2O1SA

1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
618
structure length
536
Chain Sequence
b'FDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPALPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1-deoxy-D-xylulose-5-phosphate synthase
publication title Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 169
structure length 536
sequence length 618
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.7: 1-deoxy-D-xylulose-5-phosphate synthase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
A PF13292 DXP_synthase_N 1-deoxy-D-xylulose-5-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o1sA02
3L84A 3E9YA 4GPEA 3M6LA 1UPBA 4K9PA 1DTWA 1YHYA 1W85B 1MCZA 1YHZA 5HGXA 2C42A 2IEAA 5EJ6A 5HYVA 4JUFA 1X7YA 1OLUB 5ESDA 4KXWA 2E6KA 5I51A 5DEIA 1R9JA 1YD7A 1V16B 3LPLA 2BFCB 2BEVA 1PVDA 2AG0A 2BFEA 2XT6A 5K6RA 1X7ZA 2UZ1A 1WCIB 2W93A 5K6TA 2JLCA 2R8PA 4K9MA 5EJAA 1Y9DA 5AHKA 1T9BA 4COKA 1NI4A 4GM4A 1X7XA 4FEGA 1X7WA 2UZAA 3DV0B 5FEMA 1V1RB 2WVAA 2WVGA 5I5GA 1W85A 2JI9A 5EJ5A 1DTWB 2JLAA 1QGDA 3AHFA 1PI3A 5EJ4A 4JUCA 2PGNA 1UMDB 2OZLA 4JU9A 1OZGA 2VK1A 3AHDA 1POXA 4KGDA 2QTCA 5DGDA 1QPBA 2C3MA 4K9LA 2BFEB 1X7ZB 1U5BA 1PYDA 3D7KA 3FLMA 4XEUA 1UM9B 3EXG1 2O1XA 2BFFA 5ERXA 4GG1A 2BEWA 1ZPDA 2G67A 2VK4A 4KXUA 4QPZA 3ZHRA 1X7WB 3EY9A 1V1MB 4KXXA 2IHTA 3EXG2 2EZ8A 3HWX1 4MPRA 4WBXC 5K2OA 1UMDA 2EZ4A 2Q5LA 4D5GA 1OVMA 1N0HA 4QELA 2BEUA 2OZLB 2QTAA 3HYLA 4K9OA 4C7VA 2VJYA 2BFBA 1UMBB 4MPJA 3ZHTA 4JU8A 1UM9A 2Q5JA 1YI1A 3RIMA 2VK8A 1U5BB 2C3YA 2JI8A 3AHCA 5EJ7A 3IAFA 2VBIA 3EXHB 3EA4A 2BFFB 1Q6ZA 3OE1A 4QQ8A 5C4IA 3OOYA 2Q5OA 1V1MA 2Q5QA 2BEWB 5I4IA 2J9FA 3EXHC 2EZTA 3EXFA 1L8AA 1V11B 4GM0A 5EXEA 1UPAA 1JSCA 4GM1A 5K3SA 3M7IA 1V5GA 4K9QA 2XTAA 3F6BX 2G28A 4MPPA 2C3OA 2DJIA 2Q29A 5DGTA 1RP7A 3AHJA 2JIBA 3F6EX 1UMBA 2BEUB 4KXYA 3AHGA 2BFBB 1OLSA 2EZ9A 4JUAA 1V5FA 2FN3A 3EXHA 2JGDB 1NGSA 4K9NA 4MZXA 5HHTA 3EXIB 2IHUA 1AY0A 3ZHQA 2VBFA 1OLXB 1UMCB 2BP7A 3M49A 2JI6A 1V11A 2IHVA 1ITZA 2J9FB 1PO7A 1OZHA 3EXFB 4K9KA 4ZP1A 3DVAA 3AHEA 3ZHSA 1YNOA 1TKBA 3MOSA 4C7XA 4MQ5A 4FEEA 3EYAA 3HWWA 2X7JA 2C3PA 3KOMA 1YI0A 5EXDA 2WVHA 4RJKA 2C31A 4JUBA 2PDAA 4RJJA 2O1SA 3EXEB 5HJEA 2VBGA 2BFDB 2PGOA 1UPCA 2JGDA 1X80A 3IAEA 1OLSB 1TRKA 3ZHUA 1Z8NA 1GPUA 2NXWA 3M34A 3EXIA 4RJIA 1QS0A 3AI7A 4Q9DA 1YBHA 5EJ9A 1OLXA 1UMCA 3DUFA 2PANA 3AHIA 2BP7B 5ERYA 1TKCA 1W88A 4D5EA 2Y0PA 4GP9A 3DVAB 1V5EA 4JUDX 3LQ4A 2EZUA 3AHHA 2YICA 3LQ2A 3EXEA 5EJMA 2BFDA 2R8OA 1OLUA 1BFDA 1IK6A 1T9CA 3UPTA 2Q28A 1T9DA 1X7YB 1T9AA 1V16A 5IMSA 4KXVA 2BFCA 2G25A 1X80B 2FWNA 1POWA 3ZHVA 1WCIA 1OZFA 3UK1A 5I5EA 1QS0B 2V3WA 3JU3A 2BEVB 2C3UA 1TKAA 3DUFB 2UZ1B 5EJ8A 2JI7A 1B0PA 2XT9A 1KEKA 4JD5A 2Q27A 3DV0A 1W88B 1NI4B 1V1RA 3FSJX 3LQ1A 2YIDA 3FZNA 2AG1A 2R5NA 1X7XB
chains in the Genus database with same CATH superfamily
2GJ8A 3W5SA 2XNSA 3HJFA 1ZIYA 3DA8A 1XYVA 1QYXA 4QHSA 2NG1A 3FCAA 2GNAA 1TMGE 4D92A 4Z3KA 2AQHA 4BRUA 3GG9A 4BZWA 5TMPA 4X7BA 1N1EA 3BMOB 3UZUA 2P1RA 2HLDA 1A7UA 4JBIA 4WSOA 1K7EB 2Y1LA 3BE5A 3BJRA 1BHJA 4P7GA 4C1NA 5CGQB 4G09A 1P9WA 1THMA 1QTQA 2C42A 3B78A 3L0PA 1LBSA 1W4AA 2COEA 4XRGA 2XUHA 3C6BA 1GA4A 2AUNA 3BBLA 3U3ZA 4IIEA 3JR3A 5HYVA 2P7HA 4HDAA 2G9QA 4DLYA 3O8RA 4LTDA 4E6EA 1FYWA 3QEOA 2NV6A 3QHAA 5TQ0B 4ETIA 2FYTA 1GG9A 4YRBA 1E3IA 2PWPA 1G16A 3TTUA 3GCZA 3VAAA 2BFCB 2WE7A 4NBRA 2PUFA 4N3GA 2VTKA 1TA0A 1HT2E 4FDMA 4S2UA 2H2DA 4WOPA 3THYB 1Y5LA 2O2DA 5ALYA 4YA6A 1QZUA 3L4KA 4W1QA 3ANYB 3ITDA 1W36D 4B3MB 1U9IA 4CF5A 3BD8A 2PKYX 3IEIA 4KUHA 3GRYA 4KFSA 1WBDA 2AN3A 1D2CA 2QLLA 3LA8A 4S35A 3OZGA 5A3RA 4K9MA 3U0VA 4CEJA 3WGZA 2VXYA 1PEYA 2QRVB 1T8UA 4RYDA 4JI7B 3K0CA 4B43A 2JFBA 2QLJA 3DT6A 5BN1A 5A4DA 1NG9A 2IZ7A 1G1MA 1M2KA 5DHRA 2VDOB 4CMEA 1I14A 3DOEA 4IDGA 5IDXA 1I2BA 3CXRA 1T10A 1ONOA 2JANA 4R71A 5JS6A 1ZN9A 2BDTA 1XLTC 3RVPA 1Y8ZA 4RFSB 4AP6A 2YWRA 4ENVA 4BEVA 4H6WA 5AVSA 2ODEA 4GO1A 3UMFA 1CQIA 3IXQA 1T5HX 1FZTA 3ORHA 4R7TA 3ZE9A 4R5HA 2P7IA 4PNEA 3EMDA 2UYCA 3CLSD 2ZYHA 3HO1A 2W2QA 4B0OA 7REQA 2F9FA 1W1WA 2R1VB 4WL0A 4HVCA 2Z5FA 3MJCA 4R68A 1AHPA 1P5FA 3UHAA 3D8TA 3W5AA 1ZMXA 3FUWA 3IE2A 2PTGA 2QTFA 3MBKA 4Z8XA 5EJ5A 3ZHYA 4G2NA 1FNMA 2FV8A 3VTAA 4EUSA 2FZEA 1ENOA 1U7PA 3N2GA 3LDHA 1P2FA 1N2CE 5IVIA 1EP3B 4R8MA 2MYPA 5GJBA 1MPXA 1Z2PX 5ENVA 3RR2A 3EASA 4MWZA 5BVHB 3K9FC 4DVGA 3AW8A 3T5TA 5DWDA 4W6ZA 5F78A 4MUHA 4LZOA 5IS2A 4QBGB 2PGNA 4WJKB 5CA1F 3E9ZA 3P9NA 2A3RA 5CYGA 3CPJB 1CS0A 2FG5A 4NE9A 5H0IA 4DLAA 4OG2A 2VTBB 4FHCA 4KFRA 3ADCA 4M6WB 1A71A 1X19A 5BV7A 2DWOA 4MUEA 3LHDA 1DJOA 1DP4A 5SYMA 4UQPA 3LFHA 1A04A 1ZS9A 1E7YA 1IN6A 1QG0A 4HDOB 2P9TA 4IO1A 4DMKA 4GDMA 2CNKA 4MV5A 5ALEA 1FJGB 4JH0A 3WLIA 1DINA 2JFQA 2VWHA 3GH1A 4AJIA 3VVBA 4A92A 1JXOA 3ABQB 3LSYA 1PYDA 1B0ZA 1NI5A 1Q16A 4RD3A 4IILA 3U7QB 2WJHA 1TM2A 5I45A 1U3DA 3ABZA 2VNHA 3MWYW 5G1OA 3V48A 4QAJA 2XF8A 1HL7A 4M1TA 4IIDA 2Y2UA 1ZG3A 1ZPDA 1BH6A 1SHLA 4PAGA 4Q00A 1FS6A 3MWEB 4HAYA 1OGYA 1SKAA 2FE4A 2JAUA 1SBHA 3MGBA 1TCBA 4KXUA 2PRKA 3QMPA 4CV3A 5CYFA 4C6RA 4A9AA 1G5IA 2VHCA 3NM4A 1XU7A 5ALJA 1PR5A 