2O1SA

1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
618
structure length
536
Chain Sequence
FDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPALPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1-deoxy-D-xylulose-5-phosphate synthase
publication title Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 169
structure length 536
sequence length 618
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.7: 1-deoxy-D-xylulose-5-phosphate synthase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
A PF13292 DXP_synthase_N 1-deoxy-D-xylulose-5-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA02
2EZ4A 4KXYA 2PANA 4QPZA 1WCIB 3DUFA 1YD7A 4K9PA 2IEAA 4JUAA 2BEVB 3F6BX 2QTAA 2UZAA 4KXUA 1X7ZA 2C3MA 1UM9B 4JUDX 5FEMA 1W88A 2C3YA 1KEKA 3FSJX 1X7WA 2G28A 1OZGA 4JUCA 1Q6ZA 4K9NA 1R9JA 1UMBA 3RIMA 2JGDB 3HWWA 2XTAA 4D5EA 4KGDA 2EZ9A 1PI3A 4COKA 3HWX1 4ZP1A 3FZNA 2BP7A 2WVGA 3EY9A 3EXFB 2JLAA 2R5NA 1UPAA 2OZLA 5K6RA 4XEUA 1POWA 1V16A 2BEWA 3ZHUA 1AY0A 5EXEA 5EJ7A 3L84A 1UMDA 2V3WA 5I5EA 1T9DA 2PGOA 2IHTA 1X7YA 1DTWB 5C4IA 2IHUA 3EXEB 1IK6A 4K9QA 5K2OA 2UZ1B 1V1MB 4K9OA 1NI4B 3OOYA 3LQ1A 3AHGA 1UMCB 5EJMA 2O1XA 5K3SA 1YHZA 3AHHA 2BEUB 2G67A 5HGXA 1T9CA 5EJ9A 5IMSA 5DEIA 3M6LA 3HYLA 3DV0B 2VJYA 1Z8NA 4K9KA 4JU8A 2J9FB 3KOMA 3EXIB 4MQ5A 3E9YA 2Q28A 1X7ZB 1YI1A 3LPLA 1V5GA 1X7XB 1W88B 1W85B 1X7WB 4K9MA 2WVAA 3IAFA 2R8OA 1PO7A 2BFEB 5EJ5A 2JIBA 4QQ8A 3LQ4A 2FWNA 2JI7A 3EXG2 5DGTA 2BFBB 5EJ4A 2XT6A 3EXHB 1WCIA 3D7KA 3EXHC 4GG1A 1U5BA 1POXA 2BFDB 1TKBA 2BEVA 4MPRA 2VK1A 1OLUA 4Q9DA 1L8AA 1OLSA 4D5GA 4RJIA 5I51A 1T9AA 2VBFA 1V5EA 4GP9A 1V1RA 3AHFA 3DVAA 5HYVA 2JI8A 1X7YB 3FLMA 1YI0A 5K6TA 1OLXB 1QGDA 1V11A 4KXWA 2Q29A 2QTCA 2JI9A 3IAEA 1TKAA 2C3OA 1X80A 2BFFA 4C7XA 2Q5QA 1B0PA 2R8PA 4K9LA 1TRKA 1NGSA 3M7IA 2YIDA 4GM4A 2EZTA 1GPUA 2Q5LA 1QPBA 4KXVA 1TKCA 2G25A 1QS0B 1YNOA 3JU3A 5DGDA 4FEEA 4MPPA 1DTWA 1BFDA 2Q5JA 3M34A 3EXEA 4JU9A 2UZ1A 3AI7A 2X7JA 2WVHA 4MPJA 2Q5OA 1UPCA 1V1MA 2BFCA 3DUFB 1JSCA 1RP7A 2PDAA 4KXXA 4C7VA 5I4IA 1OVMA 3AHIA 5EJAA 4QELA 3EYAA 2VBIA 1UMBB 3DV0A 1T9BA 2J9FA 4GM0A 1U5BB 3EXIA 3EA4A 2PGNA 4GPEA 4JUBA 1OZHA 1OLUB 1N0HA 5AHKA 2BP7B 1OLSB 1X7XA 1W85A 1ITZA 4JD5A 5ERYA 5HHTA 4FEGA 3M49A 1UM9A 2OZLB 3ZHSA 1V1RB 1V16B 2BEWB 4GM1A 2EZUA 3DVAB 3AHEA 1UMDB 2BFEA 4MZXA 1OZFA 2E6KA 1Y9DA 3ZHVA 2BFBA 1V11B 2Q27A 5HJEA 1PYDA 2Y0PA 3EXHA 2AG0A 3ZHRA 3F6EX 1X80B 2BFFB 2JGDA 3AHJA 3UK1A 2C3UA 3MOSA 4RJKA 2BFDA 1ZPDA 1YHYA 4WBXC 2JI6A 4JUFA 2C42A 2JLCA 2W93A 1MCZA 2C3PA 4RJJA 3UPTA 3EXFA 3AHCA 2VK4A 5EJ8A 2YICA 2XT9A 3OE1A 5ESDA 2NXWA 3LQ2A 2VBGA 2DJIA 1UPBA 2AG1A 2IHVA 1OLXA 2EZ8A 5EJ6A 2VK8A 2BFCB 3AHDA 5EXDA 3ZHTA 1PVDA 3ZHQA 5ERXA 1NI4A 2FN3A 1UMCA 3EXG1 1YBHA 2O1SA 1V5FA 2BEUA 5I5GA 1QS0A 2C31A
chains in the Genus database with same CATH superfamily
2WT9A 3DQQA 3O8LA 1NUPA 3D2AA 3BULA 5FHRA 1GUBA 1K7XB 1GR0A 5K3FB 1TC1A 3H04A 3DMPA 2JD2A 3OE7A 4LC9A 2XWBF 2KQUA 2ZTHA 4KQ9A 1FSGA 2QDKA 2NO5A 2G77B 2VTEA 3VFDA 3U2QA 3GWZA 5J4KA 1COZA 4EYQA 1OOEA 2A7QA 5DN9A 2HHAA 3QLVA 4K9PA 4L9RA 3PWSA 1K8ZB 5I8WA 3BILA 3GFSA 3K73O 2ORWA 4R2MA 1XEWY 4RMIA 3ZWWA 4FB5A 5ERGB 2FFJA 5GONA 5ILQA 4E46A 2BI7A 1FYFA 3UMFA 3IT3A 2O3RA 1UM9B 3ZKWB 1EI9A 4MS1B 2DBRA 3KAPA 3T8YA 1RM3A 2A9OA 4EHAA 4TMZA 1AKVA 1NLZA 4B1FA 4I9NA 1RJ9A 3BXGA 1W2WB 1PG0A 2WYVA 3E1KA 2C9OA 3H9BA 4P4GA 3SAJA 1QFXA 2PYZA 1DO0A 2Q1UA 1WMSA 3MTIA 4ZAXA 5B4TA 1BHQ1 1E3WB 1QG4A 1P7WA 4DDTA 4Z1MD 4BO3A 2UUAB 1SCDA 4F5ZA 2C5BA 4EGFA 4U6QA 5GQSA 4B6SA 4PO8A 1M1ZA 3UC9A 1QPZA 1VJDA 7REQB 3I4FA 4P32A 3NASA 4ZVTA 4YJ2B 3OFJA 1W5AA 1I4LD 4IQFA 5C8YB 1EWQA 1PT8A 4ZO8A 4RE6A 5IJZA 3HSYA 3PRHA 1J21A 3L01A 4EMSA 4QM6A 2PD6A 3P5SA 5EKTA 4DLPA 1V4NA 1YR8A 1ZH2A 2I6UA 2Q2VA 2JG3A 4E1AA 4NFHA 1GL7A 3C8DA 5JNUA 3LT1A 3VHXA 2PH1A 4EITA 1NW9B 3R0ZA 5IAKA 2AD5A 2Z2XA 1GRRA 2JLAA 1GTRA 2W2LA 1IUKA 4V1CI 1J8VA 1KDPA 1WM1A 3OQIA 2UUBB 3R09A 2QTVA 1LU9A 1YB7A 2I3AA 4YWJA 3UANA 2B4AA 2ZBDA 4L4SA 1N2HA 4AZ0B 2GKSA 1SAYA 4TSFD 1ZGAA 2HO4A 1UZLA 2VA9A 5H8WA 2Q2QA 5BN1A 1POWA 1RC0A 2NT3A 3NHRA 3FOWA 2HMVA 3JVEA 4FKZA 4LSZA 3ZIAA 4AUMA 4DQUA 1AQYA 3L7AA 4CL3A 1IXKA 1UMDA 1LLDA 1SBCA 3KZVA 2HTEA 3TZQA 5FWAA 4DSTA 3OU6A 4H1VA 2VO1A 3GLGA 2A1UB 1CUHA 1K2WA 4AMBA 1GLGA 1TZMA 1Z4QA 2XYGA 1XMSA 2WSSD 2YZ2A 3EGXA 3RV4A 3ITKA 4G0ZA 4J91A 4ETMA 4DPLA 2DT8A 1GOTA 3UWKA 5BSWA 2L19A 1WQ3A 1X7YA 2QXTA 5EQFA 3LCMA 5LQUA 2OFPA 4IIJB 4WINA 2XBMA 2BR4A 2B25A 4F60A 3LLSA 3GEIA 2YMPA 1AD2A 3KQPA 4HYTA 1RQLA 5ARCA 3VYSB 1PBNA 1JDBB 5F64A 2ATCA 1YONA 2QSUA 2ZUCA 4W5QA 4HS9A 4AB1A 1Z8DA 4LJYA 4MP3A 2WP0A 1IY8A 1I4EB 1U2QA 4OD0A 3WL8A 4BV9A 3JAWB 1JG2A 1GPYA 2WFLA 2QPLA 2CMHA 4F91B 3DHEA 3LQ1A 1L7AA 1UBSB 3R0XA 2DUNA 3MJCA 2WTXA 1TVEA 4CEJA 1ULTA 2D1YA 2FW6A 1SH7A 5CCBA 5AVSA 2HRRA 3KZCA 5K3OA 1HEUA 1L4MA 1MJ5A 1UBNA 2UUPA 1I7SB 4N5LA 3B9RA 1GZSA 1GVNB 1X38A 3CVOA 3NUZA 3UG7A 5FRDA 4BEBA 5KTMA 1FYEA 2ESRA 1ZIXA 1NM5A 3QELA 1GQ2A 1L8OA 3AUFA 2UVQA 3SEFA 1KH2A 1P9RA 1Q0SA 2XUZA 4JL8A 4LOIA 2Q1WA 4ZDWA 4FGKA 2NTYC 2GNAA 2ZREA 3LP5A 