2O1SA

1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
618
structure length
536
Chain Sequence
FDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPALPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1-deoxy-D-xylulose-5-phosphate synthase
publication title Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 169
structure length 536
sequence length 618
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.7: 1-deoxy-D-xylulose-5-phosphate synthase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
A PF13292 DXP_synthase_N 1-deoxy-D-xylulose-5-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA02
2VK8A 3ZHTA 3ZHRA 3DV0B 1R9JA 2R5NA 5IMSA 2W93A 3M6LA 4K9OA 4K9QA 2DJIA 1T9AA 3FZNA 2JLAA 3AHHA 1YNOA 4FEGA 1UMBB 3DVAB 3FSJX 1V1RA 1OLSB 3KOMA 1W88A 2E6KA 2OZLB 3DUFB 2R8OA 1YHYA 2JI6A 3EXG1 5K3SA 2QTAA 3JU3A 2UZ1A 2BEUA 4GPEA 1X7XA 2YICA 5ESDA 2QTCA 3DV0A 1Q6ZA 2UZAA 5DGDA 2PDAA 3D7KA 1ITZA 4MZXA 1UPBA 1UPAA 1UMBA 3DVAA 5EJ6A 1V16B 4MPRA 1OLSA 4JUBA 1DTWB 2OZLA 3DUFA 2PANA 3LQ1A 2Q5QA 2IHTA 2JI9A 2G67A 1N0HA 5EJ8A 2BEVB 5EJ7A 5ERYA 3EYAA 5HYVA 4GP9A 2VBGA 4JUDX 1V5GA 1V5FA 5HJEA 2EZ9A 4COKA 4JUCA 4GG1A 2BFBB 4K9PA 2VBIA 2C31A 2EZ4A 5K6TA 1DTWA 4KXVA 1JSCA 3MOSA 1AY0A 1UMDA 5EXEA 3ZHUA 2BEVA 5EJ4A 1MCZA 1X7WB 2JGDB 2PGOA 1NGSA 3LQ2A 2C3PA 2VJYA 3AHEA 4JUFA 4Q9DA 1UMCB 2C3YA 4K9MA 1YHZA 4KXUA 2R8PA 1U5BB 2NXWA 1X7YB 5I5GA 1W85A 4FEEA 2JLCA 1T9DA 2BFDB 4GM4A 1X80A 2BFFB 1RP7A 3M49A 1OLUA 2C3OA 5ERXA 1X7WA 2JGDA 2Q5LA 1T9CA 3E9YA 1UMCA 2VBFA 4MPPA 4K9NA 2G28A 4QELA 4JD5A 4JU8A 3HWX1 2Q28A 2WVAA 3AHGA 2BFFA 1YI0A 3M7IA 2O1SA 1QGDA 4WBXC 1KEKA 4KXXA 1WCIB 2JI7A 4K9KA 5I4IA 1UM9B 5EJMA 2O1XA 1TRKA 2BP7B 3ZHVA 1GPUA 3M34A 4KXWA 2EZTA 4RJJA 3EXFB 4KXYA 2JI8A 5DEIA 1V16A 2Q5OA 1PI3A 1QPBA 1V11B 2WVHA 3UK1A 1PYDA 5HHTA 3F6EX 3EXHC 3AHFA 3LQ4A 4C7XA 3AHJA 2BFCB 2Q27A 4ZP1A 1UM9A 3OOYA 1OLXB 4JUAA 1BFDA 2EZ8A 4GM0A 4GM1A 1YD7A 5I5EA 2IHVA 3EXFA 3IAEA 2AG1A 2V3WA 1TKCA 1TKAA 2BFBA 4KGDA 2XT6A 2UZ1B 1OVMA 2BEUB 2VK4A 1X7XB 2AG0A 2YIDA 1ZPDA 1T9BA 2BFCA 1YBHA 1OZFA 2BFEB 2C3MA 2BEWB 1PO7A 3AHCA 5FEMA 2X7JA 3EXHB 3HWWA 1X7ZB 2IHUA 1QS0B 1OLXA 1V5EA 2FN3A 3RIMA 2Y0PA 3F6BX 5K2OA 2Q5JA 4XEUA 2JIBA 2G25A 1U5BA 2EZUA 1X7YA 2FWNA 4MPJA 5AHKA 3EY9A 1TKBA 1PVDA 2BFDA 5EJ9A 1L8AA 5I51A 2WVGA 3ZHSA 1OZHA 3OE1A 2BFEA 2BEWA 4MQ5A 1OZGA 3EXHA 4RJIA 1UPCA 4JU9A 3AI7A 1X7ZA 4RJKA 4D5GA 3UPTA 1QS0A 5K6RA 2PGNA 1YI1A 1B0PA 5DGTA 5EJ5A 3HYLA 2XT9A 3EXEB 2IEAA 2J9FB 1V1MB 3EXG2 1UMDB 2C3UA 3EXIB 4C7VA 5HGXA 1NI4B 1Z8NA 2C42A 3FLMA 4D5EA 1WCIA 1Y9DA 4QPZA 3ZHQA 3L84A 1W85B 1IK6A 2XTAA 3LPLA 4K9LA 2BP7A 3AHDA 4QQ8A 3EXEA 2Q29A 1X80B 2J9FA 3EA4A 3AHIA 5EJAA 1V1RB 1V1MA 2VK1A 5C4IA 1W88B 5EXDA 3IAFA 1OLUB 1POWA 3EXIA 1POXA 1V11A 1NI4A
chains in the Genus database with same CATH superfamily
1E0SA 1OY1A 2VK8A 3C41J 1MQAA 4OI4A 3ZHRA 3U61B 1NBMD 4CLRB 1P6XA 1LVGA 3LUAA 1CQWA 4R1OA 3A1DA 1RXSA 4E4RA 3JY6A 4ZGGA 3HXMA 1OBHA 5H68A 4NDAA 3DCYA 4D9BA 3F9RA 2AE1A 2B3DA 2GK4A 2PMFA 4RACA 2VYND 4CF6A 5ITSA 3E3LA 4ZQCB 1S9DA 3RANA 4F85A 8GPBA 4LRXA 3HUFA 3OEYA 1WW2A 2NT3A 4W8HA 3I04A 4ZIRA 1U4OA 1PX0A 3V8RA 4YJ2B 4DNFA 4KO2S 1C9NA 3ZZ0A 1RMQA 4M9SA 1K6XA 5FPQA 1JR3D 4YLEA 3WLLA 4G0XA 3DEFA 3DVAB 3CG0A 3UJ8A 4M4SA 1CUAA 3VX3A 4CZ2A 5C1PA 3PGLA 3ZIAA 4BIIA 4W6ZA 2XWPA 1H2ZA 5I7EA 2YHSA 4D80A 1P4GA 2UYHA 1N5JA 1JIVA 1YL6A 1B16A 1Z7WA 2PKRA 2XMPA 3EGIA 1LFDB 4WADA 2AXNA 621PA 2GD6A 3U60B 4HGNA 1L1EA 1VRCA 4LNHA 3RVQA 3KSMA 4L0QA 4JLPA 4EBFA 4FEYA 3HZOA 4M1KA 2F00A 2X0NA 2BE7A 2Q3LA 5K3SA 2QTAA 3JU3A 2W4IA 3ZKWA 4BZQA 4BU0A 5LB4A 2P6OA 1IE3A 1KI3A 2PZGA 1UJ6A 2ZSKA 1X7XA 2OHXA 3O9VA 2OLEA 1BGVA 1JDPA 4RKYA 1SXGA 2V54A 3EUWA 3OQMA 4Q7KA 4UD2A 1KORA 2YWJA 2FFAA 1DQRA 5LA6B 1JXMA 3IB3A 3URMA 3K70D 1WXQA 1P3JA 3JZAA 5CDYA 1VE7A 1IY0A 1QVAA 3I5XA 1HPLA 2CGEA 3GZJA 2JJ1A 3C39A 1A2QA 2BBTA 4MV8A 4HWRA 2QB5A 1WUKS 2NQTA 1PYGA 4PBRA 3T4XA 1RZRD 2KLHA 3DHWC 3EQ9A 2I6UA 3V7FA 3LCVB 2BBOA 2JK0A 1NQOA 5KNCA 3CVOA 3N2ZB 2Z6VA 1BRTA 4AU1A 2QT1A 5BWMA 1PD1A 2FOLA 3EWAA 3L4BC 3R9WA 2BGTA 1TW2A 1VG8A 3DLAA 4M7PA 1QGUA 3BWYA 4Y1EA 4AZ0A 5SYNA 2PV0A 3TZBA 1R6VA 4LDNA 4I6EA 3RKUA 1U0LA 2F7SA 4BUZA 1Q1ZA 3SS9X 4FYYA 4MVJM 4BLOA 1QIHA 3CX7A 1TC2A 1T3HA 2ZIVB 1H2YA 4GZ3A 2GARA 3ASVA 5EIWA 3UANA 4WUVA 2A1UA 2ZUTA 1CJKC 3TD2A 1GUFA 1FDRA 3AIOA 3OPYA 4ZKEA 3OJXA 1N5LA 4FC6A 4NBWA 4R69A 4RXMA 1SA0B 1PDVA 5LQDA 4IVNA 2CLFB 1J97A 4EH1A 3NNSA 3NM6B 1QGOA 3LPDA 3K70B 3FHJA 4FCWA 1EZZA 1YZHA 2AUNA 3WYGA 1IDN1 2WMNB 4DIDA 2PM8A 4EF4A 1ECJA 1ESDA 1QV9A 3BTVA 3GOQA 4C29A 4U4AA 2DKNA 4K8OA 1NVXQ 1QRTA 1QLWA 2P1ZA 3BE8A 3L1JA 3OTHA 1GUZA 4HDAA 5BUQA 2BCJQ 1IHPA 4GG1A 4BKQA 5K0BA 1U3WA 3HDJA 5GP1A 4EW2A 2GDZA 3CUUA 2R8YA 4DQDA 4KBFA 3FNHA 3GW8A 3W7BA 2QSJA 1EG7A 1MOPA 3KQPA 3GJ0A 1VL1A 4MWEA 4URHA 5D85A 5EA2A 3RHZA 3RVBA 3IP6A 4ZVOA 2LTAA 2XQVA 2V5AA 3F4LA 3LT5A 2B5OA 5BOVA 4IX1A 3LCUA 5I9MA 1PS0A 3WSVA 1XXHE 1UDAA 3NYIA 4LXUA 5CYPA 3GO4A 5AVOA 1EINA 3AV0B 3GVPA 5KTMA 1HY3A 2E1PA 1C9MA 4AQ7A 2AVNA 4UBMA 4EA6A 2FUNB 