2O23A

The structure of wild-type human hadh2 (17beta-hydroxysteroid dehydrogenase type 10) bound to nad+ at 1.2 a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
248
Chain Sequence
RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQPGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of wild-type human HADH2 (17beta-hydroxysteroid dehydrogenase type 10) bound to NAD+ at 1.2 A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HADH2 protein
total genus 91
structure length 248
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o23A00
4DIBA 1BXGB 5MDHA 1DRWA 3TF5A 2O50A 3GPDG 3GT0A 4EUFA 4ALLA 4HBGA 1BDMA 4YJGA 1P45A 4PZCA 3HUDA 4B4OA 5DP1A 5T8KA 2JD0A 5TF4A 4EJ6A 1TT5B 1ULUA 2UV8A 2GERA 2J3HA 3ICCA 1BSVA 4RLHA 4XZ3A 5TSDA 3RQSA 3WGOA 4DBZA 1ZCJA 2R6JA 4DLLA 3HG7A 5IDXA 2ZB3A 4EBFA 5COBA 3D3WA 2AMFA 1NPDA 2DUUA 3JQ8B 1NP3A 4PLWA 4UVEA 1MXHA 3RC2A 3FNFA 1IY8A 2G17A 2VUTA 4D45A 4MIOA 4YDRA 2YHIA 1U4OA 1VE9A 4Z3KA 3ROKA 1DHTA 4BNTA 1QV6A 1Z7EA 1R15A 1BG6A 4BNNA 3SC6A 4IJUA 2DBRA 2Q4EA 1YBAA 3QIVA 4QQRA 2I76A 1S7CA 5JAMA 1MC5A 1YDWA 2AQKA 2ZATA 3ASUA 4RVSA 4CM4B 4H3VA 2EIHA 1Q1NA 4K6FA 1PQPA 4MVJA 5EL0A 3HNPA 1NAHA 1DFHA 3IMFA 3NGXA 4PVCA 5JPIA 4MP8A 3F46A 2ZYAA 4JBGA 2EXXA 2IXBA 2C54A 1ZW1A 1P3DA 2WYWA 4A26A 4BNLA 4YB8A 1ZMTA 3ZNOA 2EW2A 4RVFA 4YAJA 4W6ZA 3HB5X 1B8UA 3LSYA 3H4VA 1PR9A 4JBIA 3G3EA 3RI3A 3TN7A 4C7KA 5CPFA 4YAKA 3IJRA 1GZ3A 5H82A 1R4NB 4RF3A 2GN6A 1ADGA 1DIHA 4HUJA 1TLTA 3S55A 1PJLA 3ZDFA 4OL9A 2WE7A 3ZW8A 3OEWA 1SB8A 3A4VA 4KTVE 4OGWA 1GTMA 1M2WA 4K6CA 1IHYA 4BO9A 5IXSA 1YL7A 2QX7A 2CDBA 4HX5A 5ER9A 5JBIA 4TRMA 3RKUA 5I9NA 3WDSA 1SB9A 3S8MA 2CZCA 2ZCUA 1HDZA 5ILOA 4MINA 2OBYA 2VWQA 1ENOA 3T4EA 1T2CA 4CL8A 4Q3CA 4EI2A 1LNQA 4LCJA 3BHMA 4ALMA 3U4HA 2NNLD 3BTOA 3CUKA 1YL6A 3KM0A 1D8AA 5G0TA 5CAEA 2VN8A 4WCFA 4Z0TA 1VJTA 1ISFA 2P2SA 5L7WA 4R41A 2EGGA 1XWFA 3W4KA 3WBBA 1QYVA 3MEQA 5JYDA 3QQPA 3VVCA 1HE2A 3GFBA 1YRLA 1KEVA 1YQGA 3AU8A 1KEPA 1ZXLA 4OXYA 5K0ZA 4AJEA 5I7SA 1EK6A 3C24A 3GOHA 4FN4A 4W7HA 4J1TA 1Z74A 2FSVA 4XJSA 1W73A 1ZBQA 2Y1FA 3WLFA 2XAAA 2RHCA 2D1YA 2Q1UA 2HMUA 3QHAA 2VOJA 5H81A 1E1LA 3B1KA 1SBYA 5L51A 4ZQGA 5DF1A 3RUCA 4J7UA 4J4HA 1YB1A 3GK3A 1R66A 4DMMA 4MVJP 4DUPA 2GCGA 3VPHA 4BO5A 5FEUA 4YBZA 2YFHA 5TIIA 4RV9A 4BGUA 4R16A 4NJMA 1I32A 1U2DA 3DZGA 2H1SA 2RIRA 1BXGA 3RUFA 5EQFA 3U9LA 5IAAA 4FIZA 3PHGA 1IYZA 2P5YA 2P9EA 4QO7A 1HTBA 3A06A 4NHEA 1WAMA 4OO3A 3I1JA 3VOSA 1HDCA 1OAAA 5G0WA 4CM5A 1E7RA 1TT5A 4JJFA 1EBUA 2Q1SA 3AY3A 3KTDA 2Y1EA 4KOAA 2ZIZA 4U8GA 3WGGA 1A5ZA 1YJ8A 3NTRA 1YQXA 4CMJA 1RJWA 2O3RA 3WWZA 4E30A 3WIDA 4P4LA 3MWDB 4EYEA 4LISA 3QWFA 4W99A 2C2YA 2RAFA 4ALKA 3GN2A 2Q1TA 4J9VA 2ZJ1A 4IGFA 4AJ1A 5JAQA 1B7GO 1WP4A 3ON5A 7ADHA 1YWGO 2YW9A 3PQFA 4XR4A 3RD5A 4Y98A 4D3SA 1JAYA 1FJHA 2C2XA 1Y9AA 2VRBA 3U49A 3C7DB 4BNIA 5F1KA 3H9JA 3L07A 2ILTA 1HETA 3F4BA 5ILGA 3B6ZA 3H7AA 4ZJUA 4AG3A 4XGKA 5JE8A 5A04A 4Q3DA 3DFZA 3CPSA 1C0LA 1IPEA 1U1IA 5GY7A 3ZWOA 5I8ZA 4YAIA 1T24A 1Y8QB 4WLFA 5L4LA 1F06A 2Y0CA 4DTIA 5BR7A 1L7DA 2HMVA 5JY1A 2JFHA 2VQ3A 3VZSA 1PU2A 5CP8A 2A92A 4JP3A 3WYCA 3WTCA 3M6IA 1ADCA 3Q9NA 2CF6A 2HUNA 4Y6RA 3LLVA 3KYBA 2PTGA 3KSUA 1ZSYA 3PK0A 1LRKA 3GR6A 3RFVA 2XPCA 1XHLA 3GEGA 3DZBA 5A9RA 3ENKA 4XIYA 3ITDA 2ZQZA 2POQX 4UREA 2EP5A 3DMTA 1UXJA 3GH3A 4YPOA 1IL0A 1WZEA 4Z9XA 4O63O 4LVUA 4QTZA 4RLSA 4ZA2A 3LK7A 1SO8A 1ZK2A 4DLBA 1H5QA 2CNBA 1PX0A 2O4CA 8ADHA 3LU1A 2EKPA 3GMDA 1GZ4A 2XXBA 2Q1WA 4RDHA 3K8ZA 3WMWA 3DO5A 1GCUA 5JS6A 1PJTA 4E5PA 1YOVB 2HJRA 3JQFA 3BA1A 4NFHA 3SVTA 4U0KA 1PS9A 2B35A 1QXSA 2VHXA 4ZRMA 4LRTB 2GDZA 5EN4A 2X5KO 3H9UA 1N2SA 1CERA 4IDAA 4CLXA 2RHRA 3E1KA 4MPDA 4HXYA 3RFTA 3RSHA 4IDDA 4YRBA 1PS0A 1PJBA 4B3IA 2E6UX 3JQBA 4WK6A 3WG9A 1BW9A 1X0VA 1DSSG 1T2DA 3BYZA 3Q2KA 1YVEI 2XF8A 1KY4A 3EYWA 4BNMA 4TSKA 4EITA 1YKFA 3C1AA 4BGEA 1DB3A 4MO2A 3BAZA 5T6BA 3PWKA 2ZCVA 3K6JA 5EJ2A 1XCBA 1A4IA 3OFSA 3PDJA 3QA9A 4GVXA 3VDRA 2ZB8A 4G2NA 2O3JA 4IS2A 2JL1A 5JO0A 2NM0A 5G0SA 3TNLA 4DQXA 3RU7A 1KVQA 1K6IA 1WW8A 1LDMA 2WTBA 4J7CA 2P4QA 3NKLA 1JDJA 3F5SA 5KVSA 4RGBA 5FFFA 3W4JA 4MIYA 2V6BA 1EUCA 4RVDA 3VH2A 3NAQA 3OETA 3ITKA 4ZQEA 5CPBA 1GY8A 4TRNA 2VHWA 3NDJA 4MJLA 3IP3A 3RC1A 4BUCA 1ISGA 5C5IA 4AJIA 2Q99A 4CMEC 1MGOA 3ICPA 5JSFA 1YONA 3K9QO 4YQZA 5TQVA 4ZHSA 3DEYX 4CMIA 4AJJA 4WCFC 4XA8A 3GY0A 1DIAA 2RH8A 3OQ1A 1ZSVA 1XYGA 4FW8A 4MKXA 3M1AA 5EERA 5JCJA 1DRUA 4MOWA 3OQBA 5BNFA 3ZNPA 1JU9A 1A9ZA 1E1MA 2EW8A 1XU7A 2YV2A 3QVOA 4IIUA 1J49A 3IQDB 4TVOA 2BKAA 2EF1A 