4F8JA 3RHTA 4ITUA 3B6IA 4NU0A 1DDGA 1LPBB 4YJHA 2BV3A 3EH1A 3PC3A 5C8ZA 2R65A 2CNNA 2W6ID 1R8XA 3R6DA 2WMDA 2N1BA 2SBTA 1DV1A 1H4QA 3GROA 2YQ4A 3PXBA 4C30A 3D8NA 3NRCA 1LWOA 5JAUA 5L8VA 4LRUA 3W4KA 4RKWA 2X3YA 5JH7A 2YFHA 1KKUA 4Y2PA 3PEUA 4JYPA 1XNRB 4B3RB 2W6JA 2QUHA 5CT5A 5D3MB 4EARA 1Z36A 2GBIA 3FPBA 3WAJA 1FB5A 2ZUWA 4HO1X 4IDBA 4L4RA 1F38A 4U2DA 4QELA 2Q7XA 3C0KA 5FFFA 1EA5A 1WCV1 1I1QB 1ZIOA 2PHZA 1T2EA 3EPPA 5BV2P 3Q72A 5IAEA 3LY7A 2NYRA 3NGXA 1XDZA 1NASA 4CMIA 3ZVMA 1R4ZA 1HSZA 2GA9A 4JS0A 4OQQA 5CURA 3BN3A 1DU4A 3QX8A 3LXMA 3PF8A 2BISA 3ZHTA 3LHKA 1QIEA 4MUIA 1TZJA 2GVZC 4J0HA 3QI2A 2VRNA 2ZSAA 4OMUA 5BWCA 2D5CA 2OG2A 1UFKA 3OA0A 4HMPA 2Q5JA 1SXJE 1TO1E 3MT8A 3N6VA 4A5OA 1N25A 2O8EB 4ZT4A 3EUWA 5AJVB 2VK8A 1DQYA 1I36A 3DMYA 5FNVF 3ETHA 1ZMRA 4PN3A 4FOTA 2AN9A 4G2TA 1Y8RB 4YJDA 1EUCA 3PGMA 5EHNA 3TIFA 2JAQA 3OLQA 4MCJA 4L75A 2X4GA 2EFCB 1JLLB 3INRA 3JQ9C 4I0WB 2DGDA 2BEWB 1Q44A 3PFIA 1YQEA 1KY5A 1HEUA 2C9ZA 3DAPA 4PCVA 2QD4A 3TD6A 1P2DA 1WHSB 3DV2A 2X1LA 4B32A 4JJ6A 3O8BA 3A70A 3R5XA 4Y2SA 5D5PA 3PXUA 3UKJA 1RM5A 3HBAA 2DFVA 1X1DA 2JHCA 4NR0A 5K3EA 1Q7CA 4HDNA 1JAYA 1MQSA 4GM0A 1TUBA 1EUYA 2CVHA 4ADSG 1N7JA 1LS6A 2H00A 5D3KA 5AKLA 3TBFA 4ZN6A 1DFGA 3BCRA 3OMXA 2IUSA 3DJFA 3FG9A 3HBMA 3PL1A 4UDOA 5KOJA 1KAQA 2D8AA 2MU1A 3VJKA 3DPUA 5AQ1A 3NIGB 1IN7A 1V3TA 2H2HA 4M55A 4RGYA 4YLEA 5CJ2A 5I47A 3D64A 2INGX 5DGTA 2JIBA 3H8JA 4ERXA 4I3FA 2VP5A 1FSSA 3PNSA 1U7DA 5CXQA 1FU4A 1QX3A 4KQXA 1DEKA 2B4AA 3A6EA 3QUAA 1T4CA 3BXOA 2AF3C 1O8BA 2A59A 1CUWA 1IXRC 3OIUA 3OWOA 1XNGA 3D0OA 1ZGCA 2XLCA 1CY2A 2FW9A 2WTXA 2Z5GA 3K0FA 4F5YA 4RLQA 3VKUA 4D42A 1QG6A 5ELMA 5AUOB 1AURA 2ZE5A 2YWBA 3MINA 1IUOA 3G9ZA 4WDRA 4YUVA 3VPBA 5BWNA 3CUVA 4DV4B 2AEEA 2EYUA 3AFIA 5DHPA 1RXWA 1BXGB 2QUAA 2IIVA 3FFBA 4KQGA 4BQOA 2I7VA 5JZSA 1GFSA 1RI5A 3HKBB 3WGTA 4PAQA 4J4TA 1J5XA 2I3ZA 1SHJA 1JHZA 4IY1A 3ESDA 4C04A 4D9CA 1QWSA 5TVGA 3ZWPA 2ZSBA 4TXJA 1Q0SA 5AKXA 1K6EA 1IN4A 4NZPA 3DZHA 4ZQCB 5ICGA 2NUPB 4DCTA 2EL9A 5BWMA 2AC7A 2XXAA 1G18A 3AJDA 1QG2A 2VBFA 3E3MA 1ADYA 2J9XB 2E55A 4BC0A 2BVNA 5JTTA 5LA6A 3J81A 3DVLA 2AJ8A 1EWTA 3IMGA 1PG2A 1FYEA 4JGBA 4NECA 5FL7A 3UAGA 4NJOA 4OY3A 2O20A 1MZPA 3U9TA 4EI9A 4YXFA 4N3BA 1LBEA 3CEJA 3O4HA 3R7FA 1M74A 1QGAA 1LK0A 4ITRC 4PYOA 2FAXA 4RIHA 4DEVA 3I37X 4MS4B 3D2BA 3H1GA 2H8KA 2VTEA 4JBHA 2OAEA 3QVGB 5REQB 2G9NA 1NJ5A 3BSFA 3R77A 2GJSA 1U90A 3H9EO 4B7AA 1NUQA 2IXFA 5B7PA 4FW8A 4ARBA 1CEEA 4MQFA 3OEEA 4TYQA 2K4MA 1S8AA 3FPKA 4TMFA 4R31A 5L6MB 3U44A 3LBYA 4L5CA 3AEKB 5FPTA 4ETWA 2WF5A 2JHFA 1OH8A 2WVHA 1H0HA 2OO5C 4JJ4A 3IB6A 3A6KA 2O3JA 5JNTA 1RYEA 1BJRE 1UBSB 1NF8A 2AZTA 2ZE6A 1M10A 3OTGA 3HC7A 3X1ZA 1F2UB 4BP1A 3O6VA 3FWZA 1RJEA 3V2IA 4EJSC 3HVHA 4BX2A 4CODB 1G66A 1Z4JA 4J43A 1S8FA 2G40A 1FBNA 3G6KA 5HBRA 3IV6A 4K87A 1LA2A 2VBGA 2YWDA 5F33A 4DXDA 1BEZA 5JBIA 4DR1B 1E0SA 4RAOA 1ZAKA 2F62A 5T4HA 3NHRA 4OMDA 2XPCA 3NB0A 4PRYA 2YTZA 4XTRA 5B2ZA 4ALLA 4D45A 1DCMA 3ZGNA 4INZA 1JIXA 1JDVA 3M34A 4Z3OA 1UOOA 1DQPA 2RGWA 3Q5EA 3QF4B 5TVKA 3CW2A 3LZDA 3SD7A 5BNFA 4CF7A 4IDPA 4TZ6A 1NOKA 5HZMA 2NXNA 4PG8A 5I3CA 1F5SA 3WLNA 3ORYA 3HXMA 2A4MA 2ONJA 5DJ5A 4OI2A 2Y99A 2C82A 2HQBA 3CR7A 4LKRA 4H7JA 2ZWVA 4YRJA 2B6HA 1NP3A 2BKEA 1T5LA 2IPXA 2WHPB 1QVRA 4U9IS 2JEYA 4RMGA 4QO7A 2V96A 2JL1A 4YBRA 1WTAA 1FFBA 5CT9A 5AI0A 5ALXA 2JBAB 5EMMA 4OFXA 4ZAZA 1XT6A 2FTKE 3RSLA 3HB5X 1G7CA 1U9CA 1DJLA 1RFLA 4XJSA 5CJPA 3NNDA 2BMWA 2YY5A 1F3LA 1FP4A 1LK7A 2E4WA 4HFNA 4UHFA 4EHDA 3T1TA 3H13A 4KAFA 3EYWA 3GOHA 3L43A 1PEKE 5AJYA 1SJ9A 2GTIA 1YQDA 3U1VA 1A4UA 3R76A 3R8FA 3UKDA 1LSSA 3L82B 3WYEA 1FSPA 2QORA 2EJCA 4IV5A 4IIBA 3CB4A 5AVQA 3B3FA 1M5RA 1NW4A 2V7EA 1WCYA 5C51B 3WVNA 4QT4A 2IXGA 5EE0A 3MYRA 1S2OA 1ZCBA 2AEJA 1AS0A 5I7AA 3AHHA 2I5PO 3U39A 1QK4A 1UQRA 3ER9A 3EQ2A 3VU3A 1IULA 3PFBA 5G40A 4DVJA 2ZAOA 2C8JA 2B5WA 1O6GA 4RZ2A 4X63A 2Z4TA 2Q6IA 5DN9A 1ESZA 4Q4CA 3U6KA 5K01A 4HAOA 5AYVA 4XWYA 3RC1A 2BFDA 3G23A 5JBNA 2GSWA 3SG0A 2OXRA 1KAMA 2QTWB 2AK2A 4IFTA 5CVDA 3UO8B 1DBQA 4M99A 1ADBA 4M0LA 1LZLA 1KDTA 4BKMA 5T57A 4JQSA 4WCFB 3F5MA 4YAWA 4G1CA 3I4CA 4GZLA 4TWBA 3FPLA 4FGJA 5EJFA 5JI3E 2WK1A 1DKMA 3ZE8A 2VAXA 721PA 1NPDA 2EW1A 2H57A 5ALDA 1CP3A 4EHBA 2JCGA 4QU9A 2M6SA 3HRKA 1KP2A 1M9NA 4I1YA 5IX8A 1S4MA 5JNLA 1E5QA 1FTWA 4HEA1 3WGUA 3FMFA 1NHWA 1OX6A 1WUTA 2PA3A 1VPEA 4D9FA 5DN6D 4X97A 3OFVA 5EJ8A 1G9XA 2ZUFA 5AW3A 1DRWA 4I4IA 3A6FA 5J2UB 4F9FA 2BR4A 1D4AA 2OEPA 1G5TA 5J5CA 1HLPA 1V8ZA 2WE8A 2ZI4A 2ZQYA 1B1CA 2JI7A 5CRIA 4EHNA 4AUKA 1JJFA 2GRUA 2DQKA 2J41A 1QQ5A 4O2LA 1A9XB 3WC4A 2C5SA 4CKWB 2WYWA 4PONA 4JYBA 4U6SA 1USVA 1R0WA 3GFRA 1NP6A 1ZJ5A 5ER6A 3VGPA 3H19A 2JA2A 3ILVA 5BRAA 2HDNB 4MRSA 1PR2A 3WDKA 1OX4A 2O23A 4GL4A 1UBFA 3AOGA 4B46A 1TEHA 2HCBA 3WV5A 3TMKA 4TL7A 5A9TA 2J33A 4QPPA 3S2ZA 3ILXA 3FCCA 4HXFB 4LNUB 3UJ6A 2VSXA 1XRNA 1Q1EA 3E5NA 4F4IA 5AQEA 5C9ZA 1RACA 5CA0F 1GKYA 4DA9A 3WIOA 3RSHA 1P9NA 2PX4A 3P2MA 5JXJA 1JDBC 4Z6KA 5GM2A 4H59A 2ZIFA 3GRKA 1Q50A 5BMVA 4WLFA 5HVNA 1Y5RA 1V7PC 1W85B 3IOBA 4MWGA 2HTEA 3KQPA 3SF8B 2YZNA 5B58C 3OX2A 3RAEC 4KFTA 5KYGA 4P0TA 