KB9E 1N7SA 3IFMA 3HD7D 3GLMA 3H1LE 1NWQA 2R3SA 2WSFJ 2QIWA 1NTKD 2QJPC 3BVHA 2FXPA 2W27A 3BCCE 4ASWA 1SQBJ 2L91A 2NZ2A 1OW8A 1IJDB 1NH4A 2QJPB 1NTZD 3H1KG 4I7ZC 5AW8B 1RQVA 3RGUA 3BCCJ 1Q2NA 1VQLP 1SQPE 4WY4B 2OYHA 2IBZG 3U59A 4IFDK 2OGUA 3D70A 3I5CA 2IDBA 3M9BA 1T3JA 3L70G 1JY3O 4IL6H 5E79H 5AW9B 3K5BA 1NTZJ 3LW5H 1EQ7A 4BRYB 1KYOH 1NTKE 2B87A 1NTMD 3L75D 2WZ7A 3CCEP 3Q2YA 1Q81Q 1HJBA 3HD7B 2KUBA 1NTZE 2P7JA 2FY8A 5C39A 3P7KA 3CI9A 1RF1B 2Y0DA 2KIKA 1BCCE 2G3AA 1FOSF 2KB7P 5K5GB 5KKZB 4H0LC 1WMKA 2QJYC 2YKOA 1KQFB 2SPZA 3TGUJ 1H88A 1VL2A 3CXHI 1L0NJ 4BXLA 1BCCJ 1FZGA 1IFPA 4WY4D 1LWUB 3VN0A 5M1BA 1G1JA 3LW5J 2FYUG 1VQKP 1EZVG 3KZIH 2Y0EA 1M1JA 1L0NE 1L4AD 1PGPA 1W5CE 2WSEJ 1S5LX 4PD4H 3CCMP 1GL2B 1DIPA 2AEMA 3CXHE 5CHXA 1OVUA 2WPQA 3LIEA 1GMJA 1GL2C 3BASA 3IR9A 2K37A 4H44B 5DJUB 1D7MA 5KLVD 2W6JH 3MUDA 5CBOA 1T2KC 1SQVE 2OTJP 4AYCA 1NU1K 1SQXD 1KTMA 3NFQA 3NXSA 1PP9G 2LXCB 2N1TB 3VMAA 3ABVC 2K9YA 4HJGH 4L75A 4YXDC 3L74D 2E76B 1BE3D 3M9QA 1BDDA 5KTBA 1L0NG 2KSJA 3HTKB 1K05A 2R44A 5AVYB 3S9OA 4C46A 5TISH 2BASA 3S1KA 2L5GB 3L73J 3CCVP 2J58A 1SQVD 3H1ID 3Q3DA 4GOFA 3A5TA 1FDIA 1X22A 4H44D 5APUA 3VMXA 1SQPK 1L0ND 1BE3E 2NRGA 4UB8E 1H0TB 3OAKA 1FE6A 1NTZG 3VTPC 3CL3D 5CMZA 3L70J 3RK3E 1NTKK 5E79E 5AW0B 3M06A 1NTKG 1SQQE 1URQD 1P84E 3JCUH 1KD1Q 1EDLA 1HBWA 3L70E 1NTZK 4XFJA 1HJ0A 2JP3A 4OVNF 5APVA 2Z4EA 1YI2P 4W80A 1SQPG 3CCSP 2IYPA 1KILA 4JF7A 2A06E 3NMDA 1S5LH 4RJTA 1JNMA 2QE7H 3R2PA 2KK7A 2Y9ZA 5L8RJ 2NPSB 3D6YA 1FZEA 1JMMA 1BGYD 3PRJA 1HGZA 1L0NK 1VDFA 2YMKA 2ZYGA 3D71A 3H1JJ 5AW6B 4UB6H 2WT7A 4KHXA 4WBAA 2PGDA 2R5BA 1FU1A 3AEDC 2GUSA 2YIUC 2YMYA 3FWNA 1HTLC 3MIWA 3P8CD 4H13B 3H1HJ 3A3YB 4ZNCA 1NU1G 4IL6X 1L4AA 2QM7A 5H2FE 3USSA 1K04A 1LT9C 1S4XA 4QMAA 1JUNA 1YTZT 1HUCA 3CXHD 3AE2C 3L71G 3TSIA 3W68A 1Q82Q 1MFTA 2FXMA 3H1KE 3WMM0 1AVYA 1EDIA 1JTHB 3MTUE 2KP8A 3BCCG 1L0LE 3GMAA 4I6MC 2QA4P 1ZRTD 1NU1J 1M1KQ 1H8AA 2QG4A 1L2PA 5KJ7D 2P2UA 3A0BE 2IBZD 1LTBC 2ZT9C 2M5AA 3H1HG 4DT0A 1MUUA 1XTCC 1PV3A 2UWJE 2KOGA 3WU2E 2ZT9B 1R5SA 2K1AA 1KC8Q 1WT6A 1VQNP 1JM0A 5GTIE 4LGDE 2NPSA 1VF5B 3GF3A 2CK3H 1QVGO 1S72P 3VP9A 2Z5HA 3HUSB 1VQPP 1NYHA 1KB9D 1G2CA 1OFCX 1GW3A 2XZRA 4DOJA 1CW5A 1EDKA 4YPCA 1YHQP 3WU2H 1VQOP 1SQPJ 1FZCB 3L72G 3O6QA 3H1KD 2JDIH 1SQQK 2MKVA 2WSCH 3MD0A 2FFDC 5APWA 1LTTC 5AVTB 3C8VA 4JYCA 2GA1A 3RBXA 1OW6A 1NTKJ 1LP1B 2O01N 1JY2O 2PP6A 2PRRA 2R5DA 1ZW0A 1FC2C 3GHGC 3M0DC 5APXA 4C7RA 3BRTB 1HVVA 2RH0A 1JMBA 1URQA 3CCQP 5KLVG 2AXCA 2OARA 5GTHH 1FOSE 2FXOA 1MV8A 4C7NB 3CC7P 1EZVD 1PPJE 2M3BA 3TGUE 2QEXP 3EFGA 1HGVA 3QH9A 5CCHD 4K3AA 2HYNA 3RK2B 2QJKC 4WB4A 1PGOA 3EQ2A 4W7ZA 1SP4A 1EXJA 2W6BA 3H6PA 1T6AA 4KJMA 2C0XA 2AXTE 5GTHE 3A0HE 4U3FG 1KQSO 3B5NC 3AEGC 4EDFA 4PD4I 3PHLA 3H1IG 5H2FH 3MGNA 1M1JB 2HODB 2I1JA 1SQXJ 1ZV8A 2A06D 1LTJB 2KI7B 1L0LK 2A06G 2Q3EA 3IF4A 3L71D 1JB0J 1YJWP 1VQ8P 4GT1A 3AECC 3L74J 1W2BO 3JC22 2WSEH 3M0AA 2P58A 2P10A 1MKMA 1JCDA 2E75D 2ZAEB 1GK4A 1SQQG 3A0BH 3G9RA 2ZYAA 1E79H 3L73D 3NTNA 3O8ZA 4PV1D 2N9BA 2PAJA 4I2LC 3A2AA 3V4QA 5KJ7A 5CBNA 2GM4A 1M90Q 3WUTA 1RE4A 4C7NA 2Q9IA 1IFIA 2HG5D 3AEEC 3C1LA 4IL6E 1K9MQ 1N73A 2FYNC 2M3EA 3N4XA 1YITP 3JSVC 2ZYDA 1S5LE 2QSIA 2HPCA 1X8YA 1KN7A 1RE3C 3L35A 3TNUB 1BE3J 1FJPA 1OVRA 2WVRA 2K3RA 2OYOA 4XA4A 3SWYA 2B89A 5GTIH 1VQ9P 3BATA 3MZWB 4PV1B 1SQQJ 1OVVA 1N8RQ 1SQPD 4MN4C 5AW3B 2KLVA 1FBMA 1M8OB 4WY4A 1RF0C 2QVAA 1KB9I 2Q6QA 1J1DC 4N78D 2KNCA 3RK2C 3KZIE 3Q5SA 1N73C 5B66H 3E7KA 1NTMG 3L75G 3FXEA 1AV1A 1U7MA 1YJNP 1WRGA 1BGYJ 1NHLA 2FYUJ 5CCGC 3TDKA 1KILB 2FYNB 1KB9H 4IFFA 3KQGA 2ITAA 2KLUA 1KILE 3CCJP 1RHZB 2FYUE 3F5HA 