3RU9A 3KHUA 4CODB 1NQOA 3KSZO 5ICMA 4NPCA 3PXXA 2O3UA 3K31A 4BV8A 1PWXA 3BMNA 3K2BA 1P44A 2BFMA 3GGGA 3ZV6A 2GSDA 3ZN2A 1KVSA 1QKIA 3X2EA 2X0RA 1QRRA 5DOZA 1NFRA 3K96A 3MJTA 5BNTA 1Y8QA 5CDTA 3P19A 2G76A 3GZNA 3Q11A 4NU5A 3JYPA 4UEKA 3DB2A 4CUKA 2OL4A 3V2UA 1I10A 2Y0EA 1J5PA 4E32A 1R4MA 5KVQA 4P38A 3MJ4A 4S1VA 1V3TA 3ZW9A 1W4ZA 4BO7A 1UR5A 3L6OO 2ZTUA 5TJHA 4NZ9A 2Q2VA 1TVEA 1DIRA 2FHSA 2Y66A 1PQUA 4KUGA 4IJVA 2AXQA 4U5QA 3GHYA 4LMRA 3ABIA 4GMGA 4XDZA 4ZQBA 1NXQA 1P74A 2BGMA 4YQYA 1T2AA 3WS7A 1ZK3A 4E33A 1NR1A 3OMLA 2HRZA 1WDKA 1E5QA 2WDZA 3DMYA 3DWFA 4HY3A 2JAPA 1XA0A 5ITWA 2I65A 5C3MA 1QG6A 4LRSB 3DAPA 2J3JA 3FR8A 5H83A 5AOVA 4D44A 2B83A 2IZZA 2BH9A 4DPMA 4CQLB 3A14A 1NX6A 3UGKA 1PGOA 3CMMA 1D3AA 5B12A 2HDHA 4TRJA 1PEDA 1GPJA 4NBTA 1AGNA 4R1SA 3ZU4A 3ZCXA 3WQQA 4IM7A 3PPIA 5G4KB 1DPGA 1OZAA 1EE2A 2ZB4A 5JAZA 2FPPA 4GI2A 1AHIA 1BW9B 1KVTA 5HWSA 1LDYA 2CVZA 3IUSA 1KEUA 1ZK4A 2OP1A 5G2OA 1LRLA 3TRIA 3TSCA 1NNUA 1KY5A 3D4OA 3GG2A 2O3TA 1B3BA 2OMEA 4U6QA 1DLIA 3MOIA 5EESA 3D7LA 1U3VA 1RM0A 3WGQA 4AJLA 1GV1A 1H6BA 1ZK0A 4FFMA 4CV1A 2V6GA 5ICSA 4J1QA 1MG0A 1IPFA 2X23A 4AJ2A 3CSDA 4F6LA 1QLJA 4AVYA 1UDAA 1Q7CA 2ZB7A 3LYLA 4OJNA 1C0PA 2JHFA 1U8FO 4BMVA 4Y8VA 2FR0A 2X9GA 1HE5A 4PRLA 5JC8A 3FNHA 3GN1A 2PGDA 1W6UA 1LRJA 4XRGA 1LDEA 4FD3A 5HTOA 4CV3A 3ZV4A 4CJXA 1CF2O 3R3JA 1NFQA 1JQBA 2WD7A 4E2XA 1FK8A 2VTDA 3SXPA 4CMIB 4DPLA 4HP8A 2NU7A 2X0IA 3PYLA 4D42A 1JLLA 1YQDA 2B4QA 4Z9FA 4CQMA 5A3JA 4W9NA 1UDCA 3QW2A 1N7HA 2D4AA 1V3VA 4XYMA 3ULKA 1E6EA 4DWVA 4EJMA 2VZ8A 3N74A 2NU8A 2X5OA 1KERA 2VZ9A 5TJ9A 1AN9A 1V3UA 3FSRA 1JAXA 3NDRA 2EJVA 3DZKA 5EIOA 4YACA 5BSEA 4YJFA 1GPDG 5F5NA 4E13A 2YQ4A 3AI2A 3JSAA 1JWAB 3CEAA 4KTTE 3UUWA 4WEOA 1XQ1A 1A27A 5A05A 1Q2XA 5L3ZA 1SPXA 2ZTLA 1AXEA 4D41A 3K30A 3GHHA 2EGHA 4R4JA 4PGFA 5A3VA 4BNGA 3FF4A 1K3TA 4N7RA 1N5DA 3JQCA 4N5MA 4BMSA 4CLOA 4II2A 2FZEA 1SAYA 5BNIA 2DU8A 1EQ2A 1PGQA 4GKVA 1WDMA 1E77A 2E48A 5HRUA 1JWBB 4L4SA 3WQSB 1GAEO 3IDSA 4TROA 4Z0HO 3SJ7A 2VOEA 1DC6A 4TRRA 4EUHA 5G4LA 1V9LA 5GZ3A 4JBHA 5KTKA 5TGDA 1LEHA 5L4SA 4R9SA 4PFJA 3IJPA 2VWHA 4BOYA 1SEVA 4YRDA 5HS4A 1E3JA 1TXGA 2DPGA 3H9GA 5TX7A 3GVIA 3LC7O 1ZEJA 3KO8A 3ZNQA 4PLTA 1E6UA 2HKIA 2D5CA 4MVJE 3RFXA 5IZCC 1DFGA 3HFGA 1NQTA 3GNSA 4CM8A 3WJ7A 1F8GA 1HWYA 3WR5A 3SBOA 4UULA 4FGWA 3C3XA 3OEYA 2FY8A 2G1UA 3PYXA 4FBGA 1NM5A 4NMHA 3D4NA 4L0QA 3ZH2A 5BQFA 4OXNA 4R51A 1ARZA 2H5LA 3GRKA 3GFGA 4G65A 4ALNA 4ZICA 4J49A 1H93A 3WICA 4RPGA 1WXDA 4NK4A 1TB4A 4W9NC 4JGBA 3UN1A 1IZ9A 4JK3A 3MJSA 1LX6A 2CD9A 3B20A 2J5QA 2EKLA 4BKQA 3D0OA 3R1IA 4DYDA 5CEJA 8LDHA 3G49A 4TZKA 2I99A 2CDAA 3ANNA 4BO6A 2CSUA 3E8XA 6LDHA 2Q50A 3V8BA 2B0JA 5F1PA 3WWYA 1EQUA 1GU7A 4DQUA 4UVIA 1ZEMA 3NDIA 4NFYA 1Z75A 3D1LA 2C20A 3UCXA 3KSDO 3RUIA 3ZU2A 2VHZA 2VT3A 3JQ9C 1DIGA 5DULA 2AQHA 2GLXA 4FFPA 3EC7A 4J4TA 3IUPA 1MB4A 3WYBA 3UOGA 1XGKA 1B8PA 3ETGA 2CMDA 2OUIA 2OXIA 1CETA 1N9GB 3VH1A 2FWMX 2Q2QA 1GFSA 3WOHA 1M66A 1NVTA 2BF7A 1T1SA 5T5QA 1Q0LA 1XLTA 1A71A 3OJLA 1DFIA 1VKNA 3DL2A 4A73A 2Z1NA 3LDHA 3OIFA 2NSDA 1ONNA 4AJOA 1R12A 1UXGA 4DBVO 1ENYA 5IN5A 5CEFA 4ND2A 2PGJA 2BI7A 3UW3A 4IY1A 4BNHA 1B8VA 3NV9A 2C7GA 1PJ4A 2ZKLA 4ND5A 2QZZA 2J3IA 4WNIA 1PZGA 2P5UA 1M6HA 4OIMA 3GDGA 3VPXA 1NR7A 2HCTA 2YHUA 1EUZA 4ZN6A 1Y1PA 2VYVD 3QLJA 2G5CA 3BMCB 2OO5A 1OC4A 1VI2A 3PI7A 3ETEA 4YJFB 9LDTA 4WNCA 1E1NA 2VYND 1ZXBA 2AEMA 3OIGA 1V8BA 4NIMA 2QZ9A 3C85A 4KDFA 3U4IA 3UICA 3N7UA 1I36A 1VRWA 3F9IA 4I9NA 2UUOA 3QY9A 1EBFA 4JQCA 5IDYA 4BIIA 1GADO 4FQ8A 2C0CA 3GC6A 3D3EA 3KZVA 1P31A 1E7SA 4RF2A 4RQUA 1VJ1A 4A0SA 2Y1OA 1BHSA 1HSZA 1T2EA 2E49A 3H2SA 1T1RA 3HDYA 1EFKA 3DOJA 3EZYA 4UUPA 1I24A 4E5KA 2LDBA 3PJEA 3GUCA 1NWCA 4Y6PA 1MFPA 2WE8A 2A4KA 3W6ZA 4QO8A 1U2GA 5C37A 4MP3A 2A9FA 4CV0A 4AFNA 1K6XA 3VZQA 1FXSA 1GV0A 4RO0A 1HYEA 3O38A 4PG8A 1C1XA 1U5CA 5LCXA 1E7YA 4DRYA 1EVJA 1MFZA 3E48A 4E31A 1F8FA 1L7EA 3EHEA 1N8KA 3RROA 1C14A 1U3WA 1JA9A 3WNQA 4CM8B 5GZ1A 4RZIA 3RBZA 4L8VA 3QVXA 4UEJA 4FGSA 5I7EA 4NFSA 2IEBA 1C0KA 2DBQA 4F6CA 2VCYA 4YJGB 1MUUA 4PLVA 3F1LA 4LGVA 4R5HA 3VDQA 4CMKA 1XR3A 4ZVVA 3LQFA 5C7LO 1P33A 1QYDA 2HK8A 5TC4A 2GZ1A 1YH3A 1Y6JA 5CFZA 2YV3A 5DCYA 2GUGA 3CMCO 1FDWA 4YYZA 4M55A 4BL5A 3AI3A 3DAFA 1DC4A 2FOIA 3UAGA 4YXFA 1TI7A 1UDBA 2JJYA 4CMHA 3ZWYA 4YRAA 4N18A 3DBLA 2R2GA 3PHIA 3V1TC 4CLHA 4QEDA 1D1SA 2YHIB 3HDJA 4GAEA 2LDXA 4GQAA 4R5MA 4R1NA 3MJVA 2FPIA 3E18A 4GMFA 3V2HA 1ML3A 2HK7A 3D4PA 1LJ8A 1P77A 2D3TA 4WLOA 3UXYA 1KS9A 1B14A 1EVIA 4CM4A 4CLDA 4RPHA 2GR9A 2I3AA 1W0CA 