2O1JA

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
44
structure length
44
Chain Sequence
IETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nonstructural protein NSP4
publication title Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4
rcsb
source organism Rotavirus str.
molecule tags Viral protein
total genus 16
structure length 44
sequence length 44
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o1jA00
1G1JA 4LLHA 2O1KA 2O1JA 4DOJA 2WITA 4C7RA 3CI9A 2L5GB 4WBAA 1G1IA 4HH2A 3MIWA 4WB4A
chains in the Genus database with same CATH superfamily
2NPSC 1A02F 2KZJA 3M06A 4C46A 1KC8Q 1TU3F 1ZV8A 5AVXB 3AE3C 5CCHD 3CCJP 3MGNA 1NKZB 4U3FD 5AVVB 2C0XA 2QJPC 3CC7P 5KAIE 4IOIH 2OARA 1NTKK 2OYHB 2WSCJ 2NPSD 2XV5A 1SFCB 4ZNCA 2Q7CA 4H13C 5AVRB 2HPCB 1FOSF 3RGUA 3LIDA 2C9LY 1FZBA 5AVYB 3H1KJ 2PRRA 1VQ6P 1RQUA 1KD1Q 1GK6A 1KYOE 4ASWA 3T97A 3H1KG 1OVVA 3QWOC 3TSIA 3CMAP 1EXJA 1NTMJ 1VQ7P 2R3SA 5AW1B 4EI2A 1NTMG 1L0LK 1KQFB 1NGMB 4BRYB 3RK3C 4OH8B 3Q2YA 2B88A 3Q5PA 3H1LD 4NPFX 5TISH 3CXHE 1IO4A 1Q82Q 1H0TB 1S72P 1U7JA 3CLQA 3V4QA 3CCVP 1BCCJ 1OX3A 1VDFA 2K9JB 2DW3A 4N78D 3TK1A 2ZT9B 4IL6X 1BCCG 2V4HA 2G8YA 1LGHB 3VMZA 1FJPA 1PPJD 1PP9J 3V2PA 3E1IA 4QMAA 1USDA 1R5SA 1PP9G 2KSEA 1KILE 3KZIE 3D71A 2C9NY 1U57A 3D6YA 1KV4A 4GKGA 3BCCD 3L70D 3L72D 2OYHC 3H1HJ 3B5ND 5KLVK 1IZNB 2ZXXA 5GTIH 1LP1A 2E74B 2OYHA 2YMYA 1Q2NA 2GA1A 1ZOYC 5AW7B 3CCMP 3L36A 2KLUA 3IF4A 1BGYJ 1N7SB 1SQBK 2K3RA 1S4XA 3OJAB 2IX7C 1BGYG 3D6ZA 5K5GB 4Y28J 4ZMDA 1MV8A 1HBWA 4CPGA 1ZXGA 4JBZA 1EZVG 1DIPA 3O8ZA 1NTZD 1YI2P 1NO4A 1LTSC 2OYOA 2P7JA 4O9BA 2OQQA 5CHXA 4JQ0D 1PV3A 2AEJA 5APWA 4HB1A 1YYCA 1S5LH 1P84I 2ZYDA 3L37A 3UIAA 4M3LA 3B71A 5AW6B 3MUDC 1SQQK 1SVFA 2JJLA 3HE4B 2Q3IA 1DH3A 3CCEP 1EQ7A 2A45H 3MUDA 1RY3A 3C1LA 1GL2B 1PZQA 3M9HA 5KKZB 4DOJA 1NTZJ 4YXWH 1SQPK 1NTKD 1D7MA 1L0NE 1WRGA 5E79H 1JY2O 1QGKB 1JTHA 3WU2H 3MTUE 1VPCA 1ZR4A 1M90Q 2R44A 1S9KE 1JY2P 2JWDA 3TGUJ 1LT9B 3L75J 1QVGO 4XE5B 3H1IE 3BATA 3TGUG 3H1JD 2Y9YA 3L75G 1SQXE 2RN0A 2XZRA 1GW3A 1AQ5A 1JNMA 1DX7A 2YO2A 1CI6B 3HD7B 4LLHA 1IFDA 1NU1E 3BASA 2A06E 2OTJP 1IFJA 1L0LD 2PP6A 1KMIZ 2QJKB 2B87B 2K9YA 2OYIC 2QA4P 3G9RA 4L75A 3GF7A 1MFTA 4ASVA 2O01H 3CX5E 2PFXA 1VF5B 2BASA 2OYIA 4OVNF 2M5AA 5KAIH 2ZJSE 3MD0A 4RKUJ 1NH4A 5AW3B 2BCCE 1FZFA 1NTMK 3L74E 2HG5D 2XDJA 3OW2O 2FFDC 3FXEA 2FXPA 1KQLA 1XTCC 4LC1A 1HGZA 2CPBA 4DJGA 1PL5A 2NZ2A 1GL2C 1WT6A 3G3ZA 2KS1B 1KYOH 1Z56A 5KKZC 2FFDA 1KTMA 1HF9A 1MUUA 1LTGC 1QX8A 1NAYA 1GL2A 1X8YA 4NPEA 5KLVD 3E1RA 1KORA 4DZOA 1GZLA 3G6EP 2J58A 1LT9C 1SS1A 2FYUJ 5H2FE 1SQVE 1YIJP 3L71D 1EC5A 3CL3D 1SQBD 3CXHH 2FYUG 1LT9A 5M1BA 4K3AA 2R3CA 2WSFJ 1Q90D 1PGOA 3USSA 2QG4A 4U3FE 3H32B 3A3YB 2WT7B 4A7PA 1N73C 4D6TJ 2M3EA 1CI6A 1OWAA 5KLVJ 3GW6A 3L73D 1X22A 3JC22 4TT3H 1GMJA 1N73A 2R5DA 1IC2A 3KQGA 4D6TG 1VQ4P 3WUUA 1X9VA 2I1JA 4WY4B 3JCUE 3VMYA 3H6PA 3LW5J 1MFZA 1FDMA 1YHQP 1SQQD 2CPSA 4Y99B 1S1CX 3G4SP 2GUVA 3CCSP 4OWFA 3AE6C 1VL2A 1T3JA 2N9BA 5CBNA 3CCUP 2I8DA 3L73J 3EFFK 4PJ0E 1JOCA 3Q5SA 2IZ1A 1SQPD 3H1LE 2FYNB 4W80A 3G71P 3SWKA 5B5EH 3R2PA 5E79E 4N78E 3PTZA 4IFFA 3PH0A 3F89A 2H8PD 1NAFA 1PPJE 3CCQP 1BE3J 1M1JC 1VQLP 2WZ7A 4EOTA 3M91A 1BE3G 3TNUB 4WWIA 3RL0g 1M1JA 1VQMP 3BCCE 3H32A 3L70E 3L72E 3RK2B 2WT7A 3SWYA 1PIXA 3H1KD 2E76B 1Q7YQ 2L5GB 3GLMA 1T3UA 3C9IA 1AJYA 3CCLP 3SSUA 1ZR2A 2YMKA 1KB9D 4OGQC 3FXDA 4HKZH 1FS0E 1CW5A 3NTNA 3B4SA 3MP7B 4UB8E 1NTMD 4MN4C 2BCCG 4DCKA 4GODA 1NVOA 1LNQA 2V7QH 2D2CC 2E75B 1OW6A 1LT1A 2KUBA 3IN6A 2JP3A 2YIUB 2WVRA 3AE9C 4OGQD 4JYCA 3EQ2A 1L4AB 1CZQA 1BCCD 1KB9I 2D2CD 5AVZB 3H25A 2FBWC 2WSEH 2WQYC 4R4LA 3LIEA 4H13D 1FZEA 3KDPB 5APQA 4W7ZA 2E5TA 4NPDA 1PP9D 4I6MC 1DEEG 2E5YA 1HUCA 5APTA 1GTWA 1K8AQ 2YKPA 3AEBC 3CX5H 3QH9A 2BEZF 1M7LA 3RBZA 4L76A 1K9MQ 2W83C 4Z1MH 