5JFTA 1ECBA 3RDPA 3WOHA 3RS8A 4EFDA 1JIJA 2O2DA 4DLSA 3TL6A 1JAIA 3PFFA 4FONA 4QA9A 4O8CA 4WOBA 4RLSA 4C4PA 4X1KA 2AE2A 3FDIA 4LMBA 1QK5A 3GPIA 2GA8A 3BE5A 3PC6A 3UFBA 1YR6A 1HGXA 4EUFA 4UEOA 5AM0A 5HE9A 3T99A 1CJUC 2OO5C 1NGSA 5FOSA 5BN3A 4OLAA 1QPZA 2C3PA 3O7WA 4G4GA 2W2XA 2VJYA 3SNHA 5L6MB 1NDUA 3SYNA 2HMWA 1A4RA 3FLBA 1PV1A 3KJGA 4IHAA 5B36A 5J2TA 4YCSA 2P9GA 1S4QA 3G8DA 1D7OA 1DDGA 2EL9A 4PLVA 1HYEA 4C4RA 4KQWA 1QR6A 1SK8A 4OM7A 3N5CA 5A7GA 4PICA 1B23P 3VKWA 1KKLA 4JOQA 2UUBB 4MEJA 2VDRB 2PLRA 2AFVA 2YRXA 3N39C 5FA8A 4KQXA 3PXGA 3HLTA 3EG5A 1FTSA 2GCOA 2XA2A 3RC2A 5JS8A 1GQFA 3Q3GE 1RYNA 5HXAA 4YQZA 3D6NB 2UDPA 1WCXA 3PJGA 5ELLA 2B7LA 5IH3A 1WOYA 4ZV4A 1MG5A 1ZH6A 4TRJA 3V7YA 1KVRA 2WNIA 2FE1A 2EAUA 2W90A 3JYPA 4D3DA 1RP7A 4IEEA 2WICA 1ZGBA 3L4BA 5HIJA 4QBTA 3IS3A 5E6RA 3RRXA 1AF7A 2GJ9A 1SVMA 2AG5A 4ZAVA 2RGUA 4LGVA 1T3SA 1P4JA 1FTGA 5EP2A 3I9V6 2JGDA 2WFAA 3HXTA 4M3NA 1CZUA 1XKTA 3K70C 3EGCA 2I2AA 2YW2A 4CLRA 1YT5A 1PG0A 3PFGA 4OYHA 3UPDA 4IPTA 4RGVA 4I5FA 4AJNA 3WGUA 2NSYA 1GYQA 5ALSA 1IQRA 3T4UA 2ZT6A 1ULZA 2FRVA 4ZYVA 3OLCX 2WTEA 1XVVA 4C0XA 2B2CA 5CGQB 5K4HA 3IESA 1ZIXA 3BPSA 3KSRA 1EWRA 3ZYZA 4JYCA 4BVLA 5KVCA 4Q6WA 4GKKB 4M9UA 4MWGA 3WRWA 3HJNA 3ROFA 3O94A 1PJZA 5GGYA 2HI0A 4JLJA 3RFXA 5DLYA 4I9HA 5BRAA 3E9QA 3A6EA 1JGTA 2F2TA 5LOVB 3VO9A 1K1EA 4YI5A 4MB6A 5SY4A 1B6TA 2XUQA 1DPFA 1Q0SA 3H1BA 2CLIB 4X97A 3T7IA 2FE4A 1AUOA 1NXXA 1W25A 1XJWA 1Y6ZA 2JFOA 2VRCD 2I2FA 1JPVA 3L7OA 3ETHA 2CLEB 4MIEA 3R7AA 2FUG1 2NX2A 4QJ3A 2JFZA 4CV1A 4O29A 4B0OA 2WHXA 4HTAA 1ZK1A 2QMEA 3UWPA 1HX7A 1EXVA 1GPBA 2Z4RA 4CKBA 4XAQA 2DLNA 1SHTX 1CLEA 3HDVA 3KBBA 3G85A 1IY8A 4L5YA 4M0MA 3SVZA 3UY4A 3NC4A 3VC1A 4AWAA 2ZJ7A 3BD7A 3O0DA 4UHJA 4HNTA 4NNPA 3LX6A 3ODPA 3PRKE 4Q7JB 2RHTA 1NBMA 4R2XA 1F60A 1LSUA 4FKZA 4JLAA 4Q4CA 3HP1A 3N53A 5G4LA 5LA6A 3WADA 2VRWA 2OO5A 4P4UA 5JWHA 3RAEC 3FZGA 4PR0A 4Q0MA 3V8NA 3ZKAA 3PF8A 1E1MA 4H4CA 2WZDA 1A9PA 3OJOA 1M5RA 5TQ2B 1E3IA 2WSIA 5T67A 4EAAA 1HA3A 3DE6X 2IWHA 1P5ZB 1T8YA 2FQQA 1CK4A 1NE7A 3C7DB 3PEUA 1M1YE 3I1FA 4NMXB 3HE3A 4FFWA 2FGKA 3OZFA 1WPGA 1EUCB 1IHYA 1QYRA 4IXTA 2WV9A 2ZVDA 3ZWXA 3NVMB 3NWBA 1JR3A 2NSHA 2R2GA 5AQEA 5L3QA 4I50B 3LLVA 4MWZA 2AMVA 4XFDA 5DXJA 4G5OA 3PS9A 4Q3KA 4UJ3A 1QTIA 3C3EA 2FZCA 3N0TA 4HGPA 4OXIA 5FPYA 2BISA 2IU3A 4V0NA 3WG9A 3AETB 2WVHA 2BGNA 4OTZA 3DAPA 2IEGA 3TD9A 3D4BA 2B1RA 4X5OA 4QM7A 4V0SA 1EK2A 4EMTA 5BT9A 3N2EA 4Q3EA 1YVUA 4OUKX 1Z9BA 4PZLA 1NDHA 3TYXA 1EGHA 5C7LO 3P0EA 3AF3A 4FLFA 3DLPX 1YULA 2Z95A 1NNEA 3SS7X 4YAEA 1P1KA 4Y9UA 1Z07A 1L1FA 4LCBA 2WUDA 2GZRA 1SA0A 3DZKA 4MX8A 2OPBA 3QEAZ 1QUFA 1QVWA 5IULC 3CLUD 3SJ7A 4IDAA 4OAOA 1MD9A 3PQFA 3UCFA 3NJ8A 1V6SA 3LIPA 2EZ8A 1KQNA 1P91A 3GAAA 4JOCA 4X64B 4DSTA 3GZTB 3LNCA 1YD7A 3TQTA 3W9SA 2ZE7A 4G9BA 1BH6A 3B89A 1VG0B 1RZRA 1SZJG 2W6OA 1YIOA 4MYUA 3UMYA 3RRJA 3WWOA 1PL6A 2P90A 4P33A 3KR2A 3FJ1A 1TTQB 5C8XA 4DV1B 3U56A 3AL0C 1L1RA 1NUTA 4LF9B 3GEDA 2JG3A 1N8TA 1ZVKA 3OZRA 2XMSA 2ZB4A 2QX6A 4TOIA 1V3QE 1JBEA 5JE8A 5TQVA 1AGYA 1SHJA 3R7SA 1PT6A 4AJ1A 1NBOA 4ZK6A 3PJEA 4A27A 3MJSA 1G2QA 4IWYA 1EJ6A 3AO0B 1NWCA 1CVIA 3SDZA 4AMBA 4BNXA 4C6TA 1DKLA 2EJCA 2VDNB 2RAPA 4R81A 1P29A 3GLVA 5GZ3A 1K27A 1EUDB 1QYIA 1Z5WA 5KWVA 4RVDA 4TZTA 1Y98A 3EISA 4MS3B 3A0RB 3CONA 4MW7A 3X44A 3K1AB 3RROA 2H2FA 1XNJA 4C3OB 5ED4A 4TZ6A 1FRZA 1H66A 4U7GA 2YFHA 3L93A 4GLOA 4O4IF 4TWZA 3M2TA 4AFNA 2QMQA 4LOHA 1Y6RA 5FPSA 1ZN2A 2NIPA 3UH1A 1XZHA 2PX6A 2JIZA 4KXQA 1G0NA 1HQCA 5JDIC 2H08A 3WK8A 1L5YA 2JIBA 2XHEA 3VNQA 3C7KA 3S6JA 4LJLA 2YCBA 2YOHA 1WXHA 1QTRA 1CPYA 1NPTO 1KEWA 2IYZA 3BTOA 4W1QA 5AHKA 1HURA 1KYZA 4MV1A 1VA5A 3G0GA 3QVOA 1F8FA 1M2FA 1TVMA 4GX0A 2VZLA 4W9RA 3KK0A 3UBTA 3GCWA 3JD1A 1WOMA 3O1LA 4F6CA 1W46A 2FPOA 2QNBA 4GOND 2YX1A 3DKKA 4YPFA 1NMZA 1EM8B 3WNQA 2FEXA 4MWOA 3KHTA 3UC5A 3C6YA 4HX2A 2C88A 1TOAA 2OZPA 4IDGA 4AMVA 1GQ2A 4IOLA 4N9WA 3PQDA 2XGMA 3BS4A 1E0JA 4RJKA 3TTXA 2HPZA 3G2IA 4CG3A 2D13A 2FEPA 1H1LB 1FRVA 3DBRB 4OBXA 3QXHA 1DADA 4Z3OA 1QMPA 4MCHA 1QH1A 1RZ3A 2H65A 3D4PA 1MAWA 3GQVA 2C2KA 2F3RA 3BFVA 4OKIA 3FH0A 1TMKA 4ZYYA 4I4LA 4S3MA 3QWIA 3EW7A 4X1YB 3A14A 5FTJA 1JILA 1P7YA 4MR7B 1GPYA 4X54A 4RKQA 4UFPA 4J2OA 2W7TA 1VKRA 3CW2A 3MILA 3P0RA 2XT9A 3DZ8A 4Y1GA 1CQPA 2EBHX 2QL9A 4D3SA 4CM9D 1NM5C 3CLSD 2ZDHA 4JNKA 1EZ4A 4H1VA 1KQGA 4C0BA 1DJQA 2HJWA 2J9FB 2Q4BA 4EG0A 1YZNA 1L0BA 1SGWA 3T1VA 1T4BA 5JMWA 2YR0A 5L3VA 1Y34E 2FAXA 3KR0A 3KLNA 1XN1A 4INAA 2EFYA 5ALHA 1R00A 2L42A 3AR8A 4OXQA 3HKEB 2VT3A 1RKBA 3C3JA 4DY4A 3MELA 3QVMA 4MUEA 3URKA 1OCEA 1WLYA 3QI2A 4X45A 3SICE 2IW3A 2VCHA 3ON5A 4EG3A 1YRYE 3ZWQA 1IZYA 3CUKA 3VZQA 1QQBA 4UBLA 2ZJAA 4O0LA 2WB2A 1GAEO 1T2AA 4MO9A 4UW9A 1UXGA 2XNCA 1CIPA 3OQ1A 4XI9A 4EJSB 3P8ZA 2Z2KA 1A71A 1J2EA 1YQQA 2IYOA 3BXHA 1E2NA 1EGAA 2G3YA 2ONZA 1EZ1A 1RLJA 2CSUA 4GZLA 4B4WA 3MS4A 1CNFA 2L82A 3WP0A 1UPTA 4C4ZA 1ZDMA 1XQXA 2VAWA 1L4LA 1USIA 1XAHA 5GONF 4XSVA 2Q4RA 3D9QX 3BZUA 4B87A 3S2IA 3LKBA 4TMTA 4MW4A 2HGSA 4C3ZA 2HHJA 3R76A 1R50A 1MO6A 2OT3B 2QVZX 4M22A 1OF1A 4RK1A 4S2UA 2ATCA 2JGIA 3UVEA 3SMQA 1RAHA 3GVIA 3SHVA 3RLIA 