1Y9JA 3IUQA 3IMCA 1C30A 1PQPA 3EPKA 3HUEA 4ZJYA 3VU1A 4CLRA 2XB4A 1PLLA 1VG8A 1ISFA 1P1JA 4GMGA 5FUWA 2GLTA 3OJLA 1EDZA 5CXSA 3FUXA 3VXKA 4IDCA 2QT9A 1R6TA 2JBAA 4RULA 1KYTA 4R0MA 1CQIA 3KAJA 1WS6A 1SVSA 3IAHA 4ND1A 4O33A 2R8ZA 1QFSA 3F6PA 1J20A 2R96A 2B6NA 4TRRA 3EBPA 3EF0A 3CIFA 3LY9A 4YMVA 1YQWA 1OROA 4GGMX 4OGWA 3A6DA 4MS4B 3G88A 3RFFA 1PJSA 3RSLA 4QJIA 1CUVA 4QO8A 3FCAA 4O2AA 1EK2A 1TQ8A 1K97A 2Q49A 2QRZA 3K94A 4G0YA 4GI5A 3ZJTA 4CIDA 1I32A 1RQ2A 1YDEA 3O82A 4KMMA 1KPHA 4D96A 2Y66A 4MYRA 2J9ZB 4A6EA 1B6SA 4LHWA 2C96A 5DM2A 1EUZA 3HJUA 1PTKA 1QH1A 3KJHA 4IDQA 1WLYA 3QTBA 3B13B 1AUVA 2IZOA 1WTCA 2MMGA 4CIAA 2EKPA 2AG5A 4IIGA 3UMBA 2QLBA 1E20A 3PZRA 4NG5A 3MEQA 2CLDX 2C00A 2VHTA 4JLUA 3SF0A 1B8OA 3AL2A 3SJAA 3T5TA 1F6BA 1QCCA 4AS3A 3THXB 1NY6A 3DMRA 5CITA 3KEMA 1SELA 1C0LA 4BVGA 3OCZA 3OZFA 1QLWA 3N2LA 4J1QA 4TMXA 1N2BA 3K0CC 1JNXX 3FG9A 2HIAA 4MJ7A 1MDBA 1E92A 1TF7A 4EHDA 1JHQA 4QFMA 3EK2A 1I94B 1E9SA 3RUIA 1CQPA 1IBLB 1ZLYA 4UARA 4YVFA 1H1TA 1MN6A 2JFNA 4YS6A 4BMOB 1SD2A 3OKAA 2ASEA 5J2UA 2IE0A 2I4OA 4QPNA 1QZTA 4JLWA 1B93A 5FNVF 3IAM1 1U9IC 4WOBA 2F8MA 2OBLA 5KWIA 5DWVA 1K5HA 4F85A 1SUEA 4Z7OB 3GA7A 1JJBA 2BLLA 4A15A 5D1HA 3P71T 3QE0A 1G3QA 2GN0A 3L4BC 3MA0A 4KZKA 1IZ8A 1K92A 1UJ6A 3QA3E 2Z6QA 1G6Q1 2YHBA 4UASA 5JASA 3U56A 1IXZA 2VZ9A 1WXWA 3IPYA 5JO9A 2VDPB 1OIVA 2C2WA 4IYJA 3WOVA 2W37A 4YJ3F 4JIMA 2JI8A 2I4RA 2WICA 1XFDA 4MRNA 4QJ3A 4MGHA 3FLMA 1ORDA 4HZGA 4OOFA 3DTVB 3OSZA 1KI8A 4JC0A 4WGGA 1JQEA 3CNHA 4W1QA 1MX9A 1NVKA 1W44A 1W75A 5DXAA 1LFDB 1PG2A 2GFQA 2GHRA 3EG9A 5K51A 4H9GA 2CXTA 1GSAA 3HLYA 3CBGA 2FPXA 3R0JA 4RK6A 3EEQA 3W5CA 4TQ9A 3B70A 1QE0A 4Q7JB 3I09A 3LCUA 4TV9B 1QYVA 3Q7QA 5G40A 2HCJB 1OBCA 4PLCA 3H2KA 1B0PA 1LNQA 1AT1A 4K9SA 4CQLB 3SLGA 2O59A 1E2DA 3ANLA 4IHQA 4WEOA 3EG5A 4MKFA 3ESBA 4HUJA 1GZHB 2QL5A 4EMUA 1T2VA 3D8SA 2Z1DA 4MUFA 3WIDA 4ZYXA 1YRLA 2ZS9A 5JFOA 1N78A 3S4YA 2EC5A 1EM8B 3ZD9A 4DMCA 4OGFA 4V1CA 4UBKA 1Y6RA 4KX5A 5JVDB 1M2WA 1W5SA 5AM2A 1XQYA 3GL9A 1CSEE 1E2KA 1G5PA 4TT3A 3CBQA 5K0NA 4KO3S 2ZR7A 4YT2A 2DRIA 1E9FA 2B61A 2I2BA 1VMIA 2QX4A 4UD6A 1C7FA 2Q8NA 4PONA 4YREA 1RC8A 2V7GA 3K9BA 1ZN9A 1AGXA 1B3BA 1Y8QA 1NW8A 2GTHA 1NJ6A 2EKDA 3E84A 3ETDA 5T6MA 2D5LA 1DL5A 2PO7A 3OFSA 1L5RA 4EX7A 4F3NA 4BEVA 2Q3JA 2JCBA 2E3JA 3CF6R 5BT9A 3OY7A 3P32A 1GKKA 4B2LA 3FZQA 3B1ZA 2P6MA 1OA1A 3LAWA 1JMVA 1W48A 4HADA 1HE4A 3NOQA 4WX2B 3TZEA 3VPBA 3JR3A 2P9BA 4TS4A 3N2GB 4QRHA 2IYFA 3K6RA 5EJ2A 2PGLA 2D1FA 1FMTA 4HQ0A 2PRSA 1E18A 5FIUA 2GJ8A 4R7ZA 1F2UB 4EBBA 2OC4A 1LGYA 5K5EA 4L74A 1BWSA 3HL0A 1ZMXA 2VJCA 2APJA 2XNCA 2ZOSA 1NLMA 1NR1A 1AO3A 2GD6A 3E82A 4Z9BA 1F5SA 3ZS8A 3PXGA 4F97A 1ZCJA 3D0OA 2EL7A 3DDCA 2IXGA 2XGSA 4ND7A 1T5BA 1N4AA 2DUUA 4NBNA 1KMMA 5ARBA 4J0EA 1RQNA 2FEAA 1R8YA 5BQPA 5D6NA 1U2SA 5AMXA 2O8NA 3CH7A 3GFFA 4DG5A 2IUUA 3X43A 4TT8A 2HA2A 4HAXA 4BECA 3LUBA 2PZGA 2X2FA 5AM1A 4Q05A 1RZUA 1AS0A 3E0XA 1NXVA 1COWD 2AF3C 1C0KA 1VRVA 2GAOA 1AHHA 2RK6A 1I0IA 4G4IA 1ISGA 1ULBA 4KQJA 5D8DA 3EZYA 5FBLB 2Q1YA 2R00A 1KGDA 3HU3A 5LZ8A 3SVZA 1ZAYA 3LG2A 2H1LA 1V25A 4UC0A 1U8YA 2C4KA 3EA4A 4TYNA 1CUUA 3CPEA 4C4XA 1J49A 2ECQA 3MT9A 4Y2YA 4QRIA 4D2IA 4EJ6A 4UPEA 3C41J 4LRXA 2C7OA 1Z5PA 5DN6D 4OI1A 4KDFA 3H7IA 2PWBA 4UMEA 3ZQKA 4DCMA 3Q11A 4IQGA 2IYTA 2NQTA 4RKEA 1GITA 1ZMBA 1KHHA 5KYTA 3ORRA 4MVJM 3PTLA 2F1IA 2WNIA 3RU2A 1VSQA 3K96A 2JAOA 4BO4A 4E21A 1V3TA 4C7OA 1TD1A 2WKQA 1OYOA 3E03A 4MV3A 4RGQA 3V8NA 3WIOA 1QKIA 2VNIA 3FPJA 3M6VA 4DA4A 4B46A 2FE1A 4URZR 4A2CA 1NMXA 3WI7A 1FPQA 2EZUA 2W2PA 1TYZA 5BWNA 4D74A 5H70A 2VLIA 1BEUB 3O1HB 5JD4A 3EQ8A 1N5OX 1SUWA 4A8HA 1TZKA 1Y9DA 5EUBA 1GUZA 3MBKA 1KDYA 3BIXA 2BI4A 3T61A 1EESA 1N2GA 1V11B 2PX8A 2M6RA 3ER6A 4N6GA 3GIDA 1M0WA 4YMUA 1PJ4A 4NF2A 2C5GA 3GC6A 4EFDA 3DULA 1JFVA 4QTUB 4HB0A 4QU0A 4EJSB 1QO7A 4R0VA 3U9SA 4WK4B 5I9MA 2ZI4A 3NRBA 4HDNB 1F0KA 1A5AB 5EVCA 2OR3A 1UQTA 1P75A 1PV1A 1XD8A 3E9ZA 4I8IA 4J7CA 4HN2A 4ZOBA 1E1QD 4OQNA 5E6RA 2HB6A 3L41A 1XCMA 2TYSB 4TXJA 2PTGA 3D6AA 4JROA 4KE7A 1XKXA 1R3DA 2O1WA 5BNIA 2Z5LA 1GZDA 3EUEA 4BMZA 4LFAB 2I33A 1S8OA 1P9LA 2JFGA 2Q0SA 4M6WA 2VJLA 2IPAB 4PNZA 1VXOA 1G5TA 1VLLA 1ATIA 2WTBA 3DOUA 3DV9A 4EENA 4NYJR 5JC8A 4JEUA 2XVYA 1UJMA 3GWGA 1U3VA 3QUQA 4MUNA 3U1TA 4CV2A 3OM1A 4J2TA 5DHAA 3M1AA 3W9UA 3WWCA 1PSWA 1S01A 1TMOA 1WBJB 4NCIA 1L5VA 2WJJA 4BVKA 5L3QA 4XKJA 4LSGA 3AWIA 4C3ZA 1UM8A 3ZZTA 4QE3A 1EX9A 1JG6A 3R3YA 4DV1B 3IOBA 1QVZA 3U3ZA 5JT1A 4BJHB 3STXA 1UK9A 5H68A 4FHZA 1US8A 4Y2HA 1JTEA 3RW9A 2CFRA 3EQ2A 2QE6A 2GNOA 3KQSA 4INPA 3P5BA 4MWBA 3I6IA 4DQLA 4K88A 1WUKS 4TZKA 1ZA2A 4M8SA 1N2EA 1P2BA 2QA5A 4PS1A 1T13A 2I1WA 2J1LA 3I2JA 5KYKA 4MR8A 5TPWB 4XYBA 1E8NA 1MRNA 5BPFA 1NYTA 1K3TA 2CWWA 3LY8A 1A96A 3PRYA 5JSZB 4RTPA 1OQAA 2IC5A 1T2FA 3UCEA 1H6CA 1HNZB 3IUNA 5JECA 5BN4A 2DFVA 1KC1A 4KN6A 1EYZA 4Y1RA 4C5AA 4HL6A 4H77A 1BS9A 1I4DD 2FN3A 2Y3IA 3KQLA 2B6HA 1AX9A 3KBBA 4ODIA 1JZSA 1W34A 3X1MA 5TS2A 3DPSA 4G5SA 1NVGA 2LD4A 3DL2A 2VZLA 2FXIA 1V5FA 4BKOA 1BVUA 2ZIFA 1H2FA 4NOKA 2BGRA 4TTQA 1L7RA 3AOGA 1QS0A 4B8WA 2YV3A 4X41A 3UAWA 5IYZA 1QYDA 1XQWA 3QHQA 