3C1TA 4DA9A 1VPDA 3QV1A 3DAGA 3H8VA 3TWOA 4YEDA 2PD4A 1GEEA 3ZHYA 4GLLA 4ND3A 2A94A 2IODA 3AI1A 4IDCA 1MX3A 3I9LA 4J16A 3VH4A 1QYCA 3DHEA 4ND1A 1U5AA 4GPD1 3KYDA 3AUAA 1H9AA 3I9NA 1E1KA 2AEFA 1N9GA 3VH3A 1QYXA 2QW8A 1JKIA 1R0SA 4KDEA 3RAJA 3S1LA 3O26A 4CR7A 3QVWA 3W1VA 2Q49A 4ZQFA 2YY7A 5DCWA 4CLRB 4L75A 4BO0A 3ZNNA 3O8QA 2X7HA 3GRPA 1ZJYA 4K28A 4WUVA 2I5PO 2V65A 1YDEA 2X0NA 2JFGA 2Z1MA 5DBGA 4PLPA 5JY6A 3I9OA 5IDQA 3TQHA 2EV9A 3I9KA 4WLNA 3EGOA 2I67A 4BO3A 1BTOA 4W4TA 5JAIA 4J90A 5F3RA 3EVTA 4XJTA 4FR5A 3ORFA 3WNVA 2WM3A 4D3FA 5IG2A 3K5PA 4WLEA 1RM3A 4WOJA 3WGZA 5U9CA 3P2OA 2Y0DA 1IHXA 3CXRA 3O9ZA 3VTZA 1Z45A 3PWSA 3I9JA 4Z0PA 2P9CA 4B3JA 2EWMA 1DEHA 5AVOA 3ZZNA 2OHXA 5A06A 5KVCA 4GVLA 2PR2A 3TZCA 4MVJG 4E0BA 2J5KA 3WSVA 3CZRA 1Y7TA 1ULSA 4E5MA 2X8LA 4LSWA 3TOXA 4XQ9A 3R0IA 2HMSA 2NVWA 1DAOA 3FBTA 3GEMA 4GWKA 5JLAA 2ZTMA 5COAA 2HAEA 3VVBA 2X6TA 3H65A 5JCXA 5ER6A 3WB9A 1QSGA 1A7KA 1JVSA 1UZMA 1VJ0A 2I9PA 2YYYA 4GBJA 4MVJF 4AJ4A 3NUGA 4ND4A 3QVTA 4KP7A 4YVFA 5KIAA 2E4AA 3VZRA 3Q6IA 3FWZA 1J0XO 3OHSX 3WGYA 1CJCA 1XSEA 5KVVA 1Z7BA 3ZV3A 4BB5A 4N5NA 2O3QA 4OH1A 3FWNA 1GR0A 3DZFA 1P1HA 3PJGA 1V0JA 2C59A 3MZ0A 4TWRA 2Y05A 3ZWCA 4E2ZA 2PH5A 2NADA 3E82A 1PWZA 4D3DA 1ID1A 3COSA 3TZQA 3PHHA 1BWSA 1K89A 5BSHA 5F5LA 3X2FA 5KCZA 3ONFA 2Q4BA 3VKVA 4CV2A 1ENPA 3JV7A 2W8ZA 3ZWMA 1ADFA 1YB4A 3NT5A 5KKAA 5ES3A 3T4XA 3RUAA 2WYUA 2NUAA 5HBRA 4BNYA 1PGJA 5CG1A 3G1UA 3NGLA 5TT0A 3BTUA 3RC7A 1GUYA 1HRDA 1LSSA 1MV8A 3WJAA 3PYMA 4NDNE 4UVGA 2UDPA 2YQ5A 1ZFNA 1OC2A 3JCZA 5KJEA 4N54A 1K5HA 4FCCA 1F0YA 1YBMA 4BKPA 1PZEA 2GZ2A 1JKFA 3IKTA 4KMSA 2GYYA 4OSPA 2CFCA 3DBLB 2O23A 2DBVO 2WEKA 4GX5A 2NVBA 1XQ6A 3VPGA 4EJ0A 2I3GA 3AM4A 3EAGA 1JW9B 3ETDA 1NQ5A 4EGFA 1WZIA 3QWIA 4WEQA 3DR3A 2BHLA 4WCDA 1FMCA 3JQGA 2ET6A 4R3NA 3ZI0A 3GNTA 2PK3A 3Q2IA 4PLHA 3SX2A 3KYCA 3F4LA 3FCOA 1LC3A 2WWRA 4GGPA 4IDBA 2PV7A 4RPKA 3DDNA 1G0NA 4R1UA 5IXYA 3H5AA 1P1IA 3C1OA 4BHTA 3KYDB 5B4TA 4Y9DA 4URFA 3KETA 1PTJA 3PLNA 3SLGA 3TFQA 4BNXA 2BD0A 3WLEA 4A03A 5KWEA 1KOLA 3U62A 3GVCA 1G6KA 1MC4A 3RJ9A 3RUDA 5A9SB 2O4UX 1R16A 3UVEA 1HF3A 3CE6A 3JQ9A 3PRJA 2PA3A 4OQZA 1ZNQO 3GF4A 3H2ZA 2QRLA 3O8QB 3LVFO 4QXMA 3PGXA 3P7MA 2B37A 1YOVA 4ITUA 5LC1A 3EDMA 2BI8A 4YWJA 2C82A 3I83A 2H63A 3ADPA 3EZLA 3I3OA 1HYHA 1E5LA 1GYQA 1PGNA 4F3YA 2NTVA 4ROSA 4EEZA 4RVUA 3TZKA 4ILKA 5C7IO 5L95A 4OMUA 5DP2A 1X13A 2DVMA 1E0DA 5CHEA 1ADBA 3IC5A 2B5WA 4LCEA 5F1OA 1D1TA 5FI3A 3ZWAA 5AYVA 1PL7A 2VNSA 4QUKA 1E7QA 2C5AA 3QWHA 4J3FA 3W8EA 3K2EA 2X1HA 1H9BA 4O0LA 1UZLA 1DJQA 4E5NA 3GA0A 2Y1DA 4EW6A 1EMDA 4NBVA 3PQEA 2DUWA 2J8ZA 3KXDA 4O5OA 3SJUA 3R3SA 4CM9A 5B4VA 1BMDA 3L6DA 3TFOA 1V6AA 3ONEA 1PJ2A 4JIGA 4NI5A 5L53A 4GWGA 4I1IA 2PKRA 4IPTA 3WIEA 4JJIA 2PFGA 3QVSA 1LTHR 1WMBA 1YXMA 1H94A 2WYVA 3QRWA 1HLDA 3TJRA 2Q46A 4E21A 2IXAA 3S2IA 4LSMA 3WQRA 4D7AA 1KVRA 1N1GA 4NBUA 3B70A 4EDFA 3P5SA 5IN4A 3G1TA 1MXFA 1PIWA 2H9IA 4DYVA 2AE1A 4KWHA 2DTEA 2IZ1A 2X5JO 3HE3A 2BMAA 3ZU3A 1A4UA 1UXKA 4NU6A 3JQAA 3F5QA 2C7VA 5BT9A 3W8DA 2VWPA 1WDLA 4U6SA 3JD0A 4XGIA 4E2WA 2I6TA 4E2YA 1IOLA 3HDQA 3F6YA 4YAEA 3KVOA 5K6AA 3CZMA 4RVHA 4Q9NA 1I2BA 1UXHA 5JO9A 4TKMA 1HT0A 4E3ZA 4IUYA 3VPFA 2PY6A 1K0UA 1LDBA 2FR1A 2GN8A 3PP8A 2PH3A 1U3TA 4JJGA 5CDYA 3ZGYA 3HFSA 1XDWA 3BMNB 5C7OO 4HFMA 2Z5LA 4CM1A 2VHYA 3L4BC 4NH4A 3M2TA 1JTVA 4XKJA 5DZSA 3WGTA 1LUAA 5EINA 3P2YA 1GZ6A 4PLFA 4BGIA 3GZNB 4BNUA 1I01A 2GASA 2VUSA 4KUHA 4J2HA 3FI9A 3EK2A 4MVJM 2Y1GA 1Q7BA 1Y9EA 1R4MB 2FRDA 3KYCB 5CG2A 2Y99A 4B79A 4I9HA 3ROPA 2OBNA 1Q7GA 1CYDA 3IAHA 4KUEA 3LT2A 1KYQA 2EEZA 3GAZA 3OBBA 2G82A 4HWKA 3PGJA 4UAGA 2PKQP 4WJZA 2QIOA 3AWDA 3E9QA 4IIVA 3WX0A 4H15A 4J1SA 4TKLA 1P0FA 3TL3A 4QFDA 4JXKA 1ZO8A 1CQIA 3C8MA 3KV3O 4CUJA 5JNLA 4J2OA 5JW6A 4R69A 4RQTA 2YJZA 1GQYA 2AE2A 2IZ0A 4G5HA 2G0TA 3I6QA 2QQ5A 4UUMA 5DBIA 3MTJA 4OOEA 3HQ4O 5JYEA 1X15A 4FJ1A 3RBVA 4I5GA 1O95A 2B4TO 1UP7A 3VPSA 5A03A 5KNLA 1H6CA 1IB6A 1P9LA 1E6WA 2Y68A 4YT8A 2BLLA 4OKIA 4ZQHA 4GL4A 3SC4A 3UHAA 1VSVA 3HN2A 3NRCA 2HK9A 4CQLA 3E5MA 2GD1O 3O03A 5A4DA 4ZU3A 1BVRA 4PG4A 2D59A 1LI4A 2HQ1A 4O59O 4UUOA 1DOHA 4MDHA 3LT1A 4RORA 4IGEA 2V6MA 4NJOA 4M89A 1H6DA 3JQAD 3JD1A 1YL5A 3DC2A 5JCJD 4PG7A 3H5NA 5A5EA 1T25A 3PIDA 2VYVA 3Q1LA 2O2SA 3V1UA 5IZ4A 5JMPA 3NYWA 4L4RA 3RJ5A 3FNEA 2YDXA 3OJEA 3CTMA 4RPLA 4BNVA 4BQRA 4WOKA 4BKOA 4MVJI 1GDHA 1UJMA 4Y67A 1ZZEA 3JQEA 2AQIA 3BMQA 4L76A 4UVDA 4HV4A 4FSHA 4J0FA 3VC7A 5B37A 1M67A 3MOGA 3QJ5A 2UVDA 3BHJA 7MDHA 4OQYA 1K2WA 1NFFA 2X86A 5B4UA 4MP6A 4QX6A 4CL3A 4YR9A 