1FAVA 3G3ZA 1BSNA 4O9BA 1NU1D 1SFCA 5B66E 1NGMB 3MHVA 2YXQB 2WITA 3AE9C 4WVZA 2HPCB 1PFIA 1FDMA 1PIXA 4XE5B 5TISE 1IFMA 1SVFA 3CCUP 1GTWA 1SQXK 1PP9D 1L0LJ 1CI6B 2KS1B 2O1JA 3A7OA 1IFNA 3B8EB 1IK9A 1ZRTE 2ZVOB 4N78E 3B5NB 1USEA 2KNCB 2OTKE 4PD4D 1JY2N 3L36A 3AE6C 1K8AQ 2KZIA 1ZXGA 2RMZA 3L71E 2A45H 2B87B 3HE5B 5AVWB 2YNYA 3AE1C 4Y99C 3W67A 5CCHA 3CWBG 5DJTB 1QLED 1USDA 2BCCJ 3CWBD 3CX5I 4Y99B 4I1LA 4D6TJ 1NAYA 1RF1A 1ZOYC 1KQGB 4H0LD 1Q86Q 3R4YA 1PGJA 2K9JA 2W6AA 4EI2A 5CCGA 3SWFA 1S3JA 2A45I 3H1LG 4L76A 4DZOA 2BCCG 4D6TG 4TLFA 3RK3D 1JCCA 1G2CB 1HH0A 4OH8B 3G6EP 5APYA 3AEAC 3B5ND 1N7SD 1LWUC 3RBZA 5KAFH 1XTGB 4WY4C 1KORA 2N9YB 2N1TD 3RK3C 3VYIA 1R5LA 3H25A 1EXIA 3L70D 4HB1A 1N7SC 1OW7A 1LTIC 1OX3A 1X0TA 2NPSC 2IYOA 3Q1MA 2VRSA 1GU5A 2E76D 3QWOC 5AW7B 4D6TD 1QEXA 1DEBA 1PPJD 2FYUK 4PJ0E 5AW5B 2N1TA 2FYZA 1DD3A 3KXDA 3TGUD 4EIJA 1L4AC 3CMEP 3H1JG 3HD7C 2OYHB 1FZFA 2H43A 2KZJA 3CCLP 4EYYQ 3I56P 2R32A 2K9JB 1QL2A 1M57D 2JKVA 3Q5RA 2OYIB 1OIPA 2IFMA 2WSFH 4I7ZB 2Y9YA 1SQXE 4PJ0H 5BU5A 3CMAP 1KQLA 3MP7B 2FBWC 4IFMA 2W83C 3L74E 5APQA 1CSBA 3VMZA 1P84H 3JCUE 3S4RA 2H88C 2POHA 2XNXA 3WUVA 3UIAA 3AE3C 1H0TA 1PP9E 3E1IA 1LTSC 1OWAA 3L72D 3PH0A 3RL0g 2JR8A 3H32B 5AW2B 3VP8A 2N1TC 1NKNA 4U3FE 2YKQA 3T97B 3V2RA 1VQ5P 1S9KE 2M8RA 3HE4A 2E76C 4RKUJ 2NPSD 4U3FJ 1KYOE 3SSUA 1JO5A 1PZQA 1Q90D 1KV4A 2O1KA 1PPJG 3TGUG 2C0WA 1JOCA 3L73G 1FZCA 1SQQD 3KPEA 2Q1KA 1LWUA 3H1HD 1OZHA 2FKWB 5AW1B 3OA7A 1A02J 2E42A 1BDCA 3GHGB 5TJHA 2OTLP 5KAFE 2OQQA 1YYCA 1W2EA 3KYQA 4JBZA 3SFEC 3V2QA 1KYOD 1EC5A 4Y28J 1T3UA 1IK7A 4M3LA 1SQBD 3KHUA 1VQ7P 2P1JA 2RN0A 1L4AB 2LR2A 5KJ7C 1S9KD 3Q5PA 1RF1C 1GL2D 3A0HH 1HWTC 2YKPA 2XU6A 3CCRP 1EZVE 1BGYE 2WPSA 3CXHH 5KKZC 2RKLA 3BRVB 3CX5E 5APTA 4TT3H 5AVUB 4YXWH 2QJKB 4BRYA 5CCHC 1Y47A 3F89A 3MUDC 2IBZE 2ZT9D 3GF7A 3H1IJ 4HKZH 5AVQB 1LGHB 3HE4B 2M5AB 2FFDB 1YJ9P 1L0LD 1LNQA 2J59M 1VQ6P 3HTKA 5AW4B 1VF5D 2R3CA 4ZKPA 3OW2O 3FGAD 4CPGA 4EOTA 5CJ0A 2M0BA 1P84D 1N2DC 4L73A 2YIUB 1AQTA 3CLQA 3FWLA 1VF5C 2E5TA 3HUSA 4NPDA 1MFZA 3C9IA 4ASVA 1YIJP 1SLQA 1E5WA 3HUSC 1FDOA 4B86A 1AJYA 1LT9B 1NTMK 3O6QB 4LC1A 2QJYB 3P8MC 4NPEA 5KLVJ 4WWIA 3M9HA 2LKMA 1NAFA 4NPFX 1CI6A 2WPVB 3SFDC 3I55P 1DX7A 1LTAC 3L71J 4YTPC 2Y0CA 1URQC 2KYVA 3PLNA 1AVOA 1FZBA 2XDJA 5KAIH 1H89A 1A02F 2BCCE 1URQB 2KXPB 3M0DA 4D6TE 2V4HA 1SFCC 1R8EA 1T8ZA 4HYTB 3OJAB 2IBZI 2Q7CA 2FFDA 2I8DA 3AE8C 3V2NA 1QX8A 3GG2A 4OWFA 3KDPB 3AE5C 3VMYA 2BEQD 2MJZA 1EZVI 3CWBE 1PL5A 4LLHA 2DW3A 2XKMA 5KAIE 4H13C 3GW6A 5B5EE 3CWBJ 2CPSA 3LIDA 2E74C 2Q3IA 2OYIA 1BGYG 1AA0A 4GDOA 5AVZB 4AQRD 1IO4A 1RF0A 1NKZB 2IX7C 3V5BA 1NVOA 1M7LA 1S1CX 4H13D 1J1EB 4DCKA 2A45G 2E75C 2OYIC 3II6A 3CC2P 3P32A 1J2JB 1LT1A 1SQBE 2BCCD 2JWDA 1JTHA 1JY3P 1M56D 1GZLA 3HRNA 4JPZB 1RH5B 1YQ3C 3IN6A 3U1CA 1EDJA 1KFNA 2E5YA 2V7QJ 4N3YB 2H7HA 1KYOI 1RE3A 1KFMA 5AVSB 2YO3A 4JYBA 1UIXA 1IFDA 1S2EA 2ZJSE 3PTZA 5CJ4A 3V2PA 1TU3F 3CPWO 1RE4C 2D2CC 1DH3A 4OGQD 2PFXA 3AE4C 1N73B 1OMIA 1YQ4C 4K35A 1NJIQ 1NTME 1FZAA 2XV5A 3L75E 2QM8A 3RL0D 3VOPA 1U7JA 1RQUA 2WSSH 1J1EC 1SQVG 2H8PD 2HFED 1PP9J 3H1JD 4GOEA 4R4LA 3WUUA 1GL2A 1NTMJ 3L75J 3P8CE 3ZDMA 5KLVK 5EFWB 4L74A 2KS1A 1JY2P 2O01J 5AVXB 1JY3N 1LP1A 3B71A 3L74G 3TK1A 3CD6P 2WSCJ 1QVFO 4U3FD 3B5NA 1RY3A 3V4WA 1LJ2A 1YTZI 5BU8B 1AFOA 2Q5UA 3BCCD 1SQXG 1HF9A 4OGQB 3H32A 1GU4A 3IAOA 1UIIA 1IC2A 2AEFA 3T97A 1GW4A 1SQVJ 3B4SA 1QL1A 4BWNA 2D2CB 3V6IA 2K88A 3D6ZA 1ZR2A 3RL0B 1OXZA 2LXBA 2O3JA 1BE3G 1BCCG 4ZMDA 5KLIC 3M91A 1FZCC 1NO4A 1PGQA 3PP5A 1YBKA 3ITKA 4N6JA 5B5EH 3PJSK 1ZMEC 1X79B 3U1AA 2W8ZA 5BVZA 1SFCB 2KSEA 2C9NY 1X9VA 1GD2E 4IOIH 3L73E 5AVVB 3AEBC 1BSHA 2H89C 1LTJC 1Y8AA 3GHGA 2IPPA 1SQBK 2I1KA 2IZ1A 2W90A 3L4FA 4RO0A 3RK2D 2WTYA 1ZN5A 1LTJA 1IFJA 2JO1A 4AUWA