4HUQB 4DWJA 3MD0A 3P0FA 1EUQA 3RTDA 4BC1A 4BB9A 5B4UA 5IAAA 3EE6A 2H5EA 2HNKA 1A9XA 3GFBA 4JVMA 1CR4A 1ZYUA 2R86A 2VRBA 3BMOB 3NJ4A 5FUVA 4LF5B 2EEZA 4YLGA 1H42A 1PNRA 2BMVA 1H0HA 2FMKA 3NG1A 4RGYA 1LWNA 1XAIA 2WG2A 3FIJA 4CMGA 4LTMA 4WOKA 2AX4A 3V97A 1C9YA 1MVLA 1WJGA 4F2WA 2HD4A 3KQKA 1RHKA 3SN6A 1L5WA 1ATZA 3L9XA 4EARA 5TARA 2OXFA 4YAJA 3E4CA 3IXLA 3OTHA 3A8TA 4HX5A 4UPVA 2PYDA 3OZCA 3EPLA 3RTAA 5LMCA 2EBUA 4KXUA 1Z7BA 5FWYB 1QB7A 1E4EB 1J97A 1SM4A 1V6SA 1WQ4A 3QU2A 2QU8A 1ZSYA 3HGMA 2QU7A 2JGMA 3BXFA 4UAUA 2H11A 4DCPA 4UUBA 2FX2A 4G8DA 4LFBB 1SU8A 2QD5A 2QRQA 4E6PA 1JKXA 4PC6A 3FNIA 5LNK6 3FRHA 3O83A 4QLAA 3GN1A 2HDWA 4BNIA 2BGWA 2X0IA 1JR3D 5DI3B 2EVWX 5EZQA 3LPDA 4LQDA 5SYMA 2W2KA 5FNZA 3KYJB 1TZJA 2I8CA 3A4TA 3RC3A 3Q3VA 4F1KA 4Z51A 5DRYA 4ZYUA 2YWCA 2O8FB 4LJ6A 3M0EA 3GRAA 4RGVA 1ADBA 2X15A 4TWRA 1WZ2A 3DL7A 3GXOA 1E7RA 5TQJA 3ZD6A 4L8VA 3LLCA 1AV7A 1NVDA 2YRFA 1HGXA 1CRPA 3N3BC 1HDYA 2EKQA 3H6HA 1OYYA 1Z0IA 2WU0A 3FPSA 3FXAA 3QVSA 4R40A 1CUWA 4Q66C 4X7PA 5DHTA 4XTRA 2WQ7A 2VSOA 1VE7A 1BDMA 4NH0A 3VZSA 1G21E 1JT2A 4WFJA 1T2CA 2JIZD 4R8KA 1GAWA 1G66A 1I30A 1UIRA 4YEDA 3PR3A 1T2UA 5EZYB 5TDHA 4QGHA 4NU0A 3DD1A 1DUSA 1M3SA 4JXZA 2D4AA 1OSNA 1V16A 2JRLA 3FDXA 3JQFC 4NYMR 4OFWA 1U0BB 4AZ3B 3R5SA 5EXEA 4L15A 4FGZA 5FA5A 4ZU1X 1XALA 3DHWC 2PXAA 5AJUA 5JQGA 3SIPA 4G0PA 2JHPA 4A91A 3EZ9A 2G1AA 1R0RE 3ONVA 3KO8A 2W5UA 2X4IA 3MIZA 2OD9A 3IUSA 3IALA 4OSPA 5F9HA 1YKGA 2GMWA 3CW2A 2G08A 1H1LA 4MHTA 3FFBA 1SOVA 5DF1A 3ZY6A 4TKMA 1AF7A 4CEIB 1FRFS 2J6CA 1Y48E 1STOA 3H1GA 4H17A 2BGIA 1W36D 3P52A 1NYLA 5HZKA 3M9WA 2HV9A 1QHFA 4KKVA 1XRNA 1SZCA 1XX6A 3DTYA 4PBSA 5TGTA 1D0IA 3T7EA 3PE6A 4KTTE 1TOAA 4BRSA 1DARA 1NUAA 3H4MA 4LBWA 1IUNA 5JS8A 4GBGA 4TUYB 4YP5A 2FRVA 3QOYA 4DGQA 1VLZA 2FQ1A 3TVYA 4DHWA 2X9GA 4N48A 4LK3A 3KTFA 2JIMA 3E3MA 4GS5A 1Y8AA 3TZKA 4YX9A 4XRGA 1RU3A 1IM2A 1ONBA 2O14A 2CNLA 3ANSA 4WOCA 5K3SA 2G5TA 4IFBA 1GDHA 4BU1A 1CR0A 2VI5A 3HXPA 3E5RA 3V55A 4BMDA 4ANFA 2H1HA 5LXTB 4MTLA 4MKHA 1CY7A 3DEYX 9MHTA 2G5CA 1YAHA 3PVZA 4Z86A 4LJ4A 3PNQA 2GBLA 1HO3A 2UYOA 1RWMA 2V65A 3A05A 1GSHA 2G9UA 3W5UA 2JA2A 4B3DA 3C5HA 3OT1A 1Z33A 3RQSA 4DOMA 2H1FA 2X0FA 3KEOA 4P0QB 1K4YA 5TEWA 3WGVA 2BM8A 3KHUA 3WADA 4G1CA 5A4DA 1QOPB 1N8NA 3S2UA 4HGPA 1HLPA 2ENUA 4J1TA 5BUZA 1L8XA 2MINB 3ITDA 1Z2PX 1R8SA 1JAYA 2O54A 2LCFA 2PQMA 4K2AA 3OA2A 1NULA 3NHJA 3BK2A 4PLFA 1GG8A 3PQ3A 3AUKA 1DKQA 3QRWA 5EZSA 3S44A 1X1QA 5F23A 5HQ3B 4C03A 3D2CA 1QHNA 5LKAA 2QUBA 1UFVA 3ELUA 3ET5A 3DVSX 2I71A 2IDKA 1XTBA 1CR6A 1WR8A 3RYHB 2TRSB 3GRVA 4GH5A 4DZRA 1FS4A 4ZHQB 3UK2A 1Y4UA 1U3CA 3K9HA 5DHQA 4H4DA 1SVMA 3G5MA 3T9FA 2QPOA 2PFGA 2V4UA 3QBTA 4XD2A 3WZLA 5GAJA 4MLCA 4RD2A 2PRYA 2A9FA 1L5KA 4L9SA 3DL0A 3RFCA 1WBDA 1GTL1 2GPYA 3ZGZA 3K4HA 4BTVA 2IP1A 2PWZA 5KU7A 5DGXA 1RM5A 3OLYA 3K31A 4TL9A 3OQNA 4FR0A 5D86A 4MW9A 4OU4A 2C9CA 1YQXA 4XLLA 3NONA 1UKAA 4PHTA 2WWGA 1DWOA 3CUUA 2XVMA 3DMYA 3RAPR 4YCMA 5IHPA 3G2OA 1EUYA 5JEEA 3RDPA 3ZWVA 1MW8X 1E4VA 1U3TA 2C4NA 3OEHA 1GPBA 1VGRA 1YJAA 2VJPA 3EMKA 4H3SA 1GG5A 1PR1A 1XMJA 4RFLA 1TF5A 3W8EA 2JLRA 3D7KA 2B8NA 5T3UA 3MTBA 1XXHB 1U5BA 5EQTA 3PDCA 4RHFA 2A5FA 2OK7A 2WZQA 3TZCA 3X2SA 2H4FA 3AEZA 1IOWA 2VYQA 2Y05A 4MEAA 2FJ0A 5HFAA 3PG5A 2OFWA 1E5LA 5LM3A 5IUNC 3JQBC 4Z1OA 3UJNA 4GR4A 1HQCA 3K20A 2QXUA 4BMCA 4WDRA 3ZKWA 4MS1A 2GJKA 4WASA 4W6QA 2VAXA 4JBNA 5BR8B 2CUNA 4IZOA 3RTGA 4D5GA 4LJRA 2VBFA 1HTTA 1S8FA 1YAJA 3TVTA 3VX4A 3TRIA 4HP8A 3J81k 10MHA 4D92A 3R4CA 4PWZA 1K88A 2Q6LA 2YOHA 4RIIA 9LDBA 2JVKA 3DZBA 3OAAD 1TZBA 4UHDA 1HC7A 4U9UA 2W4QA 1X8LA 4P81A 1EK6A 5H1YA 1QDEA 1XA4A 1AMNA 4KWTA 1WWKA 4FLMA 2P90A 3QVWA 4FI3C 1M34E 2AKEA 2XJ4A 3D3QA 4U9IS 5I7UA 1A77A 3K15A 4P3YA 4ZODA 4RLSA 1E2BA 2FWPA 2YYYA 5K6TA 5C8YA 2CLOB 1KAMA 3VC2A 4XX1A 4Z9AA 1KBOA 1S7CA 3MS4A 4LF8B 2DHDA 2P2LA 1ISPA 4RABA 4N7JA 4Z5XA 5CD9A 2P9TA 2AOWA 3PXBA 4K3UA 5EP2A 1JTVA 5JD3A 1EPUA 2ZPAA 4CR6A 2EKBA 2G9VA 3QUAA 3OEWA 1QAOA 4BNGA 3FZYA 1KOLA 4D9GA 1KFJB 5A03A 3K2IA 1BX3A 2DF8A 3CNNA 4G09A 3P9YA 4TS1A 4MPDA 4FT4A 4YP1A 4S1NA 2HMUA 2FN9A 1E1LA 2DH5A 2EARA 4UXIA 5AKIA 3SR4A 1NRXA 2A0FA 2WKRA 4M8NE 3OZEA 3RSZA 2NUTA 3UUGA 3NBKA 4AZ0A 5BVGB 5LQMA 3STWA 2OHVA 3SPXA 4PNHA 4BEWA 2OAEA 4ILEA 3ROGA 1IHUA 4LXUA 2HW8A 4ZT5A 1C7RA 2YXDA 4MKRA 4V03A 5SYAA 2IBSA 2WMYA 4C6SA 1N9GB 1DX4A 1P8JA 4AF6A 1RWVA 4BAGA 4U7DA 4R51A 2LKCA 3SWWA 3FCXA 1XRPA 3DP7A 4C14A 1VCHA 4XOUA 1Y5IA 1M7HA 2OB2A 4TMTA 3EIWA 4BFVA 1NXQA 4KTVE 2GVNA 2NSJA 1RM4A 1SC6A 1TT7A 1YNOA 3HO6A 3I37X 2CDCA 3MMPA 1CUSA 1VKRA 2AJDA 2GN6A 3NOXA 2PWPA 4HAZA 4P4NA 2DFPA 5FOQA 3RKUA 3K1AB 2HSGA 4IIJA 3L0CA 2AA3A 1I14A 2GETA 2R1TB 2RCNA 3COPA 4RK7A 4HNUA 1XTPA 3WGNA 5H80A 4ARUA 4JU9A 2FPGA 4C6HA 4KW7A 4LXQA 2X7JA 3WLIA 3TTWA 1KMCA 5A0TA 3PQ7A 4MVJE 4OXIA 4O2LA 3UGKA 1PR6A 4EGJA 1ESCA 2WEKA 1RACA 3ZZNA 3SFZA 3BTVA 1IQ0A 1T5SA 3FBWA 3GGJA 4TSRA 4XW2A 1OWLA 5JCJA 3KV1A 3ZBUA 3SSAA 1ECGA 3U17A 3BDVA 3VR5A 3RIEA 1BCRA 3GVHA 3RU7A 3SOZA 4ARVA 1AB5A 3CLVA 5CH3A 4FB4A 1P9NA 2GS9A 1KEEA 4YDRA 2C99A 2ZI3A 4F7WA 3RJTA 1Q1QA 2VUTA 4O2AF 4OHZA 