4DQVA 3AY7A 3M2PA 4HKTA 4IDGA 1E3IA 4R1TA 4YJHB 1Q0QA 4CR6A 4EEXA 5L7YA 1ENZA 1YBVA 3NTOA 4FC7A 3JYQA 4L74A 4DMLA 2QRKA 4IZHA 4J9UE 4MKRA 2JCXA 4E4YA 4D0RA 2X9VA 4Z6KA 1P1FA 3JD4A 4HNGA 4XX0A 4CM3A 4XYGA 4FB5A 3PFWO 3HSKA 1QP8A 2BRUA 4P4GA 3JQAB 4IS3A 5KKCA 3DHNA 4BO8A 1PJ3A 4CM9D 3ZU5A 2GPTA 1T26A 3TL2A 2NACA 3JYNA 3ZHZA 1KC3A 5I9MA 5GZ6A 2BGKA 2YDYA 2BFPA 5T64A 1R6DA 3VHRA 4CQMB 1VLLA 3RCBA 2O2YA 2PLAA 1GCOA 3QSGA 4IDFA 2IEDA 2DC1A 4IJKA 4E6PA 5L7TA 5AXCA 3FNGA 2VRCA 4HNHA 5U1PA 3UKOA 2TMGA 1B16A 2EKQA 2ZYDA 1CQJA 4HFJA 4Y6SA 3AUTA 2OGUA 3MJCA 1F12A 1H0KA 5T57A 3RBXA 3GUYA 1LQUA 3DHYA 5K6AC 3KLPX 3VZPA 1DXYA 1TA4A 3KUXA 2FZWA 4G81A 4CR8A 3PTZA 1ONPA 4HFNA 1O8CA 1SEPA 2BELA 3F1KA 1P1JA 2B4RO 4CMGA 2A35A 3D3WB 4AJKA 1E3EA 4XQGA 3AJRA 3JQ8A 4O1MA 1B0AA 2FMUA 3FN4A 5DCUA 3DQPA 1SOWA 5CDUA 4B4WA 4CLOB 2W2KB 1U3UA 5T67A 3KRTA 1QLHA 1ZKMA 2YZ7A 2ZTVA 3KB6A 4C4OA 3LZ6A 3PLRA 4XGNA 3QE3A 5BSGA 2AG8A 4YTEA 1NWHA 1X7HA 5L4NA 4TMFA 1U7HA 1T4BA 4M86A 1ISMA 4CMCA 3H9QA 1R37A 1SOVA 3L4SO 4GKBA 3WMXA 3KLMX 4ESOA 2V7PA 4FDAA 5K9ZA 2VYNA 3I4CA 1HDYA 4NG5A 3TDKA 3FHLA 1CEQA 5IF3A 1O6ZA 5F21A 3K73O 4C7JA 3D64A 2CF5A 2WMDA 4LN1A 4LVCA 2NWQA 4RL6A 1IZ0A 1PL6A 4GX0A 4RJTA 3VTFA 4AL4A 2H6EA 4ONEA 3FRJA 2IE0A 2W98A 4CMEA 2SCUA 3NEPX 2Q3EA 1NHGA 4J43A 4NNJA 4MKZA 3ZWVA 3G79A 1NPTO 1I5RA 2JD2A 1HE3A 1R4NA 2AA3A 3U4DA 1OFGA 4YAGA 2IDZA 4OSOA 3DOCA 1JVBA 2D2IA 4NK5A 1NQAO 1B26A 3DZIA 1E7WA 4H16A 1XELA 4MVJH 2JHGA 4QT0A 1U28A 3U5TA 4FFRA 3RUHA 1EUDA 4Z3DA 1X1EA 2QYTA 4PLZA 3INGA 3BHIA 2YFQA 4PVDA 1LDGA 1FDVA 3ZWWA 2JD1A 4IJWA 1KVUA 1I3KA 2VHVA 3GAFA 2RBEA 4NBWA 3NT4A 2HU2A 4FFLA 3QWBA 4KWIA 4XQCA 4OOFA 4RZHA 1MLDA 3OA2A 5JDCA 3E9NA 4FOOA 2DT5A 4PLGA 3BMQB 3DMTC 3KEOA 4M8SA 3QWAA 4CM7A 1HL3A 3WTBA 2X4GA 3WFIA 2HSDA 1CIVA 1U4SA 5DDIP 5IDWA 4Q3BA 1XU9A 3INRA 1LLDA 4B7UA 4D43A 1IE3A 4Q3AA 1QORA 1DC3A 1KEWA 6ADHA 3H9EO 4DIOA 2BFAA 2GO1A 5FF9A 3GGPA 1QMGA 4YJHA 4N5LA 3EY4A 3A1NA 4CM6A 3V1YA 3L9XA 1I3NA 1LLCA 1ZVMA 4JP2A 1A72A 3I52A 3U4CA 2PD6A 1D7OA 1EVYA 3DXFA 4BNZA 4YA6A 3IIEA 2PZLA 4CQMD 4OXKA 2VRCD 1RYDA 4XD2A 1MP0A 1SNYA 4WLUA 2W4QA 3O4RA 1PQWA 1B3RA 1WNTA 2CUKA 4KQWA 1X7GA 3GQVA 5DNAA 2V6FA 4BO4A 2O7SA 1R0KA 4EZBA 4AJNA 1E7MA 4NQZA 3STHA 3AM3A 5L40A 1B15A 3OIDA 1VL8A 3RC9A 4PLYA 2DTDA 3RIHA 4BNWA 4WKGA 4JLWA 3CH6A 4NJMB 5DOVA 3W4IA 4M49A 4YJDA 4P8RA 4YT4A 1ZUD1 2FN7A 2C5EA 3CINA 3AM5A 4IMPA 2UYYA 1VC2A 4BO2A 2CVQA 3BMCA 1YGYA 4RCVA 3ONDA 4PIVA 5HS6A 1IULA 3OJOA 3V5NA 4B4VA 1T2FA 2VT2A 1NPYA 4IDEA 3RUEA 3FTNA 1WVGA 1Z73A 1BXKA 3GEDA 2QYSA 3MJEA 4W7IA 1KETA 3ZWXA 2F1KA 2Z95A 4DREA 3LF2A 3HB4X 4GSLA 2X22A 2QHXA 4MVJD 1P1RA 2W2KA 1D4FA 1UP4A 5KJ6A 3W6UA 4BGVA 4A5OA 4K1LA 4MIEA 4FS3A 2ZJ0A 4IINA 5EMHA 5JXWA 3GPIA 5CEEA 1LLUA 2C29D 4BKRA 1I30A 1CRWG 4L4XA 4Z9YA 3ANMA 4A7PA 3AOEC 3SLKA 3PZRA 2DAPA 4PLCA 4XEHA 4CMAA 1Y5RA 1YS4A 3CKYA 2J3KA 3PHLA 2CDCA 4PG6A 2HO5A 4Q39A 4XQEA 5JMWA 3PEFA 4D0SA 3PZBA 4J0EA 1F17A 1GD1O 4XB1A 3DTYA 4M87A 5TNXA 4B3HA 4PN3A 1I2ZA 3EUWA 3ENNA 3Q0EA 2R00A 1Q0HA 3DBVO 1DC5A 4XWYA 3I4FA 4PG5A 3HADA 4I9UA 1EFLA 5KJCA 3RASA 4II3A 4BO1A 3LC2O 4IQ0A 1C3VA 1B2LA 4JROA 5DT9A 3UCEA 3GGOA 4QFCA 4A2CA 1MG5A 4XR9A 3BZUA 5FI5A 5I8WA 4AJHA 4UUNA 5JDIA 3G17A 2DTXA 4QECA 2FP4A 2HJSA 4WLVA 3ZHBA 1HDRA 4WE3A 3JYOA 1SCUA 1J6UA 2DPHA 4FFNA 3AOEA 4XRRA 1Z82A 3PHJA 2PZMA 3BMOB 5LDHA 1E92A 5MGBA 4I5DA 4XYEA 2Y1CA 4D46A 3ROMA 4E12A 2J6IA 1V35A 1HE4A 3DTTA 3A9WA 1DHRA 2W90A 3NJ4A 4B7XA 1DIBA 4I08A 3L6EA 3UCFA 3MWEB 1LA2A 4PZEA 2ZK7A 3I5MA 4I5EA 1FDSA 4R01A 3FPCA 3BXXA 4P22A 3D5QA 3I23A 1KC1A 1YO6A 4M1QA 3JD2A 1RM5A 3JQDA 3LLSA 1O94A 3WYEA 3JD3A 3HWRA 3AK4A 1GYPA 1PL8A 1X1TA 3ASVA 5G0VA 4IQGA 1C0IA 4CLRA 3NX4A 4BKUA 1HZJA 1NYTA 3OJ0A 4J1NA 1GUZA 2CY0A 4R3WA 1HKUA 4XB2A 1UAYA 2X58A 1LSOA 2FR8A 2EG9A 4ZGWA 4ALJA 3IKVA 4AICA 2WD8A 5TRTA 3S2EA 3PWZA 1ISHA 5IJZA 2FPGA 2GN4A 5BSFA 2TMDA 1Y5MA 2O7QA 3PIIA 2EJWA 1EVZA 4Q3NA 3KEQA 3A28A 5THQA 1DJNA 1O0SA 9LDBA 4I8XA 4OM8A 2Q45A 4WPGA 1HSOA 5DBFA 4TZTA 1LXCA 2XXJA 5COQA 1AXGA 1WPQA 1KBZA 4LMPA 3UH1A 4CUZA 2BFOA 1C1DB 1T4DA 3F47A 3E03A 1HDOA 1O89A 1BVUA 2JCVA 3FR7A 4IQ8A 4IZIA 1PZFA 3U09A 2B69A 2OFPA 1ISJA 2C07A 4NBRA 1MA0A 1XG5A 3CIFA 1PGPA 4RPJA 3PJDA 2PZJA 2OZPA 1OMOA 3G0OA 2PD3A 2VWGA 1W8DA 2P91A 2P68A 1ZJZA 3I9MA 3OECA 4D79A 4R68A 1LLQA 1Y8RB 4F46A 3IL2A 1I3LA 1I8TA 1G1AA 3HDHA 4JN6B 5LDGA 5U4QA 1AE1A 1BXZA 2JKVA 3OM9A 2GZ3A 3IS3A 2VNAA 1BRMA 3N58A 3UFXA 2WJPA 3LT0A 2XOXA 1X0XA 1VL6A 3ZWNA 4DIFA 