2QVAA 1NTKE 3H1HD 4WBAA 4C7NA 2JR8A 3FWLA 1BSNA 1EDLA 1X0TA 4H0LB 3RK3D 3RK2C 1K73Q 3N4XA 2E76C 2FYUK 1H8AA 3GF3A 1BGYD 5L8RJ 3SFDC 2H7HA 3H1JE 4PD4D 3FX0A 1Q81Q 5EFWB 3IFMA 1YTZT 1ZW0A 1EZVD 2A45I 2Q6QA 3A7OA 1SFCC 2QRXA 1L0LE 5H2FH 1QL2A 3AEDC 2KNCB 2A45G 1YJWP 3TDKA 1SFCA 1KN7A 1KILB 3FGAD 4I7ZB 2HPCA 2KP8A 3PP5A 1HWTC 3HTKB 4GOEA 1P84D 4PD4I 1H89A 1SFCD 4UB6E 5TJHA 2ZYAA 1EZVI 2KI7B 1AA0A 3L4FA 2IBZG 2XNDH 5B5EE 3PLNA 4W7YA 2WWWA 1VQPP 1OW7A 3JCUH 2P67A 2Q5UA 2YKOA 1DD4A 1URQB 4JYBA 3HE5B 2P10A 3BRVB 4BRYA 3M9QA 4ZKPA 2GUSA 5CCGC 1SP4A 1FC2C 2AEMA 2ZT9C 1H0TA 3TGUD 3L75D 1VQ8P 3MIWA 4H0LC 1FZAA 4PJ0H 2K9JA 5CCGA 2O01J 2MJZA 1LTBC 5BU8B 2JKVA 5DJTB 1PGPA 5AVUB 3U1CA 3L71E 1SQBE 1PGQA 2ZT9D 2FXOA 2P1JA 3Q1MA 1YITP 1WMKA 3MZWB 5AW4B 1LTAC 2E74C 3CD6P 2OTKE 1KFMA 2W6BA 1ZN5A 1NOHA 1AVOA 3NFQA 2KNCA 1A02J 1M8OB 2QIWA 1N7SC 3AE4C 3NXSA 1Y9BA 1YQ3C 3AEEC 4H44B 1SQQE 3CWBE 1N7SA 1J1EB 2M8RA 3HTKA 3CXHI 2E74D 4N6JA 4EIJA 3AE5C 1N7SD 1GW4A 5BU5A 1LTJB 1RQVA 3RL0B 3CCRP 1SQPE 3OAKA 4UB8H 1JM0A 3TYYA 1JCCA 1N7LA 3AEFC 3HE5A 2KB7P 2Q1KA 2JDIH 3GHGB 3BVHA 2ZAEB 1M57D 2ZVNB 2FYUD 2N1TB 3VN0A 4XFJA 2Z4EA 2AXCA 1KFNA 3HE4A 1R5LA 2B9BA 2G3AA 2P2UA 2K88A 5AW0B 2WPRA 5DJUB 4I2LC 2Y0DA 2YXQB 4D6TD 5APSA 2KZIA 3KXDA 3SFEC 4DT0A 4IFMA 1GL2D 3A5TA 3P8CE 2AEFA 1NYHA 3H1KE 4EDFA 4HYTB 1OW8A 1XTGB 1LTTC 3AE7C 2FYZA 2W27A 2Y0EA 2UWJE 3HD7C 1JCDA 5AVQB 1VQKP 2XU6A 2E42A 1NTME 1HJBA 3TF5A 4GOFA 2PGDA 3HD7A 2W90A 2Y0CA 2QJKC 3Q3DA 3N7NA 2H43A 3GG2A 1JB0J 3E7KA 3HD7D 3AEGC 2KIKA 1OVUA 2B87A 1VF5C 4U7JA 1KQGB 1BCCE 5BVZA 1YJ9P 2NPSB 4RJTA 2QM8A 2IDBA 1JY3N 1FZCB 1KQSO 1RF0C 1AV1A 3K5BA 1N86A 1PP9E 1BE3D 2QJPB 1EDKA 2IFNA 2HODB 3KYQA 1VF5D 5CBOA 2JWAA 1L0NJ 1M56D 1GU5A 4L74A 1RF0A 1VQNP 5CMZA 1X79B 2V7QJ 2OTLP 2YO3A 4UB6H 1L0NG 2Q9IA 2KS1A 3I55P 3VP9A 2Y9ZA 1ZRTD 1E79H 3T97B 1Y8AA 3H1HE 1DD3A 3H1IJ 3OA7A 3W68A 5KAFE 1SQXJ 3RK3E 4AQRD 1K04A 3H1IG 1NKNA 2L91A 1OZHA 1SQXG 2BCCD 5B66E 1FAVA 3KHUA 1NU1J 3CWBJ 1G1IA 1VQ9P 1BGYE 2JEEA 2WSEJ 4L73A 2QEXP 2VRSA 5KJ7C 1NU1G 3CWBG 2A06G 4PD4E 1T8ZA 1NHLA 2R32A 3HUSB 3L35A 1YBKA 5KJ7A 1EZVE 2M0BA 1Y47A 3CX5I 3ITKA 1ZLLA 1RE3C 1JMBA 3MHVA 1ZMEC 4EYYQ 3V4WA 4WY4C 5CCHC 1NJIQ 5KJ7D 4GT1A 1VQOP 2I1KA 2KK7A 1RE3A 2K37A 1E5WA 2BCCJ 1NWQA 4WY4A 3L74J 5CCHA 1RHZB 3V2RA 1P84E 2IYPA 2K1AA 3S1KA 2CK3H 4Y99C 3B5NB 3M0DA 3L74G 3HRNA 3V5BA 3S9OA 4WY4D 1FZCC 2HR3A 1BDDA 1MKMA 1IK9A 3A0BE 2NPSA 2FY8A 2XNXA 4GIFA 2PAJA 4BXLA 1FZCA 1NTZE 1LP1B 4TLFA 5C39A 2HODA 5APYA 2FYNC 3V2QA 5KLIB 2ITAA 3CC2P 1SQVJ 2WSSH 4KHXA 4YPCA 2QJYB 2WPQA 3TGUE 3L75E 1SQVG 2C0WA 1FE6A 2NRGA 4U3FJ 2OGUA 3WUVA 4GDOA 4LGDE 4U3FG 1RF1B 3U59A 1QEXA 5AW9B 3HUSC 3A0HE 1IFIA 2ZVOB 4PV1B 3TNUA 1CSBA 4ZKUA 2O01N 3HUSA 3IAOA 1FOSE 2KYVA 3AE8C 2W6AA 2IBZD 3WMM0 2LKMA 3CPWO 1KZUB 3P32A 2WSCH 3RK2D 3VTPC 2LXCB 3B5NC 2E75C 1FDOA 2BEQD 4HJGH 3V6IA 2E76D 1FU1A 1JTHB 2WMMA 2H89C 2YIUC 3H1LJ 3AECC 3B5NA 3VOPA 3AE2C 1U7MA 1H88A 2QSIA 5AVTB 3H1LG 2FXMA 1L4AC 5APXA 2IBZI 1KB9H 1EXIA 2E75D 5KLIC 2JO1A 3VP8A 5GTHH 3H1HG 1L4AA 3EWKA 2ZXEB 2WITA 2WPVB 2QJYC 4IL6E 1PGJA 2KLVA 3VYIA 2FYUE 2Z5IA 1G2CB 2RMZA 4K35A 1L4AD 1PPJG 1J2JB 4RESB 1USEA 3AE1C 1AFOA 1L0NK 3II6A 2RKLA 3BRTB 1RF1C 3BCCJ 3L70J 3L72J 3I5CA 2MKVA 2OYIB 3B8EB 1BSHA 1AVYA 2M5AB 4D6TE 3BCCG 3L70G 1IFNA 3L72G 1RF1A 3ABVC 5KLVE 4PV1C 1FBMA 3P7KA 1KYOD 2O1KA 4R4MA 4BWNA 1QLED 2YKQA 1OFCX 1SQXK 2AXTE 3JSVC 2SPZA 3CC4P 5AW2B 4C7RA 1DEBA 5APVA 1NU1K 2N9YB 5CCGD 1IFPA 2WPSA 3KPEA 2FFDB 4PV1D 3M0AA 4H0LD 1LWUB 1PFIA 1L2PA 3EFGA 2ZYGA 3CXHD 5KAFH 1JO5A 1FJKA 1KYOI 4YXDC 3M9BA 3L73E 1G1JA 1IJDB 5B66H 3SWFA 1NTZG 3V2NA 1MZ9A 1KILC 1JY3O 4I7ZC 2LR2A 3PRJA 4PD4H 1SLQA 2Z5HA 1JY3P 1KILA 2LXBA 2HYNA 1FZGA 1RE4C 3C8VA 3S4RA 1J1DB 1GU4A 1KILD 1RE4A 1LJ2A 1UIXA 1BE3E 4JPZB 