chains in the Genus database with same CATH topology
3TYYA 4ZKUA 2ZXEB 1T2KD 1VPCA 3N7NA 2OYHC 1KZUB 4HH2A 1FJKA 1J1DB 1GDTA 1ZR4A 1Z56A 1SFCD 2YO2A 2JEEA 3HE5A 1AQ5A 3RK3B 1G1IA 2O01H 2WPRA 1M1JC 1N7SB 1ZLLA 3TNUA 4W7YA 3L37A 2Z5IA 2WT7B 2JJLA 1NOHA 1CZQA 1GK6A 2CPBA 1LT9A 2WWWA 2HODA 2C9LY 3RL0C 1N7LA 1N86A 2P67A 2HLOA 2IFNA 1KILC 4RESB 3HD7A 1SQVK 4GKGA 5CCGD 4GIFA 1MZ9A 2ZFCA 1LTGC 1KILD 5APSA 2E43A 2GUVA 1N7SA 3IFMA 3HD7D 1NWQA 3BVHA 2W27A 1IJDB 1NH4A 5AW8B 4WY4B 3U59A 4IFDK 3I5CA 3M9BA 1T3JA 5AW9B 1JY3O 3LW5H 1EQ7A 2WZ7A 1HJBA 3HD7B 2P7JA 3P7KA 3CI9A 1RF1B 1FOSF 2KB7P 2YKOA 1H88A 1FZGA 4WY4D 1LWUB 1G1JA 1M1JA 1L4AD 1GL2B 5CHXA 3LIEA 2WPQA 4B86A 1GL2C 3BASA 3IR9A 3V2PA 1T2KC 3MUDA 4AYCA 1ZN5A 1NU1K 3NFQA 3NXSA 2N1TB 3M9QA 5KTBA 2KSJA 3HTKB 5AVYB 4C46A 2BASA 2L5GB 2J58A 3A5TA 5APUA 3VMXA 1SQPK 3OAKA 3VTPC 3CL3D 5CMZA 1NTKK 5AW0B 3M06A 1URQD 1HBWA 1NTZK 2Z4EA 5APVA 4W80A 1KILA 4JF7A 3NMDA 3R2PA 2NPSB 1FZEA 1JMMA 1HGZA 1L0NK 1VDFA 5AW6B 2WT7A 4KHXA 4WBAA 2R5BA 1FU1A 2GUSA 2YMYA 3MIWA 1HTLC 3P8CD 3A3YB 1L4AA 2QM7A 1JUNA 1LT9C 1YTZT 1HUCA 3TSIA 1JO5A 2FXMA 3WMM0 1JTHB 3MTUE 2KP8A 4I6MC 1H8AA 5KJ7D 2P2UA 1LTBC 1MUUA 1XTCC 2KOGA 1WT6A 4LGDE 2NPSA 3VP9A 2Z5HA 3HUSB 1G2CA 2XZRA 1GW3A 4DOJA 1CW5A 1FZCB 1SQQK 2WSCH 3MD0A 2FFDC 5APWA 1LTTC 5AVTB 4JYCA 2R5DA 1JY2O 2PP6A 3M0DC 3GHGC 5APXA 4C7RA 3BRTB 1HVVA 1URQA 2OARA 1FOSE 1MV8A 4C7NB 2M3BA 3EFGA 1HGVA 5CCHD 2HYNA 3RK2B 4WB4A 3EQ2A 4W7ZA 1SP4A 2W6BA 2C0XA 3B5NC 3MGNA 1M1JB 2HODB 2I1JA 1ZV8A 1LTJB 1L0LK 4GT1A 2WSEH 3M0AA 1JCDA 1GK4A 1JNMA 3O8ZA 3NTNA 3V4QA 2N9BA 2PAJA 4I2LC 3A2AA 5KJ7A 2GM4A 1RE4A 4C7NA 2Q9IA 1IFIA 2HG5D 1N73A 3N4XA 2HPCA 1X8YA 1RE3C 3L35A 3TNUB 1FJPA 4XA4A 3SWYA 3BATA 5AW3B 2KLVA 1FBMA 4WY4A 1RF0C 1J1DC 4N78D 3RK2C 1N73C 1WRGA 5CCGC 1NHLA 1KILB 4IFFA 3KQGA 1FAVA 3G3ZA 4O9BA 1SFCA 2HPCB 2WITA 1PFIA 1FDMA 4XE5B 1IFMA 1SVFA 1GTWA 1SQXK 1CI6B 2O1JA 3A7OA 1IFNA 3B8EB 1IK9A 4N78E 3B5NB 1JY2N 3L36A 2A45H 3HE5B 5AVWB 5CCHA 2YNYA 4Y99C 2OYHA 4Y99B 4I1LA 1RF1A 2W6AA 3SWFA 5CCGA 2A45I 4DZOA 3RK3D 1JCCA 1G2CB 1HH0A 4OH8B 5APYA 3B5ND 1N7SD 1LWUC 1XTGB 4WY4C 2N1TD 3RK3C 3VYIA 1N7SC 1LTIC 2NPSC 1GU5A 2VRSA 5AW7B 1DEBA 2FYUK 5AW5B 2N1TA 2FYZA 4EIJA 1L4AC 3HD7C 2OYHB 1FZFA 2H43A 2R32A 1QL2A 2IFMA 2WSFH 5BU5A 1KQLA 4IFMA 5APQA 1CSBA 3VMZA 2POHA 2XNXA 3UIAA 3E1IA 1LTSC 1OWAA 5AW2B 3H32B 3VP8A 2N1TC 1NKNA 3V2RA 2YKQA 1S9KE 2M8RA 3HE4A 2NPSD 2O1KA 2C0WA 1JOCA 3KPEA 1LWUA 2FKWB 1A02J 5AW1B 3OA7A 2E42A 3GHGB 1YYCA 1W2EA 3KYQA 3V2QA 1T3UA 4M3LA 2P1JA 1L4AB 5KJ7C 1S9KD 1RF1C 1HWTC 1GL2D 2YKPA 2XU6A 2WPSA 5AVUB 3BRVB 5APTA 1ZR2A 5CCHC 5AVRB 5AVQB 1LGHB 3HE4B 2FFDB 2J59M 3HTKA 5AW4B 2R3CA 4ZKPA 4EOTA 5CJ0A 1N2DC 3CLQA 3HUSA 1MFZA 3C9IA 1SLQA 1E5WA 3HUSC 1LT9B 1NTMK 4LC1A 3P8MC 3M9HA 2LKMA 1NAFA 1DX7A 1CI6A 1LTAC 1URQC 2KYVA 1FZBA 2XDJA 1H89A 1A02F 1URQB 3M0DA 1SFCC 1T8ZA 4HYTB 3OJAB 2FFDA 2Q7CA 3V2NA 3KDPB 3VMYA 2MJZA 4LLHA 2XKMA 2CPSA 3LIDA 2Q3IA 2OYIA 5AVZB 4AQRD 1IO4A 1RF0A 1NKZB 2IX7C 3V5BA 1M7LA 1J1EB 2OYIC 2A45G 3II6A 3P32A 1J2JB 1JTHA 1JY3P 3HRNA 1GZLA 3U1CA 1KFNA 4N3YB 2H7HA 1RE3A 5AVSB 1KFMA 2YO3A 4JYBA 1IFDA 5CJ4A 1RE4C 1DH3A 1N73B 2XV5A 1FZAA 3RL0D 2QM8A 3VOPA 1J1EC 2H8PD 2HFED 2OYIB 1GL2A 3P8CE 5KLVK 1JY2P 5AVXB 1JY3N 3TK1A 3B5NA 1RY3A 3V4WA 5BU8B 1YTZI 1AFOA 2Q5UA 3H32A 1GU4A 1IC2A 3T97A 1GW4A 1QL1A 3RL0B 1OXZA 1FZCC 3M91A 1NO4A 3PP5A 4N6JA 1X79B 3U1AA 2C9NY 5BVZA 1SFCB 1X9VA 1GD2E 5AVVB 3GHGA 1LTJC 3L4FA 3VN0A 2IPPA 1SQBK 2I1KA 3RK2D 2WTYA 1FZCA 3H6PA 1LTJA 1IFJA 4AUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOJ A;  1G1I A;  2O1J A;  1G1J A;  2O1K A;  4WBA A;  2L5G B;  4LLH A;  4WB4 A;  3MIW A;  4C7R A;  2WIT A;  4HH2 A;  3CI9 A; 