2QGFA 1EBFA 2R9VA 2V6FA 3RYHB 1N1GA 3H6HA 3V46A 1LDBA 1VI5A 4RYLA 4BTVA 1WHTB 3LCJA 4MQ6A 3WSVA 1WXEA 1HY3A 1HE1C 2AX4A 2FX5A 3SCZA 5JSZA 4M1ZA 4IFBA 4I4TB 1C80A 4UBNA 1PT6A 3H2GA 4I1UA 3T1QA 3OZDA 2VL7A 2LR0A 3RFCA 1CF4A 2O8VA 4OPMA 2P0EA 2GHTA 1RRMA 4QEDA 5FBWB 3RG8A 5DK6A 4YLGA 5AM1A 2IPMA 3JTEA 2PIAA 1V37A 3DP7A 4TMKA 4L27A 2NU7A 1X77A 4L8LA 1NLZA 3OE7D 1LCIA 4DXHA 4F21A 5FEUA 1E5VA 1PR9A 4W5QA 1ZGGA 5JCZA 5LIRA 4EUKA 4R0VA 1YR3A 2P4SA 3L8CA 4J2HA 4NQRA 1KDVA 1MV5A 1GQSA 2QW1A 4UE2A 5CDYA 2XQFA 2YN0A 3N5CA 3BMXA 1A3CA 2ZSUA 3P9RA 3CPHA 5DKFA 4YYEA 3I05A 4JI6B 5LL6P 1GAJA 2WTBA 4TLMB 4I55B 2CKDA 3D31A 1S2LA 1B41A 4FE7A 3GEHA 5E1OA 1JR3E 3DLPX 4OQMA 1ZVMA 2A9RA 2QMQA 2XCTB 2GYVA 5FEMA 2R68A 4NL4H 4ZTZB 1SK8A 4FNGA 3TLAA 1H85A 2AFIA 5ILOA 1PTJC 2DQSA 4RCYA 3D59A 3QI7A 1IB6A 1AS3A 3DFFA 1J9GA 4Z7OB 2B3DA 3BILA 2XNDA 4QM7A 3GLKA 3CN9A 4IG4A 3OD1A 4X9XA 5K51A 5AO9A 3QZUA 1SRQA 5ADWA 4PBSA 1G4AE 3JQFC 4YP1A 4U7PB 2ABWA 3RGGA 2GZSA 2Q4TA 4DT1B 2IP1A 4O3FA 2A0XA 3SC4A 1T4GA 3TCKA 4BVGA 2P9QA 1PI3A 1E2MA 3NVKI 3OSUA 2E3JA 1VBMA 2GLXA 3WJ2A 1U7XA 7GPBA 3C16C 2D6FA 4W7HA 3SFZA 1JI3A 2P5UA 3ZWOA 3FGZA 1NV8A 1W6UA 2Q2OA 5DVZA 3DEKA 2OXTA 5EPUA 3W9BA 3WFIA 3FDZA 2R0QC 4TXNA 5BNIA 3K0AA 1B1AA 4C0AC 4OJQA 4QBKA 1OBOA 3DO8A 3QLJA 2CVZA 1XNJA 1DFHA 3UBTA 4FINA 1P74A 3F6RA 3DE7X 1PNQA 3BWCA 4LJSA 2BWJA 4MARA 3W6ZA 2PV7A 2YASA 3IJRA 2WU1A 1JDTA 2OWEA 2VJMA 1A88A 1R2QA 4OQYA 1XLTA 4B6OA 4O5OA 4INAA 4GMFA 1PR6A 1U0NA 3DDOA 1OWLA 4Y3UA 4RHCA 2X8JB 4QFCA 5LQSA 1GTG1 3SHFA 3LCVB 2O4UX 3WP0A 3EUAA 4LXUA 1RHUA 4MCIA 5H70A 2ODQA 2D0DA 5HF8A 5EFOA 2C8LA 3TRKA 3KJZA 2HHLA 3NYQA 5E0OA 1YCFA 3P2OA 4M7WA 1CSEE 3O74A 1IN1A 2OC4A 3DD5A 2X23A 1QG4A 1GEGA 2EJBA 2W6CX 5DMXA 5EKSA 4RKQA 3DOOA 3SVTA 1B2RA 1XTKA 5DYGA 1CP2A 4RM2A 3ZLVA 4QHTA 4CM6A 3DR5A 4N8SA 1V4NA 4RV4A 3CW9A 2GTPA 4P80A 4CLEA 4ZMRA 3HXQA 2IX9A 3R0VA 3ZR4B 2PFSA 3E8MA 2HU5A 3C7TA 3HP1A 1IXSB 4PYRA 3ZHRA 4G07A 1UKVY 2PUCA 3NYIA 5FPKA 4YWHA 3K6RA 3ZE6A 3QUBA 5JS1A 2NO5A 5KNDA 1R4AA 5FTNA 2IHTA 2NV2B 5L9AA 3TUIC 1I2ZA 3EXG2 3G9QA 2EP8A 4UCXA 1RI2A 3O9MA 5DNWA 2QQEA 1PR0A 4HDKB 1EFCA 3H5TA 4Q1EA 4E11A 2JH8A 5JWOA 2FEPA 1PHRA 3BSSA 5DWVA 3AKCA 4YO7A 4XIYA 1S7CA 4EB6A 4ZOEA 4M37A 4PC6A 2BHSA 3EQ7A 4BHTA 4L9SA 5HS4A 3SHOA 3UUEA 3VX4A 4B2YA 2H0AA 2RIPA 5TX7A 1MNAA 1N34B 5EWJA 3AB7A 1TYCA 4OD0A 2XUKA 4AN4A 4AN0A 4B1FA 4B2IA 1A96A 1PWYE 1FXWA 4ZVTA 3DZIA 2UZ3A 3JYNA 3TAXA 2OCGA 4I1IA 1UK8A 1JNYA 4X91A 1RTKA 4GOMD 1MO2A 3TJRA 2I8LA 2LXNA 1Z88A 4DUPA 1K89A 3L1JA 1JYSA 2HIHA 1XZLA 6REQA 1QE5A 2CVPA 3PNVA 1Z39A 5KDOA 2CYAA 3GVIA 2P9BA 3O8NA 4IUDS 3CVUA 1DAOA 2WIDA 3NU1A 4R2KA 1CYDA 2QRNA 3P0IA 2GESA 4YJFA 1EVKA 1C8BA 1FFGA 4YECA 1OILA 5BOVA 5K2MA 3QBVA 3EZ9A 3II6X 3QYPA 3N8NA 1KMMA 3MK31 1ZESA 2ZI3A 1A95A 3IAUA 1XKQA 3L8GA 3LYHA 4XQCA 5A03A 3TFWA 4X1YB 5JXGA 1VTKA 2Q2NA 3DEJA 1H9BA 4RS4A 1NVFA 4YDSA 2WWIA 1JSXA 5EOVA 1R4NB 4QOIA 3INYA 1ZK1A 4ZT5A 1T0BA 2O7NA 3ESQA 4G01B 4MLPA 2BFFB 2RE8A 4RD6A 2PXCA 4BMZA 4BYGA 5BT8A 2AMLA 2M9MA 1SEVA 3HGTA 3O4JA 2MMCA 3OQ6A 1EAMA 1M8FA 2JIPA 2VKQA 4MVJF 3N8DA 3K6JA 2ZI5A 1SQFA 3DZDA 2DR0A 2B99A 1JIJA 3B1YA 2PKWA 1KJIA 1XJWA 2O8DB 3FUUA 1KRWA 4Z51A 3KLMX 3T8YA 1CUJA 1Q92A 3ZV3A 2ADOA 3BMCB 3FZEA 1CUCA 1CHDA 3PX2A 5BQFA 2XX3A 5IDVA 5B36A 3ER6A 4TKZA 4EUHA 4FT4A 4RVUA 3IVXA 1UAGA 3RC9A 5F23A 4TTAA 1M1ZA 1MO3A 2A0KA 3ELYA 4A6XA 3SJAA 1LNZA 1TADA 1U5CA 2G28A 4YRRA 3K2BA 1M33A 3CF4G 2RD2A 3B12A 1TJ4A 2G1KA 3H9UA 3NALA 4FI3F 4M0FA 1V7ZA 1JHPA 2VLIA 5BSHA 1FW6A 4URUR 1WCWA 2IYNA 2OB2A 3F6EX 4L50A 5AJTA 3NBMA 2I2CA 1QVZA 5FXMA 1NKVA 1N9KA 1ZU5A 2JAPA 3P2JA 4TYNA 1US8A 4QUKA 5KDDA 1IY8A 2YMLA 2H65A 1NJ8A 1EFKA 3EPLA 4JQZA 2GCIA 4D80A 3UWPA 1FNCA 2VQEB 3PDCA 1NW5A 3CLRC 3BB3A 4OXRA 1N36B 2HRCA 4H35A 1RXSA 1J56A 4MOWA 3MUEA 2IZ6A 3D4IA 1H3EA 1PJLA 4WLVA 2GZ2A 4KRYA 2YV2A 4I8DA 5JTUA 1MVOA 3GPLA 3HYCA 3KWLA 4GOXA 3Q6NA 1MC1A 4CBVA 4EG3A 5HX7A 1SKYE 2B35A 3O03A 4ZZ1A 4LF7B 1HQYE 1JIQA 3U62A 4ZHQA 1GKKA 4G0YA 3TTVA 1Y3HA 2IW1A 3KZCA 4CF6A 3UTDA 2HLDD 1UBHS 3NT4A 4HB0A 1TYEB 2ZYAA 4UMVA 2QRKA 2YWXA 5DI9A 1V11A 4FNAA 5A2GA 1VL8A 3LH5A 2OCIA 4ZC8A 1MW8X 1GU7A 1ZD1A 1K4YA 2RI0A 4NYIR 4ENUA 4LDRA 1U6KA 1QCZA 2YRXA 4EYKA 3NBYC 1WZ2A 3D5QA 3VTZA 1I2AA 5J4LA 1DIOB 1AOXA 1P2BA 4LC0A 2PKQO 3DNFA 3IESA 2I62A 4TSKA 4B7UA 4NFYA 4EG1A 2C95A 2RK4A 4RQAA 1C3VA 1E4EA 1OXVA 2P1DA 3CNQS 3HPRA 3G0OA 4FE3A 4GQIA 5C53B 2CD9A 3GQBA 1AC5A 1X8LA 3PGXA 4HQFA 5JQGB 3RG2A 1PE0A 1ZNYA 3DMFA 2IWRA 4RPLA 4YT5A 4CDRA 4PO1A 4O4LA 4UHKA 4IS2A 4NENB 4RJKA 1HUQA 1VIMA 4DFDA 1FOEB 5CDHA 2DBRA 2GXQA 1UBRS 2C61A 2ZJ4A 2W2PA 2IUUA 2JK1A 3ZWVA 4GGMX 2FHPA 1ICIA 4E51A 2XE8A 2AW5A 2AV6A 1KJJA 2JVKA 4O2BB 3FYTA 1OW3B 4D96A 4MW9A 2D5BA 8GPBA 4S0ZA 2VDRB 4QGFA 1GLNA 1YZNA 2GN8A 4EO4A 2VCYA 3RGWS 2ZITA 4I50A 1WXFA 2O2GA 3AZPA 4JJIA 4KWTA 5K03A 1VSBA 2HZBA 3ILYA 4NV1A 2QX4A 3BE6A 2A8YA 4P5PA 1F5NA 3T3EA 1ZICA 1GNSA 1G2QA 2AE1A 4EEKA 3HSKA 4EKDA 3ZGVA 1NTRA 5KC8A 1U3WA 1ZGHA 2OLJA 1QHGA 1PT7A 4NONA 4QTZA 2YYZA 1U3UA 1QS0A 2VAMA 1NQAO 3NRJA 4EO9A 