1URQC 1N73B 1N8RQ 1NTKJ 3PHLA 1QL1A 5CJ4A 3IR9A 2KXPB 1G2CA 4RO0A 3CI9A 4AYCA 1P84H 4WB4A 1NTKG 1URQA 3AEAC 1HGVA 1YTZI 1S3JA 1SQVK 1ZRTE 3A0BH 4AUWA 1URQD 3H1JJ 5TISE 2Q3EA 3R4YA 3NMDA 2R5BA 3H1JG 3D70A 2IPPA 5CJ0A 1L0LJ 4IFDK 1HH0A 2HLOA 2J59M 2KSJA 1LWUC 2H88C 1L0LG 5AW5B 2IFMA 2POHA 3PJSK 1JUNA 1LWUA 5KTBA 1OMIA 1HVVA 2QM7A 3VMAA 3O6QB 5AVSB 2GM4A 1K05A 1T6AA 3A2AA 1EDJA 3ZDMA 1VQ5P 2IYOA 5AVWB 1KB9E 1JEKA 2YXRB 3P8MC 3A0HH 2WTYA 4H44C 2M3BA 4KT0J 1QVFO 5GTIE 1J1EC 2P58A 5GTHE 2J5UA 1M1JB 1S5LX 1J1DC 2YNYA 1R8EA 4N3YB 1L0ND 2QE7H 1GK4A 2HFED 1LTJC 2W6JH 3Q5RA 2ZFCA 3RL0C 1GD2E 1BDCA 1S9KD 4H44D 3U1AA 1Q86Q 1LTJA 1HJ0A 3H1ID 1LTIC 5AW8B 5KLVG 3GHGC 1SQXD 4B86A 1AQTA 3I56P 1JY2N 2N1TC 3L71J 1SQBJ 3KZIH 1JMMA 4OGQB 3GHGA 3RL0D 2FKWB 1NU1D 3CWBD 2A06D 3L71G 1SQBG 2KOGA 2N1TA 1S5LE 2D2CB 1YJNP 1M1KQ 1FDIA 4H13B 1UIIA 1W5CE 2N1TD 1EDIA 4JF7A 4IL6H 3F5HA 3WUTA 3CX5D 3L73G 1HTLC 3W67A 4XA4A 3GMAA 4HH2A 1OXZA 3RBXA 5APUA 2B89A 1GDTA 2WSFH 1SQQJ 3L74D 3WU2E 1S2EA 2W8ZA 1W2BO 2IBZE 1W2EA 1SQQG 2E43A 1T2KC 3O6QA 4KJMA 3RK3B 4YTPC 2XKMA 2IZ0A 4WVZA 1OVRA 1RH5B 2AXTH 4C7NB 4I1LA 1SQPJ 1NTZK 3VMXA 1ZP0C 3LW5H 1OIPA 1SQPG 1T2KD 2RH0A 2O3JA 3M0DC 1N2DC 3P8CD 1SQVD 3FWNA 1IK7A 2O1JA 1YQ4C 1IFMA 3CMEP
chains in the Genus database with same CATH topology
3NXSA 2NPSC 1N7SC 3B5NA 3VOPA 1A02F 1CI6A 1OWAA 3M06A 4C46A 1ZV8A 1H88A 5AVXB 5AVTB 5CCHD 1N73A 2R5DA 2FXMA 1L4AC 3MGNA 1IC2A 1NKZB 3KQGA 5AVVB 1N7SA 5APXA 1X9VA 2C0XA 2I1JA 1J1EB 4WY4B 2M8RA 3HTKA 3VMYA 3H6PA 4N6JA 3VP8A 1MFZA 1FDMA 4EIJA 1L4AA 2ZXEB 2OARA 1NTKK 2OYHB 2WITA 2NPSD 1N7SD 2XV5A 1SFCB 1GW4A 5BU5A 1LTJB 2Q7CA 5AVRB 2KLVA 2HPCB 1FOSF 2CPSA 3VYIA 3LIDA 3RL0B 4Y99B 2GUVA 2Z5IA 1G2CB 2C9LY 1L4AD 3OAKA 1FZBA 1J2JB 5AVYB 1T3JA 2N9BA 3TYYA 4RESB 1JCCA 1N7LA 1AFOA 3HE5A 2KB7P 1GK6A 1L0NK 3GHGB 3II6A 1JOCA 3BVHA 3T97A 3BRTB 1RF1C 2N1TB 3VN0A 2Z4EA 1KFNA 3TSIA 3I5CA 2OYIB 3B8EB 1IFNA 1RF1A 4W80A 1FBMA 3HE4A 3P7KA 2O1KA 5AW1B 2YKQA 2P2UA 1L0LK 1SQXK 5AW0B 3R2PA 3RK3C 2WPRA 4OH8B 4I2LC 4N78E 4IFFA 5AW2B 5APSA 1IO4A 4C7RA 1DEBA 5APVA 1NU1K 2H8PD 5CCGD 3CLQA 1NAFA 2WPSA 3V4QA 1M1JC 3KPEA 1VDFA 4IFMA 2FFDB 3M0AA 2WZ7A 1GL2D 1LWUB 4EOTA 1PFIA 4N78D 3EFGA 3TK1A 3A5TA 3M91A 3P8CE 1JO5A 1FJKA 3TNUB 1M1JA 1LGHB 3VMZA 4HYTB 1XTGB 1FJPA 3M9BA 1LTTC 3V2PA 1G1JA 3E1IA 1IJDB 2FYZA 3SWFA 2W27A 3HD7C 3H32A 3RK2B 3V2NA 1MZ9A 1JCDA 1KILC 2WT7A 3SWYA 1JY3O 5AVQB 2XU6A 2E42A 1HJBA 2L5GB 1SLQA 1T3UA 3HD7A 3C9IA 2Z5HA 1JY3P 1KILA 2C9NY 2HYNA 1ZR2A 1FZGA 4GKGA 1RE4C 2OYHC 1CW5A 3N7NA 3NTNA 2H43A 3B5ND 1J1DB 5KLVK 3HD7D 1GU4A 1KILD 1RE4A 2OYHA 2YMYA 5AW7B 3L36A 5BVZA 1URQC 1N73B 1QL1A 5CJ4A 3IR9A 2NPSB 1N7SB 1G2CA 1SQBK 3OJAB 3CI9A 4AYCA 2QM8A 2IX7C 4JYCA 1JY3N 4WB4A 1FZCB 1URQA 1HGVA 3EQ2A 1L4AB 1RF0C 1YTZI 1CZQA 1N86A 2IFNA 5AVZB 1SQVK 2HODB 3KYQA 1MV8A 4AUWA 2WSEH 1GU5A 1HBWA 1RF0A 3LIEA 1URQD 1FZEA 5CMZA 3KDPB 5APQA 3O8ZA 4W7ZA 1X79B 1NO4A 1LTSC 2YO3A 3NMDA 2R5BA 2P7JA 2Q9IA 4I6MC 4O9BA 5CHXA 3VP9A 2IPPA 5CJ0A 1HUCA 5APWA 3OA7A 1YYCA 5APTA 1GTWA 2YKPA 3L37A 4IFDK 1HH0A 2HLOA 2J59M 2KSJA 3UIAA 1LWUC 4M3LA 4AQRD 1M7LA 5AW6B 1NKNA 1SQQK 1SVFA 2JJLA 3HE4B 5AW5B 2Q3IA 2IFMA 2POHA 1DH3A 1EQ7A 1FAVA 1JUNA 4WBAA 1G1IA 4C7NA 1LWUA 2JEEA 2A45H 5KTBA 2VRSA 5KJ7C 3MUDA 1RY3A 1HVVA 2QM7A 1GL2B 3RK3D 3M9HA 3RK2C 4DOJA 3N4XA 1T8ZA 1NHLA 2R32A 3HUSB 3L35A 5AVSB 5KJ7A 2GM4A 2FYUK 3A2AA 1SQPK 1H8AA 5AVWB 2H7HA 1WRGA 1ZLLA 1JY2O 3P8MC 1RE3C 2WTYA 1JTHA 2M3BA 3MTUE 1VPCA 3V4WA 1ZR4A 4WY4C 1J1EC 5CCHC 1M1JB 5KJ7D 1S9KE 1J1DC 1JY2P 1LT9B 3IFMA 4GT1A 2I1KA 1YTZT 1RE3A 2A45I 1E5WA 2YNYA 4XE5B 3A7OA 4N3YB 1NWQA 4WY4A 3BATA 5CCHA 1SFCC 1GK4A 2HFED 1LTJC 2XZRA 3V2RA 1GW3A 1QL2A 1AQ5A 1JNMA 2ZFCA 3RL0C 1GD2E 4Y99C 3B5NB 1S9KD 2A45G 1DX7A 3M0DA 2YO2A 3HRNA 3U1AA 