#chains in the Genus database with same CATH topology
 3FXD A;  1P84 I;  2B9B A;  3TYY A;  4ZKU A;  2ZXE B;  2FYU D;  1T2K D;  1VPC A;  2D2C D;  3N7N A;  2V7Q H;  3H1I E;  3TF5 A;  2E74 B;  2OYH C;  1K73 Q;  2WQY C;  3AE7 C;  4KT0 J;  3CC4 P;  1KZU B;  4HH2 A;  1FJK A;  1J1D B;  4H0L B;  4JQ0 D;  1JEK A;  4PD4 E;  5AVR B;  2B88 A;  1KMI Z;  1Y9B A;  1QGK B;  3L72 J;  1SQB G;  1GDT A;  1ZR4 A;  5KLI B;  1Z56 A;  2E75 B;  1SFC D;  2YO2 A;  2JEE A;  3HE5 A;  4UB6 E;  1AQ5 A;  3RK3 B;  2ZXX A;  4Z1M H;  3E1R A;  3L72 E;  1G1I A;  2O01 H;  2WPR A;  1M1J C;  4R4M A;  1N7S B;  1ZLL A;  4DJG A;  3CX5 D;  3EFF K;  3TNU A;  4W7Y A;  3L37 A;  1Q7Y Q;  2Z5I A;  2WT7 B;  5KLV E;  1ZP0 C;  2JJL A;  1U57 A;  4PV1 C;  1NOH A;  2E74 D;  4U7J A;  3EWK A;  1CZQ A;  3H1L D;  1GK6 A;  2CPB A;  3AEF C;  3H1J E;  2G8Y A;  1LT9 A;  3FX0 A;  2J5U A;  2WWW A;  1IZN B;  2HOD A;  2JWA A;  2C9L Y;  3RL0 C;  3G4S P;  2IZ0 A;  3H1H E;  3SWK A;  1N7L A;  1N86 A;  4GOD A;  2ZVN B;  1L0L G;  1FS0 E;  2HLO A;  2P67 A;  2IFN A;  2QRX A;  4A7P A;  1DD4 A;  1KIL C;  2HR3 A;  2WMM A;  2BEZ F;  4RES B;  1SS1 A;  3H1K J;  3HD7 A;  1SQV K;  4GKG A;  5CCG D;  2AEJ A;  2YXR B;  2AXT H;  1NU1 E;  4GIF A;  1VQM P;  1MZ9 A;  4UB8 H;  1VQ4 P;  3G71 P;  4H44 C;  2XND H;  2ZFC A;  1BCC D;  1LTG C;  1KIL D;  3CX5 H;  3H1L J;  5APS A;  2E43 A;  1DEE G;  2GUV A;  4OGQ C;  1KB9 E;  1N7S A;  3IFM A;  3HD7 D;  3GLM A;  3H1L E;  1NWQ A;  2R3S A;  2WSF J;  2QIW A;  1NTK D;  2QJP C;  3BVH A;  2FXP A;  2W27 A;  3BCC E;  4ASW A;  1SQB J;  2L91 A;  2NZ2 A;  1OW8 A;  1IJD B;  1NH4 A;  2QJP B;  1NTZ D;  3H1K G;  4I7Z C;  5AW8 B;  1RQV A;  3RGU A;  3BCC J;  1Q2N A;  1VQL P;  1SQP E;  4WY4 B;  2OYH A;  2IBZ G;  3U59 A;  4IFD K;  2OGU A;  3D70 A;  3I5C A;  2IDB A;  3M9B A;  1T3J A;  3L70 G;  1JY3 O;  4IL6 H;  5E79 H;  5AW9 B;  3K5B A;  1NTZ J;  3LW5 H;  1EQ7 A;  4BRY B;  1KYO H;  1NTK E;  2B87 A;  1NTM D;  3L75 D;  2WZ7 A;  3CCE P;  3Q2Y A;  1Q81 Q;  1HJB A;  3HD7 B;  2KUB A;  1NTZ E;  2P7J A;  2FY8 A;  5C39 A;  3P7K A;  3CI9 A;  1RF1 B;  2Y0D A;  2KIK A;  1BCC E;  2G3A A;  1FOS F;  2KB7 P;  5K5G B;  5KKZ B;  4H0L C;  1WMK A;  2QJY C;  2YKO A;  1KQF B;  2SPZ A;  3TGU J;  1H88 A;  1VL2 A;  3CXH I;  1L0N J;  4BXL A;  1BCC J;  1FZG A;  1IFP A;  4WY4 D;  1LWU B;  3VN0 A;  5M1B A;  1G1J A;  3LW5 J;  2FYU G;  1VQK P;  1EZV G;  3KZI H;  2Y0E A;  1M1J A;  1L0N E;  1L4A D;  1PGP A;  1W5C E;  2WSE J;  1S5L X;  4PD4 H;  3CCM P;  1GL2 B;  1DIP A;  2AEM A;  3CXH E;  5CHX A;  1OVU A;  2WPQ A;  3LIE A;  1GMJ A;  1GL2 C;  3BAS A;  3IR9 A;  2K37 A;  4H44 B;  5DJU B;  1D7M A;  5KLV D;  2W6J H;  3MUD A;  5CBO A;  1T2K C;  1SQV E;  2OTJ P;  4AYC A;  1NU1 K;  1SQX D;  1KTM A;  3NFQ A;  3NXS A;  1PP9 G;  2LXC B;  2N1T B;  3VMA A;  3ABV C;  2K9Y A;  4HJG H;  4L75 A;  4YXD C;  3L74 D;  2E76 B;  1BE3 D;  3M9Q A;  1BDD A;  5KTB A;  1L0N G;  2KSJ A;  3HTK B;  1K05 A;  2R44 A;  5AVY B;  3S9O A;  4C46 A;  5TIS H;  2BAS A;  3S1K A;  2L5G B;  3L73 J;  3CCV P;  2J58 A;  1SQV D;  3H1I D;  3Q3D A;  4GOF A;  3A5T A;  1FDI A;  1X22 A;  4H44 D;  5APU A;  3VMX A;  1SQP K;  1L0N D;  1BE3 E;  2NRG A;  4UB8 E;  1H0T B;  3OAK A;  1FE6 A;  1NTZ G;  3VTP C;  3CL3 D;  5CMZ A;  3L70 J;  3RK3 E;  1NTK K;  5E79 E;  5AW0 B;  3M06 A;  1NTK G;  1SQQ E;  