4WGFA 2Z09A 1VG0B 4NBTA 3Q87B 3LY8A 4Y1RA 3O2JA 3E27A 3LLSA 3QFRA 4HSGA 5I9LA 5K6AA 1DBWA 5HIAA 2V7QD 4PFKA 2E89A 3ZDQA 4WGGA 3I62A 1GYPA 4DB4A 1KAEA 1I9CA 1HZJA 2I0FA 2P9JA 3BC1A 3DT8A 3HH8A 4XCVA 1BMTA 2R7KA 1PUXA 2UZIR 3CR8A 1Z4QA 4L8GA 4QYXA 3T3IA 3VO9A 1EDZA 3I2JA 2AKAB 1B2LA 3CEMA 3LT4A 5BT9A 4NATA 1PZXA 4W9NA 2OO5A 4X6LA 3G2IA 4KR0A 3K9QO 3O8QB 1MEEA 4LGYA 3ROTA 4KLAA 1O94A 4ALIA 2J48A 2XKBA 3O8CA 2PJDA 1YVUA 2PT9A 2OECA 1AXGA 3NHPA 3ZI7A 1Q74A 4QDUA 4A0GA 2YH2A 4TUYA 1I7LA 2ATEA 4IGFA 4I5EA 4EJSA 1XNQB 4X1IA 5KREA 3AM3A 3A26A 3GRAA 2G71A 2PXAA 2QZSA 4TKVB 3ZHBA 5I48A 2A57A 2Y9PB 4OVKA 1HZZC 4GUAA 1JIIA 2O50A 3LQ4A 1OXBB 3EEFA 1JALA 2VP4A 2ZXFA 1UBNA 4M53A 4ER7A 3KU1A 1CXZA 1KEEB 2A5DA 4LYDA 1JHUA 2ASEA 2C5LA 1KQGA 2H1CA 3PEFA 3PXXA 1CEYA 1MABB 1T1RA 1XDBA 3A8TA 3HB1A 4X54A 2VNIA 1HFKA 1G7RA 3OP1A 2Q46A 3F6YA 5BQPA 3H11B 3ESBA 3U1BA 1ODFA 1TW2A 5SV2A 3WQQA 1T2FA 5IKXA 1ZVKA 4DDHA 2YBEA 1F6DA 3WIVA 2BUCA 2CLHB 3L8MA 3D6MA 3FOCA 3H1FA 4QSHA 5JRZA 5JO9A 3TEMA 1GZSA 3CIOA 5JMOA 2IYLD 2FPSA 4MEJA 3M0EA 5FP0A 3L7YA 3UHJA 1QO0A 2YVAA 4C3OB 5BQ3A 3ABOB 1BA2A 3B8HA 4D9EA 3NAGA 4KN6A 1RC1A 4OBWA 4YMIA 4EFKA 1LU9A 3MM4A 5F2EA 1NW8A 2RK3A 3ANXA 5C8VA 3RK4A 2W6PA 2JLSA 4LXGA 5FYDA 1VLVA 1ZSVA 1U5AA 2ZAYA 3PWKA 4YCAA 1A2OA 2IH4A 1CZKA 2X6RA 2HK9A 1KEWA 4Q47A 1FMCA 4HNQA 4US2R 1A8HA 1GFZA 4ER3A 4Q1VA 1JQBA 1FQKA 2YMQA 4MYRA 2JZOA 4N5LA 3OIGA 3AYXB 1RLIA 4BBZA 3CUEF 4ZZ2A 5LMNB 3DWFA 3SSMA 1FMLA 3LPDA 2PK3A 4GI2A 3W6UA 3VHQA 3FHOA 3WMXA 1NONA 2PJUA 1U1EA 2QE7A 2EKPA 3FR7A 1PR1A 3NI2A 1C7QA 3JWPA 1ZW6A 1CUHA 1JA9A 1K08A 2X9NA 4KZPA 3URMA 4D6XA 2ILVA 3UPUA 2C4HA 2QN6A 1K4MA 3LF1A 3DKVA 4JD5A 4F4UA 5BQXA 1OYYA 1NT2A 1P45A 3N58A 4L5BA 2W6JD 1BO6A 3G5LA 2CLSA 4JLMA 3SX4A 4EBBA 2AXNA 3TQHA 3GC6A 1HKHA 3G2QA 2HT6A 5H3LA 3IERA 2C03A 3RVDA 2V7PA 4BO7A 4KRFA 1NLMA 5G0UA 2ZE8A 4XWGA 3H6KA 3R0IA 1F2DA 2EJWA 3VJLA 2YHUA 2XEDA 2C2WA 3F98A 3U7HB 1Q83A 2Q3DA 3E84A 1FFHA 1R27A 1UPBA 2HLNA 3AK4A 3AYZB 3H8SA 1PQWA 3ND9A 5LZ8A 3A6PC 2C0QA 1AKUA 4H18A 4XUGB 1X2EA 5E6SA 5CCEA 1QO9A 5EMLA 1OC2A 1D6NA 2FWMX 5DOZA 2F1IA 3RF6A 2OBYA 4BFYA 1VPWA 1TTTA 2FFRA 3BGSA 4PR0A 1Z28A 3M1LA 3NBUA 3NJ8A 1AKNA 1SVUA 1X94A 5JDIA 2XGJA 4E2WA 4LV8B 2FEMA 5IG2A 1PDOA 3D8HA 2XB9A 2XBLA 3R6GA 4Q1AA 5A6SA 4MCAA 4FD2A 4V2UA 2ZB4A 4QRDA 2LRHA 4I9UA 4S0XA 1TVKA 3K1AB 1KYYA 1B3BA 2NPIA 4L6AA 3L92A 5BUQA 5KOJB 3JALA 1R9JA 3QOYA 1XZMA 3A27A 1YD7A 2H1VA 5KJ1A 2NGRA 3OOJA 2XCSB 3CZAA 4JR2A 2QWXA 4KYVA 1OI2A 3IQGX 5CM2Z 1D09A 2VVTA 4LHVA 1T9GS 4PIVA 4YCDA 4BLSA 1PVDA 3NHYA 1QGED 2Y1DA 1VPDA 2BFEA 1KI1A 2PEYA 2XT6A 3MD9A 3PC8A 5D8DA 3UV6A 5JAPA 2ZBUA 4MVJG 3TF5A 1Z3IX 4DW8A 3NORA 4DSUA 4WINA 2QRMA 4GPIB 3PUWA 2F43A 5EQFA 3GFSA 2JDID 3AEQA 1N7GA 3CMMA 3QMWA 4XIIA 2BR3A 5CLLA 1FJ2A 3L4EA 2HXGA 4GS5A 2B0CA 4EGSA 1M34B 1AMOA 3HTXA 2FRDA 1W44A 3HP4A 4OHKA 1EHIA 4NZ9A 3GJTA 3PIDA 1NA5A 2CN1A 3COVA 3IAHA 1U1GA 3PVCA 2OGTA 3AVXA 2Y0CA 1Z2AA 4UUMA 4BAZA 3K0BA 1MEOA 2DFNA 4I6JA 3G89A 1E5LA 2EARA 2PUAA 1IHOA 1EXDA 4PE5B 2JKYA 1CKEA 3AR3A 3RBXA 2IH2A 1V5IA 4OQLA 1J24A 2GUWA 2X0DA 3ZVKA 2O19A 1DOZA 3I4FA 4K8OA 3EZFA 4KWIA 4MS1A 5KYVA 5BORA 1QPZA 1VPLA 1FQWA 1HBJA 4C5AA 4DHEA 1H1TA 2XMRA 3SJUA 1U31A 4IIJA 3HXPA 2NSHA 3SU8A 2VPZA 3KX2A 2D00A 4KO2S 4M9RA 1N5KA 4INPA 3NHUA 2N3ZA 1PV4A 2L17A 4BNDA 1AJEA 4WVLA 1YR1A 3BGDA 4I9NA 5EJGA 3N2KB 4EZBA 2F8LA 4JVOA 2BMJA 1J39A 4NMXB 1YS6A 1VB5A 1SG9A 2D62A 3DO6A 5I7HA 1N32B 1SBZA 3WL6A 4A0QA 4P6VF 3VOSA 2WU0A 2GN4A 4YREA 1JLMA 2V3CC 4MW5A 2ZZNA 1HXHA 2CF5A 2PQ2A 3GV0A 5IDYA 4DR2B 1J7JA 5TQ2A 5DASA 1T25A 4HBZA 3RU2A 3M3PA 4EM6A 1NLUA 3NBKA 4EB0A 5EHXA 1ZOPA 4HQ6A 2AT1A 2O6HA 2PYZA 3QPAA 4QOEA 1XELA 3RU9A 5KYWB 1ZUNB 1GPBA 1X1TA 3FNRA 2OGWA 3K8ZA 1DEHA 5FL7D 3SIRA 3V33A 3FZYA 5CM9C 1AF7A 4E30A 2DZDA 2Z6UA 3NFYA 3QVTA 1ZHHA 2EKDA 1XJ0A 3QVUA 4F6LA 3RS4A 2HF7A 4K9LA 5LQRA 1L5FA 4L0QA 1XB2A 3K16A 3KEGA 1SD2A 3KOUA 1GL3A 3ACCA 1LPNA 1GT91 1PTKA 3IUNA 3KXLA 3TQTA 2W6ZA 4MLZA 4WOBA 4Q4JA 1BWSA 1ZRSA 3O92A 5KKCA 3PI6A 4PX5A 3OEED 4IXMA 4G41A 3ZIUA 1SKBA 4CMJA 1GSIA 4I4NA 1QH8B 4AKEA 3GDHA 1HT0A 2REQA 1V25A 4NK4A 3JQAB 4B3DA 4IYRA 4CHGA 3NM6B 1VYTA 1EXVA 1G2PA 2OUKA 4FHGA 2HA2A 2ZVPX 3CJQA 4R8VA 4D7AA 1OPXA 5JATA 3UT5B 1XQ9A 3HY6A 2O06A 1B4DA 1Y1KE 3WQBA 1QQAA 4AYWA 1EGQA 2LGJA 2C2HA 2ZRLA 1TK3A 4QICA 4QOGA 1BEEA 3PNQA 2A58A 3M6UA 3C70A 4AYXA 1B15A 1ACLA 2JVJA 4FUTA 4RD0A 4YV2A 3RADC 3PGLA 4YUAA 1Y1PA 1LDEA 5EUMA 3FLAA 1A7KA 3V8RA 3WNZA 4N5NA 2EAUA 4A1FA 4A8PA 3LMKA 4AKTA 4F8EA 4C2UA 4AURA 1PQYA 1JAZA 4XWTA 3A1WA 4QUBA 3RS3A 2XW6A 4H4DA 4EI7A 2QQGA 3DDWA 4OL0A 4Q6BA 2IGTA 5JZBA 2ZSKA 2H5EA 4RTOA 4KQ6A 2JJQA 4MQMA 1VKZA 4IIGA 2EZ4A 1NI3A 1M5UA 3IMCA 1BQ3A 2QTHA 3EPHA 3WLQA 4WN3A 4BGIA 1N2CB 3AESB 1OI3A 4ZALA 3KZOA 3DCIA 3H3JA 2B2CA 3M1AA 5EP1A 1VBFA 3HU2A 6GPBA 2FZGA 1YB4A 4ESOA 1E3TA 3DE0X 3Q0IA 5AK5A 4QYSA 4JOCA 3RTAA 2IDZA 3W3AD 3ZVRA 5ELXA 1LDNA 3LYAA 5KTSA 3AVQA 2QTAA 3HYLA 1W35A 1MC5A 1RRKA 1MAVA 3I5MA 4OLJA 4RA9B 1YC5A 2OB1A 4TV8A 3TN7A 5IDQA 5LXTA 4GZMA 1UMBB 3PQDA 5EERA 3KUXA 1DCTA 