1CI6B 3HD7B 3V5BA 1SFCA 4WY4D 1KILB 1FZCC 1LTJA 4LLHA 1IFDA 2HPCA 3BASA 1IK9A 1LTIC 2KP8A 2NPSA 5AW8B 1IFJA 3PP5A 1HWTC 3GHGC 3HTKB 4B86A 2XNXA 4GIFA 2PP6A 2PAJA 1JY2N 2N1TC 1FZCA 1H89A 1SFCD 1JMMA 2OYIC 3L4FA 3GHGA 3RL0D 2FKWB 2HODA 5APYA 3V2QA 2KOGA 4W7YA 2N1TA 2WWWA 2O01H 2OYIA 2BASA 2P67A 4KHXA 2Q5UA 2YKOA 1URQB 4JYBA 2WPQA 3MD0A 3HE5B 2N1TD 1NH4A 5AW3B 2C0WA 4JF7A 3BRVB 1FZFA 1NTMK 2HG5D 3M9QA 2XDJA 4ZKPA 2GUSA 2FFDC 1HTLC 5CCGC 1KQLA 1XTCC 4LC1A 4XA4A 1SP4A 4LGDE 1HGZA 2CPBA 1RF1B 4HH2A 3MIWA 1GL2C 1OXZA 1WT6A 3G3ZA 3U59A 5APUA 1FZAA 1Z56A 1GDTA 5AW9B 2FFDA 2WSFH 5CCGA 3HUSC 1MUUA 1LTGC 2MJZA 1IFIA 1LTBC 5BU8B 1GL2A 1X8YA 1CSBA 5AVUB 3TNUA 1W2EA 3U1CA 4ZKUA 2E43A 1T2KC 3HUSA 3RK3B 2XKMA 4DZOA 1FOSE 1GZLA 2P1JA 2KYVA 2J58A 1LT9C 4C7NB 2W6AA 4I1LA 1NTZK 3WMM0 2LKMA 3VMXA 3CL3D 3LW5H 1KZUB 1LT9A 3P32A 2WSCH 3RK2D 3VTPC 3B5NC 2R3CA 5AW4B 1T2KD 1LTAC 3M0DC 1N2DC 3H32B 1KFMA 3P8CD 2W6BA 1ZN5A 3A3YB 2WT7B 1FU1A 2O1JA 1JTHB 1NOHA 1N73C 1IFMA 3NFQA 1A02J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1J A;  4LLH A;  2O1K A;  2O1J A;  4DOJ A;  2WIT A;  4C7R A;  3CI9 A;  2L5G B;  4WBA A;  1G1I A;  4HH2 A;  3MIW A;  4WB4 A; 
#chains in the Genus database with same CATH topology
 2NPS C;  1A02 F;  2KZJ A;  3M06 A;  4C46 A;  1KC8 Q;  1TU3 F;  1ZV8 A;  5AVX B;  3AE3 C;  5CCH D;  3CCJ P;  3MGN A;  1NKZ B;  4U3F D;  5AVV B;  2C0X A;  2QJP C;  3CC7 P;  5KAI E;  4IOI H;  2OAR A;  1NTK K;  2OYH B;  2WSC J;  2NPS D;  2XV5 A;  1SFC B;  4ZNC A;  2Q7C A;  4H13 C;  5AVR B;  2HPC B;  1FOS F;  3RGU A;  3LID A;  2C9L Y;  1FZB A;  5AVY B;  3H1K J;  2PRR A;  1VQ6 P;  1RQU A;  1KD1 Q;  1GK6 A;  1KYO E;  4ASW A;  3T97 A;  3H1K G;  1OVV A;  3QWO C;  3TSI A;  3CMA P;  1EXJ A;  1NTM J;  1VQ7 P;  2R3S A;  5AW1 B;  4EI2 A;  1NTM G;  1L0L K;  1KQF B;  1NGM B;  4BRY B;  3RK3 C;  4OH8 B;  3Q2Y A;  2B88 A;  3Q5P A;  3H1L D;  4NPF X;  5TIS H;  3CXH E;  1IO4 A;  1Q82 Q;  1H0T B;  1S72 P;  1U7J A;  3CLQ A;  3V4Q A;  3CCV P;  1BCC J;  1OX3 A;  1VDF A;  2K9J B;  2DW3 A;  4N78 D;  3TK1 A;  2ZT9 B;  4IL6 X;  1BCC G;  2V4H A;  2G8Y A;  1LGH B;  3VMZ A;  1FJP A;  1PPJ D;  1PP9 J;  3V2P A;  3E1I A;  4QMA A;  1USD A;  1R5S A;  1PP9 G;  2KSE A;  1KIL E;  3KZI E;  3D71 A;  2C9N Y;  1U57 A;  3D6Y A;  1KV4 A;  4GKG A;  3BCC D;  3L70 D;  3L72 D;  2OYH C;  3H1H J;  3B5N D;  5KLV K;  1IZN B;  2ZXX A;  5GTI H;  1LP1 A;  2E74 B;  2OYH A;  2YMY A;  1Q2N A;  2GA1 A;  1ZOY C;  5AW7 B;  3CCM P;  3L36 A;  2KLU A;  3IF4 A;  1BGY J;  1N7S B;  1SQB K;  2K3R A;  1S4X A;  3OJA B;  2IX7 C;  1BGY G;  3D6Z A;  5K5G B;  4Y28 J;  4ZMD A;  1MV8 A;  1HBW A;  4CPG A;  1ZXG A;  4JBZ A;  1EZV G;  1DIP A;  3O8Z A;  1NTZ D;  1YI2 P;  1NO4 A;  1LTS C;  2OYO A;  2P7J A;  4O9B A;  2OQQ A;  5CHX A;  4JQ0 D;  1PV3 A;  2AEJ A;  5APW A;  4HB1 A;  1YYC A;  1S5L H;  1P84 I;  2ZYD A;  3L37 A;  3UIA A;  4M3L A;  3B71 A;  5AW6 B;  3MUD C;  1SQQ K;  1SVF A;  2JJL A;  3HE4 B;  2Q3I A;  1DH3 A;  3CCE P;  1EQ7 A;  2A45 H;  3MUD A;  1RY3 A;  3C1L A;  1GL2 B;  1PZQ A;  3M9H A;  5KKZ B;  4DOJ A;  1NTZ J;  4YXW H;  1SQP K;  1NTK D;  1D7M A;  1L0N E;  1WRG A;  5E79 H;  1JY2 O;  1QGK B;  1JTH A;  3WU2 H;  3MTU E;  1VPC A;  1ZR4 A;  1M90 Q;  2R44 A;  1S9K E;  1JY2 P;  2JWD A;  3TGU J;  1LT9 B;  3L75 J;  1QVG O;  4XE5 B;  3H1I E;  3BAT A;  3TGU G;  3H1J D;  2Y9Y A;  3L75 G;  1SQX E;  2RN0 A;  2XZR A;  1GW3 A;  1AQ5 A;  1JNM A;  1DX7 A;  2YO2 A;  1CI6 B;  3HD7 B;  4LLH A;  1IFD A;  1NU1 E;  3BAS A;  2A06 E;  2OTJ P;  1IFJ A;  1L0L D;  2PP6 A;  1KMI Z;  2QJK B;  2B87 B;  2K9Y A;  2OYI C;  2QA4 P;  3G9R A;  4L75 A;  3GF7 A;  1MFT A;  4ASV A;  2O01 H;  3CX5 E;  2PFX A;  1VF5 B;  2BAS A;  2OYI A;  4OVN F;  2M5A A;  5KAI H;  2ZJS E;  3MD0 A;  4RKU J;  1NH4 