1URQ D;  1P84 E;  3JCU H;  1KD1 Q;  1EDL A;  1HBW A;  3L70 E;  1NTZ K;  4XFJ A;  1HJ0 A;  2JP3 A;  4OVN F;  5APV A;  2Z4E A;  1YI2 P;  4W80 A;  1SQP G;  3CCS P;  2IYP A;  1KIL A;  4JF7 A;  2A06 E;  3NMD A;  1S5L H;  4RJT A;  1JNM A;  2QE7 H;  3R2P A;  2KK7 A;  2Y9Z A;  5L8R J;  2NPS B;  3D6Y A;  1FZE A;  1JMM A;  1BGY D;  3PRJ A;  1HGZ A;  1L0N K;  1VDF A;  2YMK A;  2ZYG A;  3D71 A;  3H1J J;  5AW6 B;  4UB6 H;  2WT7 A;  4KHX A;  4WBA A;  2PGD A;  2R5B A;  1FU1 A;  3AED C;  2GUS A;  2YIU C;  2YMY A;  3FWN A;  1HTL C;  3MIW A;  3P8C D;  4H13 B;  3H1H J;  3A3Y B;  4ZNC A;  1NU1 G;  4IL6 X;  1L4A A;  2QM7 A;  5H2F E;  3USS A;  1K04 A;  1LT9 C;  1S4X A;  4QMA A;  1JUN A;  1YTZ T;  1HUC A;  3CXH D;  3AE2 C;  3L71 G;  3TSI A;  3W68 A;  1Q82 Q;  1MFT A;  2FXM A;  3H1K E;  3WMM 0;  1AVY A;  1EDI A;  1JTH B;  3MTU E;  2KP8 A;  3BCC G;  1L0L E;  3GMA A;  4I6M C;  2QA4 P;  1ZRT D;  1NU1 J;  1M1K Q;  1H8A A;  2QG4 A;  1L2P A;  5KJ7 D;  2P2U A;  3A0B E;  2IBZ D;  1LTB C;  2ZT9 C;  2M5A A;  3H1H G;  4DT0 A;  1MUU A;  1XTC C;  1PV3 A;  2UWJ E;  2KOG A;  3WU2 E;  2ZT9 B;  1R5S A;  2K1A A;  1KC8 Q;  1WT6 A;  1VQN P;  1JM0 A;  5GTI E;  4LGD E;  2NPS A;  1VF5 B;  3GF3 A;  2CK3 H;  1QVG O;  1S72 P;  3VP9 A;  2Z5H A;  3HUS B;  1VQP P;  1NYH A;  1KB9 D;  1G2C A;  1OFC X;  1GW3 A;  2XZR A;  4DOJ A;  1CW5 A;  1EDK A;  4YPC A;  1YHQ P;  3WU2 H;  1VQO P;  1SQP J;  1FZC B;  3L72 G;  3O6Q A;  3H1K D;  2JDI H;  1SQQ K;  2MKV A;  2WSC H;  3MD0 A;  2FFD C;  5APW A;  1LTT C;  5AVT B;  3C8V A;  4JYC A;  2GA1 A;  3RBX A;  1OW6 A;  1NTK J;  1LP1 B;  2O01 N;  1JY2 O;  2PP6 A;  2PRR A;  2R5D A;  1ZW0 A;  1FC2 C;  3GHG C;  3M0D C;  5APX A;  4C7R A;  3BRT B;  1HVV A;  2RH0 A;  1JMB A;  1URQ A;  3CCQ P;  5KLV G;  2AXC A;  2OAR A;  5GTH H;  1FOS E;  2FXO A;  1MV8 A;  4C7N B;  3CC7 P;  1EZV D;  1PPJ E;  2M3B A;  3TGU E;  2QEX P;  3EFG A;  1HGV A;  3QH9 A;  5CCH D;  4K3A A;  2HYN A;  3RK2 B;  2QJK C;  4WB4 A;  1PGO A;  3EQ2 A;  4W7Z A;  1SP4 A;  1EXJ A;  2W6B A;  3H6P A;  1T6A A;  4KJM A;  2C0X A;  2AXT E;  5GTH E;  3A0H E;  4U3F G;  1KQS O;  3B5N C;  3AEG C;  4EDF A;  4PD4 I;  3PHL A;  3H1I G;  5H2F H;  3MGN A;  1M1J B;  2HOD B;  2I1J A;  1SQX J;  1ZV8 A;  2A06 D;  1LTJ B;  2KI7 B;  1L0L K;  2A06 G;  2Q3E A;  3IF4 A;  3L71 D;  1JB0 J;  1YJW P;  1VQ8 P;  4GT1 A;  3AEC C;  3L74 J;  1W2B O;  3JC2 2;  2WSE H;  3M0A A;  2P58 A;  2P10 A;  1MKM A;  1JCD A;  2E75 D;  2ZAE B;  1GK4 A;  1SQQ G;  3A0B H;  3G9R A;  2ZYA A;  1E79 H;  3L73 D;  3NTN A;  3O8Z A;  4PV1 D;  2N9B A;  2PAJ A;  4I2L C;  3A2A A;  3V4Q A;  5KJ7 A;  5CBN A;  2GM4 A;  1M90 Q;  3WUT A;  1RE4 A;  4C7N A;  2Q9I A;  1IFI A;  2HG5 D;  3AEE C;  3C1L A;  4IL6 E;  1K9M Q;  1N73 A;  2FYN C;  2M3E A;  3N4X A;  1YIT P;  3JSV C;  2ZYD A;  1S5L E;  2QSI A;  2HPC A;  1X8Y A;  1KN7 A;  1RE3 C;  3L35 A;  3TNU B;  1BE3 J;  1FJP A;  1OVR A;  2WVR A;  2K3R A;  2OYO A;  4XA4 A;  3SWY A;  2B89 A;  5GTI H;  1VQ9 P;  3BAT A;  3MZW B;  4PV1 B;  1SQQ J;  1OVV A;  1N8R Q;  1SQP D;  4MN4 C;  5AW3 B;  2KLV A;  1FBM A;  1M8O B;  4WY4 A;  1RF0 C;  2QVA A;  1KB9 I;  2Q6Q A;  1J1D C;  4N78 D;  2KNC A;  3RK2 C;  3KZI E;  3Q5S A;  1N73 C;  5B66 H;  3E7K A;  1NTM G;  3L75 G;  3FXE A;  1AV1 A;  1U7M A;  1YJN P;  1WRG A;  1BGY J;  1NHL A;  2FYU J;  5CCG C;  3TDK A;  1KIL B;  2FYN B;  1KB9 H;  4IFF A;  3KQG A;  2ITA A;  2KLU A;  1KIL E;  3CCJ P;  1RHZ B;  2FYU E;  3F5H A;  1FAV A;  3G3Z A;  1BSN A;  4O9B A;  1NU1 D;  1SFC A;  5B66 E;  1NGM B;  3MHV A;  2YXQ B;  2WIT A;  3AE9 C;  4WVZ A;  2HPC B;  1PFI