4H7PA 3BG5A 1E3SA 2ACEA 1UK7A 1P5JA 2VQ6A 2WT9A 3LPLA 4HGYA 4IXDA 3BRWD 2C20A 4HQ0A 5TQ0A 2YWDA 3ZEIA 4B3GA 3LGSA 5JC8A 1XEWX 3TJZA 4IIBA 1I3CA 2F90A 2X5KO 3E3OA 8LDHA 4XIJA 2JDID 5I8ZA 2D5AA 1IJEA 4DNQA 5K8JB 5JIBA 5JDIA 4HN2A 4FUQA 1V41E 3FHCB 5EXDA 2H07A 2K7FA 2VDOB 4Q3DA 3WSTA 1FJXA 1R4AA 2LDXA 4GX5A 1Z2CA 3HB4X 1HETA 2ZQYA 1QE0A 4D4LA 2Q2QA 1A2OA 1POXA 3QF7A 2O0HA 2P5UA 4NBLA 4WCFB 5AJYA 2VS1A 1YCHA 2GLUA 1P2GA 2FR1A 4F56A 5FBHA 1YCDA 4BFWA 1SOUA 4QDOA 4A92A 4JBYA 2B4AA 2VRCA 4ARVA 1ZSVA 4JBHA 1MABB 2RI1A 4IV0A 4JFAA 3FB4A 2Q9CA 2H1FA 3LNTA 2QROA 4WIAA 1NUHA 5KPDA 1OHHA 2XWSA 2Y1GA 4MRMA 3LCMA 3RRYA 3W5UA 4GOKA 3OOWA 1RWBA 1LPSA 1OZ0A 5E1DA 2JH3A 2ZYVX 1IN1A 3GRVA 1W8IA 2XCUA 3OZ7A 4BKOA 4UEKA 1T34A 4ZT5A 1BEEA 4B80A 1EFPA 2ZXEA 3DFZA 1KR2A 3G02A 4ENVA 4XGIA 3B70A 3IVRA 1G3IA 2E4YA 3KYCB 3C5HA 4MUJA 2H51A 3T8YA 4FHFA 5ALEA 3CW8X 1H2AS 3GN1A 2ZP1A 3VOAA 2CMHA 5EGNA 5L3SA 5B3LA 1Y6QA 3ENQA 4I1YA 2G1PA 2HRDA 2H57A 4CMAA 3BJRA 3F98A 3IO5A 1XTTA 3BXEA 4MI3A 5D1HA 3GHYA 2I7CA 3RFCA 5HQ3B 3SVTA 1NM5A 3H2IA 5ALLA 2AMYA 1GTRA 2AI1A 3HNRA 4U3JA 2QZ9A 1E2IA 5HRAA 1N9ZA 4DT1A 3UCEA 4OXKA 2E6UX 5JAMA 2C2MA 3EH1A 4KQCA 3O8RA 4NZ9A 4XZ3A 4KDFA 4ZQIA 2L0XA 3SYMA 3BJEA 1W2HA 3HJCA 4DQLA 1XF9A 3ZTWA 2ECKA 3GG9A 1BA3A 4HLUC 4PM4A 4B0PA 1AKNA 2GO7A 4MUNA 4WINA 5K8UA 3LHSA 1FJHA 1QM5A 1TVEA 3ZZUA 5GY7A 3Q8LA 1AUXA 4Z0TA 1FQOA 3GA7A 4ZVNA 1EUDA 5B6PA 5CA1B 2WWYA 3C6BA 1RI4A 2O3RA 5IYZF 3WWYA 1SCJA 5JC1A 3M1LA 1GPAA 3K1AA 2FPKA 3MYYA 4DMCA 4XEHA 1T2DA 2QGZA 4H0NA 1XPUA 1VSBA 4WE3A 3L04A 1INLA 3UOAB 4K26A 4AKGA 4D9MA 5EKUA 3T38A 5LYYA 3EULA 1R8QA 1WXWA 3C8ZA 2ETXA 2XVAA 4EPVA 3UGJA 3IIIA 3F0TA 1SBIA 1VHQA 2HLNA 3BX1A 1UJ2A 2NVWA 1ZM2A 2G80A 3BSFA 4WQMA 4JKIA 3WNZA 4F46A 5C4MA 1XK7A 4WCFC 3LQ1A 2ZRDA 4HNRA 4P4NA 2JFGA 4JEIA 3E15A 3SEZA 1F8GA 4G4SP 2E1RA 4UHBA 1ID8A 3CLTD 1U1DA 5FDFA 3CN7A 2BEVB 3HCFA 1IWOA 2YMPA 4FYMA 3AZPA 4AYWA 2J59A 3O3CA 4FN5A 1O03A 4FQ7A 2MSEB 2YHIB 1TMYA 3C2QA 3AM1A 2H5JA 1V45E 1YOVB 2D4AA 2JGJA 1DRVA 4MUAA 5DRTA 4ATNA 1LPBB 2J48A 5HYVA 5ICEA 3ELDA 2A5DA 5U4XA 5JSFA 4A5OA 4HK4A 3O1JC 4H15A 1LC3A 3O2JA 4ZFNA 2ZYIA 2BTQA 1G7CA 4FDTA 4UATA 3EEYA 4XWTA 1UBHS 3T5MA 4Z1MD 1KS2A 1V5FA 1A8PA 1XAGA 2DHDA 2PCLA 2QL7A 1ZCAA 3DR3A 2XDYA 1ISGA 3EF0A 1IQUA 3EZYA 3HNOA 3N6XA 4P9NA 4TMZA 4WKCA 5EI5A 1EE2A 3ZV7A 3L7JA 1FFGA 4COKA 1W7AA 5AVRA 1JQLB 4Y67A 4AF6A 1C3EA 1EX9A 4LMPA 1ZNWA 3I2HA 4FFLA 2OCPA 4YPOA 2MMCA 5D8DA 2D2XA 2H0QA 1O0SA 4MGZR 2WWWA 2X2FA 4YCAA 1ONSA 4G97A 4LQDA 1JJVA 4Y6QA 3RTAA 3ZXSA 2NZUG 4ONEA 4WHMA 3A70A 2AD5A 5E9AA 1JEAA 3DM5A 3EIFA 2J3JA 4KXVA 3JZFA 4U9HS 1FDWA 1MZVA 3WJ7A 3NJRA 5KSZA 4OK3A 1N2ZA 1F2UB 1FNBA 4HFNA 4MMXB 5HA5A 4XVRA 1SHKA 3K1YA 4BLTA 2R6HA 4HR7A 1OI2A 3KJFA 3AYXB 3QLJA 4PPGA 2QV7A 3HKEA 3EGVA 2YL2A 4MCAA 2GWHA 4MMYB 5GJBA 1RAGA 2ZIGA 5EMKA 4FOSA 2YWEA 3CZ4A 3UJBA 5A0VA 2X4DA 1GZSA 3UXHA 1ZOIA 3HJFA 2V0CA 5JCJA 2R4QA 3Q10A 4MKFA 1L7EA 4GSYA 4GC9A 3FVQA 3N8HA 4HSEA 4JJ6A 5KINB 4MWCA 2ZW9A 3K0BA 1HC7A 1XQYA 2H4FA 3KVYA 1I3NA 5HILA 3TO5A 3FGOA 4HLUA 2GM9A 4ZZ3A 2DFKB 1A9ZA 1EI9A 1UAGA 3HBAA 4IEFB 4KXUA 2RGGA 1FX1A 4OHFA 4HDKB 3S44A 1F4LA 2BEJA 1R0BA 3RNLA 4XWOA 1RWKA 2B2XA 2PX0A 4O4LF 3ND7A 4NCNA 4UE3S 5FJJA 5K51A 5CXXA 4BRUA 5JZSA 4A2PA 4X7BA 3I9NA 2LCIA 2VCYA 3UG6A 5ALOA 2GEBA 4C04A 4XR9A 2P2ZA 2X6QA 3NH6A 3PQ2A 4G6ZA 2H1HA 3JWHA 1WR8A 1PKEA 1FUIA 1MO2A 4LWZA 4RMNA 4XLTA 4CM9A 4FYJA 2O20A 1MC1A 1BA2A 2J5KA 1IJFA 2HLHA 4YO8A 1QR2A 5EPEA 2ZJBA 4ER6A 3HY3A 1JG4A 3SKVA 4NENB 3FJYA 2WJ3A 3A9VA 3GCZA 4PZYA 3MSXA 1QAQA 3FDZB 1XEXA 2XB4A 4GICA 4JROA 4WCFA 3RVJA 4PYIA 4I6GA 4CM4A 1T0IA 3F78A 4HPJB 3JQGB 4KIUA 4CCAA 4EFKA 5CIYA 4PGFA 3FE2A 4BB9A 2YJNA 4O1HA 2Q7OE 1DO0A 1MABA 3FA2A 2PQ0A 3BXGA 4QIHA 3ED1A 4FR2A 5HE8A 4N41A 1NMYA 4F4FA 4NTZA 2F55A 3GMSA 4A0QA 4BVHA 2A86A 1ODIA 4ZVPA 2FYTA 4WFIA 4DBLC 3NNDA 4FCCA 2BJVA 4DQVA 3MQ2A 3B5IA 1S3IA 1M34E 1U94A 2CEAA 3NWPA 3FCEA 2HL6A 3DMFA 3GQBB 3P1JA 2EBWA 2ZIZA 3KRTA 1V2HE 2Y1WA 2B4KA 4D0GA 1UFQA 4P7JA 3SXPA 5JQWA 2ZJZA 1GXSA 3KYCA 1Z4NA 3DCNA 3FRJA 1Z82A 3I5MA 4PANA 3AHGA 1ZL2A 1QTNA 2RH4A 3PTLA 4BZWA 4DUGD 2EFJA 3U3MA 2PPLA 5IMBA 2IUUA 2VQEB 4XGRA 3VYTB 4EVRA 2JDIA 1W2GA 2XF2A 4BPRA 4ZHQA 2XTZA 1PJ2A 1VBMA 3CLTC 5HFNA 1CNMA 1X13A 5C81A 2GRJA 5A3QA 1K4KA 4NOJA 5EKXA 1L7OA 2Q50A 3DB2A 3H3JA 2JHPA 3NBZC 5EIEA 1HO3A 3EGWA 1KDPA 5A71A 4Q24A 4LZLA 1JH8A 3WL4A 3C48A 5JMOA 2O8BB 4NYIR 1D04A 4AUMA 1QHNA 1QORA 1ODJA 4PTZA 5AI4A 3VTAA 2CF5A 2Z3WA 4KP7A 3WGTA 2WAXA 1CF4A 4WK2B 5JSQA 2A0KA 2ZS7A 1ZEJA 2D1TA 1M2NA 3G2PA 4YWHA 3VPCA 3ZGLA 1OOEA 3K6SA 1O5IA 4PPNA 2POCA 1GUYA 1ZONA 2FX5A 3EDMA 3PIIA 4HLCA 1Z5PA 3TR5A 1J39A 4L7VA 5CA1A 4HVAA 3GLIB 3MMSA 1QHXA 3KYDB 3M34A 4C43A 2XKJE 3AG5A 4UUPA 2IT1A 3UT5B 2EZTA 1H8HD 1VLHA 1JXQA 3B6KA 1BKYA 3QW4B 5GAJA 2R6GA 4YGYA 3FD8A 1RYYA 1A9TA 1Q1NA 2I6QA 3EXFB 4KXYA 2OB2A 3GFTA 4QNMA 5EKTA 2OQIA 3BTUA 3TLYA 3QV1A 1KAEA 2JIDA 5AVWA 4EDHA 4BU1A 2V6BA 3CM0A 3CKMA 1N2IA 3CTMA 2OXEA 4RY2A 2VDPB 3L6DA 1C8LA 3WLKX 3RREA 3CLKA 2QE7D 2OP0A 3HWSA 4PSAA 3E8SA 2VJKA 