4ZGWA 1H4SA 3SQDA 2R7MA 3WHKA 4JH0A 1L5HA 1IJKA 2WWRA 2K7FA 3W5BA 3CZQA 3C8MA 3PFCA 3IB6A 5HMMA 3RVJA 2QUKA 5CEJA 4FMDF 4LBVA 5REQA 4DCNA 2PE5A 4O3FA 1KAQA 2R6CA 2R4UA 1LA2A 3HBAA 5BYBA 4ZK2A 3GCGA 3LXMA 1F4VA 2OBNA 4OY3A 2B83A 2IOHA 4HDMB 2XUIA 4HDSA 1S5PA 4BNNA 1RAGA 2N46A 4UMVA 1CB7A 3P9RA 5AVWA 2VPWA 3A04A 3AFIA 3L7IA 4YA6A 5C1BA 3Q7IA 5BNZA 2E89A 4BQSA 1TM3E 3E3AA 1KU0A 2BGLA 1Z6QA 2CF5A 2VAWA 3ANNA 3Q5GA 4JJ8A 3TJMA 5EJEA 1IHPA 1TEXA 3KSZO 2OC9A 1KVRA 1N0IA 2X2OA 5E3IA 3VO8A 4YCSA 1JH9A 4YRBA 1V3VA 1NQUA 2CFCA 1PCXA 4UHEA 2Q8QA 4DCCA 5DU2A 3WRYA 4E4YA 3ABZA 5F78A 4EKNB 4DDWA 1U0RA 4RVHA 5IX8A 1QMGA 5EI5A 5BO5A 1XNQB 4B73A 2VNHA 4MS4A 3SX4A 3ZR4B 2VFAA 3ZCRA 3FDZB 2B5WA 4UD2A 2GZRA 3GEMA 4H27A 4IHJB 4C7MA 4TLLB 5J2UF 3RS9A 4F96A 1M0SA 3A9CA 1UMKA 4KPEC 3EIFA 3E9NA 4PZUA 3NMUF 2D2EA 3BZWA 5ITZA 3AIIA 2J6HA 4FW9A 4G89A 1OWMA 3E1GA 4FE7A 5I7OA 2QPTA 3GJYA 4UUMA 2QMOA 1U3FA 2A92A 3A1DA 4ZDIA 4LY3A 1XI2A 2BEWB 3ME5A 4R31A 5IJAA 3P94A 1MD9A 2HJWA 2I4IA 2NSHA 3BG5A 3P7MA 1WEHA 4XX0B 2QVXX 4F9TA 1DI0A 2AI2A 3THXA 4EVRA 4HMPA 2REBA 4RPLA 4D57A 5DNYB 1Z4NA 4BMVA 4KVFA 4YFVA 4DIDA 3DVRX 4IX9A 4P4UA 2I80A 4BGEA 1E2LA 4QUIA 2UKDA 5HS6A 3OLZA 1VMAA 5FOVA 2ETXA 2OCIA 3I9KA 2FW9A 1OW3B 2RHCA 3ABIA 3LT5A 1T0HB 4ZAVA 2C7QA 3ESCA 4DARA 3FDFA 1FPMA 5HE9A 5AW4A 2NYAA 1BMDA 1Q6YA 1Z0FA 1CJVC 3LQYA 4FWIB 2FEWB 3HU2A 4TL7A 3L4SO 5HMLA 1PZHA 2D3WA 3DYBA 4LE1A 5CA0B 3CE9A 2XMPA 6YASA 4PCVA 3FMGA 1TUBB 3FKQA 5J59A 2C42A 4MVJP 4QOEA 4ZVNA 5BNFA 4E5PA 1PR2A 3TBFA 2C3PA 3FIUA 3AF5A 4RJJA 1NNI1 3VVBA 1N2CB 5JYEA 2X2EA 1GADO 2W2LD 2PSHA 3GGCA 1Q0RA 2OV1A 2B7CA 1ODSA 2FX3A 3EDRA 3WTCA 2WA1A 3UFXB 3A6LA 2PKQP 4M9RA 4K6MA 4BLTA 1XCBA 4QPDA 1PSZA 2AUMA 2YICA 3PC4A 4LI3X 3BORA 4OQXA 1XL1A 2Q7DA 2INGX 3EAGA 3ZIAD 4NMLA 3CX8A 3V8RA 4OAPA 3QW2A 2GILA 2EFHB 3N39C 3FNGA 2IXBA 4J76A 4ZARA 3IQXA 2QHXA 3PDHA 4BN4A 4CW7A 5JAHA 1QGUB 3TSAA 2EBHX 4IXDA 5FI0B 1Y7PA 2EZ8A 3LPCA 4D9BA 4XFJA 4F4FA 5FA6A 1LDYA 3DF9A 4DEXA 4F71A 1E1YA 3A6PC 4CF6A 4Y2PA 3RASA 1D7AA 2I3GA 1CF2O 2WHRA 1Y3FE 3N2ZB 3A1UA 5AHXA 1F7VA 2JVJA 4OM7A 4TV9A 1HFEL 1Y4DE 2DPMA 2YXNA 5AW8A 1SBHA 5JZMA 2ZAOA 2B78A 4TLBA 1OUMA 1C3LA 1OPXA 2G70A 3HFSA 2A0WA 2AWOA 1KGSA 1ZU4A 3V2GA 2V6IA 3SS8A 4D0RA 5AVXA 5CYOA 1PN3A 1J24A 1NFRA 2ZXEA 4G41A 5H5JA 3K4QA 5EPOA 3FBGA 4MULA 1H05A 2XOKA 5KNBA 1BJKA 4PCLA 1Z68A 4RDIA 4TYMA 5DZSA 1I4WA 4ZMRA 1F4PA 4YUVA 5JZBA 3OTOB 1EM8A 1CLUA 3NHUA 4M9XA 4R2IA 2AOTA 4KXMA 3UJDA 2ZAIA 1NU6A 4M8KA 5J23A 4WN3A 4ZYYA 2YWBA 4YGYA 3N7TA 2CKDA 2GK6A 1K06A 5AKYA 3V8MA 2ST1A 3C5VA 4TPKA 5AJHA 3K0AB 4HEJA 1W4BA 5CA1B 1KSJA 1IWPB 1NA5A 1C3XA 1P0IA 2W71A 1IHYA 2YV1A 4FGUA 3D3WB 1FLDA 1ZSVA 1MJFA 3KWFA 1EFUA 4WXHA 1A3CA 4FFPA 2ZAYA 1FE8A 4BLUA 4X95A 4ZZ0A 5AFSA 1HLDA 1IRXA 2Z9CA 1YE3A 2G9NA 1IHDA 2AFHE 4HQFA 5DNUA 1N2CE 1JZQA 2CDBA 5DEOA 2NGRA 4CM5A 3GLQA 1GRVA 1L7EA 1G98A 3DA8A 1DKRA 1KI6B 1XQ1A 3DZCA 4MYTA 4P3NA 5BURA 1U8CB 3IAS6 5BOSB 5CFMA 5DBFA 4KR3A 3ICOA 3AEKA 4KV7A 2Y1GA 1N5JA 1KY2A 1WUYA 4LWQA 4MH0R 2BGGA 2P27A 2AQHA 1J42A 3N2GA 4XQEA 4BVLA 3BVPA 4GLJA 4MAAA 1V3UA 2IPLA 2QLMA 1YO6A 4IMIB 3QUCA 4EMTA 3C16C 5IH7A 1BQ4A 2WHXA 4RV4A 5GGYA 3H42B 2GBIA 4NNJA 5SZJA 4U2CA 3P0HA 4R9UC 3VTAA 1T9ZA 5KOYA 1JEYA 4CV3A 2LNDA 4KH1A 5EPEA 5IS2A 3FPBA 4F6CA 3H19A 3UAVA 5HKOA 3BCHA 1S8AA 2BD0A 2F1KA 3AOEC 4JGIA 2Y8EA 1MB3A 1F2DA 1M5UA 2A1IA 3D8UA 4FFDA 4JOBA 5TEVA 4DRXB 3DO8A 4ZKEA 3REQA 1AQUA 2IHNA 3BB4A 3PUJA 5L95A 1CZUA 1T6ZA 5K9ZA 2C82A 4J90A 1GFSA 1Z4PX 3DAPA 3B1JA 4KQKA 5T3YA 3IP5A 1Q50A 2X5KO 1PV2A 3OM0A 1NNSA 3ADKA 3GW8A 3O1LA 3WDKA 1MOZA 3DHNA 3FYUB 4LYAA 3EC7A 1M1UA 3BGWA 3ZX5A 4HDCA 1QHXA 1S02A 1WUTA 3DM9B 4NZ9A 3KOWA 1UZAA 5ESRA 4CIXA 4DLNA 4H2DA 4I9UA 4Q9NA 2O7VA 1HR0B 4UQOA 5AI0A 1ISSA 1M54A 3EWIA 4ETNA 1W36C 3LTNC 4F2HA 1TE2A 1I9CA 1CS4C 3EEYA 4NC9A 4J1NA 3FVVA 3P0JA 2P4SA 1AA6A 2WTMA 2J9YB 3WKDA 2YXLA 4D9KA 3VISA 4PPQA 3A4NA 2C83A 3B7WA 3SHWA 2XKKA 2A0XA 5IBQA 2OHGA 3ZDRA 1X87A 5F98A 2QIPA 4Q00A 1HOXA 1VG9B 2KSQA 1PFKA 3FPAA 3I72A 3I5YA 3OTWA 1KA9H 4CR7A 5CDHA 3W3ZB 1WLSA 4PZDA 3LP8A 1D09A 2XUGA 4M87A 1IZ7A 3LCVB 4NZZA 4I4TB 1IC6A 3T12A 1E3SA 3D3NA 2X13A 4NMWA 3RHTA 4JWKA 3TMAA 2JLZA 3AL0C 2HYDA 2QRHA 4WXMA 4G9GA 5CXQA 2WB4A 1TDJA 1QYXA 4I55F 4RWEA 3E5MA 4TTPA 3DH0A 1YOVB 2IOYA 4F72A 1PGPA 3RVBA 3FTPA 3MQFA 2N47A 3JD1A 5JC1A 5AP9A 2H0QA 3LYLA 1CB0A 3BIWA 3LX4A 4LYJA 4QO7A 2XUJA 5KI6A 2FJPA 3THWA 1H2YA 5DOZA 3C0KA 1CK4A 2ODAA 2YR0A 3CR8A 3G79A 2RGXA 4HDNA 4K9QA 3A6EA 4MI9A 3D2LA 3V80A 4Z7JA 4LC0A 2GVZC 3PWKA 4KLZA 4UU8A 5LA6A 3VR4A 4PY2A 3I52A 2B69A 5ALTA 4DBLE 2PL1A 3H2IA 1GRQA 2Y1FA 5JZOA 3FWHA 3L1KA 4ZVRA 1DWPA 4PZYA 4Q4HB 5FD8A 4A23A 4OM8A 4F4IA 3EZLA 4PZ0A 1BE1A 2ADOA 2HIGA 4I5DA 4MWTA 2J4DA 4D9JA 4X84A 1EX7A 1PTJC 2D1QA 2H2WA 3GMSA 1KR5A 3OCVA 5AKLA 3SIWA 2VJMB 4UNNA 4BVBA 5LKRA 2EW8A 3DMTC 1O6BA 1UP4A 1E32A 1Q3HA 3PX2A 5KTSA 1QGAA 3BRQA 2FHPA 6REQB 2KLHA 1LZKA 2XMGA 4CLDA 1SXJB 2WU3A 5IMSA 2YWRA 3KFXA 3BWVA 5L7YA 4ER0A 1RYDA 5DEIA 4ZZ3A 3ICQB 3CY6A 4W1SA 1R0SA 4Y9SA 4D4MA 3ESAA 3EQ7A 4TT3D 