4EZEA 4JYZA 4F4DA 2DBZA 5IUJC 1DS6A 4J6FA 4TPKA 3ZLUA 4CM9D 1UM9A 3TG8A 3L79A 3MTGA 3KV1A 4DR7B 4AAYA 3A10A 2WWVD 1BQ4A 4HDRA 4M3NA 4H7FA 4AKGA 1J99A 2I3DA 5E3JA 2ZYGA 3F97A 4J8PA 3FCXA 2JAXA 2WIJA 2X0RA 2XUOA 4XIGS 3KKPA 1LDYA 3NJ4A 4B6RA 4YR9A 4OX9Y 3GVPA 1JKMA 1ZUIA 2OMEA 5KOIA 4LQDA 4LYFA 1EBBA 4JB0A 2V6JA 3JVIA 2Z2JA 5BRNA 1Z5WA 5HSGA 5LQUA 2WWGA 3DDSA 4WNAB 3FKSA 3UJ9A 3DTVB 2TMYA 1Z0IA 2P65A 4YMSA 5FBZA 3WDLA 3JAWB 4R1PA 2JNWA 2OHIA 2ZAGA 4D9KA 3IR5A 4CIDA 3AF6A 1QO7A 2J67A 2R5WA 4PZPA 3W4IA 9LDBA 5ENDA 3SZOA 1IHPA 1UF9A 4HS4A 2XTZA 5F9MA 3TGLA 4IRXA 4MGYR 2X13A 1A8IA 4O59O 4X60A 3IT2A 3L4BA 1AQYA 3T0IA 5KEIA 2F55A 3EWSA 3CURA 1H2HA 4GM1A 4LHSA 3K2EA 1XDUA 1T9KA 2CNWA 1WXGA 2BGNA 4HRVA 3M7IA 4RZSA 4UOZA 1XU4A 3MEQA 2FSVA 3GEPA 1J90A 1XVAA 3QBDA 5EIBD 4YWJA 2A9KA 5JARA 3F6BX 5AK3A 1KFEB 4H1VA 3EGDB 4TWIA 5SYNA 1X15A 2C3OA 3DBLA 4HTFB 2JEOA 4LYGA 1K6JA 2NVUB 2H11A 1Z7EA 1VJCA 1PS8A 3RKUA 1PRYA 1UFVA 4BFXA 1UP4A 1FRNA 2IDKA 1BD4A 2IGBA 2WMYA 4HQLA 2R6HA 4Q4AB 2JZCA 4Y2TA 4WXHA 2HIAA 2GPTA 4EELA 2O8BA 4LF5B 3LRPA 4IJKA 5JAHA 3P9XA 4NF2A 1FNNA 3CGWA 3I0NA 3IPAA 3LQYA 3SZRA 2HW8A 3OCUA 4MULA 2UYYA 1WP9A 3BXGA 5AW2A 1MDBA 1XTPA 4J0GA 4K9DA 2D06A 1VA4A 1O5IA 2J30A 4MP3A 4XX0A 3G8BA 1TVEA 1F8YA 2WA1A 4KLCA 2DHRA 4Q5IA 4B7XA 3TW0A 4RKYA 1G38A 1CRWG 1Y5IA 3HV0A 2DT8A 4RANA 4E5UA 1DTSA 1NXPA 1DWUA 1VJDA 1SXJB 4FVTA 1GZ3A 2HBQA 1K6MA 4WFQA 1E0KA 2Z5VA 3KU4A 3LHSA 3P0FA 3MELA 4HH0A 1OMOA 5JVDB 3UPDA 1Z7YA 3UMSA 5KSPA 2ONKA 3R5HA 3RREA 3IVCA 3M83A 3W9YA 3HCAA 4RD1A 2OO3A 5KMGB 5B1SA 2D1TA 3IS3A 2B8EA 4KQ1A 4N0DA 4E88A 5A1TA 2GA8A 3CRVA 1L5MA 1QCCA 2PBFA 6AT1A 1C5KA 5JCOC 1CUYA 2JJ1A 2OV8A 3QKUA 3PICA 4JC0A 1KVRA 4EMTA 2EU8A 3O93A 2QG6A 5IU6A 3TG2A 4D9GA 1JEYA 2AWOA 2CZCA 5GAJA 3ZXXA 4D0GA 2PQMA 3RCBA 3UYKA 2G04A 4H77A 2JIRA 5IT5A 2ZTSA 5C80A 2P2NA 1JDPA 4BDSA 1PLJA 3AHEA 1T3HA 4E1BA 2CFRA 3K09A 4BFZA 2O54A 4CCSA 1XRMA 2VJBA 4QREA 2O8FB 5E9WA 2V6GA 2EHJA 4K9SA 1C9JA 1E3QA 5THXA 2NQTA 1S0UA 4LZJA 3VSCA 3KOMA 5IVPA 4AJ2A 3EH2A 4UZEA 2LBPA 3BEOA 2GVNA 5ISMA 2ST1A 4C4SA 1W96A 4AD8A 1M8PA 2QIPA 2HSJA 4BUCA 3PJRA 1SCUB 1RYZA 1VGVA 1IZYA 4YONB 5DM2A 4TMVA 3H1EA 1LLFA 2D5LA 4EF4A 1SZPA 2FVYA 1NF9A 3VI3B 1KZGB 5ICFA 1XEAA 4HRXA 3ISVA 1S2GA 4NAVA 2C78A 2VCHA 3WK4A 4MVCA 3KQYA 2P2LA 4BTEA 1E6CA 4NG4A 4KO8A 3CG4A 4TKMA 3JD2A 3P71T 1WKBA 3B6MA 1WKVA 4AIIA 3GLHE 3EOZA 2FVXA 3GZTB 5K8LA 1GLGA 5CK5A 4G5XA 2NTYC 1Z6GA 4GLFA 1BVHA 2DVMA 4I6GA 3GB9A 1YFZA 4O4IF 3F5QA 2IPNA 3ZHUA 9ABPA 2ZRKA 2H1HA 3LCRA 3RUDA 3TD2A 2PZJA 4PVCA 5AVWA 4DQXA 2OXCA 3LDFA 2HPVA 3PENA 4GECA 5CX1A 2QMZA 1N5LA 2EDCA 1YGPA 3DWGA 3Q40A 1RWQA 2GBCA 5AKKA 1H1DA 4BKUA 2LW7A 1IZZA 1YBHA 5EJ9A 1WNFA 2W00A 4XR9A 1LC3A 1D2GA 4JJ8A 4JBXA 5U4XA 4ZAWA 3FBGA 4F93B 3LKBA 5KPDA 1REQA 1TM5E 4TYWA 5BXYA 1FX1A 4KE9A 4EJ2A 5FR2A 5KHOC 4MR7A 1X2BA 2VH5R 3FTDA 1D4ZA 2BZSA 1WTCA 2WTUA 4ARUA 1NF2A 1RLMA 1CEXA 5H59A 1VPTA 1FFXB 1U7WA 1EK1A 2BP7B 3BIWA 3L7JA 3OI7A 4ND4A 4LE1A 3M82A 5KCMA 3TW8A 3H83A 1TKCA 3JQ6A 4E15A 5K5EA 3NDIA 1T3SA 2TRSB 4R8KA 4XDYA 3MAJA 4F6RB 3KV3O 2WJJA 4BY9E 4MVJH 2ZBPA 1X1RA 2OTCA 3F46A 3OJCA 1BTOA 4KYIB 2C5BA 2Z56A 2RGYA 3FYHA 4QRHA 4ZWNA 3WMRA 4GP9A 1CY1A 5EWLB 3SY8A 3W5UA 2R62A 5DTEA 3THSA 3AF5A 4J9VA 4LUCA 4AQDA 5G0WA 1M83A 4MO2A 4Y1EA 1ST3A 1T36B 2P2SA 4IM7A 2EZUA 3F6SA 3PA8A 4FLEA 2QT1A 3LUJA 5E8JA 1IE3A 2H1IA 4WJZA 5BNZA 2H31A 3JQ8A 2NZ2A 4KL8S 4O1IA 5CPFA 2VF8A 5IJ9A 4QTUB 1CZHA 4LMRA 4KH1A 3ZV4A 2J7KA 1AXRA 5IULC 3VC1A 2I7XA 1FL9A 5TMDA 1T3TA 5BN3A 5JFGA 2L19A 4KMMA 3BWDD 3KS9A 1ENYA 1RC8A 1OTXA 1JHXA 1T0UA 3Q2IA 1E5DA 3BBPA 4NJEA 2H7CA 5JSUA 1ZD9A 1YFJA 3JQEA 4ZYVA 4DJJA 3OQBA 1XMXA 3TEFA 2QD1A 3C4QA 3OLVA 1G8PA 2RHMA 3IVMA 4NEGA 1YS7A 2CFSA 3HCNA 2EDAA 3IDQA 3O2SB 3EHDA 1IMOA 3R6WA 3I32A 4JEUA 4C2TA 5IM4F 4EI2A 4PBTA 2ZJ0A 1VYUA 2Q6VA 3PBKA 5AWFC 1YQTA 4ZO9A 4KXVA 4DNOA 3H16A 5HP4A 4S3MA 1OT3A 4X71A 3L49A 3QK7A 2FZ4A 4LTMA 5T5QA 3EWAA 4RHXA 4QASA 3AF2A 1POWA 1U98A 1Q3TA 2P78A 3U7FB 2VHUA 1ZI8A 1WA5A 2QTTA 2TS1A 2GSDA 5JNUA 2DPYA 4I1VA 2W2VA 1ABBA 4UU7A 5DLPA 2XD4A 5DB4A 3PT5A 2XE6A 5H5JA 1U1IA 3D6HA 3A4NA 3GGCA 1SC1A 1AO3A 2DC1A 3B7GA 3H5LA 4UVGA 3WNCA 3CIFA 2OCDA 2UZ1B 1YACA 5HCNA 1F2TB 2R1TA 5B53A 5IKEA 1KMNA 3Q7RA 2R8EA 1RHRA 1XRSB 2GAFA 3UUWA 4E09A 2HRBA 1JFFA 1UOQA 3OEHA 4AY4A 4TV9A 3H2JA 1ZN7A 2ZSHA 4CKBA 2O7SA 2XD9A 1TOAA 4N39A 2CXUA 4W8OA 5C31A 2QRGA 2P4EA 3BSWA 1B7GO 5F3WB 1HQKA 10MHA 2NO1A 3DV0A 2P5YA 3JWIA 4YMUA 3D3EA 3GJ4A 3OVMA 4IDQA 3ITKA 5H9WA 5LWQA 2DLCX 2YN2A 3FR8A 4IDAA 1G9SA 1ONBA 4UM7A 1J25A 2I3BA 1O0CA 2BRUC 4N5DA 3U4MA 4QFBA 1BMFA 1BHQ1 5HTKA 1PVVA 4JNCA 4P4LA 3RYIA 3RK0A 4F45A 3EGXB 4P2GA 2YCBA 4URYR 4WX2B 4ZFNA 4M7PA 3HNRA 4Y6GB 4CGZA 2RJOA 2XQKA 3WKCA 1VMIA 4EVSA 1XTJA 2YXBA 5CEEA 3DVQX 1D6SA 2C9DA 4RWEA 2J3EA 2GD1O 4EDFA 4ZOCA 2O6LA 5EHGA 2A5JA 3OESA 1R64A 2OSVA 3KLOA 2OHHA 4CKCB 5ITZB 2P6RA 1I30A 1EJ6A 1IJFA 2VPQA 4Q0MA 2P3SA 5HKLA 4TLCA 5TV2A 2P8SA 2QQ0A 1ADCA 1AA6A 2WT8A 3H7IA 4A2PA 2I2XB 3ESYA 3KSRA 5ED0A 2NU6A 4UHDA 4KQ2A 1KP9A 4CTNA 4CCAA 1CZRA 