A;  1FDM A;  1PIX A;  4XE5 B;  5TIS E;  1IFM A;  1SVF A;  3CCU P;  1GTW A;  1SQX K;  1PP9 D;  1L0L J;  1CI6 B;  2KS1 B;  2O1J A;  3A7O A;  1IFN A;  3B8E B;  1IK9 A;  1ZRT E;  2ZVO B;  4N78 E;  3B5N B;  1USE A;  2KNC B;  2OTK E;  4PD4 D;  1JY2 N;  3L36 A;  3AE6 C;  1K8A Q;  2KZI A;  1ZXG A;  2RMZ A;  3L71 E;  2A45 H;  2B87 B;  3HE5 B;  5AVW B;  2YNY A;  3AE1 C;  4Y99 C;  3W67 A;  5CCH A;  3CWB G;  5DJT B;  1QLE D;  1USD A;  2BCC J;  3CWB D;  3CX5 I;  4Y99 B;  4I1L A;  4D6T J;  1NAY A;  1RF1 A;  1ZOY C;  1KQG B;  4H0L D;  1Q86 Q;  3R4Y A;  1PGJ A;  2K9J A;  2W6A A;  4EI2 A;  5CCG A;  3SWF A;  1S3J A;  2A45 I;  3H1L G;  4L76 A;  4DZO A;  2BCC G;  4D6T G;  4TLF A;  3RK3 D;  1JCC A;  1G2C B;  1HH0 A;  4OH8 B;  3G6E P;  5APY A;  3AEA C;  3B5N D;  1N7S D;  1LWU C;  3RBZ A;  5KAF H;  1XTG B;  4WY4 C;  1KOR A;  2N9Y B;  2N1T D;  3RK3 C;  3VYI A;  1R5L A;  3H25 A;  1EXI A;  3L70 D;  4HB1 A;  1N7S C;  1OW7 A;  1LTI C;  1OX3 A;  1X0T A;  2NPS C;  2IYO A;  3Q1M A;  2VRS A;  1GU5 A;  2E76 D;  3QWO C;  5AW7 B;  4D6T D;  1QEX A;  1DEB A;  1PPJ D;  2FYU K;  4PJ0 E;  5AW5 B;  2N1T A;  2FYZ A;  1DD3 A;  3KXD A;  3TGU D;  4EIJ A;  1L4A C;  3CME P;  3H1J G;  3HD7 C;  2OYH B;  1FZF A;  2H43 A;  2KZJ A;  3CCL P;  4EYY Q;  3I56 P;  2R32 A;  2K9J B;  1QL2 A;  1M57 D;  2JKV A;  3Q5R A;  2OYI B;  1OIP A;  2IFM A;  2WSF H;  4I7Z B;  2Y9Y A;  1SQX E;  4PJ0 H;  5BU5 A;  3CMA P;  1KQL A;  3MP7 B;  2FBW C;  4IFM A;  2W83 C;  3L74 E;  5APQ A;  1CSB A;  3VMZ A;  1P84 H;  3JCU E;  3S4R A;  2H88 C;  2POH A;  2XNX A;  3WUV A;  3UIA A;  3AE3 C;  1H0T A;  1PP9 E;  3E1I A;  1LTS C;  1OWA A;  3L72 D;  3PH0 A;  3RL0 g;  2JR8 A;  3H32 B;  5AW2 B;  3VP8 A;  2N1T C;  1NKN A;  4U3F E;  2YKQ A;  3T97 B;  3V2R A;  1VQ5 P;  1S9K E;  2M8R A;  3HE4 A;  2E76 C;  4RKU J;  2NPS D;  4U3F J;  1KYO E;  3SSU A;  1JO5 A;  1PZQ A;  1Q90 D;  1KV4 A;  2O1K A;  1PPJ G;  3TGU G;  2C0W A;  1JOC A;  3L73 G;  1FZC A;  1SQQ D;  3KPE A;  2Q1K A;  1LWU A;  3H1H D;  1OZH A;  2FKW B;  5AW1 B;  3OA7 A;  1A02 J;  2E42 A;  1BDC A;  3GHG B;  5TJH A;  2OTL P;  5KAF E;  2OQQ A;  1YYC A;  1W2E A;  3KYQ A;  4JBZ A;  3SFE C;  3V2Q A;  1KYO D;  1EC5 A;  4Y28 J;  1T3U A;  1IK7 A;  4M3L A;  1SQB D;  3KHU A;  1VQ7 P;  2P1J A;  2RN0 A;  1L4A B;  2LR2 A;  5KJ7 C;  1S9K D;  3Q5P A;  1RF1 C;  1GL2 D;  3A0H H;  1HWT C;  2YKP A;  2XU6 A;  3CCR P;  1EZV E;  1BGY E;  2WPS A;  3CXH H;  5KKZ C;  2RKL A;  3BRV B;  3CX5 E;  5APT A;  4TT3 H;  5AVU B;  4YXW H;  2QJK B;  4BRY A;  5CCH C;  1Y47 A;  3F89 A;  3MUD C;  2IBZ E;  2ZT9 D;  3GF7 A;  3H1I J;  4HKZ H;  5AVQ B;  1LGH B;  3HE4 B;  2M5A B;  2FFD B;  1YJ9 P;  1L0L D;  1LNQ A;  2J59 M;  1VQ6 P;  3HTK A;  5AW4 B;  1VF5 D;  2R3C A;  4ZKP A;  3OW2 O;  3FGA D;  4CPG A;  4EOT A;  5CJ0 A;  2M0B A;  1P84 D;  1N2D C;  4L73 A;  2YIU B;  1AQT A;  3CLQ A;  3FWL A;  1VF5 C;  2E5T A;  3HUS A;  4NPD A;  1MFZ A;  3C9I A;  4ASV A;  1YIJ P;  1SLQ A;  1E5W A;  3HUS C;  1FDO A;  4B86 A;  1AJY A;  1LT9 B;  1NTM K;  3O6Q B;  4LC1 A;  2QJY B;  3P8M C;  4NPE A;  5KLV J;  4WWI A;  3M9H A;  2LKM A;  1NAF A;  4NPF X;  1CI6 A;  2WPV B;  3SFD C;  3I55 P;  1DX7 A;  1LTA C;  3L71 J;  4YTP C;  2Y0C A;  1URQ C;  2KYV A;  3PLN A;  1AVO A;  1FZB A;  2XDJ A;  5KAI H;  1H89 A;  1A02 F;  2BCC E;  1URQ B;  2KXP B;  3M0D A;  4D6T E;  2V4H A;  1SFC C;  1R8E A;  1T8Z A;  4HYT B;  3OJA B;  2IBZ I;  2Q7C A;  2FFD A;  2I8D A;  3AE8 C;  3V2N A;  1QX8 A;  3GG2 A;  4OWF A;  3KDP B;  3AE5 C;  3VMY A;  2BEQ D;  2MJZ A;  1EZV I;  3CWB E;  1PL5 A;  4LLH A;  2DW3 A;  2XKM A;  