4IOJA 4HV4A 1VMKA 1MABB 4BBAA 2IDJA 2H9AA 2CXUA 1TXGA 3BKWA 4KUHA 4MB2A 2I6SA 1FLNA 3GT4A 4RY8A 4X8LA 3NVKI 5JRDS 3AFMA 3FGOA 3NT4A 3TOCA 5KDOA 2H92A 5KNBH 4JJIA 3OM9A 5E4JA 1CQJB 1F17A 3A1TA 4OK6A 1SZPA 4UAGA 3G9TA 1U65A 2I6QA 3L0SA 3LQRA 5TPWA 2XBUA 3MSXA 2F4NA 4JNCA 4RZUA 5FTWA 2AZXA 1J1UA 2IPNA 2IUEA 1ZM3A 3GARA 4TL6A 4ZT3A 4F56A 2H2FA 4DABA 3FYCA 4ZQGA 3PYMA 3D31A 3TW8B 3FMIA 4RVUA 1MR3F 1I6LA 2QTLA 2IU6A 2JANA 3TL2A 2VHXA 4H1WA 2OOSA 1XZNA 4MW0A 1UBGA 4QT0A 5JG7A 3UOGA 5JBNA 5JWRA 1E9CA 3D8RA 3NUGA 1GV0A 2KM1A 1XNHA 3ODPA 4GWKA 4PNPA 5DP2A 1J06A 2JHCA 2Q9UA 1D6JA 3EIQA 4TV8B 3UG6A 4IFIA 4YI3A 4K2HA 2YMLA 1YNSA 4IIVA 1DNPA 2R60A 1HURA 1E1CB 3N2KB 2Q45A 4CEHA 1X9IA 3MWJA 3SX0A 5A9SA 3GB9A 1E2JA 4ZO9A 4BGIA 2BSQA 3DBHB 3NXSA 4HUQA 4OXKA 1HMYA 2YFYA 2YOGA 3TB6A 1FP4B 1IEWA 2VDKB 3AINA 4C4ZA 2FWNA 3JWPA 2OK8A 2ZE7A 2P8SA 4P2BA 3RAGA 3J7TA 5J4HA 2IYOA 2AFVA 1BZYA 1IRIA 2JJQA 2PMCA 2DR0A 1X19A 5KC9A 2FW7A 3BQNB 3BMOA 3HSSA 1EJ2A 1UAGA 3LVFO 3D64A 2EIHA 2XI4A 5FYDA 2HMYB 1QFYA 3EXHB 4FWTA 2PZEA 4XDYA 1CDDA 2W11A 2I7TA 1S6YA 3M1LA 1IONA 5IEBA 2YVLA 2VH2A 1SXJE 4MYUA 2BFDB 1UXKA 3A06A 4MPRA 3PL5A 2I2DA 1OWPA 1XGKA 2PZJA 5G0SA 5B7NA 5FWYA 3F73A 4C5CA 1E4EA 1R18A 3PA6A 1OVGA 4IIFA 4G1MB 5EL0A 2NIPA 1OGIA 1RYEA 2PX2A 3NS7A 2B8JA 4CKWB 2ZKLA 1SHJA 4NZPA 1O97C 1DO8A 1EFVA 2VQDA 4DEVA 1KP9A 5UKDA 3T35A 1QNFA 4IS3A 1PWZA 4Q9IA 2ZQ5A 4DG9A 1N33B 2Y1LA 1L5YA 2ZAGA 2XYRA 2FTKE 2WDPA 1U0LA 5DI3A 1V1RA 4BV2A 4J43A 3V6MA 1M0TA 5JQGF 4KKXB 5AICA 3RVNA 3A2LA 3OQJA 2H85A 1RWQA 1E3JA 1HV8A 2ZJZA 1RFLA 3KYDB 5F5LA 2O8FA 1O57A 1XTVA 1UKVY 3N9IA 4E2YA 2Y71A 3IPXA 4BNLA 1JV2B 5J58A 1VPLA 2JFXA 2BH2A 4WZAB 2LCIA 2GI4A 4JX9A 2C88A 3R9IA 1DBSA 4QXQA 4Y3UA 3RWOA 5IC6A 1HZZC 3RS2A 1LPPA 3D6VA 2B92A 3DE3X 2W2VA 1Y1PA 4IJ5A 3H1PA 4TMYA 5GJVC 5LP6F 1QPGA 4WW0A 4G1BA 4UOQA 3RIXA 3VU8A 2PBLA 3B3FA 1QK4A 3CO5A 4H6XA 3MWEB 2UVPB 3TW0A 1Y4AE 5LQSA 2DWPA 2RBKA 4L4ZA 1BDHA 1QHGA 2FJUA 2OHXA 3HB4X 1QK5A 1SCUA 4ND8B 3KDAA 4OV6B 5BN5B 4AZ3A 1IUOA 5ICGA 4W5NA 4EW6A 3S27A 1AHIA 1QPBA 1FBTA 3FHCB 3OI7A 4W7SA 4CMKA 1WPQA 1Z26A 5JV5A 3AVOA 2EP5A 5IAJA 3TB4A 2MR6A 3LZCA 4N3NA 1HDEA 3AUUA 3AVPA 1W19A 4CM1A 5JHGB 4CN8A 1UBOS 4NMMA 4X9XA 2WJAA 1ZVKA 2VSQA 3HCBA 4N01A 1QFJA 3KD3A 3MAAC 1XYYA 4L3VA 1WY5A 4RCZA 1IVNA 1ZI9A 2WMNB 3A0UA 1PHPA 3OPYB 1JLKA 2DHRA 1PL7A 4GMHA 5I7SA 5BR4A 2P5UA 3FOEC 5K0CA 5BV2P 2YXPX 2NACA 1G6OA 4MPJA 1O94C 3FSGA 3WLJA 4BVJA 4MVCA 1N9KA 2C0QA 3L77A 2X3FA 3PDJA 3ERCA 4JP5A 2AEMA 2BF4A 1VZ2A 3G5AA 3G2JA 4RANA 3S5UA 4F9GA 3DYIA 4TUYA 3PRJA 5E9QA 1QIHA 5JAOA 3ZIDA 2FSSA 3QLVC 4RK0A 2A9RA 3HS3A 4J0IA 3BREA 1UBEA 4EATA 5K6AA 3PUVA 5CVCA 5DULA 4CCYA 2ODBA 2EERA 2O8DB 4IUDS 2I1VB 4WZAE 4IHKA 4PW0A 5KREA 4FKMA 4JOSA 1YDMA 5AJXA 3U9LA 4BLPA 2K2WA 4CE6A 3HG7A 1WXDA 2GN2A 2WJIA 3IQWA 3MUOA 2PAFA 4KLAA 2GZSA 4J0QA 3L7OA 2PMKA 3AF0A 5KIAA 4W5RA 3GXBA 1JIUA 2P2ZA 3QI7A 3UWOA 3FZEA 4D56A 5AR1A 3TZHA 5TQVA 2MINA 2N75A 4CU2A 5K20A 4S04A 1QZ3A 1GU7A 1R88A 2D6FA 2QENA 3ESQA 3JQPA 1V8FA 1O9GA 2RGGA 3WMEA 3AGQA 3SOPA 1XEXB 1IXRC 5D7NA 4ZVQA 1DUVG 4B3FX 3T52A 4YUXA 1P7YA 1AKQA 4JYPA 1LPSA 3IEKA 1EP3B 4LS3A 2YY7A 2PHZA 2QUIA 3S3TA 4OUDB 4AY4A 3NIDB 1PJ8A 3QYJA 3RYHA 2FE4A 3V7YA 4ENQA 1BCSA 2NLOA 4WY2A 4N41A 4O2BA 2Q5FA 2NVOA 2VP0A 1QM5A 1AS3A 2CXQA 3Q3JB 4NNOA 1KYIA 2XKJE 2ORYA 3MCWA 5LWHA 4L9AA 3B89A 2FR8A 4HC4A 1WZNA 4NIMA 2X8AA 4PWYA 5E1OA 5GP1A 3DBLA 4A0RA 1WETA 2FVXA 2O07A 1AQLA 4K9RA 3WP0A 5CBPA 3K71B 2BE9A 1YQ9A 1M74A 2CL6X 1UZNA 1NVVR 2ISQA 2PJUA 2ZVPX 3EIOA 3ILYA 3Q88A 4K9DA 1GPAA 2C2ZA 3AYXB 3G7NA 4DFDA 2HU2A 1V7QA 5AESA 4RZ2A 1YMUA 1MOSA 3F6CA 4LGYA 3VNVA 3P4UA 3VC7A 4EB3A 2CD9A 2H2GA 3EZXA 1JWAB 1V96A 3LC7O 4W8OA 4FOSA 3GVCA 2IK8A 3A3YA 3PHJA 2FW1A 2CMDA 5FUXA 3FM9A 3FNRA 3N28A 2QN8A 1EK1A 1QVWA 1XNGA 1PQ4A 2VIIA 3TLGA 3OQOA 4B3RB 1IQPA 1OFUA 1LKZA 3FKSD 2X0EA 4M22A 1XXHA 2CXRA 2V97A 5LQNA 3IUPA 3L1UA 1YVRA 3BC1A 2V6BA 3KAQA 3HJBA 3O3MB 4RJKA 3W9SA 1C7ZA 5KYNA 2FUNB 1YFJA 1T1GA 1XK6A 3ZGOA 2A35A 4JUFA 3RRBA 3ZE9A 1TK2A 4DNOA 4YAKA 2AGVA 3CRQA 3FNFA 1J2UA 3V4RA 2MSDB 1AIPA 2CY0A 2XVAA 1H5QA 1LY1A 2P40A 1YK0A 1JDZA 1BXGB 4HXYA 4R83A 2ZBFA 1NF2A 1Z5ZA 4WCDA 3G8BA 3ZKAA 3COVA 1NATA 1U2TA 4DNQA 1UBMS 2QAGB 5L6MB 3UTCA 4MVJA 4ZQCB 1R6XA 5AXAA 4OGKA 4X1IB 3G13A 4P83A 2JARA 4U2GA 2QR2A 3NBFA 4B6PA 4DMRA 1L4LA 1N8TA 1S2OA 3A4LA 2O8EA 3BWBA 3K7EA 4NBWA 2WIDA 4X6XA 1U1IA 1YB4A 4L6IA 2Q4BA 1NM5C 1UPBA 4C06A 3O90A 5CLIA 4Y67A 4F2PA 2BH9A 2WD9A 3I2KA 4L6AA 1ESNA 1QBKC 2WU1A 2ZTLA 1D4ZA 1X8JA 1CDOA 2GAJA 3KQOA 4NU6A 4RL6A 4X97A 4AMVA 2E4UA 1M1NA 3MAGA 1I5RA 2GPJA 4G4SP 3S2YA 3JQDA 1KJZA 4O6VA 2ORED 2O7RA 1XEWX 3PIRA 2E1PA 1SXHA 1RBMA 3IT1A 2JJMA 1PVDA 4EGQA 2BZ0A 2ZYUX 2C1ZA 4P38A 3L8CA 5K3BA 2XDQB 2PZMA 3GEPA 4E5VA 3DMHA 1RABA 3PD0A 1N8KA 3MJVA 5F1PA 3K35A 5L4SA 5BVGA 1O9HA 2OHIA 3CEJA 2GZAA 3I1FA 3C3PA 1QZZA 3Q0IA 2FPIA 4L5YA 4WCVA 2FZ4A 5EFZA 1L5GB 4ETWA 4YB8A 3I4LA 1K86A 1Z47A 1N9GA 3W6OA 4CGYA 5E4TA 5J4YA 5KHLB 3ZEAA 3WO1A 4G1VA 4F9EA 1CT9A 1CY8A 2LWIA 4TYYA 2ZTSA 1ML4A 3VDQA 2ID4A 3AVQA 