A;  5AW3 B;  2BCC E;  1FZF A;  1NTM K;  3L74 E;  2HG5 D;  2XDJ A;  3OW2 O;  2FFD C;  3FXE A;  2FXP A;  1KQL A;  1XTC C;  4LC1 A;  1HGZ A;  2CPB A;  4DJG A;  1PL5 A;  2NZ2 A;  1GL2 C;  1WT6 A;  3G3Z A;  2KS1 B;  1KYO H;  1Z56 A;  5KKZ C;  2FFD A;  1KTM A;  1HF9 A;  1MUU A;  1LTG C;  1QX8 A;  1NAY A;  1GL2 A;  1X8Y A;  4NPE A;  5KLV D;  3E1R A;  1KOR A;  4DZO A;  1GZL A;  3G6E P;  2J58 A;  1LT9 C;  1SS1 A;  2FYU J;  5H2F E;  1SQV E;  1YIJ P;  3L71 D;  1EC5 A;  3CL3 D;  1SQB D;  3CXH H;  2FYU G;  1LT9 A;  5M1B A;  4K3A A;  2R3C A;  2WSF J;  1Q90 D;  1PGO A;  3USS A;  2QG4 A;  4U3F E;  3H32 B;  3A3Y B;  2WT7 B;  4A7P A;  1N73 C;  4D6T J;  2M3E A;  1CI6 A;  1OWA A;  5KLV J;  3GW6 A;  3L73 D;  1X22 A;  3JC2 2;  4TT3 H;  1GMJ A;  1N73 A;  2R5D A;  1IC2 A;  3KQG A;  4D6T G;  1VQ4 P;  3WUU A;  1X9V A;  2I1J A;  4WY4 B;  3JCU E;  3VMY A;  3H6P A;  3LW5 J;  1MFZ A;  1FDM A;  1YHQ P;  1SQQ D;  2CPS A;  4Y99 B;  1S1C X;  3G4S P;  2GUV A;  3CCS P;  4OWF A;  3AE6 C;  1VL2 A;  1T3J A;  2N9B A;  5CBN A;  3CCU P;  2I8D A;  3L73 J;  3EFF K;  4PJ0 E;  1JOC A;  3Q5S A;  2IZ1 A;  1SQP D;  3H1L E;  2FYN B;  4W80 A;  3G71 P;  3SWK A;  5B5E H;  3R2P A;  5E79 E;  4N78 E;  3PTZ A;  4IFF A;  3PH0 A;  3F89 A;  2H8P D;  1NAF A;  1PPJ E;  3CCQ P;  1BE3 J;  1M1J C;  1VQL P;  2WZ7 A;  4EOT A;  3M91 A;  1BE3 G;  3TNU B;  4WWI A;  3RL0 g;  1M1J A;  1VQM P;  3BCC E;  3H32 A;  3L70 E;  3L72 E;  3RK2 B;  2WT7 A;  3SWY A;  1PIX A;  3H1K D;  2E76 B;  1Q7Y Q;  2L5G B;  3GLM A;  1T3U A;  3C9I A;  1AJY A;  3CCL P;  3SSU A;  1ZR2 A;  2YMK A;  1KB9 D;  4OGQ C;  3FXD A;  4HKZ H;  1FS0 E;  1CW5 A;  3NTN A;  3B4S A;  3MP7 B;  4UB8 E;  1NTM D;  4MN4 C;  2BCC G;  4DCK A;  4GOD A;  1NVO A;  1LNQ A;  2V7Q H;  2D2C C;  2E75 B;  1OW6 A;  1LT1 A;  2KUB A;  3IN6 A;  2JP3 A;  2YIU B;  2WVR A;  3AE9 C;  4OGQ D;  4JYC A;  3EQ2 A;  1L4A B;  1CZQ A;  1BCC D;  1KB9 I;  2D2C D;  5AVZ B;  3H25 A;  2FBW C;  2WSE H;  2WQY C;  4R4L A;  3LIE A;  4H13 D;  1FZE A;  3KDP B;  5APQ A;  4W7Z A;  2E5T A;  4NPD A;  1PP9 D;  4I6M C;  1DEE G;  2E5Y A;  1HUC A;  5APT A;  1GTW A;  1K8A Q;  2YKP A;  3AEB C;  3CX5 H;  3QH9 A;  2BEZ F;  1M7L A;  3RBZ A;  4L76 A;  1K9M Q;  2W83 C;  4Z1M H;  2QVA A;  1NTK E;  3H1H D;  4WBA A;  4C7N A;  2JR8 A;  3FWL A;  1BSN A;  1EDL A;  1X0T A;  4H0L B;  3RK3 D;  3RK2 C;  1K73 Q;  3N4X A;  2E76 C;  2FYU K;  1H8A A;  3GF3 A;  1BGY D;  5L8R J;  3SFD C;  2H7H A;  3H1J E;  4PD4 D;  3FX0 A;  1Q81 Q;  5EFW B;  3IFM A;  1YTZ T;  1ZW0 A;  1EZV D;  2A45 I;  2Q6Q A;  3A7O A;  1SFC C;  2QRX A;  1L0L E;  5H2F H;  1QL2 A;  3AED C;  2KNC B;  2A45 G;  1YJW P;  3TDK A;  1SFC A;  1KN7 A;  1KIL B;  3FGA D;  4I7Z B;  2HPC A;  2KP8 A;  3PP5 A;  1HWT C;  3HTK B;  4GOE A;  1P84 D;  4PD4 I;  1H89 A;  1SFC D;  4UB6 E;  5TJH A;  2ZYA A;  1EZV I;  2KI7 B;  1AA0 A;  3L4F A;  2IBZ G;  2XND H;  5B5E E;  3PLN A;  4W7Y A;  2WWW A;  1VQP P;  1OW7 A;  3JCU H;  2P67 A;  2Q5U A;  2YKO A;  1DD4 A;  1URQ B;  4JYB A;  3HE5 B;  2P10 A;  3BRV B;  4BRY A;  3M9Q A;  4ZKP A;  2GUS A;  5CCG C;  1SP4 A;  1FC2 C;  2AEM A;  2ZT9 C;  1H0T A;  3TGU D;  3L75 D;  1VQ8 P;  3MIW A;  4H0L C;  1FZA A;  4PJ0 H;  2K9J A;  5CCG A;  2O01 J;  2MJZ A;  1LTB C;  5BU8 B;  2JKV A;  5DJT B;  1PGP A;  5AVU B;  3U1C A;  3L71 E;  1SQB E;  1PGQ A;  2ZT9 D;  2FXO A;  2P1J A;  3Q1M A;  1YIT P;  1WMK A;  3MZW B;  5AW4 B;  1LTA C;  2E74 C;  3CD6 P;  2OTK E;  1KFM A;  2W6B A;  1ZN5 A;  1NOH A;  1AVO A;  3NFQ A;  2KNC A;  1A02 J;  1M8O B;  2QIW A;  1N7S C;  3AE4 C;  3NXS A;  1Y9B A;  1YQ3 C;  3AEE C;  4H44 B;  1SQQ E;  3CWB E;  1N7S A;  1J1E B;  2M8R A;  3HTK A;  3CXH I;  2E74 D;  4N6J A;  4EIJ A;  3AE5 C;  1N7S D;  1GW4 A;  5BU5 A;  1LTJ B;  1RQV A;  3RL0 B;  3CCR P;  1SQP E;  