1QR6A 3C7AA 2AQ8A 2OOSA 5JDIC 2EERA 1I2CA 2HMTA 3H3JA 4R9RA 1AHHA 1SC6A 4TQGA 3I6IA 1PJCA 4CLEA 4WASA 1U7TA 2HMWA 3DBHB 1XKQA 2HRBA 4DVJA 3ZHXA 4BVAA 1JN0A 1E3WA 1QV7A 2Y67A 1LSJA 3ST7A 4BMNA 4JNKA 3W8FA 3FTPA 4CPDA 2UUPA 3WFJA 3AFMA 5JFOA 5IFLA 4RVGA 4GX2A 5TT1A 2O48X 5DN9A 3MCVA 4K9DA 4PCVA 1U9JA 4S3MA 4B7CA 3GVXA 5ADHA 1F14A 1SZJG 1NVGA 3BMOA 3GVPA 1LBEA 4DLAA 2P9GA 4UEOA 1HDGO 1O9BA 2NU9A 2GGSA 3R6DA 2OORA 2E82A 3JQGB 1H2HA 2D5AA 5G4KA 1GL3A 2AW5A 2RH4A 1HEUA 1G0OA 2DM6A 3U0BA 4P4NA 3HJAA 1VM6A 3JQ7B 1DLJA 1ORRA 3L9WA 3PVZA 4GX1A 2NTNA 3LT4A 3TZHA 1RYEA 2DLDA 1NBOA 5JDCC 5KJ1A 1TEHA 1WWKA 5I7FA 4DPKA 1YE3A 4XYLA 3ZWPA 3DONA 3KBOA 1EE9A 1N92A 2JAHA 3GDOA 4FC6A 4PZDA 5A9SA 1ONOA 4ID9A 5EQDA 2W2LA 1DDOA 2WSBA 3JQBC 2Q2WA 1UAGA 4O6VA 3DZHA 1RWBA 4BNJA 4WECA 1Z6ZA 3V2GA 3ANLA 1O5IA 4OAQA 4OYRA 4UVHA 3WGIA 3PQDA 3OF2A 2VUUA 1I3MA 1JKJA 1UUFA 4GH5A 3T7CA 1BDBA 3RKRA 4BNFA 5IZCA 1HYGA 3QP9A 4B8WA 1A9YA 1S6YA 1NHWA 4GGOA 4DGSA 2IYPA 2ZYGA 3E5RA 3GG9A 1PR3A 1VSUA 4M54A 3FPLA 2WD7B 3AFNA 4J91A 3L0DA 4LK3A 5B1YA 3AY6A 1M76A 4IXWA 4FJ0A 3ADOA 4DXHA 1BGVA 2JCYA 3D5TA 3H3FA 4FPXA 4INAA 3JYLA 4F45A 1E3SA 1GEGA 2DFDA 1DBVO 3NTQA 1C1DA 5FYDA 4XDYA 1LC0A 1VKOA 2RCYA 2HLPA 3BTSA 3HN7A 2X0JA 1KIFA 4GLOA 2GNAA 3WGHA 1RM4A 1I0ZA 4A10A 2VTEA 3FD8A 1RPNA 3VKUA 1UH5A 5L45A 1YJQA 3K92A 3KOUA 5T8KC 2OP0A 4ZRNA 1UZNA 5AXBA 2NTJA 3S2FA 5CDSA 1M75A 4YT5A 4BB6A 4ALIA 1FDUA 2PZKA 4L73A 1X7DA 1P1KA 1Y8RA 5GMOA 1R0LA 1ZH8A 3AUUA 2AG5A 3U3XA 3JQ6A 4OKNA 2QRJA 4B4UA 1EK5A 1QYWA 5EPOA 2ZQYA 3JQFC 3SEFA 5TS3A 1CWUA 3AW9A 4FOSA 1UXIA 1GQQA 2PNFA 1EZ4A 3LF1A 3MTGA 3DBRA 1AUPA 2DBZA 4DC1A 1IUKA 1UP6A 3ZWBA 4E5YA 3DOOA 3WXBA 1N1EA 5ENVA 2GF2A 5A9TA 3OJFA 4BV9A 4HFRA 5L9AA 4YCAA 5FWNA 2EHDA 1E3LA 3BIOA 4CMBA 4OHUA 2NVUA 4I5FA 4Q3EA 3INTA 5HA5A 3OQ6A 3DBHA 1OOEA 2DKNA 1EDOA 4LW8A 1ZSNA 1GYRA 1ZK1A 4U0JA 1WMAA 1E3WB 3LC1O 3GLQA 1XIVA 2NLOA 4TVBA 3TPCA 1ISIA 4RF5A 1VL0A 1P0CA 3GDFA 4BS9A 3Q9UA 5KJFA 3C7CB 1OI7A 1DRVA 2NV6A 4J6FA 2YUTA 4JX8A 1EEHA 2O3SA 3BTVA 3OA0A 4DL9A 1H6AA 4PRKA 2JFFA 2DQ4A 5A02A 3IOYA 3Q3CA 4XCVA 3T7EA 3EW7A 3UF0A 1PJSA 5J23A 2AHRA 3HHPA 3F3SA 4X54A 5TLSA 2CVOA 3ZV5A 3TOZA 2NQ8A 1A7AA 1NAIA 1DAPA 1Y81A 3VAZA 4KQXA 1FDTA 3JQ7A 1U8XX 4R54A 2J5RA 4GSKA 1XEAA 1J4AA 3AU9A 2VZ0A 3B1FA 5G0UA 3JTMA 1LSUA 5KOIA 1WLYA 3TZ6A 2B5VA 4L9RA 1LDNA 3WSWA 4WGGA 1RKXA 4A27A 2W2LD 5JC1A 3GNQA 4EUEA 5I7VA 3DFUA 2D8AA 1HXHA 5HM8A 4RDIA 1H2BA 3H6KA 3WBFA 1HZZA 2GRAA 5AXDA 1FF9A 1PS8A 2BGLA 3OP4A 2NU6A 1X14A 3AOGA 3OICA 4XIJA 3DZJA 5THKA 4FJ2A 2D0IA 3NJ8A 2IRWA 1HLPA 3OH8A 2Y93A 5I9LA 2PGLA 2B36A 1M6WA 2PWZA 3PJFA 2E37A 3B1JA 3E6AA 2P4HX 1LQTA 1SMKA 4FFOA 3L4BA 4YT2A 5ITVA 1NVMB 3RVDA 3L77A 4BQPA 2QG4A 3EMKA 1EDZA 2I66A 4H7PA 5AQ1A 3PDUA 3M1LA 4IBOA 5A1TA 4J4BA 4W82A 4KZPA 5ENDA 1NTOA 1TT7A 3AUSA 3E9MA 4WCFB 4QSMA 4J7XA 2EP7A 4U7WA 5CDGA 4XYBA 3FBGA 2AEJA 4BNKA 3GMSA 3PFFA 5AXAA 5A5FA 3H5RA 1CDOA 2IYOA 1PJQA 3EVNA 1L1FA 1N7GA 1OBFO 2UAGA 1K6JA 2NQTA 1YB5A 3GZ4A 4NR0A 3GVHA 1NASA 1GQ2A 3HZZA 4IMRA 4B8ZA 3ROQA 4AJPA 1LU9A 1PZHA 2GN9A 2F00A 2YV1A 3DBRB 1I33A 3S2GA 1HDXA 1ZMOA 1DO8A 3NT2A 4IXTA 2FSSA 2DFVA 3RWBA 3OSUA 1GUFA 4K26A 4DC0A 4RF4A 4JCOA 1C1XB 4HADA 2NVUB 2X9NA 3IP1A 2R00C 4ZD6A 2PKQO 1ZIDA 1PSDA
chains in the Genus database with same CATH superfamily
4DIBA 3QXCA 1QAMA 5K8CA 3AVQA 4E5VA 5AUNB 1IQ0A 1IAVA 4HLDA 3GPDG 3HKCB 1ZRSA 2CJXA 2CXNA 5I7RA 1P45A 1RPZA 1PKXA 4IQ4A 4XIGS 5DX0A 2J3HA 4NCHA 2OOKA 3ICCA 3CWQA 3PF9A 4L7VA 1JECA 1AKNA 3T38A 3SQNA 3WGOA 2OMKA 1K6MA 1XHFA 2HA0A 4CNBA 5GVSA 1FYEA 5IDXA 1L3BA 4EBFA 3U09A 4O3MA 3D3WA 1P7VA 1QX3A 2XKAA 3O1IC 4LXQA 4TXJA 2XB2A 1ODFA 5FH9A 2Q5EA 4R98A 1K1EA 3IV9A 2P6MA 3FPKA 3PU6A 4XJVA 3RC2A 3U4AA 3WB1A 3ZIDA 1VRVA 1TYEB 1IY8A 2JGMA 2RCNA 2VUTA 3DOEA 3HGQA 4D45A 3ZDDA 1GNLA 3AR7A 4YDRA 1X8LA 3F6RA 3MQ2A 4WJKB 4X1KA 2YHIA 3R44A 2L19A 3HPQA 4RNDB 2VF4X 4ZEMA 1QV6A 3HCAA 1EP9A 3O47A 3FOEC 5SYMA 2SKEA 2D6FA 4HQRA 2RB4A 5GPBA 1E4EB 2DBRA 3UBMA 4QRDA 3QIVA 2I1VB 4DCTA 1YDWA 3KAJA 1Y6QA 2AQKA 3ASUA 3H18A 4RVSA 4ETMA 3HUFA 2HF7A 4JLOA 3EHDA 1RVDA 2DHCA 2HIAA 2QROA 2XQGA 3IMFA 5LIRA 1TM4E 3AR5A 1FX0B 2Q6LA 2PMEA 4C7OB 4I6GA 3FTFA 1MNAA 1GQRA 1SC1A 1W5BA 4OYHA 1YQUA 5FL7A 2HRDA 3ND6A 1A9XB 4DSOA 2JIQA 3WL8A 1JHMA 5BMVF 2WZQA 2DY1A 3ZDCA 4W6ZA 1EESA 1V4VA 2CB0A 1M33A 3C8DA 2WZDA 3KYJB 1ACMA 1D1QA 3O84A 3AX6A 4ZEWA 3IUEA 3UW3A 5H1YA 3RI3A 2ZUTA 3TN7A 4U9IS 5KSOA 3IJRA 4OG2A 4CTNA 1GNSA 1B6SA 1R4NB 1U94A 2R68A 4M8LA 