2R1UA 5CYOA 2FPXA 4BNUA 2OR3A 2TS1A 1YB2A 4FDAA 3AHFA 1HV8A 4GOMD 4DSAA 4BECA 5CIWA 3B3QA 3DW1X 3W2IA 4A15A 1VCHA 3DQPA 3U1BA 1JA1A 2GPWA 5HIKA 2C2XA 3JAWB 3LPNA 3WLRA 4CBVA 2OYCA 3UYKA 4YFVA 4D41A 1TD1A 1YOVA 3BK2A 4ZZ2A 5JARA 4TXLA 1QIKA 4OAQA 1PEAA 3F47A 4Z6KA 3OBIA 3K5WA 3OAAD 4N40A 1VZ3A 3U7FB 3IA2A 3O4FA 4Q7QA 4DSOA 4DLLA 2G04A 3A28A 1BE8A 1ZQ1A 4LXQA 2AOXA 1IU9A 1FYVA 1NJGA 3NDJA 5GVRA 2BGGA 3F3SA 1GNSA 2JH8A 1XZJA 1LVUA 1FJ2A 2Y67A 2XMZA 5FRDA 3N6VA 1SU8A 2A1TS 2Z8YM 4NR0A 4WZ6A 5FFNA 3VDQA 3W5JA 1UXIA 4ZZIA 2HMYB 3V8PA 1GQSA 4XGKA 2A88A 3G23A 4IJ6A 2PX2A 1KMCA 1PQWA 3GIWA 5D5QA 3T7CA 4NECA 4B5KA 1PWXA 5AW8A 1KWGA 2YXLA 2ZZMA 3UH0A 1NQAO 2FQWA 1ZLXA 2PX5A 4KQ1A 3U48A 3ZY3A 4S24A 1SWWA 3T9BA 2H2IA 2UZ1B 1UZMA 1DJNA 2CXUA 2F3TA 5J58A 3TPCA 2Z1MA 1M2HA 3UHAA 1EDOA 2K4MA 2P3QA 3SOZA 2FX3A 2VHYA 3L8DA 4YCDA 2YS6A 4ZAGA 1DQNA 3RIGA 4RDIA 4AWXA 2O19A 1XYVA 2DVMA 4ESHA 4WKPA 2RGBA 1T3LA 1W48A 2CLLB 4Y0VA 5TSDA 3AI1A 4GECA 4M9ZA 3EXHB 4FR5A 1KI4A 2QGFA 3GDFA 4KQMA 1X7ZB 5H5JA 2G6BA 4LYJA 4PYKA 2P79A 3EXAA 4XB1A 1FMCA 1O2DA 2OD9A 5E6UB 6CHYA 2C0CA 3DZHA 5CBPB 4RS4A 4EECA 5FOQA 1CDZA 4R1SA 4MI6A 1H0KA 1MQ9A 3Q6MA 3CR7A 1V5EA 2V7EA 4QVKA 3U26A 4F1JA 3SYLA 1DT3A 4WBNB 5ITVA 5T7BA 1AKRA 3CRNA 1P80A 1XT6A 3A4MA 1M83A 4FHDA 4Z1MA 3UUEA 9GPBA 5JHGB 1JQEA 2ZSIA 3HXKA 2XUZA 5AVUA 2Q5JA 3KEGA 1GNVA 2QMYA 5C32A 4CLOA 4YDQA 5CW1A 4PBTA 2RHJA 2G25A 2VAXA 3DEHA 5DTMA 3T3HA 1EGMB 3EY4A 4P22A 1MZPA 3WGVA 1X1TA 5FHQA 4EOGA 4IGKA 1SIOA 2V7UA 3L7IA 4I3FA 4QAQA 3UMRA 5A2GA 5A3RA 3FMPB 1ZBQA 4KCGA 4B3XA 4DJFC 1VCNA 4TTIA 4EHJA 3NIBA 1KDTA 5EE1A 2N1MA 3FRHA 4DCOA 4PXAA 3T1YB 5TMDA 4CN9A 3O4VA 3QENA 3OCVA 2CHFA 1P2DA 3K7EA 4DG5A 1OZHA 4LYGA 3G7SA 3GK3A 4N5NA 4NI5A 2ZIUB 1RXUA 2BH9A 3PEEA 3RFTA 1PLLA 5E4JA 1RBQA 4NENA 4ZAXA 1KK0A 3HEAA 1KOLA 4BKUA 3K35A 1TXGA 2CCKA 1Y81A 5FUVA 4BNZA 1Q83A 4FHZA 1T9KA 5AM1A 3EQ6A 1XZNA 3SKYA 1JYFA 1MB0A 4NAHA 3ZWOA 3HFRA 2WF8A 1Q3HA 3QY0A 4BL5A 3RU2A 2VI5A 4WEQA 5B7NA 4FWTA 3M82A 4PRKA 1VIMA 1KL7A 4FPXA 5DHRA 3GLHB 8ATCA 1BKSB 2I34A 1FMJA 5DYTA 1CUCA 4DCUA 3WAGA 1PV2A 1YI1A 4EABA 3KCNA 4QGSA 5EJ5A 3QKRB 2JCXA 2QMOA 2WAOA 4QPCA 2G4CA 2OWEA 2P0YA 3E70C 3EBOA 4I08A 3H0KA 3GD7A 4KPUB 5DO9A 3I42A 3HVJA 5DX1A 3H8SA 4JI6B 1PJSA 2JAQA 2Z3ZA 3MCAA 1NLMA 1P1CA 1KETA 1TVKA 4YQYA 2CHUA 2JRLA 2DLCX 2VWPA 1L5OA 4CVNA 2WTNA 3WLAA 2R60A 1T36A 3ZCUA 1IZ8A 1RPNA 2Y0DA 2MMGA 1G5HA 1WQ1R 2YJ3A 3AW8A 1LX6A 4B7AA 4N03A 3UUWA 1HL7A 1FP4A 4MTLA 3IAUA 4QOEA 3RPEA 2RK4A 2VAVA 2PUHA 4J16C 1OT5A 4HAIA 1JLLB 2PYZA 1RFLA 3B6IA 1IJBA 2CVZA 4RULA 1F12A 3EOBI 3IC5A 1AG9A 2EVWX 4OA8A 1UKVY 1D07A 1WMBA 2WKWA 1TFRA 1YDHA 4KODA 4QPZA 2AEEA 4B32A 3IP9A 2CF6A 2R96A 3F3MA 2OZVA 1DKNA 4KX3A 4AYTA 1H3EA 2CZGA 3VHXA 1CUHA 1IWPB 1Y1LA 4MB0A 3PHLA 1FUYB 1KVTA 1Y4AE 3KQQA 2YXBA 1IZ9A 3BIJA 4WLOA 3BWDD 1LTKA 1YGYA 4WLVA 5CPBA 4RV5A 5TDHA 3OPQA 2J3QA 3BFKA 2C61A 5TLSA 2CNNA 3EUFA 4QYIB 5EIXA 2X1LA 4IQ0A 1AHPA 3FSEA 1JHMA 3BVPA 1AOXA 2X6TA 1POWA 3BJZA 4TQGA 4WK0B 5KJ6A 2BFPA 3N2IA 2R00C 3MXOA 1GUDA 3HUTA 1NMSA 4PG7A 4DUGA 3E2MA 3RGWS 4KPEC 2NLOA 1PEKE 3CUWA 2FHSA 3PUKA 3UV3A 1NI4A 4LY3A 3DD1A 2I9PA 3WK6A 1F0PA 1WNTA 2IOYA 2P3SA 1VL6A 1JW9B 2FZLA 2OC9A 2H06A 1IFXA 1Y82A 1GFSA 1R1DA 2ZPUA 1DAMA 1VE3A 1W9HA 2P9QA 2WIBA 3DFKA 3OPNA 5EZ6B 4F04A 3BT7A 3EBLA 1WE2A 3EW9A 3MF4A 4M1EA 2J5BA 1N7GA 3I2KA 3MGCA 4RVOA 5ALTA 4E88A 3DTVD 1UJNA 2D54A 1VQ1A 1WCYA 3SIPA 4AP5A 1KXZA 1Z29A 4DLYA 3J7AC 3A2KA 2E21A 1RJ9B 4TKUA 2FEOA 3EMBA 4EZEA 4MR9B 2V0GA 3BRSA 3DDHA 1UMBB 5BWCA 2XTMA 4PS0A 3QUSA 1W4BA 4AURA 5DE3A 3W8EA 4G56A 4DR2B 3ENKA 2Q3JA 1NW4A 2VEDA 1X6VA 3K5HA 1FSGA 1NQWA 2EWWA 3VR1A 1DKUA 2ZQ5A 3A6FA 5I4CA 1OXKB 1H8HA 2O7RA 1T24A 3KTAB 5HDBB 1ZIPA 3BD8A 5C80A 2YDYA 3HDQA 2HA3A 4DSZA 4AMYA 2PVCA 7REQB 1U04A 4NLLA 1W52X 3RS2A 4CLDA 3GFRA 4F5WA 4QOJA 2CY0A 2XCIA 1ODTC 3QY9A 2GZ3A 2UZ1A 4LMRA 3SQNA 5A4JA 4LX0A 2J5QA 1GN8A 1TTPB 1Y33E 3FOCA 5JI3E 5LDDC 3PQ7A 2QE7A 1ZR2A 1L3IA 4F1WA 3KKKA 5JT1A 4EVIA 2ODPA 3ACCA 1OXBB 1U7UA 4MW5A 3VYUB 4EYQA 1DXHA 1P2VA 3CX6A 1B43A 2FG7C 3M81A 4LJ5A 4TWIA 2ZB3A 1XJ5A 2O57A 1ZGJA 4FMDB 4FFBA 2DWCA 4C06A 1IPEA 4D8WA 1YQDA 2QMZA 2DG2A 2GYVA 4YP9A 4CMBA 2JLRA 4J16A 3DTVB 3EZLA 3RS0A 1YS6A 2CLOB 1Z18A 5BYBA 5C1OA 3SZRA 3U1VA 1B6RA 1U7DA 3OAAA 4UDYX 3QVKA 4AJPA 3IL2A 1A7AA 3A2NA 1H9AA 2DFVA 2N9UA 4WBNA 1G4HA 1XU9A 1NA5A 3TB4A 3O91A 3R41A 4BNVA 4R2KA 1MJNA 2TMDA 4L8YA 1Z0UA 3OD1A 4JJZA 5KVQA 3VZPA 4TWBA 4E5DA 5HTOA 2ZCUA 4XVHA 1USUA 4TYMA 1U63A 4Q4HA 1OWOA 3G89A 3TAXA 4MJLA 5KDDA 2IHTA 2QI9C 1T29A 2DGDA 2X5NA 3NTQA 1RM3A 4YCBA 4Q18A 3LT4A 1JDUA 1FFBA 5HJ7A 4GVXA 1LV8A 4GPAA 5EJ8A 4DUPA 4JJAA 1PWYE 5EWJB 5DHPA 3E9MA 1RZUA 2PH3A 4PQFA 1ELOA 1YQEA 3DTTA 1XJCA 1ZJJA 2Y05A 3QX7A 2R00A 2V7PA 2C04A 2ZUSA 4LXHA 1C1DA 2I4MA 5THXA 3WK9A 5JJIA 3OLVA 3F8TA 4DARA 5CH5A 3RW9A 1WPXA 1TNDA 2MINB 1G5QA 5E7MA 1NJ5A 3T1HB 3LDGA 2PE5A 1PZMA 1NPYA 3EZGA 2AIRA 3PRYA 2MWMA 3EVNA 3ZDFA 2FMHA 1X9GA 1RQPA 4B6GA 2EZ9A 5LQCA 1BGWA 1QVZA 2QTVB 4LW8A 4BO5A 5DHQA 2MOKA 1F20A 1A27A 3ORHA 3S28A 4IMRA 