5KAI E;  4H13 C;  3GW6 A;  5B5E E;  3CWB J;  2CPS A;  3LID A;  2E74 C;  2Q3I A;  2OYI A;  1BGY G;  1AA0 A;  4GDO A;  5AVZ B;  4AQR D;  1IO4 A;  1RF0 A;  1NKZ B;  2IX7 C;  3V5B A;  1NVO A;  1M7L A;  1S1C X;  4H13 D;  1J1E B;  4DCK A;  2A45 G;  2E75 C;  2OYI C;  3II6 A;  3CC2 P;  3P32 A;  1J2J B;  1LT1 A;  1SQB E;  2BCC D;  2JWD A;  1JTH A;  1JY3 P;  1M56 D;  1GZL A;  3HRN A;  4JPZ B;  1RH5 B;  1YQ3 C;  3IN6 A;  3U1C A;  1EDJ A;  1KFN A;  2E5Y A;  2V7Q J;  4N3Y B;  2H7H A;  1KYO I;  1RE3 A;  1KFM A;  5AVS B;  2YO3 A;  4JYB A;  1UIX A;  1IFD A;  1S2E A;  2ZJS E;  3PTZ A;  5CJ4 A;  3V2P A;  1TU3 F;  3CPW O;  1RE4 C;  2D2C C;  1DH3 A;  4OGQ D;  2PFX A;  3AE4 C;  1N73 B;  1OMI A;  1YQ4 C;  4K35 A;  1NJI Q;  1NTM E;  1FZA A;  2XV5 A;  3L75 E;  2QM8 A;  3RL0 D;  3VOP A;  1U7J A;  1RQU A;  2WSS H;  1J1E C;  1SQV G;  2H8P D;  2HFE D;  1PP9 J;  3H1J D;  4GOE A;  4R4L A;  3WUU A;  1GL2 A;  1NTM J;  3L75 J;  3P8C E;  3ZDM A;  5KLV K;  5EFW B;  4L74 A;  2KS1 A;  1JY2 P;  2O01 J;  5AVX B;  1JY3 N;  1LP1 A;  3B71 A;  3L74 G;  3TK1 A;  3CD6 P;  2WSC J;  1QVF O;  4U3F D;  3B5N A;  1RY3 A;  3V4W A;  1LJ2 A;  1YTZ I;  5BU8 B;  1AFO A;  2Q5U A;  3BCC D;  1SQX G;  1HF9 A;  4OGQ B;  3H32 A;  1GU4 A;  3IAO A;  1UII A;  1IC2 A;  2AEF A;  3T97 A;  1GW4 A;  1SQV J;  3B4S A;  1QL1 A;  4BWN A;  2D2C B;  3V6I A;  2K88 A;  3D6Z A;  1ZR2 A;  3RL0 B;  1OXZ A;  2LXB A;  2O3J A;  1BE3 G;  1BCC G;  4ZMD A;  5KLI C;  3M91 A;  1FZC C;  1NO4 A;  1PGQ A;  3PP5 A;  1YBK A;  3ITK A;  4N6J A;  5B5E H;  3PJS K;  1ZME C;  1X79 B;  3U1A A;  2W8Z A;  5BVZ A;  1SFC B;  2KSE A;  2C9N Y;  1X9V A;  1GD2 E;  4IOI H;  3L73 E;  5AVV B;  3AEB C;  1BSH A;  2H89 C;  1LTJ C;  1Y8A A;  3GHG A;  2IPP A;  1SQB K;  2I1K A;  2IZ1 A;  2W90 A;  3L4F A;  4RO0 A;  3RK2 D;  2WTY A;  1ZN5 A;  1LTJ A;  1IFJ A;  2JO1 A;  4AUW A; 
#chains in the Genus database with same CATH homology
 3TYY A;  4ZKU A;  2ZXE B;  1T2K D;  1VPC A;  3N7N A;  2OYH C;  1KZU B;  4HH2 A;  1FJK A;  1J1D B;  1GDT A;  1ZR4 A;  1Z56 A;  1SFC D;  2YO2 A;  2JEE A;  3HE5 A;  1AQ5 A;  3RK3 B;  1G1I A;  2O01 H;  2WPR A;  1M1J C;  1N7S B;  1ZLL A;  3TNU A;  4W7Y A;  3L37 A;  2Z5I A;  2WT7 B;  2JJL A;  1NOH A;  1CZQ A;  1GK6 A;  2CPB A;  1LT9 A;  2WWW A;  2HOD A;  2C9L Y;  3RL0 C;  1N7L A;  1N86 A;  2P67 A;  2HLO A;  2IFN A;  1KIL C;  4RES B;  3HD7 A;  1SQV K;  4GKG A;  5CCG D;  4GIF A;  1MZ9 A;  2ZFC A;  1LTG C;  1KIL D;  5APS A;  2E43 A;  2GUV A;  1N7S A;  3IFM A;  3HD7 D;  1NWQ A;  3BVH A;  2W27 A;  1IJD B;  1NH4 A;  5AW8 B;  4WY4 B;  3U59 A;  4IFD K;  3I5C A;  3M9B A;  1T3J A;  5AW9 B;  1JY3 O;  3LW5 H;  1EQ7 A;  2WZ7 A;  1HJB A;  3HD7 B;  2P7J A;  3P7K A;  3CI9 A;  1RF1 B;  1FOS F;  2KB7 P;  2YKO A;  1H88 A;  1FZG A;  4WY4 D;  1LWU B;  1G1J A;  1M1J A;  1L4A D;  1GL2 B;  5CHX A;  3LIE A;  2WPQ A;  4B86 A;  1GL2 C;  3BAS A;  3IR9 A;  3V2P A;  1T2K C;  3MUD A;  4AYC A;  1ZN5 A;  1NU1 K;  3NFQ A;  3NXS A;  2N1T B;  3M9Q A;  5KTB A;  2KSJ A;  3HTK B;  5AVY B;  4C46 A;  2BAS A;  2L5G B;  2J58 A;  3A5T A;  5APU A;  3VMX A;  1SQP K;  3OAK A;  3VTP C;  3CL3 D;  5CMZ A;  1NTK K;  5AW0 B;  3M06 A;  1URQ D;  1HBW A;  1NTZ K;  2Z4E A;  5APV A;  4W80 A;  1KIL A;  4JF7 A;  3NMD A;  3R2P A;  2NPS B;  1FZE A;  1JMM A;  1HGZ A;  1L0N K;  1VDF A;  5AW6 B;  2WT7 A;  4KHX A;  4WBA A;  2R5B A;  1FU1 A;  2GUS A;  2YMY A;  3MIW A;  1HTL C;  3P8C D;  3A3Y B;  1L4A A;  2QM7 A;  1JUN A;  1LT9 C;  1YTZ T;  1HUC A;  3TSI A;  1JO5 A;  2FXM A;  3WMM 0;  1JTH B;  3MTU E;  2KP8 A;  4I6M C;  1H8A A;  5KJ7 D;  