5ERXA 3VC2A 1ADGA 1RBQA 3DFMA 2GZMA 1VJDA 5GJVC 2Q62A 1G3UA 5EJ9A 3S55A 3ZDFA 2WE7A 4RWEA 4EYOA 2D8MA 1J2EA 2IX9A 2L82A 1FVXA 4NNPA 3SJZA 1ZOIA 4C3OB 4OGWA 1M2WA 4BO9A 1UBLS 2QR3A 4QA9A 2BWJA 2YXEA 2JGDA 1HT2E 4AKHA 2BKXA 1QIJA 2E1RA 3CR7A 4GXTA 3WDSA 7AT1A 3RHTA 2WV9A 1SB9A 2CZCA 4XQ0A 4E94A 3SVZA 1HDZA 5ILOA 1FNBA 1W0KD 1X94A 3OT4A 4URHA 2V7GA 1T2CA 4M8IA 2QL9A 5BUCA 5JCOC 1NOKA 3LRPA 4Q3CA 1R10A 1M1NA 3AV0B 4QHSA 4YFYA 3BIFA 3QM1A 1YCGA 4S1NA 2NNLD 1X92A 2X8AA 2YW2A 4NPHA 4ZI5A 5CAEA 1NBAA 1P9NA 2VN8A 1DU4A 1OJLA 1E1CA 1ISFA 1VJTA 2X5NA 3F3MA 2JI9A 4R41A 3R41A 2CSXA 3FNIA 1ADJA 4KIGA 2KQUA 4JHLA 3AYXB 1CFJA 1VHJA 3V34A 3WBBA 1IUOA 5CFNA 1CY2A 4X0EA 4N7BA 3QQPA 3UT5B 3PA6A 1YRLA 3KHSA 3AU8A 4I4IA 4D3ZA 3LUCA 1XAHA 1YGPA 1E3QA 2VJCA 5K0ZA 4FYKA 1II0A 5JVDB 4CKBA 1ZCFA 1TUIA 1TECE 2UZ1A 4BV2A 3WC4A 4EMBA 1ZBQA 4JI1B 4B3MB 5EIHA 3UNXA 2RHCA 4KIFA 4M76B 3QHAA 3UKDA 3EWNA 4MPRA 2G77B 1RAIA 1J56A 2R7NA 5DF1A 2FG5A 3RUCA 4TV8A 4UNRA 3S5UA 3QQ5A 1YB1A 4HXEB 4QJIA 3SZUA 3WLHA 1BNCA 5H80A 2B25A 2WJWA 1XP5A 4Q6WA 1R66A 3TMYA 3QI2A 1MHTA 5AH0A 3MRTA 3LKBA 4DUPA 1GCIA 2CW5A 3IMGA 4R2MA 3ANYB 1ZD2P 3VPHA 4Q7MB 1SR8A 2OCYC 3SR4A 1ZOLA 4L1KA 5TIIA 3OTOB 1X6VA 2MMGA 5JI3E 1EX7A 1CS4C 5LOVB 2N9UA 4KQJA 4M60A 1BXGA 2X0DA 1GPYA 3AJAA 1ST3A 1GAXA 4C87A 3H05A 3PHGA 2HQOA 1L7AA 4QO7A 2NZWA 4R2IA 4O4LB 4NHEA 1BEZA 3I1JA 1USIA 1KI3A 1OAAA 1U5BA 5T4FA 2VO1A 4BRZA 4CM5A 1TT5A 3U4DA 3ZLBA 2J9ZB 2NUAB 1OH8A 1PJ8A 1RKUA 4DCSA 5K3FA 2UXBB 4G8BA 3A6LA 4UQOA 2FQXA 3K53A 1G38A 4ITRC 1WBDA 4NCAA 3WWZA 4RTJA 3WIUA 1WXIA 1OWPA 1XQYA 4X8LA 8ABPA 4MPTA 3HJFA 4Q1EA 4NYMQ 1GOTA 1IK4A 1YJBA 2C2YA 3KKNA 1ZM2A 1D0SA 2RAFA 4MROA 5E8RA 3PRHA 2Q1TA 5HQJA 4IGFA 5TVGA 4CKEB 3G82C 2H2AA 1NLFA 3HU3A 3N2EA 1MVNA 1EWRA 4NG4A 4OM7A 3IEXA 2HBQA 5EZSA 3U49A 3JARA 2BMEA 5KNBH 2VRBA 4HAOA 2QTAA 1ZM7A 4YJ2B 3AUYA 5LUBA 3H9JA 5KYNA 3L07A 3F4BA 3CW9A 3CLRD 3KL2A 1JHAA 4ZJUA 3EEOA 4AG3A 5HZKA 2C1EA 1Y9JA 1C0LA 2BHRA 3RRJA 1U1IA 5IKMA 4LI3X 4AIIA 1SK8A 2B94A 3QVJA 2EJTA 5GY7A 1AH2A 3PSAA 1T24A 2GXUA 1KQFA 1WXQA 1O57A 3SSMA 1M34B 3BXGA 3VPAA 1X7XB 3AERB 2I3ZA 3QK7A 3B3JA 4K6MA 4JNCA 2FZGA 4PC3A 2X3UA 2Z30A 3C6XA 3M6IA 3QPVA 1ADCA 3Q9NA 5F5XA 2HUNA 2O6HA 4D4MA 5EJGA 2AI3A 3CLRC 1XU4A 5ED0A 1ZSYA 2CMFA 3PK0A 5K3AA 3TRHA 3VU1A 3WHPA 3WRYA 3RFVA 2H1IA 4AS2A 3H42B 5A9RA 3KV1A 2BN4A 1C3OA 2XT0A 1WW3A 2P6OA 2NT3A 2POQX 3THWA 2O20A 2EP5A 1TIKA 2DWUA 3E7PA 1UXJA 3YASA 4K03A 2DR2A 1IL0A 2R2AA 1JQLB 3ZDYB 1DWQA 1J33A 3LK7A 2JFXA 2O4CA 3HA7A 3VR4A 2A1TR 2WJZB 2AEEA 4NYMR 1G21A 1P7PA 2IUTA 2XXBA 3SS9X 3S7TA 3WLSA 1IY1A 3DO5A 1GCUA 4V3CA 1P29A 1YOVB 1OI4A 3AVUA 1VPWA 2EWWA 1RI1A 3SVTA 1I7NA 1V26A 2G8NA 3VDXA 1G66A 1I4OA 1QXSA 4BQFA 2ID7A 1ZM9A 4KBFA 2GDZA 2G88A 1B41A 1AKMA 1CV2A 5AKKA 4YS6A 4I1SA 1LPOA 3WP0A 2H4JA 4B44A 2X2EA 3ISVA 2RHRA 5FPPA 3E1KA 2ZUVA 3N1UA 3ZD9A 2FAXA 3HJTA 2I4MA 3RFTA 4KBGA 4GIBA 3T9FA 4YRBA 5BOSA 5JFTA 1W36C 1E6CA 3BH6A 4LVNA 4DQDA 4FDTA 3FWKA 1T5HX 3JQBA 4FLMA 2IYQA 4PAOA 5BOVA 2V9ZA 3E3NA 3IHLA 3GGDA 1X0VA 4TVSA 1T2DA 3Q2KA 3ZHSA 1FQKA 3TKAA 3UA3A 2C9DA 5CA1B 1GPKA 1R3UA 3A6FA 5LQMA 3ESBA 3VYWA 4EAAA 5EJ6A 1DB3A 3PWKA 4UHKA 3AW8A 1BVYF 3I45A 3MTQA 1GWNA 1NF3A 2BBSA 3OFSA 3MBOA 2F8MA 5DNVA 1KBOA 1V25A 1VL5A 2GJAA 4IS2A 4F5DA 3TNLA 1EX6A 4ZT4A 1ZVJA 4WFJA 1Z06A 2RGXA 4KITB 2HGSA 4GPZA 4F1WA 2HMAA 1L3CA 3AR2A 4I6JA 2P4QA 4GC9A 2J09A 1KMHA 1E18A 5CB4B 2QY6A 3K20A 3ZE9A 1HH4A 1NF9A 2C04A 4JX9A 5FFFA 5F9FA 3FPGA 1F7UA 4QOFA 1E0SA 3VH2A 4CT5A 2Z5VA 5P8WA 1KZ7B 4GC5A 3RABA 2FF7A 1F3LA 3AMVA 3OE5A 4BFCA 4C0XA 1IQRA 4JYMA 3OCYA 4DNQA 1GXSB 2YZNA 5C5IA 1IM8A 4JOSA 4CMEC 3DHWC 5JSFA 2JFWA 1FJGB 3GLFB 3WDMA 1G4UR 1AUVA 1YOBA 4X62B 4G1UC 1JU3A 5IMSA 4TN1A 4YP0A 1XYGA 4FW8A 4MKXA 3LMKA 1JR3E 3BQNB 2E4YA 3M1AA 3GGSA 4XWTA 4B73A 2DPMA 1DRUA 1B4DA 4LOHA 4MOWA 2OD9A 2XRYA 4QUIA 4LX8A 2UZIR 2BHSA 1JU9A 4PQRA 3ZNPA 2KW5A 1KPIA 3SX4A 2WUGA 2GAIA 2YV2A 2CMKA 4M0UA 1J49A 4L5YA 1IUNA 1ZD3A 3TI9A 1N32B 3IQDB 3RIEA 2NP7A 3CF4A 1FXWF 3COZA 3EUFA 2BKAA 2EF1A 4D0GA 4XFJA 2X6QA 3NUZA 5PGMA 4ZYTA 5EHQA 3HO8A 1RAFA 3ZH9B 1P3Y1 2A0UA 4BMPB 4WH0A 5TMPA 4BFTA 3QENA 2V97A 1VGRA 2ZBPA 3BMNA 2G70A 1P44A 1GO2A 2X6RA 4L08A 2TS1A 2FPRA 3DW3X 3MCWA 3X2EA 1YAHA 1QVAA 2X0RA 4GO1A 2XNDA 4LYHA 5DOZA 4EFDA 1WPGA 1Z83A 3A7EA 3ASYA 5BNTA 1W93A 5G3ZA 5CDTA 1DQYA 3P19A 1ZJ5A 2G76A 2UZ0A 5DRYA 3Q11A 4K8OA 5FBRB 1GA1A 4QL3A 4OAPA 1J5PA 2ASVA 4ZO9A 3UFXB 1R4MA 4D99A 4EKEA 4P38A 1O6CA 3HVIA 3T35A 4S1VA 5AVVA 