3FMPB 2HZ7A 3B3JA 1G8KA 2CHUA 2F90A 3NWJA 5IWAB 4HPXB 5C37A 2ODWA 3K1AA 1ZJWA 1ZIYA 3G23A 1XRMA 1W46A 3RRZA 2HLDA 3RTEA 3SP1A 4E5SA 3NTXA 1JSLA 4I1OA 4DSUA 4RH3A 3GJSA 1MT0A 4D0NA 4FC6A 4Q03A 1Z0JA 4MPTA 4AURA 1RWPA 2FUCA 4AKHA 3ONEA 1N57A 4S2EA 5ER6A 2DUMA 5J5CA 4MUJA 1OPRA 2Y0CA 1YGPA 3GRKA 2H1VA 3EF1A 4KAFA 4V2IA 2EU8A 3MB8A 5FL3A 3VJMA 1NI5A 4C4RA 1DCFA 1PGQA 4PICA 4B4KA 1YQEA 1ORRA 4UNIA 4JLNA 4EG6A 5MF6A 1V9CA 1Z5NA 4U2EA 4KFTA 1PNOA 1FFCA 1LWOA 2EDAA 1MC1A 4KYTA 3DLHA 2QX7A 3IR6A 1UKEA 4IZIA 1HK7A 2HJHA 1B74A 4M9SA 1J2YA 4OMUA 1I3OA 2WAYA 4P5DA 3FCCA 1KF0A 4QOJA 1L5LA 3S1AA 1ULHA 4IDPA 1KQGA 2QRPA 3SYKA 3SVLA 3OO1A 1UP7A 3CH5A 2OQ2A 1WDTA 4HDMA 4LNAA 1BWRA 3IBYA 3EA5A 4PC7A 4RD1A 5HUJA 4YHHB 2G1PA 1Q16A 3DTNA 1F48A 3NBAA 3GJXC 5KNLA 1WSWA 3D8BA 2YJ5A 2IF2A 2Q6KA 3GVIA 1R1DA 1VE9A 3BDIA 1M6YA 1V7ZA 3UH1A 2PKEA 3WQHA 2PO5A 3CCBA 3PR1A 4JIGA 4YUYA 1N92A 1ZRSA 2DWOA 2Q6VA 4G5RA 3SVTA 4CMIB 1W9HA 1T4DA 2FETA 3FBTA 4LJSA 4CM6A 4D98A 2FDRA 4TTTS 1HNXB 1KIMA 2PVCA 3ECAA 3EFOB 4MUEA 2P62A 4D9NA 2JAPA 4NQRA 1NZJA 1JI3A 3PYLA 3OEHD 4FPXA 5HIIA 5KEIA 4IJ6A 1H94A 3BWYA 1A7KA 3A2KA 1DAIA 1DWUA 2H5LA 4YC7A 2FSPA 4ZP1A 2WF7A 3FDZA 3WDLA 3PX7A 2IKQA 3JTMA 4QJ5A 4IHJA 4CLOB 2A9QA 4B45A 4BKPA 2HXYA 2X9LA 4GMKA 1J9ZA 3ZU5A 5A9TA 4YDSA 1ZXBA 4A0SA 2C8JA 1MA0A 4MV9A 2JZNA 3BGOS 1II8A 1GUYA 1TAQA 2EF0A 3GLUA 1WMBA 1EGVB 2AN1A 4K8OA 4A2WA 4BNWA 4C0XA 5JZ9A 1CKEA 3D3KA 4NFLA 4NATA 2BTEA 2BEWA 5CFPA 1DO2A 2O23A 2PPVA 4RHXA 2FFRA 4PQFA 3HY4A 3Q6MA 4XX0A 1QOZA 2BV3A 2IEZA 5KQMA 2YDYA 5E9AA 1D6MA 5MDHA 3IURA 5I7RA 2HJRA 3C1OA 1T9DA 1GA6A 2ZRMA 2E85A 1VYVA 4DMGA 4DNXA 1GCGA 2X0DA 5DNAA 4ZC1A 4LWZA 2JLQA 1G38A 2W2NA 1LK7A 2HJ9A 1DU4A 5CT8A 3LS2A 5CDFE 2J48A 5JD5A 2AOXA 2V9PA 1G18A 4LDNA 4MUKA 3AQIA 4BN5A 5ALNA 5A7HA 4XOIA 4YHBA 3V42A 3PKJA 4XIFA 2QNIA 1E0KA 1VRCA 2ZI6A 2DEUA 1H9CA 3Q9UA 5LN1A 2JH9A 3DNPA 1LI7A 1U0JA 5DCLA 2ZSUA 1I2AA 3QMWA 5NLLA 4WESB 1DQSA 2PD3A 4LQ4A 3OZXA 4FNGA 4IL5A 5T67A 2H4WA 5JMPA 2KMLA 4BNXA 1UL1X 3UFXA 3ZHOA 3T06B 3MTAA 3PF8A 2YFHA 4IICA 4QBGB 1ZVJA 4UCXA 4QLBA 2CXPA 1DXOA 1GUFA 1ZM2A 1TVKB 5L9AA 2WZBA 4NRDA 1B3RA 4JP3A 1J99A 4GNRA 4ML3A 5DI9A 1M2NA 1K75A 4Q1FA 1QGUA 1TFRA 3O03A 4QUKA 1BH6A 4RC9A 4R84A 1HA3A 1QYRA 1NDHA 2YN4A 3PDIB 3O91A 2P2DA 4DBVO 1N3YA 2GLUA 3MERA 5FUMA 3QKSA 1I7LA 2QUHA 4XM0A 1ZUNB 2UZIR 4DJAA 1V3QE 1VI5A 4F8JA 2UUOA 1O96B 2WHEA 5H3LA 4DPMA 2ZBRA 4PANA 4AP5A 3P2MA 5KBYA 1E60A 2QLTA 2R00C 3ID6C 3U40A 5B2FA 5JNTA 1TYEB 4EJ2A 3HYNA 3IT2A 3ASYA 2Q28A 3W06A 3WK8A 5EWJB 4CU5A 5B58C 1VE6A 1BHJA 4XGQA 1QHHB 1X13A 5E7IA 2XR1A 4BCDA 4QUEA 5JCJD 4PTLA 4Y9TA 3PJEA 3VR5D 2FP4B 2VC2B 3QVMA 4QYWA 3CH6A 3A6JA 4ZV9A 1RCUA 2BTQB 1HYGA 2GN1A 3I6ZA 1SHZA 4IMJB 4B3IA 1Y5RA 4C21A 3FLAA 8OHMA 4DT1B 2MCFA 2PRJA 3BJRA 4XYGA 3D1JA 5A71A 2CBZA 2WSYB 2XQVA 1JLSA 4WLVA 5G02A 2FPLA 4O29A 2R8OA 2XRZA 1ULUA 2VF4X 1L5FA 1W0JA 1UJNA 2HWXA 3H83A 5CA1A 2C97A 4JITA 2W2TA 2BDUA 2BRUA 4LOLA 3WLQA 4F0JA 3CNLA 1FXWA 3QY0A 5EJ5A 3HMKA 1OH8A 4NYIQ 3T95A 2H5IA 1DC8A 2YVUA 2ZQYA 3EXG2 2XSZA 3NUQA 4TS3A 4QHYA 1AZLA 4LV5B 4U7JA 3TMKA 5CRIA 3RLFA 1BXRB 1AZWA 4YQYA 2LUOA 1FDSA 1FFHA 3VGPA 3H5NA 1KI6A 1P7VA 5G0TA 1FX0B 1G4AE 2E21A 3G0OA 1NJ8A 1W47A 2X3UA 4OHKA 4U2BA 2QZSA 2Q3MA 5C34B 5BOSA 3GPBA 1IPHA 1JZTA 5J43A 1WCXA 2MSKA 3V1KA 4GG1A 1RQRA 4DDUA 1LDGA 3I3SR 5L4LA 4BX2A 2YRXA 3GLHA 2VTBA 1MB0A 2C61A 4Q9DA 1U98A 4FNOA 3HTXA 6ADHA 4H3KB 4YIHA 2Z04A 2JGKA 3ZLUA 2O6HA 2BCGY 4GIBA 4NTZA 2V59A 4FZ5A 1G2PA 4RJIA 4E15A 2K87A 4A36A 3AUYA 2HDOA 1VL8A 4LHYA 1LSSA 3KKLA 3O8QB 4CLXA 4EFNA 1QP4A 1EXVA 1X1TA 1HXHA 2C77A 2BSAA 2C7RA 2G8NA 4CL0A 1QGOA 1RSZA 3G8YA 4IJUA 1U5AA 2W83A 3LFHA 4LWPA 5PNTA 2QMQA 3ECCA 4OHOA 5JJIA 3LBHA 4JY7A 2GN9A 5BSEA 3MWYW 5DFAA 3NQ41 1D2RA 3FYUA 3MGGA 4MRSA 3WA7A 4Y6QA 4XUDA 5LQDA 2VS1A 2XA2A 1YOBA 2FG6C 2J3MA 3C48A 3F3MA 2F48A 2JAHA 3V2IA 5FR1A 2O2EA 3CWQA 4BO9A 3R9XB 2H2HA 4D0LB 4GEGA 3F97A 2HRBA 2Q5QA 2WWIA 3QMMA 2RG7A 2ZRKA 1LI4A 1K3FA 3ETEA 5LA6F 2GESA 1GZUA 1VPDA 3H75A 2WJWA 1WVMA 1B0ZA 3LBFA 5BSGA 3SQMA 4A4DA 1XCLA 1PR0A 4TZ6A 3E8MA 3NAGA 1PK8A 1E6EA 3OURA 1BD3A 1XB2A 3GZTB 2XCOA 3RU9A 2VXBA 1RKUA 3VOTA 5ETJA 3UYKA 1LPAB 2HQSA 4NYJQ 5EGSA 2NVUA 5C35A 1H2BA 4FYHA 3DMGA 4I4TA 4NL4H 4ND6A 1ZC4A 5LQJA 2O50A 3B6EA 2Q5LA 2Z6VA 3P9XA 1BEZA 4GBJA 1PDOA 2Q2NA 4P33A 3M4ZA 4ZJZA 4IGFA 5FOWA 4EKDA 1AKTA 4XPZA 2G25A 1WP4A 4TRNA 5A4JA 4HVAA 1YOVA 4RU1A 4KO2S 2FW0A 1CC1S 3HJRA 3OO0A 3UXYA 4Y6RA 4BDTA 1Y34E 2QRMA 1W0CA 3AF1A 3VM6A 1E2HA 5HRUA 2X41A 3SF8A 4S05A 1JHOA 3AIMA 4KE6A 1DXQA 1E58A 1E98A 3AH8A 1J25A 3RUHA 5K8UA 2DQKA 2P9JA 2Q5JA 2JAXA 3GFQA 3A7EA 2GM3A 4KIJA 3JQ7B 5HF8A 5JZSA 1E2GA 1NRJB 4D6XA 1MX1A 4RHEA 3HJGA 4NY1A 3CCCA 1VYHA 3LTEA 5FF9A 4B3HA 4O4HB 3OWXA 5DX1A 1ZK1A 2XBLA 3R20A 5JLAA 3MCTA 2QN2A 2CEKA 5DHSA 1JGTA 4XGNA 2VP6A 1T8WA 1NUSA 1RZRA 2G06A 3JYQA 3TEMA 4Q4HA 3WX0A 3T7SA 4YJHB 3M3PA 3UV7A 3VDMA 4C7VA 3RBZA 1G8MA 3HHEA 5LDGA 1BA3A 5KSOA 1BU8A 2PUCA 2VJMA 4C08A 1EH5A 1T6YA 1SUFA 4ZQFA 3M2PA 2XOKD 1NBHA 5KNBD 3R7WB 5AD1A 3EIUA 4E32A 3RG8A 