1FW8A 1DC3A 2Q5CA 3IQIX 5BUCA 4DNXA 2EATA 4LJYA 1T1SA 1GM5A 3PX7A 2XA9A 3C43A 5ALFA 5MHTA 4EH1A 1E69A 4NNOA 1XVLA 2FPGA 4J0DA 5A05A 4G23A 3S28A 3EDQA 4B47A 4FOLA 4EAAA 4JLNA 1LBQA 3UJCA 4Q3AA 1VMDA 2G72A 1WY7A 3V7YA 4D8YA 4EGFA 3U09A 5DI3B 3U3DA 1L7VC 1U2PA 1CB7A 2JGRA 3F2VA 4IDDA 4MV0A 4D44A 1WQ4A 4OIMA 5CG1A 3HSYA 2XOEA 1CR2A 4HDSB 5EXXA 2VPTA 1RIFA 2ZRQA 1JNXX 1M75A 1YULA 3U9LA 2V1UA 3IIKA 4YCLA 2H63A 3T5GA 1M66A 1V9LA 1MO4A 5K0TA 3GVCA 3RLIA 2E5LB 1I24A 1N77A 3A4TA 4MO9A 1CB0A 5ETJA 3UMCA 4Z2AA 3K71B 1DC8A 1PD1A 5DIZA 3I2KA 2ZIEA 4HH1A 4UDNA 1PSWA 2V4UA 2I6SA 1VIYA 3NTLA 3C3MA 3UCEA 4P31A 2COKA 5TGDA 4BMSA 5BRJA 2UZAA 4NX2A 4D57A 1EVJA 3U4CA 3IBYA 5CFPA 2A9OA 1V1RB 2BM0A 1P9LA 3G2MA 1BYIA 1YU6A 2CBGA 3KIPA 3KYBA 4Y7CA 3SLRA 2YHIB 4W6QA 1NY6A 1HDOA 2EG9A 3G9UA 3Q3JB 4G89A 5AT1A 5GIOE 3K1ZA 3GIDA 3O1JC 1ZSYA 4HFMA 4L4UA 5EXTA 1O95C 4WBNB 1DTWB 3LQFA 1VPVA 1ZO8A 3IIJA 3KKQA 4EABA 3KCQA 1YRLA 3D6AA 3M33A 1F1JA 1CV2A 1ZXBA 1U2RA 1PFUA 2I29A 3OJEA 2J5RA 3FXAA 3IYLW 4DCPA 1XBTA 2A7QA 4JUCA 3WL8A 3FX2A 3FTPA 4V39A 1UDCA 3WYFA 3DS8A 3GJSA 1BQEA 1GN9A 1JT9A 1NKSA 2OBBA 3WFJA 2J3HA 2OZPA 1RHMA 4UNSA 3QBJA 1I3OA 1W4LA 4FUQA 2GRAA 4BKRA 2Q3MA 4EA8A 4TTQA 1J0BA 1JWAB 3CG0A 2FP4B 3CSSA 4NDAA 4QAQA 4DLSA 4QXRA 2VCEA 3NS7A 2DFKB 3K8QA 1II0A 3KQWA 4ZYYA 5BNWA 4KNWA 4LECA 1QYDA 1URPA 3WMEA 4YRMA 4HWOA 1ZC3A 3R9XB 3A25A 2DBVO 2GCNA 4QPNA 2XYQA 4BXOB 4KV7A 4YRNA 2P62A 3B51X 4KQJA 4BO9A 2IHNA 4NABA 3RT1A 1X7ZB 2WJGA 3G13A 5T3YA 2JB9A 4KXFB 3TLZA 5B4VA 5FBQB 1C30B 2IU6A 3KQNA 4KFCA 3OZWA 5JMPA 4IXWA 1ZOSA 3BRSA 1FP1D 1QHIA 2GO1A 2Z4RA 4BKOA 1MRSA 1G8YA 4KAAA 3WLLA 3QYAA 2QEQA 3D3WA 4LF4B 3CCCA 1OGIA 2WFAA 4JR1A 1P2VA 2G1AA 3AJRA 3PU6A 1YCDA 3B9BA 1UUFA 4QWWA 1ZONA 3DOIA 4OM8A 3WIBA 2OCAA 3MGAA 2PJZA 5DO9A 3UWOA 3WAGA 1IBMB 2PCLA 4KIJA 1E9SA 2G67A 2WWTA 5ENZA 4OU5A 1XZBA 1ZH0A 2PWYA 3GLIA 1ZIPA 1N57A 3FYUA 3EF1A 2FEKA 4H6VA 4MJ3A 1UJMA 3EVBA 4ZD6A 5I9NA 1J06A 3SSOA 4G5YA 1CNMA 1J1ZA 1WZUA 2ZJAA 3HWSA 3JZFA 4B85A 5JD6A 5LZ4A 4UFNA 1COZA 4JFAA 2ZSFA 1IXZA 3JSXA 2LV8A 4NLLA 2F1OA 3JV7A 3ZYCA 4D2IA 4KDFA 1S9DA 2QVXX 3AUAA 3F1KA 3JYQA 1ML4A 2DFPA 2POCA 1RCTE 1LQ2A 4UFPA 5LQCA 1QIFA 2XYPA 4O4HB 1ZZEA 2OILA 5K2OA 2PH5A 2FE1A 3VNAA 2R4UA 4FKBA 2O3QA 1QHFA 3PTAA 1M2WA 4JP5A 3ZJ5A 4G37A 4BWVA 4P84A 1QF6A 4CQJA 1O7JA 3O3MB 1CY4A 2RHHA 1WDWB 2XTNA 1BVYF 4IJMA 3KBBA 4DMRA 2Q5IA 1PK7A 3JASB 4JP2A 4ZQBA 1VDMA 3V4OA 4B2PA 3K6SA 1IQPA 4KI0A 4C9BA 2HF9A 5E7QA 2JK0A 4K3UA 3T5BA 2AD5A 4P3PA 4Q7JB 3W2FA 4HDCA 4K9OA 4P35A 4B45A 3N8GA 3P2IA 3V1MA 4CL8A 2VHEA 3CY6A 1KEUA 2RAVA 4CM8B 2X0EA 3NG1A 2QRHA 2BGRA 4IIHA 4GC9A 1QOQB 2V6BA 2ZIVB 3NZEA 3ZDAA 2A9PA 1QRDA 3Q15C 3WL5A 3ZBQA 4JELA 5D1NA 3G2OA 1MIOB 2EFEB 3ASUA 3Q11A 4R1QA 1VBKA 3OJWA 4RTKA 3IKLA 4J3NA 2ZRCA 3OMLA 4JASB 4WN9A 4XI9A 4C4YA 1EQUA 5CFMA 1QH9A 3HJAA 4RLHA 4HT3B 1OA0A 4GVPA 5IPFA 3RWMB 5EWMB 4WZAA 4AZSA 2W43A 4OK3A 2OXEA 4X44A 2GCGA 2OV6A 3ITEA 3WWOA 5M3BA 4A16A 2PLAA 1LSOA 5A5FA 3T5PA 3AY3A 1HYQA 1I6MA 4B4UA 3SYNA 4D3YA 4G0PA 3Q3VA 3PNOA 2F3RA 4C7OA 3E4DA 4FYKA 5A62A 3U4QB 2ALJA 5HILA 4WESB 3W04A 3QMVA 4G0NA 821PA 1JSZA 1UK7A 5L7YA 3EXHC 4IPTA 5JOQA 1I1OA 1MX9A 4FFRA 3VKHA 3DMTC 4WNIA 2IXTA 3T1OA 4EHKA 3EVZA 4P22A 3TZ6A 5KU7A 2QROA 2GHRA 3D1VA 1AK2A 3EMBA 4BQQA 3D3NA 4NNPA 4GKAA 5COAA 4LV6A 1SIUA 5E3IA 2CV0A 1JSCA 2QNRA 3UAWA 2FW8A 2RAPA 2H5IA 3V97A 3MOIA 4CUKA 3M8KA 1W94A 2CXHA 2RHOA 4OHCA 1L6IA 4ROTA 1NM5C 3R3HA 1NW6A 2XSZA 1WUJS 2PU7A 3UMMA 5BR8B 3V1YA 2II6A 4KMSA 4OHUA 1KC3A 3PD0A 1H5QA 1NC3A 1V47A 3BXHA 4J07A 4RPHA 1SVSA 3HVIA 4HAXA 4Q16A 1ZIXA 3EMVA 3R2JA 5KTYA 2LUOA 1P61B 1T2UA 5EFZA 2WFZA 4CETA 1CYEA 2XB8A 3BUSA 4I1OA 1WPXA 4K6GA 2GR9A 2PGAA 3F9CA 2ID7A 1NT4A 3B89A 2Q1UA 1R0YA 4R69A 2LE0A 5EHIA 1O03A 4LWZA 1EFVA 4OX9B 2Y77A 3HLYA 2MYTA 4DV1B 3EVGA 1YL6A 3CO0S 3L1UA 4G0QA 2XQIA 4NWIA 4XVHA 4UW9A 1XRJA 5CBKA 1IC6A 2WTEA 4FXPA 4GUDA 4TL9A 1O89A 1R88A 3QEMB 5CEJA 1PGQA 4EJMA 2EZ9A 4IUCS 4OMFG 5TXGA 5BSRA 2QMUA 1L5OA 4K9NA 1QONA 4LE2A 3JZIA 4JJZA 2ZRDA 5L3SA 1EBUA 1L3IA 5CA1A 2H59A 3EXIB 1N8SA 3I0ZA 2CMHA 4EA6A 5ERGB 1H1LA 1RIIA 3SQMA 3I5UA 2BW0A 3K4HA 4P3XA 2NUAB 3TSZA 3KR2A 3T3DA 3KYIB 4NEQA 1QJCA 1U7OA 1UK6A 2A7XA 3SIWA 4A2CA 1X1SA 2X42A 1UKBA 3VZDA 3RYCB 3VGJA 3EULA 1XKLA 1ITZA 2FSPA 4NH4A 4RACA 2H5LA 3O5AA 1PGPA 1N5RA 2I1LA 1AXEA 5E3HA 3FVVA 3RUAA 3ZYZA 2VHWA 1UC8A 1VCNA 1UQUA 1BWPA 1ZHFA 2E87A 2POQX 3Q6MA 4K9KA 5HR5A 5AVUA 2N1MA 3LP5A 3OPQA 4UBKA 3WNBA 4PZUA 1YQQA 3D0QA 3HI6A 2RG1A 3OIFA 3PKIA 2A35A 4QGAA 3UMVA 2C7RA 2G7MC 3UJBA 3T9BA 5IT4A 4EQ6B 3B9QA 4DDUA 2A92A 3FB1A 1WDMA 3E05A 1YI0A 3UH0A 1DJPA 2WSLA 4MS3B 3QTTA 4GE3A 4MKIA 2R11A 3FF4A 3NKLA 4RF5A 3S8MA 4OHBA 3ZZ1A 1JEQB 2CL5A 3CWZA 5F7ZA 3I6BA 3LTNC 1U9JA 1WQ3A 1NX9A 3FMGA 4UEKA 3I9LA 2I6XA 2QLBA 5CLQA 2QL9A 1ZC4A 2VJNA 1CVLA 3SFVA 1KZHA 4ARAA 1L7RA 4GOOD 1B00A 5E1BA 4BCCA 5A6VA 5GONA 2IE0A 2P40A 3FWNA 3I64A 4ERNA 1LLUA 1A9OA 1Z83A 2DHEA 2VDUE 1U0BB 5E7IA 2XYRA 3GUYA 4RQUA 3QM1A 1ND6A 1YZFA 1NIJA 5JCOA 5EKUA 1K97A 4M87A 5F3DA 4PSUA 3UK7A 1CLEA 4H7DA 3QTBA 