3RVJA 1BKDR 1XTBA 2FZLA 4QU0A 3ZQ6A 5AUPB 3NMUF 4FE7A 4KWEA 4QWWA 3LYUA 4ETIA 2O07A 3L6OO 5BWCA 1TVEA 5I7HA 2Y66A 1PQUA 4IJVA 3W2TA 2AXQA 3IQZA 2LCIA 3GHYA 4U2CA 4EHNA 4GMGA 2KB0A 1RXVA 1Y4AE 4K0RA 2BGMA 5BNZA 3WS7A 1ZK3A 3EGVA 1NR1A 3U39A 1UAAA 4HNVA 1R1DA 3TQSA 1ELOA 1WDKA 2Q21A 4MQEA 3KZKA 1E5QA 1YQWA 1VKHA 3GLTA 1R27A 3DWFA 1WPXA 2WQ6A 3HBAA 5C3MA 1J8VA 1NJ8A 1TUGA 3IEKA 4KFCA 2HSJA 4JB0A 4NZZA 4XVRA 5IUJC 3FR8A 3I76A 3GXOA 2CHQA 5H83A 4LEIA 2FW8A 2B83A 4EHBA 3VX4A 4ZO6A 2AN5A 3LA6A 1WKVA 5IYZA 1YS1X 1EJ0A 4DPMA 4MW5A 3JVVA 3WZLA 4FM9A 3A14A 5I3CA 1NX6A 2ORIA 3V1MA 4GFDA 4RHCA 1D3AA 3IULA 1BOFA 1ECGA 4KFSA 5C34B 1KSHA 1GPJA 3K94A 1AGNA 3AB8A 3FUCA 4R1SA 5HILA 3ZU4A 1QU3A 1JR3A 3GP3A 3ILSA 4JEUA 3DUFB 4B76A 5IT0A 5G4KB 1OZAA 1PR2A 3NOVA 1ZD1A 2Z08A 4M1MA 3UGQA 1M2VB 4B2YA 2FPPA 4JA2A 4A36A 1NJGA 1FLDA 1AHIA 2DR0A 2OAP1 4LF9B 2CMHA 4NJEB 4CIAA 1LDYA 3IUSA 2VKTA 2VAWA 4PEVA 4PRYA 4B0PA 1KYVA 6YASA 5G2OA 2IW3A 4BLQA 2WF8A 3NLLA 4IRUB 2NXNA 4PCAA 3IAS1 2FWIA 3NEAA 1U1GA 2VLBA 4ZWNA 3LP5A 1EVQA 2RJOA 2ZT6A 3O21A 5CVCA 3QVUA 2EQBA 3CNOA 1G1MA 3IH5A 1RM0A 1VIYA 2J3MA 1GV1A 2J9RA 4CIWA 4HAZA 2AG0A 4COKA 2Q5JA 1SUCA 1YA4A 1U7PA 4J3JA 4RGQA 1SKMA 1IPFA 3DZDA 1HYQA 3IAUA 1WV0A 3DL4A 4UBIA 3N28A 4I7EA 2C4VA 4L5CA 4WVFA 3V4LA 3WWDA 4LPSA 2X1LA 3I8OA 1T6YA 1ACLA 2WG0A 1HFJA 1AQLA 1UKEA 2XUKA 4OJNA 1B43A 5EJ4A 3CW8X 2BBOA 1LJUA 3BD9A 2B4AA 4PRLA 1ILEA 5JXGA 3GN1A 4EEKA 1OTHA 1XDSA 3BF8A 5HTOA 2I91A 3WLPA 1R6TA 4CV3A 1B6RA 1EFVB 1U99A 3HBMA 3R3JA 1NFQA 1JQBA 2XNCA 3RYHB 4C7BA 3RTBA 3HCRA 3SXPA 3VU3A 4LTNA 4ZOCA 3RVQA 3ZEAA 4CMIB 1XPRA 1OWNA 1L7BA 2MSNA 2NU7A 3LOUA 2HQSA 2Q7OE 4B3FX 3GJ5A 4D42A 1JLLA 3V7YA 3T95A 2OWEA 2VHJA 3EPPA 5FWYA 5A3JA 3IESA 4H0NA 3M6WA 4D81A 5IT9A 2MINB 1QIIA 2BTOA 2VZ8A 3K9BA 4TTSA 3OPMA 2NU8A 4TYYA 3MGCA 1AN9A 4P3OA 5TJ9A 3UO8B 4YCSA 4ZEVA 1KAGA 2A5LA 2PS1A 4C2AA 2IP4A 1W1WA 4UAUA 4M21A 3FNRA 3R74A 4JL5A 1YJCA 4RTOA 3BH0A 2CUNA 1QIDA 4YJFA 3R7SA 3V1KA 3O3NB 2PL3A 2YQ4A 3AI2A 2XUAA 3JSAA 3QX7A 4AZVA 3ZBQA 1KI6B 3K8YA 3WLLA 5B1SA 3UUWA 1G21E 1E2HA 1TUEA 2DULA 5A05A 4FBMA 5L3ZA 3HVRA 1YR9A 2BVNA 1Z16A 2WQZA 4DABA 1AXEA 3DKIA 2G71A 4MUHA 4EX7A 5LU9A 1UK6A 2PIAA 1RWOA 4W7SA 4P36A 1P18A 4Z4EA 5J1SB 3FF4A 2QSJA 4BMSA 3PI6A 4CLOA 2ZUSA 4R9UC 2FZEA 3HNRA 4G07A 1SAYA 1P7CA 2DU8A 3CRRA 5TPZA 3CLUD 4GKVA 3IQEA 1IZYA 2AN1A 1AURA 4LXTA 4YP6A 3WQSB 1GAEO 1ZESA 5EAIA 1DC6A 3JAKB 1KZ6A 3V9AA 5KTKA 2QUIA 3P9PA 5TGDA 1Y6ZA 3IJPA 1PFUA 4ZZIA 4RXTA 2OV1A 1NP6A 3K9WA 3PDHA 4HI0E 1EA7A 4YRDA 2QTVA 1TXGA 4ZOLF 5HS4A 4O2AB 1M5RA 2PWYA 1ZEJA 4MMXB 1R4AA 1SZPA 3GLKA 1VGVA 4NBLA 4PLTA 4Y2UA 3TLKA 1JDBB 2BJHA 3MCAA 3OE1A 1KU6A 5CDFE 1DFGA 4C4YA 1IWOA 3V3TA 1AKUA 2ZR8A 2GEFA 5F76A 4YRLA 1EM8B 2I8LA 1HWYA 2V9CA 4UCFA 1BE8A 3WJ7A 4ARVA 1EGVB 4MTLA 4B3RB 1PJRA 2O05A 1JFFA 4FYXA 4I1UA 2XNJA 4Q24A 4UULA 1L5RA 1HMYA 3ISTA 1VRCA 2NUTB 5SY9A 3OMXA 3G0DA 1Z0KA 4PQFA 1W4LA 3U7RA 2AG1A 4FDMA 1NYLA 1CR6A 4ZANA 1NN0A 3OX4A 2Q27A 3CISA 1KAHA 2IZ6A 2PCLA 4L0QA 5F51A 3ZCQA 5DXAA 3ZKWA 1M2HA 1NLZA 2GHTA 5E6SA 5E3HA 1ARZA 4OHCA 4HRAA 4G65A 2IS2A 3CTPA 1K8ZB 1QDUA 5TPZD 1PD1A 3UT0A 2V6JA 1DCTA 1YD7A 1KI8A 5AVRA 3RJZA 2CNLA 3BGOS 4IWNA 1Y8CA 1JDPA 1QQBA 1DAGA 2J9XB 3CX6A 4NK4A 2OSVA 1TB4A 1V1JA 3T1OA 2JFOA 4EABA 4JK3A 4WSOA 5BWOA 1LCIA 2J5QA 3I04M 4LOJA 3WKBA 1V16B 3D0OA 1MB9A 4DYDA 2C31A 3SZRA 2H1RA 1N6NA 4M0MA 4YRZA 2YVLA 2PWPA 3GJ3A 3EVEA 2VCEA 4PICA 3R8XA 1YZVA 3DA8A 3I2KA 3I92A 2B0JA 5F1PA 3T15A 1M2JA 2HHCA 4OD0A 2V59A 3RQIA 3WWYA 5J63A 3SLRA 4DILA 2CNWD 1EX1A 4NFYA 1WOMA 1Z75A 2C20A 1Y1TA 3RUIA 1JFLA 1TJPB 2QM3A 1IBMB 2ZJBA 1U2TA 2E1PA 2H7VA 2IE8A 5AWFC 2AQHA 1SKAA 2GLXA 3CZAA 1AM4D 4FFPA 3C3BA 3RT1A 3VUFA 1MB4A 4JMLA 3WYBA 1RHRA 3UOGA 2JG3A 3PL5A 1BS2A 1FBNA 4JQOA 3ETGA 2CMDA 4ITVA 4ROTA 4Y2JA 4JH0A 4O4IA 1TA0A 2AR9A 3B60A 3VO9A 1TU4A 1T34A 2A59A 3IMCA 4FNOA 4R31A 3WMFA 5LQSA 4QGFA 3RYIA 1SKUA 1DCMA 4H4DA 4Z1MD 4OCZA 5LNK1 3OPNA 4J6EA 2VHEA 1K27A 1ONNA 2XZLA 2VSXA 3AHFA 2G7MC 1PUJA 2QN2A 3ACBA 1MD9A 1NKTA 2JGFA 5J59A 3VYTB 3HB0A 2JEYA 2PGJA 2BI7A 2V4ZA 3NWPA 3MWLA 4ABTA 3CX7A 3FVQA 1X80B 1PJ4A 4Y2QA 2R1UA 2XRFA 3C5VA 5IJ0A 2J3IA 3PIRA 5M2QA 4WNIA 1BHQ1 2QSUA 3HKEA 1EP1B 3IE1A 1Z47A 1M6HA 1PP4A 5AKZA 3H83A 4WHMA 4KQIA 1X2EA 3A6DA 2QORA 4N9WA 1EIZA 1M2OA 2A7QA 2YHUA 1L1RA 3PXGA 3VPXA 5HFAA 5C8YB 4ZN6A 4LNUA 3OCUA 2P0YA 2V7XA 5KEIA 1Y1PA 2VYVD 1JNYA 2QA5A 2G5CA 4NYJQ 3G6WA 3PI7A 1F0NA 4JT9A 4WNCA 1E1NA 3D3NA 2JVKA 1JV2B 2AXEA 3HP7A 2QZ9A 3C85A 