2FSHA 1O9BA 1VOTA 3A9VA 4PYRA 4YCLA 2ES4A 4OJKA 1YA6A 1GL9B 1D8AA 3T3NA 1DWQA 1Z06A 4WNAA 5KNCA 1I7QB 3ROFA 1FRZA 1MABA 3OQ1A 4ZCPA 2C54A 4MUAA 4FFBA 2VKTA 1RE1A 4LOHA 3FUCA 2QZJA 1E2NA 4GLBA 2OFXA 2BOVA 1BXZA 4P4SB 1CQJA 2JATA 4YALA 1UODA 4J03A 5CDGA 1DCTA 3EY4A 2B4KA 3PPIA 4BX3A 4D44A 3HNOA 3A6HA 4ZEXA 3LMKA 1C4XA 2I55A 2XUKA 1TAUA 5LLDA 2P67A 3JASB 5KOJA 4UVGA 5C53B 4RPHA 5JAPA 2BHTA 2Y27A 2EWWA 3FWNA 3SEAA 2I9KA 2A33A 2QZPA 3GFTA 3RH0A 1U9CA 2B4QA 4LCEA 4P80A 3F5FA 1FJ2A 3NH6A 1M1XB 4M83A 3DPUA 4P3KA 2I1QA 3RI3A 1KVUA 1J07A 4HJXA 1O89A 4N18A 4B3JA 4JD5A 3S8EA 3GLIB 3ORYA 2WUGA 2E4ZA 4LISA 2OPBA 3AF4A 3T7AA 5IZCC 1HE8B 1J0XO 3OKCA 2C03A 4HRVA 4LZAA 4Y7DA 5FFNA 1IZ0A 4Q12A 4PLTA 3L7NA 2XZOA 3M49A 1CFJA 3N2KA 4ISBA 5ADUS 5B5SA 3ZHSA 3DE5X 1NDUA 1O03A 1R8JA 5F35A 3BCUA 3LRTA 5T6BA 4KBFA 1IN5A 5FO1A 3KOYA 4ITRC 2C4VA 2D0PB 3PFFA 3I42A 1VIMA 2EHDA 2F67A 4PFSA 5KJFA 4REOA 1QQ6A 1VJRA 2REQA 2ZU0C 3P9ZA 5HKAA 4MZXA 3M6IA 1FP4A 1PT6A 1ZOPA 3O4HA 4HAYA 1D0VA 2XRYA 3FWKA 2WWVD 2ZM5A 1I01A 4CM4B 2DBQA 2PX5A 1KVQA 1MAVA 1X0VA 3TKLA 4LX8A 2HMTA 1GUDA 2AG0A 2VXYA 3EXHA 3L4JA 1RPZA 5FFMA 2HAEA 1X80B 2BFFB 4INJA 1TM1E 1ZCZA 2C3UA 4YRQA 4GOXA 2WPDA 4TVBA 5J2TA 1ODIA 2J09A 4J94A 1U2RA 2BFDA 4MYHA 2JC3A 4HGQA 1NXXA 3E3OA 5FPQA 3TH5A 4R3NA 3T4XA 1YHYA 4KQEA 3IIEA 1H8HA 1NFFA 2ZUSA 3IP8A 1W5BA 1PNQA 3VH1A 2NPIA 4X64B 1BKSB 3C3MA 1CYEA 2J0UB 4CKWA 1MBZA 4D3ZA 2AXPA 3ANXA 2AUNA 2GKOA 3JQGB 4BHTA 4Q4DA 2WYUA 4AKTA 1RRKA 3EEBA 1J1ZA 3GZJA 4NYMQ 4O4IF 2NZYA 3A0RB 4YMWA 4J4HA 2F62A 1ACLA 3FFXA 3ITEA 2OO3A 3LQ2A 4MV8A 3TKYA 2WTUA 2A78A 1VL1A 2NUAA 2DJIA 3QK7A 4KVZA 1Z15A 2Z5GA 1GARA 3A2NA 4ITVA 2C84A 1Z6AA 1E2MA 4RKQA 4UM8B 2GVDC 2RMKA 3KYDA 3NZEA 4LOKA 1KSFX 3O8NA 3VU9B 3ZYZA 1RKBA 1TX4B 4LF7B 2GBLC 1RLOA 2RJOA 1JUDA 5IVPA 4JT9A 3CNOA 3GLIE 2R0QC 3ITNA 3TIGA 5G4KB 4IDGA 3PL1A 4PLHA 3VKVA 3BJMA 1D03A 1JQAA 2BFCB 3NHBA 5HZMA 3UWDA 3I6BA 4H3VA 4JQCA 4LHEA 4AZVA 4J1TC 5DLYA 2B30A 2ILTA 2QI9F 1CUFA 3EH1A 1A9ZA 3Q1LA 3SS9X 5B36A 1A8HA 5KNDH 1ZUWA 4H6WA 5EJIA 5LBIA 3QKTA 5GZ1A 1JYSA 1NBIA 4JBLA 3WDMA 3CINA 1SJ9A 4C88A 2G82A 3L1HA 4O1MA 4TM8A 3QVVA 2PZLA 1Q1EA 3DAOA 3QKUA 2WY2D 3IB3A 1VP3A 5TF0A 4CNQA 2BMFA 3MWEA 1KXZA 2LPMA 3LLVA 2KI5A 2PZBA 1MGOA 5FAKA 3W3AA 2IHBA 1MAHA 4MLPA 4ND8A 2EFGA 2H9IA 2QDXA 3ZH9B 1OI3A 2LP4Y 4EFKA 4RE5A 1GGNA 3RSOA 5HRCA 4RIEA 3AB7A 3NEPX 2BEUA 2OFOA 4OHVA 4O08A 1L1RA 3AESB 1R4NB 3W2TA 1CNFA 3DCYA 4EPWA 3ENNA 3ENWA 4JELA 3QBEA 4D8WA 3E15A 2VNJA 4G5HA 4I9GA 3GN2A 3Q3EA 4RXMA 1MHTA 1E1NA 2WFMA 4BPRA 4W6ZA 1N8SA 4Q4JB 5IH3A 1V9LA 2WB2A 3L5OA 1OB5A 5CIWA 2IVFA 1W4ZA 3CUYA 2NPFA 4F3CA 4OHYA 3SCZA 3KEFA 1Y8CA 2OBYA 3JZMA 1CQXA 5JSQA 4L78A 1CVLA 1R7RA 2YJ4A 3LDGA 4QVKA 3TNJA 1YD7A 1O6CA 5KTKA 1KZ9A 1KQOA 1EDEA 1VRWA 5JBIA 2HDHA 1TM7E 1SB8A 3B82A 5AI8A 4C0HA 1ZESA 1BGWA 2XDAA 4UKDA 4AWBA 4BMXA 5KNCH 1ORVA 3ER9A 3DSRA 1KMHA 1FDRA 1I3NA 2X1VA 4CV0A 4JENA 3KKKA 9ABPA 1Z4LA 1ZONA 1LBTA 4FSHA 4O2BF 1Z29A 4QXPA 1RXYA 2RH8A 2RBEA 3O9VA 4O2RA 5JNVA 1JQBA 2L18A 1Q95A 1X7WA 1DHRA 2DFNA 2WHPB 4MRRA 4R2LA 4ER6A 1LEHA 1SQ5A 2QM0A 1J5EB 2J9RA 3EQZA 5G4LA 4WBSA 4UBMA 1R9JA 3WISA 1DB3A 4RS3A 5DNWA 3VU0A 3KKOA 3MMZA 4INAA 4WOPA 1KI9A 1TU4A 1YRQA 4CFYA 5IP5A 4FU0A 4I5EA 3AIOA 1XEAA 4TTAA 1T2DA 4XSGA 1P9WA 2Q41A 5IUJC 1AU9A 3WL3A 3W90A 2JCSA 4C0LA 1SOAA 1BKDR 1GAXA 1PI3A 4TX1A 1C1DB 1XEXA 2QT1A 4OKIA 4COKA 2XEDA 4GVXA 4L8FA 4FNAA 4KXQA 4YN3A 2EWMA 2C5SA 3AF3A 3G2KA 4I5IA 4Q18A 4FE4A 1JQLB 2XYPA 5KKCA 3RS5A 5D6OA 5JAMA 3B2NA 2UYHA 4KEAA 1ZNXA 1FTYA 5EUQB 1XROA 4I66A 4Y2XA 2WIBA 3HYRA 5IAGA 3IQEA 1SA0B 1L4UA 2R25B 3BIFA 4G1UC 5BWCA 4WVFA 3QENA 4RTMA 2GK7A 2VPIA 3GOQA 4OG2A 4HSGA 5CJ2A 4YMIA 4C9BA 5IF3A 3EVGA 1NMSA 2Y1CA 4FZVA 3CT6A 1UF9A 3HKDB 4PZCA 3LGSA 3URMA 1K7YA 4JBIA 4RYLA 1WY7A 2NV0A 1E63A 2B1RA 3AV3A 1F38A 3M3HA 4QOIA 3TXAA 3L84A 2NYRA 4B4DA 4D1YA 4UBLA 1ORIA 1S2GA 2ZANA 1Q0UA 2NOAA 2EJCA 3O3NB 4XFDA 5EXTA 1V8OA 2ZIXB 4B7AA 2WUDA 4AULA 1OB2A 5T4BA 2W8ZA 2Z3ZA 1P81A 4B2YA 1DTWB 1P3Y1 1QC5B 2GD2A 3RAEC 3Q4GA 1U1GA 2IYLD 5C8DA 1VM6A 2O06A 2Q5HA 3BMCB 1NF8A 5AVUA 5A6SA 2YCLA 3KT8A 3FUTA 3N6XA 3F46A 4PG5A 1OXMA 3DL4A 4JASB 4M89A 4PHFA 4AUEA 1WVIA 1GTG1 1OCEA 2X9QA 4V0QA 4UJ5A 3WHPA 2LR0A 2HF2A 4M1OA 3D4NA 1I80A 1DOZA 1SCJA 2W4MA 3IDQA 4PU0A 5HQTA 5IT4A 4FDMA 4QU8A 1JDBC 2Z58A 1UJBA 2DLNA 2AN5A 2NVWA 4UHFA 1EXMA 1YZHA 4BU0A 3NALA 2QTZA 4YYEA 1BXGA 4LE0A 1Q1AA 3A25A 3N53A 1PWYE 4WQMA 2BKUA 2QAGA 4PSVA 2I76A 2VEDA 5ELXA 1JHAA 3DXFA 4HWKA 3T7DA 1ONOA 2G67A 4PSKA 3RREA 3TLYA 3KOZA 2AFIE 2C2HA 1GGEA 4EGAA 1R74A 3MBOA 4KOAA 4D79A 2FWBA 3A4VA 2XZTA 3KNZA 3DDZX 1PYOA 5A5EA 1B2LA 2I22A 4GU5A 3TD6A 3ZWPA 4OX9B 4DMHA 1BVHA 4U1RA 3ZZ0A 1PBTA 2X9NA 3OOJA 4QBFA 1F1JA 5KSYA 4JJZA 2FRDA 4NSNA 3ILHA 3TW6A 1FU7A 1TQ2A 5BW8A 3T41A 4BX0A 1G8FA 1PHRA 4Y6OA 4FSDA 3RPEA 4DQVA 4IUCS 4XJSA 3TCXB 3W3AH 3H9QA 2PT5A 2O19A 1A7AA 3G89A 3P45A 3B8HA 4EI9A 1LLQA 1Y3BE 3B1YA 4RNCA 5CR9A 2V74B 3ZDBA 3FSGD 3PDWA 3DONA 4W63A 5FB3A 5I9IA 3E9MA 4QTTB 5JSHA 3CF0A 4ER7A 3WRYC 1MVNA 1WE2A 1X1SA 2DP4E 3LY7A 