2CFIA 3DKKA 5B6IA 3P2YA 5ICCA 2YHSA 4LJ9A 3VO1A 3E23A 1Z6XA 3LWDA 4PLTA 2BJWA 4RCVA 1AO0A 4C5BA 4RJIA 4FIDA 4UVDA 1PU2A 4EEXA 1FUIA 1UXKA 3PWSA 2WDPA 2P2CA 3A37A 4M8IA 1V48A 3Q0EA 4J3JA 3DUFA 2B1IA 1N2HA 4Q9NA 3RIEA 2BN4A 1L7QA 2HX1A 3RJ9A 2FDCA 1G21E 4UUOA 1HI9A 3KJXA 2ORED 4LRXA 1U28A 2XMDA 3CN7A 4UJ3A 5SYAA 2XE4A 5CDFA 3OF3A 3K35A 4FSDA 4PPGA 1HK7A 3KSUA 1A4XA 3WLEA 5JY1A 1XDWA 1E1NA 1EFRD 3G17A 4A0SA 4DCMA 4D5EA 3LC7O 4WZBA 2O7RA 5DF1A 1GKUB 4BP8A 1YTUA 2QN7A 5BSTA 4GF5A 4IJWA 3MXOA 3A6LA 3OCCA 1Y6JA 1GP2A 2QSZA 2RC5A 2XV1A 4CLXA 3FHCB 2BGIA 2VJCA 5B3KA 3CRNA 1JT2A 3BMNA 2AR9A 3E7WA 3QJYA 4AWAA 1WUKS 5FNVA 4JXXA 3IMKA 3A9VA 4M0KA 5FQNA 4AJEA 1U0HC 1KZ1A 3QJGA 4KIWA 1K3FA 2QN1A 3RAPR 3CXUA 1UFRA 3E9MA 3JY6A 3LO8A 3V1KA 3TM4A 1W5TA 2O7VA 1L7BA 4BWFB 5JAOA 4GRAA 1DZ3A 2W8BA 1II8A 2WF6A 4MUBA 3OTOB 5IM5A 4N47A 3VHXB 4MVWA 3D7SA 3T7RA 2OCKA 2C2BA 2FEXA 3BHMA 1XD2B 1I1HA 3CLVA 4RPKA 4CQLA 3CEAA 4Q7EA 4CKEB 3AO0B 3HHEA 4HQKA 1NL3A 2CHFA 1ACMA 1HLGA 3O83A 2A1IA 4GSYA 4DF3A 2H2AA 4FC7A 4RVCA 1I0ZA 3RC3A 2ZJOA 1T5BA 3ACDA 4MUAA 1XHEA 2V65A 4IOMA 4I3GA 1JDNA 2M2IA 3DXXA 2OAP1 4R7ZA 4EB3A 3JQGA 1AKEA 5TEWA 1M2VA 5LA6F 3PGVA 5TF4A 2PZBA 4C76A 2F59A 4UATA 2C5GA 8ADHA 4RHEA 1E2UA 1D4OA 1YAJA 3WRYA 4GIBA 1DBPA 2XE7A 3T3PB 1G8AA 2V98A 4Y2VA 5BMOA 3SVZA 3LDGA 1N75A 4CM5A 3H3XA 5E2IA 4Q3EA 2Q4EA 1RWPA 1RAFA 5F12A 1P0CA 4F4JA 4US0R 3E6AA 1YJXA 3KPWA 4AN1A 3BWXA 4U0KA 4ZZ3A 4E03A 1UXIA 3FOBA 3EFOB 3M5WA 4DJTA 4E1VA 4F3YA 3HWRA 3LX6A 1GUBA 2WF8A 2YZGA 1KI9A 2X5JO 3G7SA 4NBUA 4OQFA 2Y1GA 2C9MA 4RH0A 4ZO7A 5H8WA 3IA7A 1NF3A 4MWDA 1ANKA 1NYTA 1M6VB 2R6R1 2X1MA 3CEPB 3JARA 4U7GA 3T3MB 3TRFA 2YIDA 4Q1FA 4X20A 2AG1A 3M6IA 4P3NA 1EDDA 1ZVJA 3T94A 4QDJA 2CK3A 1YV9A 4EHJA 2GPBA 4HN9A 2CHQA 2EX0A 2FNAA 2PLWA 2M1XA 1EEHA 3IOEA 3LK7A 2VDQB 4X7MA 4RH3A 3DQPA 2Z8YM 3A2MA 1ESNA 4UZFA 1Z4KA 2ZDGA 3DDNA 3WHIA 3KKNA 3LUCA 4E33A 4TTVA 1RVDA 1O96A 3K9GA 1TXGA 2Q3HA 1UODA 2JAOA 3K9NA 5FTLA 1TTPB 3TZLA 3C85A 5HGXA 3LUHA 3PQ3A 4BMOB 3TLMA 1AV7A 3KBOA 1K7YA 2GASA 2XJ4A 3L0YA 3ZDXB 2QBYB 1Q2UA 3VR1A 1OLUB 2Z58A 3B8EA 3FA2A 5DBOA 2NP6A 4RETA 4HB4A 3A0RB 1CNFA 5FFMA 3NM5A 1BZYA 1WQ1R 4ZVVA 4ZGGA 3MJTA 2NTNA 1K66A 2BD0A 3FKSD 3WOVA 1APBA 4BV2A 3X1JA 3W5BA 1AQNA 2EW8A 2P9EA 4BX0A 3QOXA 4HEHA 4MW2A 1JV2B 4D0RA 4XPIA 1IL0A 4OQXA 4UNIA 3CC8A 3TTWA 3G79A 3AIOA 1SIBE 5DP2A 1I3LA 5F7XA 1G9TA 1D2HA 4QPJC 4JJFA 4RABA 4TSFA 4MQEB 4R7GA 3N2ZB 3PNKA 2XYVA 1T1GA 3SS7X 3IAS1 1SURA 1S3IA 2BRUA 1JZQA 1GZ7A 5EJAA 5IH7A 3ZZMA 1OC4A 2WFLB 5AIBA 1TYZA 1R0SA 1DPGA 2CMGA 3QUSA 4PCAA 1R66A 2HSEA 4NCJA 1J8VA 2OFWA 4HWSA 4M49A 1KO8A 4NEHB 3ADBA 3WXMA 3W4JA 1BHO1 5FYQA 5CU7A 4ZJZA 1XX6A 2F3SA 1SHUX 2HSGA 2V8OA 1N5JA 3HB9A 3I01M 4NMLA 4QXOA 3T0GA 4BO4A 4H17A 5DX8A 2C9YA 5KJ6A 4O2AB 2BMFA 2HKIA 5IXSA 3F6CA 5KOHB 1PR3A 5F73A 1NBIA 4PTYA 4ZA2A 2XAAA 4MRAA 1E18A 2XMQA 1QXSA 4IDEA 1CVRA 3QEAZ 2WJZB 1PKXA 3JQ7B 4XYMA 2BBOA 3CA8A 5HJ2A 3ZQ6A 4FKMA 2EGHA 3OZ7A 3OUUA 4QFMA 3ZU4A 2DE0X 2DTXA 2GLUA 2B0JA 3QF7A 3RODA 2NYUA 3EJ6A 4MDYA 5B3LA 4LZNA 4HLDA 1QGDA 4TMYA 5HXAA 1SU8A 1QU3A 2W98A 1GCGA 5HA5A 4N5HX 1Z15A 2G5GX 4WKBA 3IPCA 3K94A 4Q1DA 1HPLA 2HQ1A 2VUSA 3WGMA 1X1AA 5BVGB 1N5IA 1XPJA 1I6LA 2QXUA 3BL8A 1N0IA 4FFSA 2ZJ1A 4Q3DA 5TT1A 1JIKA 3LBHA 1V6SA 4NZZA 3F71A 1JLRA 3UJDA 5AVRA 4ZCMA 1OZAA 5LQJA 1Q1BA 4F38A 3GLFA 2XZLA 4Z0PA 3AFGA 3GP8A 2JJ1D 2R6AA 4WK2B 2CZQA 3SDBA 3MRSA 3WGYA 3QFSA 4KGDA 1IBCA 1HH4A 1X9IA 1PK8A 3RSFA 2EHDA 4BMNA 3IUMA 1L5GB 1YI8A 2CVQA 3MA0A 3I52A 4G1EB 2MINB 4O4JB 1HG1A 4A03A 2PL9A 5F2OA 3EQ6A 5IBRA 2XDQB 4AU1A 3I28A 2PSDA 1FC0A 3GFQA 2QI9F 4TRJA 3T3OA 2X2EA 3KR9A 5KQMA 1DG1G 4ZI3A 1ZH4A 3BQMB 3AI1A 1KF0A 3EN0A 1IUNA 1O77A 4IDHA 1QV6A 2IZOA 1FFEA 1ONNA 3HNPA 4HYEA 4LEIA 1GSOA 5B30A 2V7XA 5GINE 2AOTA 2Z98A 3CLRD 2ON6A 4RTLA 5C8YB 4E7OA 2NO7A 1N9GA 3IQWA 1PG0A 1KQ3A 3L7CA 1WZCA 2EBWA 2A30A 3JVUA 2H0RA 3N86A 3THRA 4BNYA 3WK5A 5BMVF 3P97A 3BT7A 3MTQA 3A2NA 4DM3A 1YKFA 4JQOA 13PKA 1CQIB 3MOGA 1KSFX 3IP7A 1DAHA 5AI5A 3CONA 3UMJA 4L6IA 4F72A 1HOTA 5AW7A 2V54A 1LFDB 5GJCA 2FMXA 2Z2KA 3TI9A 3JD4A 4F46A 2B9VA 3UUFA 2PUDA 3NEPX 4EK9A 4RH1A 1HDZA 4B84A 4GAEA 3I5YA 1C1YA 1TMYA 1VRCA 3Q3EA 4GLLA 4ZZIA 5KX5B 1QRAA 2GF2A 3VKFA 4RV5A 2LD4A 3MWLA 3U3MA 1QNFA 3BAZA 1DAKA 4M7OA 1OR8A 4OAOA 2XH8A 2W83A 2CHVA 3MTAA 4Y0AA 4D5GA 4OHZA 1N0HA 4AG5A 5B1EA 1XWWA 5KAPA 2Q3BA 5HM8A 3AVOA 1R4MA 4GPD1 2H08A 3BK1A 4KFUA 3E9QA 1F48A 1HE5A 2GETA 2WNIA 3PKZA 1RRVA 2B21A 2HTFA 1EDBA 1PX2A 3ZIDA 2Y1WA 1FJHA 2A33A 2CXOA 5K0SA 2HOQA 1J8QA 4KWCA 1XFDA 3S99A 4DA0A 4R83A 3C48A 1XO1A 5LB4A 1C9YA 2X7HA 2QY9A 2WJYA 3NWJA 3ZV5A 4P7JA 4DTIA 4BNXA 3KFVA 4MITA 2DQ4A 5CA0A 4ZI7F 4RY8A 3NNSA 2YYSA 1G20A 1L5VA 2IOFA 2KS6A 2QTNA 3DAGA 3EEQA 2VXCA 2IC5A 2E9SA 3MJSA 5TPWA 1X7DA 3EEOA 1R6TA 1WUHS 2FPIB 2OFOA 3N75A 4XLZA 2CNOA 4GPZA 1T1EA 4B0PA 3AHCA 1QFZA 3NGLA 4Y6RA 3BE4A 2QVCA 1XMIA 1Y1QA 1ZLXA 2ENUA 2IEGA 3HJGA 4PYMA 3RUPA 3LO5A 1R8QA 2PUHA 2XWJI 4DV3B 5AK4A 1JX6A 4YJ3A 1TO2E 1MA0A 1NVMB 3WJ1A 2V5AA 1D03A 4Q18A 3UT6A 4J16C 2NZUG 3I0MA 4KMOA 1HNNA 