2B8TA 1O4VA 1U6JA 4GT1A 3HO6A 4RENA 4U02A 4AECA 2R5WA 4ZTZB 2ZLBA 3L49A 1JJFA 1SO8A 3NORA 5K6TA 1FXWA 1LPOA 3A7DA 3I5UA 1A9XB 1JHVA 1T6XA 1ZM7A 3KR1A 4KPUA 1KDZA 5CYFA 3VQTA 5ABPA 5B3JC 3IB6A 1JSRA 4HNUA 1LI7A 2A67A 3FMIA 2ZYDA 4YCLA 1AY0A 3DBIA 1ZUNB 5I9SA 5BRNA 1L5SA 1TL7C 1E61A 3EOZA 3IV9A 3LD9A 3MWFA 4FBGA 4LECA 1ICIA 6AT1A 3ASYA 5HKBA 1TDJA 2HK8A 1L5QA 1JA0A 4AJEA 1LBIA 2CV2A 4NC9A 1Q19A 3DFMA 3VKHA 2I33A 3IIEA 3AUKA 2O8DA 1X7WB 3O47A 4AUKA 2JI4A 5L4SA 1ZNYA 1ODKA 4O1IA 2V4UA 1JIKA 5AJHA 1ZIOA 1B7GO 1PFQA 2W98A 2W6JD 4FQ8A 4FW8A 4KO8A 3TIIA 1GRRA 4IJKA 4J6EA 1V3VA 1WAMA 2WPDD 1Z7EA 3QJ5A 4ZVKA 2Y3IA 2O1EA 2A9OA 2EOAA 4MRVA 5K3BA 4L0DA 1VOTA 3A3KA 3RTGA 1T3GA 4FYPA 1XCJA 3O5AA 3RVKA 3H84A 2CXRA 2WYVA 5IDXA 4N0PA 4FIDA 5BYAA 5JVDA 1AZLA 1MHTA 2PNFA 4FEEA 2AEFA 1ETUA 2JANA 2GAOA 1S3FA 3OZIA 3W5DA 1WKVA 2HDWA 3JALA 4LUCA 5DTIA 4HG2A 5BXYA 2ZDGA 5F5XA 1YACA 2OUKA 5JYCA 1O9BA 1YONA 1IEXA 4M1OA 4NXNB 4A6XA 1NF2A 3VUFA 1PWHA 3DE1X 3TFWA 4AN1A 4HHEA 3QMWA 2GEDA 5T57A 1PJLA 3M6FA 5JO9A 4N3BA 4XCVA 4EZIA 3K32A 3MT8A 2OKCA 3COVA 3N9IA 4GLBA 5G02A 3TQCA 4EEZA 2CNOA 3TZ6A 5IK2D 2P9ZA 3I5YA 5IVKA 3MRTA 5IRCD 3QE4A 3L4KA 1N2EA 2IEZA 3G8CA 3R7NA 3SEQA 2EJUA 4KMMA 3D7NA 4MKZA 2QP9X 5BO5A 4KYIB 1B0AA 2NVUA 4URFA 3D1VA 1R4NA 5CX1B 3S1AA 1ORDA 4WVFA 3WJ2A 4RPCA 3NHZA 1OFUA 3VYRB 4FKBA 2CMKA 2JS7A 3G6WA 3ZGYA 2VH5R 3O3OB 2ZAGA 2PD4A 1MORA 4MYDA 2Q3BA 3DBLB 1PJAA 1TK9A 4YRAA 4RTPA 1TT5B 4WK6A 1T5BA 1OX6A 5FB3A 1TJNA 2Q9UA 2PBLA 4QELA 3E23A 2C1XA 4OY3A 3ZW8A 4B81A 1EUQA 3ED5A 2WD8A 3Q11A 4ZVMA 3VPDA 3QF4B 4DR7B 1REQA 3ESYA 4M2LA 5DCYA 2PRSA 1RJ9A 4C0KA 4KJXA 3EB9A 1E4VA 1K88A 3PGKA 1Y8CA 4GI7A 4IZOA 4MR9A 2OAEA 2WVAA 2BSAA 1TZMA 3D6UA 3EAQA 3GVHA 2O2HA 3IPLA 3P20A 4LOLA 4LI0A 2PBRA 4EARA 1GITA 3FOWA 1SZDA 5LVAA 3UK0A 4FCTA 2JAUA 3UJ9A 3DOOA 1CP2A 2HU2A 3KTAA 3AILA 3DKRA 1ZVJA 3H4TA 4G2NA 4GPBA 5B3JA 5SZIA 5B6JA 1B8OA 1T8WA 3RJMA 5LA6F 1M0EA 2FPRA 4ZQBA 3T3OA 4YRQA 3QTTA 4M76B 1GL6A 3GLFE 4AZ3B 1P6UA 4RDCA 5K0FA 1IB0A 1KJYA 3F71A 3OT1B 4M8LA 2PAAA 3QGMA 2Z04A 3ICPA 1QP8A 5D7BA 5EJMA 1NJ6A 3CBQA 1Z13A 2G88A 4LYHA 3NHPA 1US8B 2HT6A 5FNVB 2IEDA 5JALA 5BR7A 2NYRA 4J0DA 1X1QA 3HVUA 4GI3A 3HU1A 4IHKA 5AVZA 1UAYA 4D6YA 1DQSA 2BP7B 2TMGA 2XUOA 4D25A 5K09A 3PXXA 3U3JA 3KZ1E 4MW1A 2HQRA 1TCCA 3DTVA 1GLGA 4CTKA 1TEHA 2ZJ2A 3SK0A 5ADWA 1JFSA 1QX3A 1MA0A 4R2WA 1C30B 3FPCA 2GD0A 1RHQA 1DBWA 3ILYA 3O8QB 5DEIA 3LDUA 1NNI1 1FZQA 2ZSAA 2Q5OA 3E4DA 1JHXA 1YZKA 5ALUA 1M1ZA 1P0IA 1OTXA 1U8UA 2GZAA 3KPJA 3IT0A 3L6CA 4FGJA 3I83A 2G4VA 1IRXA 1SD5A 5HHTA 3F6EX 4Z9XA 1WNFA 1AQUA 4DCSA 1EFLA 4ICIA 4KR2A 3UAWA 3K0FB 4MV7A 4RKRA 3GARA 4YRCA 1DLJA 4E0BA 4JYAB 4JLMA 1D0SA 1RQ7A 2DP4E 2POQX 2EW2A 2XZLA 4D3ZA 1UM9A 1N8NA 1PR2A 3DKPA 4GYKA 4NZYA 2QD5A 3E61A 3SI7A 5JRJA 2DQYA 4MIYA 1U3FA 1WZIA 4L0CA 4GEKA 1G9TA 2RH8A 4OQZA 2RH5A 4ZD6A 1N3YA 3T3DA 5HNKA 3ABOB 1DXOA 2PX4A 1DL5A 1SB9A 2ES4A 3K9WA 4PCVA 4Z9FA 3NC0C 3TFQA 1AB5A 1KNQA 1OROA 3BKWA 2PXAA 3ZK8A 5J4KA 5A06A 4EO4A 1GGMA 1U0BB 5A3JA 1OPRA 2IYNA 3Q4GA 3USCS 3D7MA 1PFVA 1R3UA 2GK7A 4CNQA 1E6MA 1QIGA 5SYMA 3JQRA 1A8SA 4UQPA 3RK1A 3M9LA 3QX8A 4CF3A 3RFVA 3PR1A 2A84A 5KSYA 4L72A 4OHCA 3P71T 3ND9A 3OIYA 3TIXB 5E95A 2Z9DA 3QMPA 4G24A 5EY5B 1KEEB 1IIRA 2C2YA 4DREA 4ZTBA 2HFJA 4HPXB 2W4QA 2Q5CA 3HXLA 4L08A 2BEUB 2PZMA 2BIFA 2CDRA 2Q3EA 4QKQA 2GFIA 3RYFB 2XY4A 3FTDA 3RSHA 3JQFC 1XUOA 1LQ2A 3INRA 3M33A 2C3MA 4ZCRA 3ZXIA 4H77A 5L3RA 3T5PA 3AHCA 2PJDA 3HDYA 4DGSA 5LD2B 4G0WA 2IYVA 3EMVA 2Q9AA 1FNCA 5T4FA 5DNCA 3GT4A 1CQIB 1J8VA 4E94A 2GN8A 3V6MA 5J2UA 4BIMA 4DMKA 3KJNA 4YMWA 2B34A 2Q6OA 1XCLA 3I05A 5JO0A 1AH2A 3TJMA 2BC9A 5BNFA 4J2HA 1W19A 3GP5A 3TNDA 1V4BA 3GROA 4M55A 3L7YA 3O8DA 2J08A 2HIAA 3GIDA 4Q6BA 5TJHA 1WD7A 4UCXA 4BQSA 2VDJA 5JANA 5K2OA 2ZUWA 3OX1A 4KB5A 4P54A 4WACA 3CC8A 2QX4A 4PSKA 5JCOC 5JYDA 2H1LA 2FWNA 1R7RA 1DBRA 1XZQA 5EKSA 1KGSA 4EHIA 3L02A 1KH1A 3IAHA 1KH2A 4PG4A 5C18A 2XCTB 2CN1A 3FCSB 1S96A 1XCOA 3PD1A 4D7AA 3GLHE 1JVBA 2QYHA 3REFA 2WVGA 1KJWA 4I3GA 1WXIA 2X0FA 1GILA 4PO3X 1H5QA 1PK7A 1W1WA 3DDCA 3O93A 3CT6A 1T0PA 1K8QA 3MMXA 3OE1A 1KFCB 4YT4A 3MTBA 3R09A 2O2CA 2LKDA 1K8ZB 2V7WA 1CUYA 1YBMA 2O0LA 2BLLA 1MNAA 3WQSB 1P4HA 4XH9B 1ZW1A 4AXBA 3LS2A 1BG6A 5CX1A 5DBHX 4E1AA 4PG8A 1BE1A 2VTBA 2PSDA 3LFTA 4BTEA 1R18A 2PV7A 4QPDA 4A4DA 4L75A 4RUKA 4YAUA 1W581 2DR2A 2JKZA 1N2CE 3U40A 3VKGA 4P08A 2PU7A 3S0JA 1DAEA 1IPHA 1WZNA 2BKAA 2JGFA 4RWZA 3ZCVA 2W6JA 3QUCA 4YRFA 2RGXA 3NOXA 1Q95A 1L5RA 1VHDA 2C4MA 2WPDA 1SWVA 2JLVA 4A2QA 4MVJP 3DDSA 3B6JA 4AM8A 4F60A 3ZK7A 4PYOA 2FPSA 4P36A 3UT6A 4URUR 3QF4A 1DKPA 3UJ3X 4Z54A 2GZHA 2PFKA 4KLRA 5J4YA 4WKGA 4Y1RB 1JV2B 2I80A 2R47A 3DEAA 3SM9A 4KUHA 4FZ3A 4MQUA 3T7EA 3KVNA 3FPKA 2AFHB 2Q4DA 3HVKA 1NP6A 1FVOA 1KYXA 2FUG6 4O02B 2YFKA 2DPMA 2VH1A 2CE2X 1NVUQ 3E9ZA 4BMNA 2J09A 1AZSC 2BY4A 2JH9A 3ZWDA 4CR6A 4OIFA 3ML1A 4AUEA 5LD2C 4YMVA 4XDHA 1JF8A 5IK2A 2HBZA 2DUWA 3ABRB 3U31A 3TIFA 3ZV3A 4IDNA 3PKIA 4OJQA 1PR4A 1WW8A 3E9EA 4OP2A 4PLTA 5HK8A 4AZ3A 5HIAA 1N32B 1WDLA 1OIXA 2ZWIA 3JQFA 4FCVA 3F2VA 4C0QC 5BV2P 1WSAA 