3OAK A;  4UB8 H;  1JM0 A;  3TYY A;  1JCC A;  1N7L A;  3AEF C;  3HE5 A;  2KB7 P;  2Q1K A;  2JDI H;  3GHG B;  3BVH A;  2ZAE B;  1M57 D;  2ZVN B;  2FYU D;  2N1T B;  3VN0 A;  4XFJ A;  2Z4E A;  2AXC A;  1KFN A;  3HE4 A;  1R5L A;  2B9B A;  2G3A A;  2P2U A;  2K88 A;  5AW0 B;  2WPR A;  5DJU B;  4I2L C;  2Y0D A;  2YXQ B;  4D6T D;  5APS A;  2KZI A;  3KXD A;  3SFE C;  4DT0 A;  4IFM A;  1GL2 D;  3A5T A;  3P8C E;  2AEF A;  1NYH A;  3H1K E;  4EDF A;  4HYT B;  1OW8 A;  1XTG B;  1LTT C;  3AE7 C;  2FYZ A;  2W27 A;  2Y0E A;  2UWJ E;  3HD7 C;  1JCD A;  5AVQ B;  1VQK P;  2XU6 A;  2E42 A;  1NTM E;  1HJB A;  3TF5 A;  4GOF A;  2PGD A;  3HD7 A;  2W90 A;  2Y0C A;  2QJK C;  3Q3D A;  3N7N A;  2H43 A;  3GG2 A;  1JB0 J;  3E7K A;  3HD7 D;  3AEG C;  2KIK A;  1OVU A;  2B87 A;  1VF5 C;  4U7J A;  1KQG B;  1BCC E;  5BVZ A;  1YJ9 P;  2NPS B;  4RJT A;  2QM8 A;  2IDB A;  1JY3 N;  1FZC B;  1KQS O;  1RF0 C;  1AV1 A;  3K5B A;  1N86 A;  1PP9 E;  1BE3 D;  2QJP B;  1EDK A;  2IFN A;  2HOD B;  3KYQ A;  1VF5 D;  5CBO A;  2JWA A;  1L0N J;  1M56 D;  1GU5 A;  4L74 A;  1RF0 A;  1VQN P;  5CMZ A;  1X79 B;  2V7Q J;  2OTL P;  2YO3 A;  4UB6 H;  1L0N G;  2Q9I A;  2KS1 A;  3I55 P;  3VP9 A;  2Y9Z A;  1ZRT D;  1E79 H;  3T97 B;  1Y8A A;  3H1H E;  1DD3 A;  3H1I J;  3OA7 A;  3W68 A;  5KAF E;  1SQX J;  3RK3 E;  4AQR D;  1K04 A;  3H1I G;  1NKN A;  2L91 A;  1OZH A;  1SQX G;  2BCC D;  5B66 E;  1FAV A;  3KHU A;  1NU1 J;  3CWB J;  1G1I A;  1VQ9 P;  1BGY E;  2JEE A;  2WSE J;  4L73 A;  2QEX P;  2VRS A;  5KJ7 C;  1NU1 G;  3CWB G;  2A06 G;  4PD4 E;  1T8Z A;  1NHL A;  2R32 A;  3HUS B;  3L35 A;  1YBK A;  5KJ7 A;  1EZV E;  2M0B A;  1Y47 A;  3CX5 I;  3ITK A;  1ZLL A;  1RE3 C;  1JMB A;  3MHV A;  1ZME C;  4EYY Q;  3V4W A;  4WY4 C;  5CCH C;  1NJI Q;  5KJ7 D;  4GT1 A;  1VQO P;  2I1K A;  2KK7 A;  1RE3 A;  2K37 A;  1E5W A;  2BCC J;  1NWQ A;  4WY4 A;  3L74 J;  5CCH A;  1RHZ B;  3V2R A;  1P84 E;  2IYP A;  2K1A A;  3S1K A;  2CK3 H;  4Y99 C;  3B5N B;  3M0D A;  3L74 G;  3HRN A;  3V5B A;  3S9O A;  4WY4 D;  1FZC C;  2HR3 A;  1BDD A;  1MKM A;  1IK9 A;  3A0B E;  2NPS A;  2FY8 A;  2XNX A;  4GIF A;  2PAJ A;  4BXL A;  1FZC A;  1NTZ E;  1LP1 B;  4TLF A;  5C39 A;  2HOD A;  5APY A;  2FYN C;  3V2Q A;  5KLI B;  2ITA A;  3CC2 P;  1SQV J;  2WSS H;  4KHX A;  4YPC A;  2QJY B;  2WPQ A;  3TGU E;  3L75 E;  1SQV G;  2C0W A;  1FE6 A;  2NRG A;  4U3F J;  2OGU A;  3WUV A;  4GDO A;  4LGD E;  4U3F G;  1RF1 B;  3U59 A;  1QEX A;  5AW9 B;  3HUS C;  3A0H E;  1IFI A;  2ZVO B;  4PV1 B;  3TNU A;  1CSB A;  4ZKU A;  2O01 N;  3HUS A;  3IAO A;  1FOS E;  2KYV A;  3AE8 C;  2W6A A;  2IBZ D;  3WMM 0;  2LKM A;  3CPW O;  1KZU B;  3P32 A;  2WSC H;  3RK2 D;  3VTP C;  2LXC B;  3B5N C;  2E75 C;  1FDO A;  2BEQ D;  4HJG H;  3V6I A;  2E76 D;  1FU1 A;  1JTH B;  2WMM A;  2H89 C;  2YIU C;  3H1L J;  3AEC C;  3B5N A;  3VOP A;  3AE2 C;  1U7M A;  1H88 A;  2QSI A;  5AVT B;  3H1L G;  2FXM A;  1L4A C;  5APX A;  2IBZ I;  1KB9 H;  1EXI A;  2E75 D;  5KLI C;  2JO1 A;  3VP8 A;  5GTH H;  3H1H G;  1L4A A;  3EWK A;  2ZXE B;  2WIT A;  2WPV B;  2QJY C;  4IL6 E;  1PGJ A;  2KLV A;  3VYI A;  2FYU E;  2Z5I A;  1G2C B;  2RMZ A;  4K35 A;  1L4A D;  1PPJ G;  1J2J B;  4RES B;  1USE A;  3AE1 C;  1AFO A;  1L0N K;  3II6 A;  2RKL A;  3BRT B;  1RF1 C;  3BCC J;  3L70 J;  3L72 J;  3I5C A;  2MKV A;  2OYI B;  3B8E B;  1BSH A;  1AVY A;  2M5A B;  4D6T E;  3BCC G;  3L70 G;  1IFN A;  3L72 G;  1RF1 A;  3ABV C;  5KLV E;  4PV1 C;  1FBM A;  3P7K A;  1KYO D;  2O1K A;  4R4M A;  4BWN A;  1QLE D;  2YKQ A;  1OFC X;  1SQX K;  2AXT E;  3JSV C;  2SPZ A;  3CC4 P;  5AW2 B;  4C7R A;  1DEB A;  5APV A;  1NU1 K;  2N9Y B;  5CCG D;  1IFP A;  2WPS A;  3KPE A;  2FFD B;  4PV1 D;  3M0A A;  4H0L D;  1LWU B;  1PFI A;  1L2P A;  3EFG A;  2ZYG A;  3CXH D;  