3NIGB 4YP7A 1E2FA 3QOXA 3ZE8A 4PAMA 1R4AA 4DIUA 4DT1A 1ECLA 3KC2A 2XUPA 4ZIRB 3C98A 1W88B 4LN1A 5AOCA 5C0OE 3DEHA 2EGUA 1R15A 1XZKA 1BH2A 3DMDA 2VNAA 4IF6A 5EY5B 4QWMA 3HCCA 3RWBA 4C0AC 2FWRA 2VQSA 5SYNA 3INTA 5EWLB 3GI1A 2GFIA 3NPMA 4G56A 4TN1A 1GDTA 2ZIVB 3Q3GE 4KUEA 4UNQA 3I53A 1Q7TA 2K4MA 3EC1A 3B2QA 1GGMA 2CJWB 4C05A 3NORA 4FD2A 1TUGA 3JZIA 1P39A 4RHYA 1A5TA 1KFKB 2C57A 2EW1A 3ML1A 1UBFA 2YCBA 4J8PA 5CPFA 4PCAA 2TSYB 1FTWA 1Z0KA 2H2IA 5DGTA 4BZXA 3O1IC 2CK3A 3KOOA 1DRKA 2ZYGA 4XFKA 1ACMA 2OXIA 1SBTA 1KAEA 1AXGA 2I4LA 2PLWA 3CKLA 3PI7A 1RXIA 2JJ8A 1V2HE 2XUHA 4BJ6A 4GL2A 2GO1A 3IOEA 4M55A 1XF9A 5FNVB 3U6BA 2G09A 2G9QA 1AGNA 4EO7A 1LPMA 2IEDA 2ZW9A 1JMYA 2Q4DA 3DE2X 2VK1A 3GCZA 5IKPA 4PLWA 4P6VF 4EFLA 3KAKA 3C5EA 1MPXA 1LNSA 4KSBA 4PE5B 4YMHA 4D82A 5AW2A 4FE3A 4PQYA 4Y0AA 2PSJA 3E61A 3TBHA 1ES9A 1RRGA 3KLPX 1TCVA 1OLSA 3SI7A 2CE2X 4F84A 4OFBA 3VJRA 4Q9HA 1FB5A 1K5DA 1PR5A 5EIBD 1B41A 1XWWA 1JHVA 1Q2UA 1BMFA 3HV0A 4YJ3B 3NTLA 5L7WA 2GTIA 2LKDA 4PXYA 3PQ5A 4MQFB 2ODPA 1PFVA 3WK6A 4N0PA 4HH3C 5B58T 4X45A 1D3AA 1R6UA 3UAXA 1TJPB 5CYGA 1XA3A 1XZIA 4JLOA 4RPJA 2V0GA 1ZRNA 4G67A 4LHZA 4MR7B 3WLAA 3KUDA 2I8LA 4OQYA 2JFVA 2PTHA 4CMIA 5CIYA 4RV5A 1X9GA 4N03A 1KO7A 2Z95A 3QNUA 3EFOA 2KHZA 3K9FC 2F9FA 3GGPA 3VMFA 2HF8A 2AQKA 2CJPA 4ALLA 1PL0A 1CVIA 4FYVA 9LDTA 2FDCA 3ZEIA 4Q82A 2L2QA 2PUVA 3C3DA 3WFZA 3OG9A 1GPNA 4IO1A 8MHTA 4GBED 4TQAA 5K2MA 3R9KA 1WXXA 2FWMX 1WW2A 2OE2A 2ONZA 3ENQA 1DQPA 3HNPA 3OTIA 4PX5A 1WBBA 4MINA 4NS4A 1TTTA 1FFEA 2NQ8A 1DC7A 1DC6A 1BVYF 1NBAA 2DQSA 2JBWA 4WGFA 1K1EA 4IOKA 3QHPA 3W1EA 4ZVKA 4EF4A 3C5CA 3E3NA 4R05A 4BO0A 1EZZA 2ZI7A 3ZZUA 2W6JA 2ZIUB 5DLDA 4EELA 1G1AA 5CT5A 4UPDA 4UM5A 2GD0A 1GIAA 3RIHA 3I2YX 3ZIUA 2ZYRA 1JHRA 2F9MA 1ZVVA 1NASA 3GOHA 4PIPA 1NE7A 4XDZA 3NYQA 4RHUA 4KACA 4QBKA 3O6VA 4BIIA 3AERB 2CHEA 3MMNA 4HNAB 3DZJA 5KHOC 3FI9A 3QIVA 1F2VA 3RF7A 2Y4OA 2ZJ2A 4OVKA 4RH0A 4UCWA 4DIMA 1BROA 2WV9A 3INGA 4QXRA 2PZFA 4HDKB 1J1IA 4XARA 2GCNA 1PJZA 4YUWA 3SKVA 4A6XA 3CXRA 3FF4A 5B1HA 2WNHA 1LVHA 3PXCX 2V03A 4HLUA 3KYCA 4MW7A 1MAUA 1QR6A 1ZGCA 2WLTA 2FZWA 4RY9A 2NM0A 3BQ9A 1XMXA 3PEFA 3JALB 3WV4A 4H35A 4M0CA 4E70A 1XTJA 5IRCD 2F3UA 1DBPA 4UREA 5TPZA 4M88A 2JIDA 1UOOA 3PKZA 1LJUA 3AR4A 1EFLA 5L3SB 4X8HA 1EFPB 1EGAA 1FVFA 1LV8A 1EG2A 5IHXA 3VBEA 3C7AA 4Q39A 4M3NA 4FW8A 1TVKA 3HFJA 4D9FA 4RPGA 1IQUA 4IXWA 3ZUPA 5BMOA 4N8DA 4NCHA 3ZTYA 3W77A 5BWMA 1KZGB 3CUEF 2XKBA 1PLKA 3KJZA 5LQRA 3UMRA 4A7PA 3CZPA 3KWLA 3S2ZA 5DW3A 1TNDA 4FN4A 1FRQA 2ZWPA 4AP9A 3I9V6 5F33A 1FXWF 1Z13A 1ZD9A 2PVPA 4KN8A 4BP8A 4F12A 4KFCA 3WMFA 2ZAMA 5U9CA 4RF2A 3HKBA 1PJTA 4GOLD 2HLDD 4NK5A 4MCHA 5M29A 1C9EA 5BSTA 2ZT6A 3UHPA 2WJYA 5KYXB 2XA1A 3SIXA 4R8LA 3FPGA 2ZJBA 3LKBA 5K0ZA 2JIQA 1U1DA 2VHUA 2COEA 4GZ5A 4XLZA 5F52A 9GPBA 1KK2A 5AVYA 5C1IA 2GDZA 4Q3KA 2XADA 5IC5A 4MJ3A 5GVRA 1QHHA 3VPDA 1HOTA 1DCMA 2DFDA 1XD2B 3BS4A 3U80A 4B8YA 2FP4A 5YASA 4MLDA 5KOHB 2BFPA 2WUEA 1GD1O 2BTQA 4HY3A 1H9AA 3X2EA 1PGJA 1YWGO 3GZ4A 5GOZA 3KUKA 3MTGA 4D81A 1YZNA 3BKXA 3MJ4A 4RTRA 4UUOA 2ZRHA 3BK1A 5CNIA 1Q1ZA 5HKKA 3RVKA 3INYA 1NOKA 1UK8A 4V0RA 5BORA 2WSIA 1QG0A 1Y82A 4PAQA 1YA4A 2JGAA 4HB2A 3EODA 3SHVA 2WKPA 4KQXA 2QWXA 1JA1A 2H18A 1ZN2A 1GG2A 4ZI7F 1EX1A 3MT0A 4JI7B 1AH2A 2XXAB 1ZG3A 3ZHVA 2WRZA 1VPTA 4K6KA 4BVHA 4K8RB 4K5QA 1QQBA 3BMQB 4EMBA 1U2DA 2TMDA 3UHAA 2A3RA 2BONA 3ADCA 1XNRB 5CTAA 3HABA 4RD4A 3L3BA 3DC7A 4OHMA 4WECA 4CCWA 2J0VA 4RK1A 1FX0A 1KOFA 1NPDA 5JFGA 3FDIA 2A2ZA 3L06A 1JR3E 3W78A 2WM9B 4XVUA 1M2VB 1V0JA 3JWHA 1T3GA 4D3YA 1RI3A 3OA0A 1RWOA 3MVEA 3DEAA 4G8CA 4EJSC 2IS6A 4ENTA 2Y92A 3ZDQA 4HLQB 3LQKA 3IODA 4S1PA 4BX9A 1DPGA 1VLHA 4II2A 3EVZA 4F2DA 3IMEA 4JJFA 3C6KA 2R8XA 5DIZA 2VYVA 3PSHA 3DGFC 4GRIA 1XCJA 4JT8A 4LPKA 3GRPA 3IV9A 2A1TR 4QM7A 1ZBQA 5HF6A 1OX6A 1WD7A 2J3DA 2HH9A 2R44A 1HDXA 2Y1DA 2VHQA 1EWVA 3BGVA 3L0PA 2Z2YA 3NCTA 4KWEA 3WRWA 4FYPA 3OE1A 1PFGA 3HP4A 5ESDA 3V00A 1RTKA 1TCCA 3PA8A 4D4HA 1MAWA 2C9DA 2GYVA 3FLEA 4G1FA 2XVZA 5LWQA 1C8BA 2HUNA 3TR5A 5B1DA 3EHEA 1DELA 1P4HA 5KYGA 4S1WA 3OHPA 5LLTA 3PT5A 3OJFA 6CHYA 5M34A 4JI6B 2I62A 5A05A 1SC3A 3PHIA 3MJTA 4FX5A 3RRJA 2GQ0A 1OXSC 3WV5A 1D2NA 3PYXA 3Q5EA 5DNDA 2R2GA 4B4OA 1IH8A 1A5ZA 2PKRA 2K5UA 4JUIA 3E05A 3KUUA 4AYTA 3CEPB 1CZRA 1C9NA 3PQ2A 4R0NA 1UXJA 2I7CA 4J2HA 4JI8B 1IEQA 5TT1A 2VQFB 3LI2A 3U31A 1XN1A 2AG6A 2X5OA 5AM0A 4F3YA 6AT1A 4NU5A 3QH4A 1ETUA 4I9FA 3RUDA 4DY4A 5B64A 4BRWA 1CPYA 2PGIA 3ZHXA 2OCAA 1WKCA 2JK1A 4FFVA 1IWOA 1KEWA 1NPTO 1YS7A 4L5IA 4C4SA 2PXHA 1XK7A 3HVRA 4LJ9A 3EXG1 1KEVA 1E2PA 2P75A 5JI2E 4KBYA 2UXCB 3U26A 1FUYB 1T1JA 1G20B 2VHCA 2X1HA 2Y6VA 3A26A 3ADPA 3AQ4A 1UEIA 3R3VA 4JX8A 3RSFA 4Z4GA 2EATA 5SZIA 1ZH0A 1TUIA 4RIHA 2QAIA 5KSPA 2PL5A 4GYJA 2C31A 1HMPA 1EM6A 2CZCA 2ODNA 1QBGA 3GGOA 5ADHA 1HH4A 2JEOA 1Y42X 2AR0A 4YPVA 2ZKIA 1SGWA 4PQEA 2YVAA 2W6PA 2HWKA 3HHPA 5FJJA 5AJYA 3JQ7A 1EE2A 2JHFA 4RSMA 1RCTE 2VTDA 4WLUA 3A37A 4B7CA 1M0EA 4KJZA 5T7BA 2HJSA 3W7AA 5F3WB 2I7VA 2DSTA 1U99A 4RS4A 4O4HA 4GI2A 3L18A 3F6RA 3O2JA 4QPZA 1RVDA 2Z3WA 4IWYA 2BFMA 2MYTA 1KH1A 1UBJS 2IWRA 3HVJA 3FGPA