5KB3A 1H2BA 2ORYA 4G1CA 4XOIA 3ZJ4A 1FSZA 3ISTA 3TQSA 2LKCA 3JQEA 4NABA 1RMTA 2PKXA 4TSKA 1US8A 4YCJA 3SC2B 4CM1A 2VLIA 1ZJ6A 2DPYA 3D6JA 3F5FA 3WFZA 3WRYC 3HFSA 1HR0B 1LW6E 1FSFA 2BP7A 2I7XA 3V55A 3SEAA 5CR9A 1EBUA 4GL4A 4IDDA 2CUKA 1H94A 1Z34A 2ZCJA 2D3TA 1LZLA 1GV0A 3ZGVA 1MOQA 5MFZA 5BY2A 2JZOA 2RAVA 3HCOA 4QXMA 4UULA 1C30A 1OXUA 3M6WA 4FGWA 2ZJ0A 1O87A 3WYNA 1P3DA 3O8QA 4FWIB 3BAZA 4J8PA 1N3IA 5JCOA 5IC4A 3QVTA 1QG4A 1BXGB 1DIRA 221PA 3EXIA 3SQXA 1DINA 1MG0A 1AE1A 3GELA 4JI8B 1IK4A 3G0BA 4ZK2A 5IARA 2NSJA 5J4VA 3P0JA 3ZHTA 1M73E 3ZYCA 1FK8A 1HFKA 3VR3A 1V8DA 3DP9A 2VOJA 2QN9A 1M7GA 1O8BA 4I5EA 2A9KA 1U0NA 1UXKA 2F1RA 3I9OA 4RZIA 4RXTA 1THGA 3T5CA 4UHEA 3UJAA 1KI1A 3WKBA 3C70A 3FWYA 4A8PA 2QNRA 4DILA 1E94E 3DVLA 2PPVA 1CUSA 3ZGXA 1FJGB 2I4NA 5IM5A 1QKJA 2H31A 1B8PA 3SF8A 3SXUB 3OT4A 2ZRIA 4GP7A 1YNOA 1SXJB 1JTEA 3OWXA 3AF6A 4ZVUA 4EY6A 1P6QA 1M0WA 2XZTA 3BGOS 2F1HA 2SKDA 3LCRA 3WNBA 1QE5A 1SQGA 1WBJB 1AC5A 5CW2A 5AXBA 1XKQA 3OQJA 2O7QA 2VR1A 4FDUA 3NG1A 5TVKA 4BB5A 1SN7A 1V2GA 4MKHA 1SC9A 3PQ5A 2C5AA 4UXIA 3PX3A 3L0OA 2WHYA 3EQ8A 1QFSA 3H99A 4M54A 1QYWA 5D6OA 2C9YA 2I71A 5HP4A 1I0IA 1CJMA 3GOHA 3ILHA 5FOWA 1T26A 4QXQA 2IIPA 2HWWA 3CNQS 4JP2A 3GWZA 2RGWA 1IYZA 4NFHA 5FPPA 3ZE9A 5K3FA 4EEXA 4EJ0A 5JLJA 5HBGA 1PJRA 3HADA 2BEUA 5TMPA 2X3YA 1PD0A 1JHZA 1QF7A 4O2AB 1HFWA 3OIFA 1TMOA 4RZHA 5AVJA 4ZCLA 3R74A 4YCNA 3DV0A 2ZJ4A 4Z99A 2CVHA 1Q84A 3HB9A 3QELA 4MHOA 1UT6A 4UNNA 1FUEA 2JCVA 4J0KA 4UUMA 4O33A 4YDRA 1JG1A 1DB3A 2G7ZA 1HDXA 1VI2A 2F3UA 1JG7A 1VJ0A 1ODLA 3FYCA 5J5CA 4ENQA 4N76A 2QP4A 1SCDA 3BN3A 3A1SA 2BSQA 4HDOB 3ELWA 1OFTA 2QUHA 1MXFA 4O4JB 4RVCA 4CIDA 4JI7B 2G07A 4WK4B 2FOIA 3ZVNA 3OPMA 2XQJA 4JL5A 1KO5A 5GTDA 4DMRA 2PGXA 2FPIB 3T95A 2J0QA 5B1SA 1BNCA 4OLJA 4RMIA 1OLSA 3WRYA 4JMLA 1KI8A 3W79A 3EEQA 4BFTA 1A77A 1DTWB 2C54A 1EWQA 3RUCA 3B7GA 1Q0ZA 1VG1A 2QTRA 1E9CA 3MTEA 3ONDA 4MRNA 2WEKA 4US1R 5G1PA 4LHZA 4CKXA 4CUKA 3FYDA 4P34A 5TPZD 1P18A 1CU1A 4QGHA 1EK1A 1KYYA 1N2SA 3ZXXA 2YZNA 2WSLA 4GBJA 2UZIR 2IXAA 2QY6A 4IQGA 3I8SA 1Y5IA 1K9VF 3OC6A 4V39A 2XWBF 2E9SA 3AB3A 3GD5A 3RK0A 3UB4A 1SG6A 4GMFA 1XDSA 2NZ8A 3LW7A 4RE5A 1N6HA 3UGTA 4GP9A 5LBIA 2ZBVA 3CVUA 4EWLA 3I01M 5JISA 4N5DA 3JAKA 4PFSA 1NKSA 3NONA 5CK5A 4Z53A 2OAGA 3AP3A 4ZODA 3RTBA 1C9JA 3IPCA 4KZPA 1I80A 1N2JA 1YSCA 5ADVA 4H3SA 4F12A 2IV7A 5DBEX 4Q9AA 2VTVA 4XA8A 4ZO4A 1B6SA 2PZLA 3UW1A 3MB5A 4OHRA 4B31A 2HR1A 1P7CA 3EA5A 3W5IA 2HYDA 3C45A 1LV7A 3U4MA 13PKA 4ZKDA 1HT2E 5KNLA 2WIKA 3SYRA 1JSXA 1DBVO 4LJ8A 5F1PA 2ZQZA 3FXAA 1YIAA 3C7TA 3BGDA 3T0IA 3S40A 2UYQA 2OFWA 1UF9A 4WSOA 5BN5A 5KAPA 1WSBA 4R8VA 1LPPA 4HSGA 4IVQA 4EKYA 1R6BX 3KXKA 2YYSA 3DO8A 2V7XA 4ENWA 4Y1RA 1QDEA 4WNAA 2VAMA 3L0SA 3MLEA 4BVAA 4X0EA 3RRMA 5CLIA 5B57C 3PGA1 3D8NA 4HH1A 4CIXA 4F4IA 2J0UA 1JBQA 3N0XA 4CT0A 4HH3C 4BQOA 5GQSA 2PMEA 2REQA 4NATA 2VHEA 4ARAA 3PTAA 3WQBA 3HWRA 1G21E 1OXTA 1NAHA 2MSKA 3EVAA 1ZLYA 5SYAA 4UUNA 2XUDA 4V1CI 3D0RA 5KVVA 3VZSA 4BGIA 4MVJI 3NYQA 1D09A 1NFQA 2XE6A 4FT4A 5DGCA 5HW0A 1IN6A 2GEVA 3D4OA 3PICA 4HX9A 5E2BA 3FVWA 2XNDD 4G67A 4OQPA 4K40A 2EEZA 3P9YA 4GOXA 5SZKB 3SC2A 2JGMA 4AG6A 4C5BA 1MEEA 4C6RA 2O0MA 3AKZA 1QRSA 2D1SA 1UDXA 1RWWA 4KDRA 3UPUA 2Z5VA 5CFQA 4IKPA 4H60A 2GNAA 2WUWE 2G40A 4JBWA 4R6XA 4DRYA 3FOEC 3QU4A 3G9ZA 1V5IA 3IAS1 4N49A 4B3RB 1IN7A 1FUUA 2ZFUA 1XZBA 4C7MA 4PZ9A 1JQKA 3OZTA 4L8VA 4ZARA 1YJXA 2VN8A 4HX5A 3AZOA 2I65A 3JD4A 3JD0A 3PEYA 3F90A 4BMZA 4P86A 1BXGA 3D6HA 2V45A 2DJ5A 4QGBA 5AW4A 4OGFA 5HMMA 1VCIA 4J1SA 1ABFA 5SY6A 2DCUA 2HO5A 1HLPA 2D8AA 2QQFA 3OFKA 4WMLA 4QBGB 5AXDA 5GM1A 1SG0A 2DUUA 3DT8A 5AHWA 3UHJA 3VNRA 4XRGA 1JEQA 5D5HA 2VKTA 2VNHA 4HTFB 4I1IA 4ESEA 4ZT4A 3ICEA 3TGWA 5L7WA 1CEEA 3ZLJA 4CQMD 1HG0A 2W2VA 3SHOA 3DFUA 4WA8A 1QOQB 4BFYA 1K66A 3NC1C 3TCXB 3WR5A 4K0RA 4ZHQF 5BWLA 4KC0A 3HL0A 4QEDA 5K0TA 3U3XA 2BUAA 3AC0A 3KAQA 1GZVA 2WUFA 3O90A 4ZXPA 4KUEA 1IXSB 3PC7A 4DBZA 1J5EB 1P2BA 2P67A 1CTQA 4MMZB 1ATZA 2ZOSA 4ER7A 4KEAA 5EE3A 1R0CA 4FBMA 1KSJA 3ABZA 4F96A 1G20A 1M2WA 3KX2A 3UMFA 5EWLA 2DLDA 1YFJA 1YKSA 3H2SA 1HI9A 1QK3A 3AR5A 4WASA 1X1CA 4G86A 2ZRFA 4R9RA 4CYMA 3SE7A 3M3DA 5FWYA 4FZ5A 5AK5A 4H6VA 3KXPA 4LOIA 3GLGA 4KXXA 3K0KA 1KEKA 4FNAA 3TW8B 3NBKA 1I01A 3BBPA 2QUKA 2M32A 2WJZB 3KQOA 1JHYA 4MUIA 3O8BA 4NAVA 1GYRA 2GHRA 1HRDA 5TNXA 4UHKA 2C5GA 1G8KA 1NOKA 1WL8A 2O1WA 1EXWA 3BFXA 3S3TA 3R7WB 1IEVA 1I1NA 3B2EA 3O2SB 4EW1A 3S81A 3DHVA 4MUXA 2AG8A 2Y1XA 4ALJA 3C24A 1F2VA 1EWVA 3K9GA 4CQMB 5KTOA 2XWJI 2VP3A 1T13A 3IPYA 2NUTA 1C7EA 5EZYB 2XDQA 3VGJA 1NN0A 3H5VA 2QXYA 2DQ4A 3ISJA 4D79A 2HBYA 1NURA 4RJJA 4LPSA 3ZXUB 2TMKA 3KU4A 3DW3X 1R9NA 3Q2IA 1VFPA 4PYRA 3VO1A 4Q47A 2LDBA 4WY2A 3IKVA 4TMVA 1G38A 3CSUA 3TUIC 2FSVC 2GJKA 3OF2A 1VIDA 3VZBA 4IF6A 4Q3LA 3OMXA 1I5RA 2NZ2A 4JLVA 5JXWA 3CLHA 4II2A 5GMOA 4LXXA 2XD9A 4ZRMA 4L76A 1YVEI 5ISMA 4S12A 3SCZA 2HUPA 2KLBA 1NC1A 1XZKA 4NFYA 5EP4A 1M6NA 3UK2A 1H22A 4EKDA 3U80A 2WF5A 5F7OA 4EJ2A 2O2SA 2VHTA 4OSPA 1KEVA 1HDRA 4Q4DA 4F92B 5K0CA 1UJBA 2NAPA 3E5RA 1WETA 4DV5B 3A9TA 1JDNA 3ZE8A 2RG1A 5JJKA 2CVQA 4BAZA 4WECA 2D3WA 