5KAF H;  1JO5 A;  1FJK A;  1KYO I;  4YXD C;  3M9B A;  3L73 E;  1G1J A;  1IJD B;  5B66 H;  3SWF A;  1NTZ G;  3V2N A;  1MZ9 A;  1KIL C;  1JY3 O;  4I7Z C;  2LR2 A;  3PRJ A;  4PD4 H;  1SLQ A;  2Z5H A;  1JY3 P;  1KIL A;  2LXB A;  2HYN A;  1FZG A;  1RE4 C;  3C8V A;  3S4R A;  1J1D B;  1GU4 A;  1KIL D;  1RE4 A;  1LJ2 A;  1UIX A;  1BE3 E;  4JPZ B;  1URQ C;  1N73 B;  1N8R Q;  1NTK J;  3PHL A;  1QL1 A;  5CJ4 A;  3IR9 A;  2KXP B;  1G2C A;  4RO0 A;  3CI9 A;  4AYC A;  1P84 H;  4WB4 A;  1NTK G;  1URQ A;  3AEA C;  1HGV A;  1YTZ I;  1S3J A;  1SQV K;  1ZRT E;  3A0B H;  4AUW A;  1URQ D;  3H1J J;  5TIS E;  2Q3E A;  3R4Y A;  3NMD A;  2R5B A;  3H1J G;  3D70 A;  2IPP A;  5CJ0 A;  1L0L J;  4IFD K;  1HH0 A;  2HLO A;  2J59 M;  2KSJ A;  1LWU C;  2H88 C;  1L0L G;  5AW5 B;  2IFM A;  2POH A;  3PJS K;  1JUN A;  1LWU A;  5KTB A;  1OMI A;  1HVV A;  2QM7 A;  3VMA A;  3O6Q B;  5AVS B;  2GM4 A;  1K05 A;  1T6A A;  3A2A A;  1EDJ A;  3ZDM A;  1VQ5 P;  2IYO A;  5AVW B;  1KB9 E;  1JEK A;  2YXR B;  3P8M C;  3A0H H;  2WTY A;  4H44 C;  2M3B A;  4KT0 J;  1QVF O;  5GTI E;  1J1E C;  2P58 A;  5GTH E;  2J5U A;  1M1J B;  1S5L X;  1J1D C;  2YNY A;  1R8E A;  4N3Y B;  1L0N D;  2QE7 H;  1GK4 A;  2HFE D;  1LTJ C;  2W6J H;  3Q5R A;  2ZFC A;  3RL0 C;  1GD2 E;  1BDC A;  1S9K D;  4H44 D;  3U1A A;  1Q86 Q;  1LTJ A;  1HJ0 A;  3H1I D;  1LTI C;  5AW8 B;  5KLV G;  3GHG C;  1SQX D;  4B86 A;  1AQT A;  3I56 P;  1JY2 N;  2N1T C;  3L71 J;  1SQB J;  3KZI H;  1JMM A;  4OGQ B;  3GHG A;  3RL0 D;  2FKW B;  1NU1 D;  3CWB D;  2A06 D;  3L71 G;  1SQB G;  2KOG A;  2N1T A;  1S5L E;  2D2C B;  1YJN P;  1M1K Q;  1FDI A;  4H13 B;  1UII A;  1W5C E;  2N1T D;  1EDI A;  4JF7 A;  4IL6 H;  3F5H A;  3WUT A;  3CX5 D;  3L73 G;  1HTL C;  3W67 A;  4XA4 A;  3GMA A;  4HH2 A;  1OXZ A;  3RBX A;  5APU A;  2B89 A;  1GDT A;  2WSF H;  1SQQ J;  3L74 D;  3WU2 E;  1S2E A;  2W8Z A;  1W2B O;  2IBZ E;  1W2E A;  1SQQ G;  2E43 A;  1T2K C;  3O6Q A;  4KJM A;  3RK3 B;  4YTP C;  2XKM A;  2IZ0 A;  4WVZ A;  1OVR A;  1RH5 B;  2AXT H;  4C7N B;  4I1L A;  1SQP J;  1NTZ K;  3VMX A;  1ZP0 C;  3LW5 H;  1OIP A;  1SQP G;  1T2K D;  2RH0 A;  2O3J A;  3M0D C;  1N2D C;  3P8C D;  1SQV D;  3FWN A;  1IK7 A;  2O1J A;  1YQ4 C;  1IFM A;  3CME P; 
#chains in the Genus database with same CATH homology
 3NXS A;  2NPS C;  1N7S C;  3B5N A;  3VOP A;  1A02 F;  1CI6 A;  1OWA A;  3M06 A;  4C46 A;  1ZV8 A;  1H88 A;  5AVX B;  5AVT B;  5CCH D;  1N73 A;  2R5D A;  2FXM A;  1L4A C;  3MGN A;  1IC2 A;  1NKZ B;  3KQG A;  5AVV B;  1N7S A;  5APX A;  1X9V A;  2C0X A;  2I1J A;  1J1E B;  4WY4 B;  2M8R A;  3HTK A;  3VMY A;  3H6P A;  4N6J A;  3VP8 A;  1MFZ A;  1FDM A;  4EIJ A;  1L4A A;  2ZXE B;  2OAR A;  1NTK K;  2OYH B;  2WIT A;  2NPS D;  1N7S D;  2XV5 A;  1SFC B;  1GW4 A;  5BU5 A;  1LTJ B;  2Q7C A;  5AVR B;  2KLV A;  2HPC B;  1FOS F;  2CPS A;  3VYI A;  3LID A;  3RL0 B;  4Y99 B;  2GUV A;  2Z5I A;  1G2C B;  2C9L Y;  1L4A D;  3OAK A;  1FZB A;  1J2J B;  5AVY B;  1T3J A;  2N9B A;  3TYY A;  4RES B;  1JCC A;  1N7L A;  1AFO A;  3HE5 A;  2KB7 P;  1GK6 A;  1L0N K;  3GHG B;  3II6 A;  1JOC A;  3BVH A;  3T97 A;  3BRT B;  1RF1 C;  2N1T B;  3VN0 A;  2Z4E A;  1KFN A;  3TSI A;  3I5C A;  2OYI B;  3B8E B;  1IFN A;  1RF1 A;  4W80 A;  1FBM A;  3HE4 A;  3P7K A;  2O1K A;  5AW1 B;  2YKQ A;  2P2U A;  1L0L K;  1SQX K;  5AW0 B;  3R2P A;  3RK3 C;  2WPR A;  4OH8 B;  4I2L C;  4N78 E;  4IFF A;  5AW2 B;  5APS A;  1IO4 A;  4C7R A;  1DEB A;  5APV A;  1NU1 K;  2H8P D;  5CCG D;  3CLQ A;  1NAF A;  2WPS A;  3V4Q A;  1M1J C;  3KPE A;  1VDF A;  4IFM A;  2FFD B;  3M0A A;  2WZ7 A;  1GL2 D;  1LWU B;  4EOT A;  1PFI A;  4N78 D;  3EFG A;  3TK1 A;  3A5T A;  3M91 A;  3P8C E;  1JO5 A;  1FJK A;  3TNU B;  1M1J A;  1LGH B;  3VMZ A;  4HYT B;  1XTG B;  1FJP A;  3M9B