4N54A 1WLSA 3KHKA 3OM1A 3KCNA 1GYRA 5I4IA 3PQFA 4DLLA 2I2FA 1Q84A 3E3LA 2UUPA 5KU1A 3P19A 1HE2A 3GHHA 1QB7A 2C2KA 2EFHB 3JRWA 3I1JA 3LW8A 3PPIA 5JDCC 4CR7A 4W5WA 3OZSA 2YRFA 4JLWA 4H1UA 1TYBE 3KAQA 1ISJA 3AQIA 2MR6A 4ND2A 4GDFA 4WW0A 4UXIA 5DCWA 1ML3A 1M1YA 3PR3A 2WQ7A 4P7BA 3EISA 3PGJA 1BG6A 2C0CA 2H06A 4JK3A 3ZUGA 4LZZA 1JSLA 4EF6A 4ZYXA 2ZT7A 2NSYA 1QZ3A 4GLOA 4PZ9A 1OAOA 3L6DA 2UYGA 4AZTA 2BBSA 3CX3A 2XADA 3DAOA 5IZCC 2Z83A 2W48A 1ZCAA 1XF1A 2JCSA 3A6JA 2E37A 5AHWA 2J7PA 3RVKA 5F77A 5IRCD 2ZVDA 3ELBA 4A2QA 3HKEB 3FBWA 3G85A 4F2WA 1EM8A 1MQAA 3CH7A 5JXHA 1Z25A 4KZKA 3LPNA 4ZVSA 1F9EA 3F8TA 4JXKA 4Z9XA 4WXYB 2AOVA 4HNGA 3LC0A 1XZAA 1U65A 3OEHD 1NAIA 3AHGA 2AUTA 3SI7A 3TAHA 4CMIB 5ILGA 4CIWA 1G8SA 5LQDA 3C7CB 4I81A 3GAFA 4V0QA 3IELA 1UJCA 2AYXA 2W6NA 2HHCA 2QLTA 2C77A 4TROA 3D3QA 3KFXA 4UEOA 5ECYA 1N4AA 1NQ5A 3BJIC 3OC6A 4BX3A 3EXHA 3WLSA 1JS1X 1MBZA 3ANSA 2X0JA 1GT6A 2X7XA 3DKIA 1C3OB 1NXQA 3DMTA 4URHA 4H3KB 5J43A 1OWNA 2PJRA 2IYFA 3V32A 3F9IA 4YPVA 1HX7A 2P6UA 1RQGA 3UA3A 3KUUA 1CZUA 5HHTA 4KN8A 3I1FA 1C2YA 1T29A 3WADA 2YJ4A 4B17A 3CE6A 3WL7A 4L2IB 3RM3A 4ZVRA 3ZHZA 3DB1A 3OEWA 1NM5A 1ZM2A 1ZN2A 1CUDA 1PJ2A 1BGXT 1RKUA 2RGUA 3G82C 3INNA 3TLGB 5CVTA 1RHQA 4O3MA 4YUZA 4WASA 4V0NA 5K3AA 2VQDA 5G0TA 4MH0R 4CF3A 1QE0A 3WGJA 3GZNA 1OZHA 1PS9A 3GAAA 2CMFA 2XOKD 3BB4A 3AEUB 3DYIA 2IS1A 1WV0A 3BA6A 3E4CA 3U56A 2RGDA 3ZHSA 1OJ7A 3BWMA 3O26A 3O1HB 4XIJA 5CYOA 2HJ9A 2X8AA 3OPYB 1FXWF 4RMHA 3SXUB 1NV9A 5JCPA 1XP8A 2HJSA 2WLTA 4HDNB 1TUBB 4J4BA 4HNSA 3NP7A 3O38A 4AMUA 5AI9A 5CGZA 2PD3A 5B1DA 4JEHA 5AW8A 5IWCA 3IFSA 1U9ZA 2C04A 1GTRA 3T7JA 4OHPA 3K70B 5CNMA 4PLGA 4L8WB 1R5NA 3EGEA 3KXDA 3PFKA 3FTNA 4HUQB 4PZEA 4RA6A 4KNVA 3DNMA 1A8PA 1GNVA 4LRTB 5AM2A 3PD7A 1NULA 3NKVA 4IEEA 4FYVA 1RBMA 3S55A 3I9KA 1DTEA 1W48A 2VYVD 3R1IA 4MRMB 4MNTA 1MH1A 4WK6A 2AW3A 4ASUD 1W46A 1I0IA 2QV7A 1BFUA 2WPDD 2Y71A 4KEAA 4AJLA 2VYFA 4JLDA 2IITA 3K0FB 1JL3A 3OLYA 2VJDA 4S1WA 4CQMD 1UANA 4JOQA 1IM5A 4Z4CA 2VYNA 1OWPA 3G3EA 4RPCA 1T6ZA 2YJ6A 3FMPB 4RD2A 4MVXA 4H1WA 1L2TA 1QOPB 2PGXA 1WXXA 2C07A 1Z63A 1OJLA 2GPAA 4CHTA 4X8HA 3LJKA 3MWKA 3A1CA 3ZCVA 4R8SA 5COBA 1RLJA 1Z5UA 3DZBA 1XRQA 4MB2A 2V4MA 3D4BA 3HDGA 5EIAA 3HUUA 1CJMA 3E82A 1P1IA 3W8RA 1BYUA 3LCCA 1XI2A 2VSYA 1S8OA 3QOFA 2J4CA 1VSQA 4EMUA 1XU9A 2AMFA 3NT5A 5HCIA 2ZGVA 1RT9A 2WT4A 3DPSA 5IDWA 3ZKAA 4U6QA 3O3CA 4NFSA 1RJFA 2D0IA 4P5DA 4R2WA 3SE0A 3G8CA 4G85A 1O0SA 2AHRA 2ZBGA 2OOKA 1EH5A 4JDUA 2DR2A 4JLUA 2C5EA 2XKAA 1DNPA 2G09A 3ELUA 3GLTA 3AV3A 3O8OA 1D2NA 1DG9A 3FAZA 1PZHA 3NEYA 3I9V6 4WLOA 2WKWA 3KB2A 3KKZA 4QQRA 4EMSA 2B61A 4M2LA 3ZWNA 5B4TA 3OOHA 3SM3A 1BA3A 1JZTA 3MTIA 3TOZA 2R1UA 4C4OA 2VN8A 3GJ8A 1U6JA 5LZ9A 4DGQA 4KJXA 4CTOA 3A4VA 2DWCA 1IUPA 1LLQA 1RC0A 1Y4ZA 4OKIA 4G0UA 4GI1A 4MQFB 221PA 4MAMA 1DO2A 1ZD5A 4HLQB 2V59A 3T99A 4F96A 1UM8A 4BNGA 1M73E 1MB2A 1UWCA 2AN5A 2GM3A 4EY7A 1JFLA 2J6CA 3U44B 4WXRA 2OGZA 4ARZB 1KERA 4EUNA 1O6BA 4PQRA 5THKA 2GPNA 1DT3A 1GR1A 4HGYA 2CV2A 4K40A 3HACA 2ZQ5A 4FSXA 4QJ5A 1JA0A 1WM1A 4N7RA 1B6TA 3FLEA 2AS0A 2G1JA 1EFHA 1QP0A 2HEGA 2R8OA 3HKCB 3ZTTA 2ZB2A 1CJBA 3KWMA 3L01A 4ZI5A 3HCPA 4DSTA 1J0XO 1BFDA 1RJ9A 1XTUA 2IEYA 4Q37A 2D2XA 2PLNA 3GDGA 2YXLA 3M6MD 4FW9A 9GPBA 3IBFA 5DSTA 4HWRA 4V3BA 3V4ZA 3MCUA 2JIMA 2ZTVA 1GUFA 3U5TA 1K06A 3GFBA 3PIRA 2J3KA 1CLUA 4L4SA 2HLPA 5FFNA 5GGXA 1MG0A 2GK6A 3GLHB 1ZRHA 4L22A 1E96A 1YZ3A 3M4NA 4KE6A 5GPBA 3EIHA 1GPDG 2C98A 5EUBA 4BWYA 2ZBVA 2UV8A 4EJFA 3EZNA 1TDJA 3AV0B 3CNOA 4C4XA 2YHBA 2I2BA 3GFGA 3SGLA 3WGHA 4WCFC 1HV8A 1RS0A 1C1DA 2D74A 5BN5B 5A4JA 4KIGA 4ZCRA 5JAMA 3V5NA 1BU8A 3L9XA 4DMCA 3VTFA 3WOHA 1CUZA 1MTZA 1VHQA 4IDCA 1YS2X 4BRSA 2HM7A 3Q3HA 2CJYA 2F3PA 1UEXC 3OCZA 1N0WA 3ZWCA 3KO8A 5JSHA 5FAKA 2VSOA 5J40A 2QXTA 5JU6A 5KDLA 2HPHA 4LDPA 1VE1A 1U8FO 2C2ZA 4O4LF 1MX5A 4TKLA 1GN8A 2Q27A 1KEKA 2IYOA 3H9BA 4XVUA 1JH8A 5T4BA 5FTWA 4UUQA 1P4JA 3VR4D 4RIFA 4X6YA 3KB1A 3BZWA 3W79A 3O4FA 4ML3A 1DBIA 2PO7A 2G0TA 4LDZA 1QUEA 4EF5A 1U4NA 3VU1A 3BH7A 3EDCA 2HFKA 4ZV4A 2AJCA 2YYYA 5EZ5A 3VAZA 3BRWA 4W9RA 5A3VA 3RRZA 4AF7A 3BIFA 1V6CA 2G9ZA 3CB2A 4IMIB 3EG9B 4MEBA 5K0FA 1RKXA 4A2WA 4RK4A 4I50F 5HM6A 3VO2A 1QHHA 3IA2A 5JJBA 4AY5A 3T1YB 4AFNA 1A69A 2CBZA 3Q2KA 4CIBA 1YQ9A 2VPWA 4K26A 3PEYA 1DBVO 3UAZA 4YV1A 3WGOA 2AG5A 1RWVA 2O5CA 4OEHA 4PFJA 1ECCA 1HNXB 3UW3A 4RWZA 1FVFA 2BONA 1IIBA 3IP8A 4G24A 3EFBA 2VF4X 3P9KA 5F7OA 5JJIA 4FOPA 5F35A 5JHGB 1V1JA 1NXSA 2GXAA 1AUXA 3FF1A 1KBOA 1PBTA 3U49A 2DSTA 2E6KA 3KYDA 4Y6OA 1HDRA 2ZYWX 1IEWA 5A7GA 3PS9A 4EFLA 4MW0A 4K03A 3ME5A 5L3QB 4HH4A 3CVXA 1T8PA 3DLHA 2E0IA 3D4OA 3PNLA 3J81k 3T61A 3IUYA 1TCUA 3MFYA 1J7KA 1LF5A 4PSCA 3GJ0A 1TU4A 2O2HA 1NNSA 3BRCA 1KGDA 3LPLA 4J76A 3SZMA 3ZE2B 421PA 5JC8A 1OB5A 5KNBA 1XMOB 1TF2A 4IH4A 2X19A 1XZDA 3TB6A 3W3ZB 5CFOA 4MUNA 3CPEA 1FE8A 1X86B 2XXJA 4WRRA 3QPBA 3I1IA 4WA8A 1XZFA 3T7CA 3W8EA 1ESCA 4TVSA 1Z75A 2WKPA 1S2MA 3HJCA 1XF9A 5H3CA 1LLCA 5K6TA 1QOZA 3Q5DA 5AW5A 1NNLA 2JLCA 3AU8A 2OP0A 1N1MA 1Y4DE 2DBQA 2C00A 5KWSA 1T5SA 2C9BA 3GPIA 2XMGA 4UAGA 3EZ2A 4Y0VA 3IEKA 3LI2A 4MV4A 3CRMA 5IYZB