2O05A 5LQSA 2ZJ3A 3W05A 5FX2A 1H3NA 1S02A 1Y3IA 1ZD2P 3G5MA 3QKIA 1YJAA 4WW0A 1T2CA 2X58A 2CXPA 4DGQA 3IVAA 3EZNA 5KNDD 5ES3A 1EJBA 2E3JA 4L1KA 4QDJA 5KVAA 3KELA 2V03A 1PKXA 3CZAA 1D8AA 1I6WA 4GMKA 3CH4B 3FPSA 2FMUA 1CE8B 4GF5A 3B78A 5HBRA 4C0JA 5HKLA 4XIGS 1WB9A 1NSYA 3D8RA 3DR5A 2WWFA 3DZCA 3LHFA 4G0QA 4PF1A 4TM7A 3NI2A 1CVRA 1P0QA 3K9HA 1NLFA 2I03A 4MSUA 2FG5A 1B76A 2WUVA 1CDEA 4FIZA 1IUOA 1UCFA 3SC6A 4NNOA 3SY8A 2AG0A 3VOSA 2F8LA 4FGZA 4S0ZA 4WESA 4Z49A 5CDHA 3B8HA 5TPZA 2BF4A 1P19A 3B51X 3OM8A 4PZ0A 5EIBD 3W0LB 1Z0KA 2IEYA 4IFTA 5KTTA 4DE5A 2BFEB 4ARUA 3G1WA 3UMMA 1Z8HA 1F8YA 1JKMA 1PO7A 2BV3A 3AEXA 2X7JA 4YGXB 5DTRA 1GPNA 4ROTA 3ZJUA 5LSAA 3G2NA 1YC5A 2QD3A 3NDPA 4CETA 4PAGA 1A8HA 3FRIA 3GBPA 4NOKA 5JH7B 1WO8A 4HP8A 1N77A 1Q11A 4BMCA 4IS2A 1TYBE 2NUPA 2VTEA 1MFPA 3EMDA 2FN3A 3KB1A 5DP1A 3SKXA 5BVHB 1L5ZA 1FLVA 3MM4A 1U7ZA 3OJWA 5UKDA 3CVVA 5BMVB 4V02A 2HHHB 3D5EA 3G88A 1HLDA 2PFSA 3JRXA 2EZUA 3ROQA 3LY9A 1FS6A 4FGUA 1YZFA 3PEVA 1KNXA 3VH4A 4BMYA 3EY9A 2HJGA 3V4LA 3BRCA 3BWVA 3KJIA 4JK3A 4F2DA 3GCDA 3ILVA 4OYLA 2BCEA 2VEOA 1Q17A 3THWA 2X14A 1T1SA 1J23A 2CWWA 2GEJA 2JFNA 2VSNA 3A10A 1HNNA 3MWGA 1NPDA 1K8YB 1PE0A 5EYPA 2FJ0A 5EG5A 3VDNB 4BN5A 5LQKA 3KDAA 1QZTA 3Q7RA 4UCQA 3E7FA 3UYLA 1QQ6A 2VA9A 1Y1RA 4QOIA 1DFHA 2FSVA 2QL5A 4RCYA 2QYSA 2W48A 1K6MA 3SX2A 2DHEA 4ZOLA 1ONOA 4LQLA 5EQTA 2I6TA 3FYSA 1P9WA 1UKYA 4K46A 4M99A 1U0HC 3OU7A 3PNQA 5JNUA 2IDKA 2QDXA 3BKXA 2O7SA 4KQEA 1DEHA 2OHVA 1S2MA 3K16A 1XALA 3IQGX 4NYMR 4R9UC 4DEVA 1CR6A 1GZUA 4KG7A 1Y7IA 1ZM9A 1DEOA 2OSVA 2O2JA 4PAQA 1ADBA 4IYJA 4NCBA 5ALJA 3GRKA 1DBPA 2P9FA 4HTFA 5BSHA 4B46A 4AICA 2I0FA 4AL4A 4EO7A 2J67A 3W34A 3GDHA 1W73A 3A6ZA 1J42A 1DC8A 3DJYA 3OH8A 3OKFA 1DCFA 2FUKA 4XQCA 5DH9A 3U5ZB 2QMUA 2GTHA 1VHJA 2XNDA 1Q2UA 4J6FA 2RSLA 3FPAA 2B99A 1H9BA 4NP6A 3DLTA 1P3Y1 2QPAA 3HCCA 1P7WA 1UOEA 4MXDA 5JU6A 3BMNA 2ZI4A 4B79A 1QYDA 3ETLA 4LJ7A 4TPKA 3LY5A 3CSDA 3GFOA 1CY6A 1KBZA 2ECOA 3V9PA 3EGDB 2OORC 1U9JA 1XJ0A 4HAOA 4XCQA 1QYCA 1Y1TA 4K3VA 5EIOA 3F5MA 4HDCA 3FKQA 1OVGA 1V37A 3TQFA 3ZDRA 3H0EA 3IMFA 3BREA 5FKJA 5A3SA 2FFQA 1MLDA 3AI2A 3TGLA 1H6AA 4D82A 1KAQA 5AK4A 5JI2E 1L7MA 1I3KA 2PLAA 3HUDA 2IBSA 5LFAA 4PIMA 4MB2A 4QOGA 2E4XA 2DBYA 2JBHA 1XEWY 2BMAA 3KYIB 4LVOA 4TMXA 5NULA 4Q05A 1DUSA 2HADA 3BWEA 5DX0A 4JJ4A 2OOKA 4CQMA 3JPWA 2O2EA 3IERA 1WMDA 3I8OA 2EKPA 1IAVA 1Z88A 4TKVB 2X6RA 5EZYA 1Y4UA 4FEAA 4RDXA 1YR3A 2D7JA 5EJ2A 2Y99A 5IAGA 1IB6A 3HO1A 1UM8A 3MTDA 2VK1A 1E1RD 3VU8A 2P40A 4F3CA 3II6X 3HM9A 4PAWA 2CXOA 4Q19A 4RO0A 5E8JA 5IXJA 5JTUA 5FOTA 1ZAKA 4RD3A 1TEZA 1G55A 1Z8DA 2PYIA 2UAGA 1GGJA 4W9MC 2WFLA 2NU8B 2CLMB 1A8IA 3E1KA 1N5KA 1PBNA 3WHIA 1UT5A 5FAXA 3CX8A 1PG5A 1Q0TA 1E2KA 1SG9A 1RLTA 1AMUA 3RS4A 3BL5A 5L8VA 4NYJQ 3K9QO 3AR3A 4LDPA 3TCNA 3LDFA 4IIXA 2ZAIA 3U0BA 3UQYS 4D4GA 4BQFA 4DQ0A 1ISJA 5KHLB 1QRRA 4CKCB 3CGWA 4GNRA 4JCOA 5FBRB 1J9ZA 2O4UX 3JYLA 5BN1A 4C2BA 4HNQA 2P9HA 6YASA 5JROA 2AMJA 2XF8A 4RSRA 2Z3VA 2X8JB 1ADJA 4RVNA 2OXIA 2QLBA 3ZY6A 1L1QA 3UIEA 3ZWCA 2CDAA 4G65A 4PHCA 3TZLA 1OYVA 1DEKA 3H04A 1CZLA 4FYIA 3H83A 3I12A 4ANFA 2QUIA 5ERGB 3KO8A 3K8OE 1A8UA 2I2BA 1RCUA 3H9QA 1B00A 2ZAMA 3GJYA 4GNKA 4IKEA 4MA0A 4KLAA 4NSNA 5EIAA 3TXXA 3FSJX 2YWFA 1V1RA 3BK1A 4KPYA 2QE6A 2VJCA 2QRVA 2P68A 4Z51A 5C5EA 1ESEA 3B7WA 2P9EA 1JHPA 3A4TA 3CE9A 4JL6A 1RADA 4P7BA 1O96B 4X60A 1R12A 2AX3A 5J5VA 4X71A 4BZPA 3FR8A 1NAIA 2R62A 4LJ6A 3ZQJA 1AU9A 4OGWA 2XUKA 3KT3A 5DV9A 4KFSA 4L4SA 5EZQA 2BI7A 5AP9A 3Q0TA 2EARA 5BSMA 4JB0A 1NIPA 3PQ4A 1N8SA 5F51A 4EITA 5KHAA 2BYTA 3DE3X 5ICMA 5SV2A 1T8TA 3E1GA 3LO5A 4K9RA 1NLUA 4UEQA 4W5QA 3RG8A 2CJWA 1GRVA 5CP8A 2DUNA 5AI8A 1JXOA 2GXUA 2BJHA 4X20B 4BS9A 3VBEA 4A1OA 3BJMA 4FJ0A 1OWLA 1JPJA 4I55B 2OORA 4OHOA 5KKAA 3LUKA 3VR4D 5B1DA 5IT4A 4KYVA 1CUEA 4NQRA 5B1IA 1U8CB 2NZWA 5H4HA 4C01A 1TVCA 5BQPA 1H2FA 1Q7GA 1NHWA 4HC4A 4LBWA 2J6HA 1RT9A 4GR9A 2Y92A 1ZCJA 2ZGVA 5FV7A 2ZI9A 4PQRA 4WEOA 1U2SA 2XYVA 4Q3BA 3MUOA 5AKYA 3WIUA 1RAFA 2VHVA 3QE2A 1UPAA 1LKZA 4UE2A 5EHXA 2AF4C 1JTFA 3EPPA 5F2OA 1FNDA 3C7AA 5KNDA 2Q4EA 1AKEA 3STHA 5BMVA 4W5OA 3OP4A 3QLVC 5AI6A 1EJ2A 3VO2A 1QWOA 3C3PA 1WV1A 9MHTA 4HB0A 1TAHA 3ERCA 4ENTA 5HKAA 3HV2A 4DLWA 2H2WA 5EQFA 4AF7A 3SBEA 1SQ0A 3K0EA 2PGAA 3W8DA 1Z08A 4XXHA 4GMDA 4QG3A 3I3SR 2WQZA 4BFXA 1PVVA 3WGQA 3U3KA 2MIIA 2P62A 3ENNA 4G41A 3CPSA 1QTQA 1BH2A 2WFMA 3DVRX 2B25A 2C4TA 3M4XA 1A5SB 3VMMA 4A0HA 4UDOA 4UZEA 5KWJA 4TLMB 1WY7A 5KNDH 2P30A 1AJEA 2FZWA 5JTTA 3I2FA 4KX5A 4IJQA 1QDUA 4Y2QA 1G98A 1XZGA 1V8ZA 2AJCA 2Z30A 4C9BA 3ZBUA 1RBZA 3E84A 3PB3A 3RJZA 3RKSA 3V8VA 2CCJA 4UU8A 1FXWF 2QYTA 1FU7A 4BP3A 4ZWNA 1NF8A 3ZOKA 4QECA 2PUCA 3HKBB 1XJQA 1RABA 3C8DA 1EFTA 2E87A 1EP3B 2HJRA 2UKDA 3LDAA 4NBVA 1PTJC 5IDVA 3IUPA 1LY1A 2G5GX 1VPDA 5TT1A 1EB8A 3MWJA 4FNGA 2BFBB 5LMUB 1VPLA 5LQNA 2HAEA 3G9QA 4PHFA 2R65A 2YXDA 4F3YA 5I7WA 4R5MA 3PXEA 3AUYA 2C31A 3VHQA 4F8YA 4ZAFA 5JV5A 1BW9B 1SCIA 2JZNA 4A36A 1EFCA 2RHHA 3N76A 1XL0A 3L43A 4WXEA 3IA7A 1SCQA 4XARA 1FTNA 4FMCB 2H8GA 4LK2A 2V5UA 3TVDA 4BO3A 2ECQA 3OZXA 3DMYA 5LU8A 1S2LA 3FUUA 4XWWA 2HA4A 