A;  1LTT C;  3V2P A;  1G1J A;  3E1I A;  1IJD B;  2FYZ A;  3SWF A;  2W27 A;  3HD7 C;  3H32 A;  3RK2 B;  3V2N A;  1MZ9 A;  1JCD A;  1KIL C;  2WT7 A;  3SWY A;  1JY3 O;  5AVQ B;  2XU6 A;  2E42 A;  1HJB A;  2L5G B;  1SLQ A;  1T3U A;  3HD7 A;  3C9I A;  2Z5H A;  1JY3 P;  1KIL A;  2C9N Y;  2HYN A;  1ZR2 A;  1FZG A;  4GKG A;  1RE4 C;  2OYH C;  1CW5 A;  3N7N A;  3NTN A;  2H43 A;  3B5N D;  1J1D B;  5KLV K;  3HD7 D;  1GU4 A;  1KIL D;  1RE4 A;  2OYH A;  2YMY A;  5AW7 B;  3L36 A;  5BVZ A;  1URQ C;  1N73 B;  1QL1 A;  5CJ4 A;  3IR9 A;  2NPS B;  1N7S B;  1G2C A;  1SQB K;  3OJA B;  3CI9 A;  4AYC A;  2QM8 A;  2IX7 C;  4JYC A;  1JY3 N;  4WB4 A;  1FZC B;  1URQ A;  1HGV A;  3EQ2 A;  1L4A B;  1RF0 C;  1YTZ I;  1CZQ A;  1N86 A;  2IFN A;  5AVZ B;  1SQV K;  2HOD B;  3KYQ A;  1MV8 A;  4AUW A;  2WSE H;  1GU5 A;  1HBW A;  1RF0 A;  3LIE A;  1URQ D;  1FZE A;  5CMZ A;  3KDP B;  5APQ A;  3O8Z A;  4W7Z A;  1X79 B;  1NO4 A;  1LTS C;  2YO3 A;  3NMD A;  2R5B A;  2P7J A;  2Q9I A;  4I6M C;  4O9B A;  5CHX A;  3VP9 A;  2IPP A;  5CJ0 A;  1HUC A;  5APW A;  3OA7 A;  1YYC A;  5APT A;  1GTW A;  2YKP A;  3L37 A;  4IFD K;  1HH0 A;  2HLO A;  2J59 M;  2KSJ A;  3UIA A;  1LWU C;  4M3L A;  4AQR D;  1M7L A;  5AW6 B;  1NKN A;  1SQQ K;  1SVF A;  2JJL A;  3HE4 B;  5AW5 B;  2Q3I A;  2IFM A;  2POH A;  1DH3 A;  1EQ7 A;  1FAV A;  1JUN A;  4WBA A;  1G1I A;  4C7N A;  1LWU A;  2JEE A;  2A45 H;  5KTB A;  2VRS A;  5KJ7 C;  3MUD A;  1RY3 A;  1HVV A;  2QM7 A;  1GL2 B;  3RK3 D;  3M9H A;  3RK2 C;  4DOJ A;  3N4X A;  1T8Z A;  1NHL A;  2R32 A;  3HUS B;  3L35 A;  5AVS B;  5KJ7 A;  2GM4 A;  2FYU K;  3A2A A;  1SQP K;  1H8A A;  5AVW B;  2H7H A;  1WRG A;  1ZLL A;  1JY2 O;  3P8M C;  1RE3 C;  2WTY A;  1JTH A;  2M3B A;  3MTU E;  1VPC A;  3V4W A;  1ZR4 A;  4WY4 C;  1J1E C;  5CCH C;  1M1J B;  5KJ7 D;  1S9K E;  1J1D C;  1JY2 P;  1LT9 B;  3IFM A;  4GT1 A;  2I1K A;  1YTZ T;  1RE3 A;  2A45 I;  1E5W A;  2YNY A;  4XE5 B;  3A7O A;  4N3Y B;  1NWQ A;  4WY4 A;  3BAT A;  5CCH A;  1SFC C;  1GK4 A;  2HFE D;  1LTJ C;  2XZR A;  3V2R A;  1GW3 A;  1QL2 A;  1AQ5 A;  1JNM A;  2ZFC A;  3RL0 C;  1GD2 E;  4Y99 C;  3B5N B;  1S9K D;  2A45 G;  1DX7 A;  3M0D A;  2YO2 A;  3HRN A;  3U1A A;  1CI6 B;  3HD7 B;  3V5B A;  1SFC A;  4WY4 D;  1KIL B;  1FZC C;  1LTJ A;  4LLH A;  1IFD A;  2HPC A;  3BAS A;  1IK9 A;  1LTI C;  2KP8 A;  2NPS A;  5AW8 B;  1IFJ A;  3PP5 A;  1HWT C;  3GHG C;  3HTK B;  4B86 A;  2XNX A;  4GIF A;  2PP6 A;  2PAJ A;  1JY2 N;  2N1T C;  1FZC A;  1H89 A;  1SFC D;  1JMM A;  2OYI C;  3L4F A;  3GHG A;  3RL0 D;  2FKW B;  2HOD A;  5APY A;  3V2Q A;  2KOG A;  4W7Y A;  2N1T A;  2WWW A;  2O01 H;  2OYI A;  2BAS A;  2P67 A;  4KHX A;  2Q5U A;  2YKO A;  1URQ B;  4JYB A;  2WPQ A;  3MD0 A;  3HE5 B;  2N1T D;  1NH4 A;  5AW3 B;  2C0W A;  4JF7 A;  3BRV B;  1FZF A;  1NTM K;  2HG5 D;  3M9Q A;  2XDJ A;  4ZKP A;  2GUS A;  2FFD C;  1HTL C;  5CCG C;  1KQL A;  1XTC C;  4LC1 A;  4XA4 A;  1SP4 A;  4LGD E;  1HGZ A;  2CPB A;  1RF1 B;  4HH2 A;  3MIW A;  1GL2 C;  1OXZ A;  1WT6 A;  3G3Z A;  3U59 A;  5APU A;  1FZA A;  1Z56 A;  1GDT A;  5AW9 B;  2FFD A;  2WSF H;  5CCG A;  3HUS C;  1MUU A;  1LTG C;  2MJZ A;  1IFI A;  1LTB C;  5BU8 B;  1GL2 A;  1X8Y A;  1CSB A;  5AVU B;  3TNU A;  1W2E A;  3U1C A;  4ZKU A;  2E43 A;  1T2K C;  3HUS A;  3RK3 B;  2XKM A;  4DZO A;  1FOS E;  1GZL A;  2P1J A;  2KYV A;  2J58 A;  1LT9 C;  4C7N B;  2W6A A;  4I1L A;  1NTZ K;  3WMM 0;  2LKM A;  3VMX A;  3CL3 D;  3LW5 H;  1KZU B;  1LT9 A;  3P32 A;  2WSC H;  3RK2 D;  3VTP C;  3B5N C;  2R3C A;  5AW4 B;  1T2K D;  1LTA C;  3M0D C;  1N2D C;  3H32 B;  1KFM A;  3P8C D;  2W6B A;  1ZN5 A;  3A3Y B;  2WT7 B;  1FU1 A;  2O1J A;  1JTH B;  1NOH A;  1N73 C;  1IFM A;  3NFQ A;  1A02 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...