2P2U A;  1LTB C;  1MUU A;  1XTC C;  2KOG A;  1WT6 A;  4LGD E;  2NPS A;  3VP9 A;  2Z5H A;  3HUS B;  1G2C A;  2XZR A;  1GW3 A;  4DOJ A;  1CW5 A;  1FZC B;  1SQQ K;  2WSC H;  3MD0 A;  2FFD C;  5APW A;  1LTT C;  5AVT B;  4JYC A;  2R5D A;  1JY2 O;  2PP6 A;  3M0D C;  3GHG C;  5APX A;  4C7R A;  3BRT B;  1HVV A;  1URQ A;  2OAR A;  1FOS E;  1MV8 A;  4C7N B;  2M3B A;  3EFG A;  1HGV A;  5CCH D;  2HYN A;  3RK2 B;  4WB4 A;  3EQ2 A;  4W7Z A;  1SP4 A;  2W6B A;  2C0X A;  3B5N C;  3MGN A;  1M1J B;  2HOD B;  2I1J A;  1ZV8 A;  1LTJ B;  1L0L K;  4GT1 A;  2WSE H;  3M0A A;  1JCD A;  1GK4 A;  1JNM A;  3O8Z A;  3NTN A;  3V4Q A;  2N9B A;  2PAJ A;  4I2L C;  3A2A A;  5KJ7 A;  2GM4 A;  1RE4 A;  4C7N A;  2Q9I A;  1IFI A;  2HG5 D;  1N73 A;  3N4X A;  2HPC A;  1X8Y A;  1RE3 C;  3L35 A;  3TNU B;  1FJP A;  4XA4 A;  3SWY A;  3BAT A;  5AW3 B;  2KLV A;  1FBM A;  4WY4 A;  1RF0 C;  1J1D C;  4N78 D;  3RK2 C;  1N73 C;  1WRG A;  5CCG C;  1NHL A;  1KIL B;  4IFF A;  3KQG A;  1FAV A;  3G3Z A;  4O9B A;  1SFC A;  2HPC B;  2WIT A;  1PFI A;  1FDM A;  4XE5 B;  1IFM A;  1SVF A;  1GTW A;  1SQX K;  1CI6 B;  2O1J A;  3A7O A;  1IFN A;  3B8E B;  1IK9 A;  4N78 E;  3B5N B;  1JY2 N;  3L36 A;  2A45 H;  3HE5 B;  5AVW B;  5CCH A;  2YNY A;  4Y99 C;  2OYH A;  4Y99 B;  4I1L A;  1RF1 A;  2W6A A;  3SWF A;  5CCG A;  2A45 I;  4DZO A;  3RK3 D;  1JCC A;  1G2C B;  1HH0 A;  4OH8 B;  5APY A;  3B5N D;  1N7S D;  1LWU C;  1XTG B;  4WY4 C;  2N1T D;  3RK3 C;  3VYI A;  1N7S C;  1LTI C;  2NPS C;  1GU5 A;  2VRS A;  5AW7 B;  1DEB A;  2FYU K;  5AW5 B;  2N1T A;  2FYZ A;  4EIJ A;  1L4A C;  3HD7 C;  2OYH B;  1FZF A;  2H43 A;  2R32 A;  1QL2 A;  2IFM A;  2WSF H;  5BU5 A;  1KQL A;  4IFM A;  5APQ A;  1CSB A;  3VMZ A;  2POH A;  2XNX A;  3UIA A;  3E1I A;  1LTS C;  1OWA A;  5AW2 B;  3H32 B;  3VP8 A;  2N1T C;  1NKN A;  3V2R A;  2YKQ A;  1S9K E;  2M8R A;  3HE4 A;  2NPS D;  2O1K A;  2C0W A;  1JOC A;  3KPE A;  1LWU A;  2FKW B;  1A02 J;  5AW1 B;  3OA7 A;  2E42 A;  3GHG B;  1YYC A;  1W2E A;  3KYQ A;  3V2Q A;  1T3U A;  4M3L A;  2P1J A;  1L4A B;  5KJ7 C;  1S9K D;  1RF1 C;  1HWT C;  1GL2 D;  2YKP A;  2XU6 A;  2WPS A;  5AVU B;  3BRV B;  5APT A;  1ZR2 A;  5CCH C;  5AVR B;  5AVQ B;  1LGH B;  3HE4 B;  2FFD B;  2J59 M;  3HTK A;  5AW4 B;  2R3C A;  4ZKP A;  4EOT A;  5CJ0 A;  1N2D C;  3CLQ A;  3HUS A;  1MFZ A;  3C9I A;  1SLQ A;  1E5W A;  3HUS C;  1LT9 B;  1NTM K;  4LC1 A;  3P8M C;  3M9H A;  2LKM A;  1NAF A;  1DX7 A;  1CI6 A;  1LTA C;  1URQ C;  2KYV A;  1FZB A;  2XDJ A;  1H89 A;  1A02 F;  1URQ B;  3M0D A;  1SFC C;  1T8Z A;  4HYT B;  3OJA B;  2FFD A;  2Q7C A;  3V2N A;  3KDP B;  3VMY A;  2MJZ A;  4LLH A;  2XKM A;  2CPS A;  3LID A;  2Q3I A;  2OYI A;  5AVZ B;  4AQR D;  1IO4 A;  1RF0 A;  1NKZ B;  2IX7 C;  3V5B A;  1M7L A;  1J1E B;  2OYI C;  2A45 G;  3II6 A;  3P32 A;  1J2J B;  1JTH A;  1JY3 P;  3HRN A;  1GZL A;  3U1C A;  1KFN A;  4N3Y B;  2H7H A;  1RE3 A;  5AVS B;  1KFM A;  2YO3 A;  4JYB A;  1IFD A;  5CJ4 A;  1RE4 C;  1DH3 A;  1N73 B;  2XV5 A;  1FZA A;  3RL0 D;  2QM8 A;  3VOP A;  1J1E C;  2H8P D;  2HFE D;  2OYI B;  1GL2 A;  3P8C E;  5KLV K;  1JY2 P;  5AVX B;  1JY3 N;  3TK1 A;  3B5N A;  1RY3 A;  3V4W A;  5BU8 B;  1YTZ I;  1AFO A;  2Q5U A;  3H32 A;  1GU4 A;  1IC2 A;  3T97 A;  1GW4 A;  1QL1 A;  3RL0 B;  1OXZ A;  1FZC C;  3M91 A;  1NO4 A;  3PP5 A;  4N6J A;  1X79 B;  3U1A A;  2C9N Y;  5BVZ A;  1SFC B;  1X9V A;  1GD2 E;  5AVV B;  3GHG A;  1LTJ C;  3L4F A;  3VN0 A;  2IPP A;  1SQB K;  2I1K A;  3RK2 D;  2WTY A;  1FZC A;  3H6P A;  1LTJ A;  1IFJ A;  4AUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...