3C6QA 4HYTA 4Z9AA 2W8BB 4YQFA 2C5HA 1YE3A 1JWAB 2HXYA 3FCYA 4QQKA 3LBNA 2EU8A 3M6VA 4L16A 4QVGA 2OGWA 4CLEA 4KGXA 1P1FA 1AUPA 1SUAA 1K7SN 1YH3A 1YASA 1CP3A 1QZZA 1SCUB 2ATVA 3RI3A 5F3DA 5JVDF 2GD1O 1R9GA 4HQKA 4KDCA 4XKJA 3I92A 1TTHA 1UK9A 1XHLA 3C3YA 3S70A 2CZQA 1N3BA 2NO7A 3L5KA 4K2HA 2PWYA 4HZGA 1KR5A 2I3GA 1NYLA 4FC7A 2FLWA 4F5YA 1C0IA 3A32A 1XELA 4JASB 4K9MA 1NUSA 2XUPA 1XMXA 5K0GA 4JI4B 3BDIA 4K88A 1DNPA 3CZPA 4ZI7A 1S1MA 1SVSA 4BV8A 2P9TA 2CJPA 4G1FA 1A2BA 1W59A 2FQYA 5C37A 6REQB 1GR0A 1UBUS 3FCXA 4CQLB 2E37A 3WV5A 2LIVA 2X5JO 4P92A 4EB0A 2NN3C 1PLJA 4WLUA 1NSFA 4L74A 4ME6A 4QXAA 1XZDA 4ZT6A 3GGCA 5CT9A 5FR2A 3TRHA 4BUCA 3GI1A 4HDRA 4B75A 1M2JA 2YVUA 2GNOA 3W4IA 4DCVA 2G8NA 1YE8A 3QLVA 2C7OA 3KKLA 5JAOA 3X1XA 3K53A 2QPLA 3G49A 5IJ9B 1MH9A 4I99A 1WWKA 4LC9A 5H81A 3E7PA 4ZO7A 3HVRA 2Q2NA 1I7NA 4B73A 1ANKA 1DBSA 1HM5A 4AN0A 2A58A 3QVLA 1KP2A 3O84A 1T25A 1DV1A 3JQ7B 5FI3A 3A6HA 2FTKE 4D9FA 4RD2A 3IDSA 3VX4A 2XB2A 3E9YA 3IMEA 2YZGA 4G0PA 4N3NA 1EFDN 4P0PB 4DLNA 4ETMA 1C0LA 4EELA 4WXPA 2HMAA 3PQ8A 4E2FA 2HSEA 4FGSA 4NQZA 4ITUA 5TGZA 1GT6A 3T7DA 2YYYA 4MV6A 4QTXA 2KYRA 2WU0A 5A4KA 1ZINA 2BUBA 4DM4A 1K6JA 5JWOA 3WLOA 1PJTA 1IXYA 1DMRA 2R6AA 1UJMA 1PTJA 2AGVA 4U6NA 4XVCA 1WRBA 2Q0QA 2Q6KA 3TXYA 3FLAA 1YCGA 4UCFA 5ALIA 2B9EA 3T5TA 1IUNA 4O5OA 4JBIA 4RV4A 3FMFA 2OCDA 5B37A 3TINA 1H9CA 5FIUA 2PWPA 5DHAA 4LX8A 2W37A 5E3JA 1E1RA 4CN8A 1H6CA 4URWR 2R4UA 3KQWA 5C5DA 3WGJA 1WCIB 5A9SB 3HQ4O 3K0AA 4P80A 5J23A 4PONA 1MT0A 4RK7A 4EQZA 3OICA 4OU4A 3LJKA 3A6LA 4IICA 3U4IA 2RKWA 1P9OA 3TLBA 3Q2KA 3VZDA 2GO1A 2JIPA 4IV8A 4X20A 3GLIA 3HSKA 3NDRA 4MQEA 4I55A 4DIBA 2ZTLA 3K9FC 1N0UA 2QAJA 1YTLA 3TQQA 2QEQA 2XSZD 3LXMA 4IOKA 4MVXA 4V0MA 1Z0SA 2V74B 3QVSA 4PC2A 3TW0A 1LI4A 4R16A 2XZDA 1NP3A 3KV3O 4UTVA 2FWJA 3NBAA 1BD4A 1Y7HA 3OURA 5DGIA 1QFMA 4EY3A 2OBFA 3NR2A 2Q5FA 1N4AA 3K6JA 1MX1A 1CUXA 1R6AA 2X0IA 2JI8A 1DZ3A 3L6UA 4TKZA 3IIKA 3FTPA 1G8HA 3AV3A 3HCNA 4KXNA 4LN1A 1KO7A 1BXRB 2XOXA 4LWOA 4MQFB 4OFBA 1NL3A 3DLBA 2C5FA 3WL6A 3C1AA 5ELXA 5M34A 3EARA 5ELMA 3PQ6A 4YRGA 4RSMA 2R1TB 2XITA 1WZEA 3DUWA 2VDVE 1CJCA 2ZI5A 4EK9A 4D9EA 2FVXA 1RAAA 1WB4A 4M1YA 4Y2UA 3DL2A 1ZD3A 3FYUC 1S2OA 4OM8A 4KJZA 5AJZA 5IW8A 3TEMA 4B6PA 4WT7A 1CQXA 2LGJA 4QEZA 3IEVA 4OQEA 1HMYA 2VP0A 1FFCA 2CFSA 3L8GA 4FOPA 4RZ3A 3UFXB 5FAKA 5HMLA 3K2QA 1PZNA 2GBIA 3DG9A 1SOVA 3WIEA 5K0ZA 1DKQA 3LH5A 1E9RA 1O94D 1AN0A 2J0EA 2PEZA 3G8BA 4MWDA 1VBFA 3DBHA 5T6MA 2NW6A 5DNUA 1C2YA 3BDAA 2OEPA 4AI6A 4JUAA 4XSGA 3VR4A 3SX4A 2AKAB 1IXKA 5BUZA 3KT0A 1U80A 4GM0A 4HRYA 3RHFA 3E5MA 5KC8A 3L1KA 3MJCA 3I34X 4LJ4A 4V38A 1VMKA 1M54A 4K87A 1ADFA 1QGED 1JEDA 3WL3A 3Q8XB 4CT4B 3CLRC 5DHUA 1IAQA 2WWGA 2XI4A 3SIXA 3UKDA 4JJKA 2C2OA 2CNKA 2BFBA 2YW9A 3CPHA 4XDGA 5CU7A 1O9HA 3N8GA 3DAFA 1KZHA 3BD6A 1QMGA 4GEGA 3UCXA 2FSPA 3I04M 1BW9A 2WC1A 1E7YA 5C8DA 2FUEA 1UQRA 2FMFA 3IILA 3VR4H 2QVCA 5J2UF 4ZGBA 1OU4A 3O95A 4UPDA 1FP2A 1XV5A 2XGSA 4X3CA 1ADCA 2NU7B 2KW5A 1HF3A 1Y3AA 3AXSA 2B7CA 3OETA 5EXTA 4OJYA 1T9BA 3LWDA 4M0CA 2N0SA 1FTWA 2W8BA 3L1HA 3GP8A 3UWKA 5H02A 4C0SA 2REBA 2EBUA 2XH8A 4UQOA 2FGJA 2IJGX 3VZCA 3KCQA 2JHGA 2HNKA 2Z09A 1FMLA 1NFRA 3FMOB 4K3UA 3V2IA 4R1NA 3EPHA 1MR3F 3QVGB 5D84A 2MHCA 5DNAA 2P6RA 2HGZA 3N2GB 4KR0A 3RUDA 3NDBB 1OWMA 2HU5A 2X2OA 3PYLA 2E0IA 4OQYA 3PV0A 1YK0A 4DOMA 4ZHSA 1BXZA 4HRVA 1EP9A 4P4SA 3ZNQA 4AY4A 2C9BA 4Z9YA 3CZ5A 4ZANA 5DI3B 2Y0PA 4D46A 3I2IA 1UBRS 3KR9A 2FXVA 1RPAA 1XQ9A 3E3AA 3OCXA 4EFNA 4YUWA 5TGDA 2EXXA 3I6ZA 2EKZA 2VUSA 1II8B 1KJ8A 2R79A 1NZFA 2G82A 3AEKA 4ERXA 1ML3A 4QJ4A 3VR5H 4TV8A 1RWXA 3DE0X 1JU9A 3F7TA 1XLWA 3LIIA 2OCKA 3P9PA 4YO7A 3HRIA 5ARCA 1UDCA 1Z7BA 4BFSA 3UA3A 4I66A 1G8YA 1SR8A 2I3ZA 2JZCA 4ZOAA 2XCRB 4K05A 1PSWA 1KDVA 2KBFA 4CTMA 2GCIA 3S8YA 4UVHA 4BB6A 1JEEA 4BTVA 2VJNA 1LWOA 1ZL0A 2IOFK 1QX4A 5E9JA 3GT3A 1WY5A 1E0KA 2B2NA 2V6IA 1Z5UA 3UBMA 1NMXA 4CEJB 1IN4A 4F6LA 1NR5A 3R3ZA 2QK4A 4RA9B 4RY9A 1TUEA 1Y3FE 2ZRHA 3FYUA 3TEJA 2G6TA 4B3JA 2Y0BA 2NYVA 3AF0A 4DBLE 1E98A 4RPKA 3Q87B 1QS0A 3O6VA 3RIXA 3AB7A 4I1RA 4BLVA 2IU6A 1YE5A 1OV4A 1ZHHA 4OD0A 3VNSA 3NUGA 1TW3A 4YEDA 1MFZA 3I1JA 4G9GA 1E7RA 2O8CB 4IGIA 4IRMA 5ALDA 4YV7A 4DLBA 4FT2A 3W06A 4ES6A 1K7YA 2Q9BA 2AN9A 1K08A 4Y2YA 4BC1A 1T5DX 1WEHA 4GBGA 4H0CA 4V1CA 1KC1A 2ZB2A 1LS1A 1TF2A 2EWMA 1STOA 4YUXA 4MA4A 3EXG2 2XUAA 3DXYA 4DJEC 5BVGB 4MJ3A 5B2FA 3S8EA 1QPGA 3RTCA 3IE0A 1U31A 1NULA 2DFNA 4AQDA 5BW5A 3MBKA 3B2QA 1E2FA 1X3SA 2D0IA 1JAHA 4BNNA 5B3KA 5HZGA 5CM9C 3NYWA 5IVPA 2G5PA 4ESOA 2EHJA 2AK3A 1W6UA 2BBWA 4FD3A 2HXSA 4NS1A 3JWGA 4ENUA 1QGZA 4ZVSA 4PY2A 3MYRA 1C3XA 1LPMA 2IPOA 1E7SA 2P2DA 3DAYA 4INZA 4L4ZA 3ZG6A 4ZCMA 3SX0A 5JCXA 5D6NA 4MVJH 5ITZB 5F1YA 2CL5A 1DHTA 1JDBB 1WCIA 2J85A 3PPWA 1G5FA 3FNQA 5TRTA 3NAQA 5G3YA 3W1VA 1T4GA 1O94C 2B1QA 2ISSD 1G6KA 1P1HA 3FHOA 3H86A 4XPIB 5AKZA 5FXMA 3F73A 2ZS9A 4HVCA 4X44A 5BR1A 1I2MA 2O3TA 2YY6A 4UHDA 1BCRB 3R8FA 5A4AA 1WF6A 3D6AA 2VATA 2JEOA 5EHIA 5FQOA 3KWLA 1I7QB 2TSYB 3ETDA 2BONA 3T12A 1YRLA 3ZJ5A 4B8WA 4J3FA 3NUZA 3IUJA 4YC7A 2QPOA 1OFIA 3EXEA 1ISFA 2FNAA 2HHCA 2HMVA 3JYQA 4HRAA