5LXTB 4MV5A 4Z49A 5JU6A 2P2ZA 3OFND 4FHCA 3VR5D 5IK2A 4TL9A 1UWCA 3PQ7A 5KVAA 3EFOB 3QY9A 2XCSB 2OG2A 5A0TA 2ZI7A 3G2OA 4BIIA 3LBFA 4F4CA 4DA7A 5LR6A 1GADO 2EKZA 2C0CA 3KZVA 4ZGWA 4RF2A 4AN4A 1QH1B 3H2SA 3HDYA 1I4DD 2JDID 3B36A 4DMCA 1EFKA 3DOJA 2B2CA 4LZOA 3JAWB 3G1WA 2Q3JA 4QOHA 4UUPA 3W7VA 4ZYVA 4DB4A 1M0SA 3T3EA 1NWCA 1MOSA 4IEIA 1MFPA 2WE8A 4ANFA 3MK31 2A4KA 5HZHA 5ITZA 4QDJA 3DBIA 1HX7A 3W6ZA 5E9JA 4CF7A 5D6NA 1E89A 1N2JA 3BL6A 5C37A 4YIHA 5L3RA 3OQNA 2TRSB 3DQZA 1RQNA 4DG8A 1C7IA 1JG7A 1AJEA 4YUXA 4X93A 1FP4A 1AIPA 1FVOA 1C1XA 1J2RA 1HKHA 5LCXA 1E7YA 3EEYA 1Q1AA 2AUMA 1E5XA 1EVJA 1I6LA 2GESA 2PMDA 2ZJ4A 2R8ZA 1OVMA 3BSWA 1OH5A 1QPBA 1MX5A 2PXXA 3EHEA 4KJZA 3RVNA 4GLBA 4RV4A 2JLYA 2YMLA 1PNOA 2V7EA 5KU7A 4UEJA 2FEWB 1C2TA 4FGSA 4KQ2A 3AUJB 1KH2A 1QNLA 4Y6GB 3IB6A 1T43A 1MUUA 4YDQA 4JUAA 3LM8A 1T9ZA 4HDSB 4LGVA 1IWPB 2NO0A 2JZOA 3BFJA 3PWTA 4ZVVA 1L4GA 1TA9A 1INLA 3BXOA 1P81A 2GZ1A 3KK0A 1S2GA 1Y6JA 2I2FA 2X0KA 4GLJA 3BT7A 3QU2A 4GUDA 2EKBA 4RY9A 3CMCO 3KCQA 4EA6A 3PX7A 1J2TA 4YYZA 5AD1A 4BX3A 3H2KA 1PNQA 5BNWA 2B8JA 3UAGA 1DGQA 1FFEA 3G5AA 5CT8A 3R09A 1VZ2A 1NULA 1KKMA 2ODEA 4JLDA 3HKBA 3GCZA 4FX5A 1FPMA 4WXPA 4WZ6A 1Y1QA 4Y9TA 2ZUBA 4ZOBA 3R3UA 3A10A 4H1HA 1IUPA 3AYZB 1AUQA 1D1SA 4RADA 4A6XA 3IEIA 4YRNA 5ITSA 2LDXA 2W37A 3QEOA 1XHEA 5BSKA 3N8KA 1O97D 1BH2A 3MJVA 4HQ0A 2HV8A 2VJBA 3E18A 4OA8A 2H31A 1CF4A 1NNI1 5IBPA 1IB0A 1M5TA 2ALJA 1PF7E 4FW9A 2D3TA 4GBED 4WLOA 1Z0IA 3F2VA 3A9SA 4ZYWA 4TXMA 4D9FA 4L8WB 1FMJA 1PK8A 1N7JA 1RXIA 2NO9A 5KREA 2I3AA 4DZRA 3C1TA 3ZE8A 4R71A 2I6GA 1IK6A 1FYFA 1I13A 3CQ9A 4M0EA 4ND3A 3ZHYA 4JGIA 1K4KA 4TWAA 1ECLA 2WDPA 3U56A 1U11A 1RRMA 1Y3IA 3I9LA 2G4VA 3K3PA 1PT5A 1U5AA 4QODA 3RJTA 1J9GA 2ERYA 4IDNA 3I9NA 2AEFA 2G72A 2XQFA 5THXA 3VH3A 1IHDA 1V7PC 2Q5OA 1JKIA 1AZSC 5IHPA 4RV5A 3O26A 1PL0A 4QEKA 3HCEA 2Z9DA 2QJOA 4NYIQ 1EJ2A 1VLJA 3QE2A 3QVWA 2Q49A 3OF5A 3TB4A 4ZQFA 1L5NA 4HUQB 2W7TA 5GVRA 3I5AA 3AUXA 2QG6A 1Z5WA 3LBNA 5E1OA 5REQB 4TXLA 1P2VA 2L2QA 2ZREA 2V65A 3IKLA 2EX0A 2X0NA 2SBTA 3NHBA 2JFGA 2ACVA 4PLPA 3I9OA 3CNBA 1YZTA 3TQHA 3I9KA 1PRYA 4RVOA 5JCPA 3C3JA 1EUYA 2J46A 1TAUA 1QK3A 2XUDA 4EZIA 4JDPA 2H2HA 5AJXA 5F3RA 2NZVG 4FR5A 4WT7A 1MZPA 2VAPA 4OBBA 4P92A 2I8AA 5H3LA 3PUKA 4WLEA 4AN1A 1RM3A 3WKEA 5I7UA 3P2OA 1G55A 2GM9A 2Y0DA 1ZUWA 2XJ9A 3CXRA 3RW9A 4NZOA 1A98A 2YTZA 2GA9A 1Q0ZA 4JD5A 4D4LA 5AVOA 3T61A 3ZZNA 5A06A 2CVFA 1KQ3A 4E08A 4FWTA 4BFLA 2GILA 2ZIXA 5CT9A 4YV0A 2IV7A 5IKPA 1ETUA 4HQNA 1DXHA 1ULSA 4E5MA 2X8LA 4HDOB 4M7PA 4X91A 2ZRCA 5E0KB 3BWBA 4H7EA 2OV4A 1QKJA 2B7LA 2M6LA 4EL0A 5JLAA 2J32A 3OQOA 3CEJA 2ZTMA 1M2KA 3FX2A 3P9SA 3SEQA 4LRWA 1VYHA 1E4VA 2BEUA 4IXMA 3TR0A 3UPUA 4MQ4A 3OPVA 1JB9A 5JCXA 1QSGA 1JVSA 1X7WA 2PX8A 4G0ZA 1NE2A 4BCCA 5ALTA 1IIBA 4CFZA 3LHFA 3DE6X 4WV3A 3QVTA 4YVFA 2JH9A 2DRIA 2E4AA 3T9DA 2WWFA 4K46A 5JRZA 3L01A 4IJQA 1BYUA 4PO8A 4C2BA 2H4WA 1Z7BA 4MW1A 2EFYA 2RONA 3X1JA 4BB5A 1M2FA 2VXYA 1SBTA 1K2VN 1GR0A 3R8CA 4BV3A 4DLVA 5EWMB 2IA5A 4GE3A 3RS8A 1RLUA 2C59A 4EPXA 2O8FB 3D5EA 3MZ0A 4TWRA 1XTUA 5DV9A 2I71A 3WK4A 2PH5A 3IP7A 2CEKA 1PWZA 1OFUX 3BFPA 1ID1A 3COSA 3CR3C 3IAXA 3OD5A 5CM2Z 1WNFA 4KAJA 3G89A 3SYTA 3T3OA 1K89A 1W4BA 4YCJA 5ECWA 4Y6OA 3NHLA 2NPFA 2BHNA 1MAWA 5ABPA 4RIHA 5EGSA 4LBVA 3PR2B 2QN7A 2WTXA 4YRFA 3K0HA 3NONA 3RH0A 2BTQA 4EIWA 2YHAA 1YQEA 3HR7A 4C0LA 2XGSA 2GKOA 1KJ9A 2PT5A 4D9NA 1JQEA 1JFSA 2WYUA 1Q44A 3BREA 1RWPA 3P9NA 1J8YF 4AX4A 1S8NA 4DEYA 4J76A 5B3LA 5A5GA 1I80A 1HRDA 3IE2A 2WJJA 4Y2XA 1E1QD 3V8NA 4NDNE 1OROA 4KR0A 4Y2SA 3GDWA 1IY9A 2H16A 3D4IA 3HCWA 2YQ5A 1YS7A 4UVGA 3UMGA 5JXIA 1X19A 2W6MA 4MWDA 1F0YA 2KS6A 3HFJA 4HGNA 5FPYA 2DJ5A 6GPBA 3NH9A 1UFOA 1TMYA 4OSPA 4KXFB 1M34E 3DBLB 2WEKA 4GX5A 3LHIA 3G02A 4MQFB 2VP4A 1XQ6A 5B3AA 1YSCA 2LUOA 4MUIA 1UM9A 4N3AA 5ALFA 3VPGA 4DRXB 5KNDH 2FPIB 3EAGA 4HMPA 4BZPA 5EOVA 4EJSC 2XV1A 4ARAA 1KA9H 4LYEA 1YRHA 1J06A 2W6ID 4OLBA 1JX6A 4WCDA 2GBLA 3I30X 7ABPA 4M1TA 3G23A 4C08A 3JQGA 4D9BA 3ZS9A 2ET6A 5BV2P 2C2MA 5C2JB 4FP9A 3CLTD 3UUFA 4BFZA 2PO7A 4YUAA 1NLYA 3HXOA 4MO9A 3GMIA 3NHAA 2J59A 1GTZA 3K1AA 5EIAA 3UWDA 1RHJA 4GU5A 3SQOA 2JIRA 4G1EB 3CNNA 3DDNA 3ZK7A 3AJEA 3N0XA 7GPBA 4QJBA 4B48A 3H5AA 2B21A 2CXRA 2IDJA 3KYDB 5FPTA 5B4TA 1LPAB 4URFA 2BGNA 2WLTA 3C8UA 1YFJA 3LOQA 4N8SA 5IASA 2BD0A 2DECA 3OU6A 1S2MA 2UUBB 5KWEA 4D26A 1YR6A 1WXGA 3GVCA 1G6KA 4FLFA 2P5SA 4WNAA 1RAHA 5F2OA 3RUDA 3UC5A 4BVJA 4X84A 5A9SB 3UVEA 1FFCA 3O4IA 3B85A 3WMGA 4ER7A 3BC1A 2F3PA 1TKCA 1GRNA 1U0FA 1VPVA 1ZNQO 3ECAA 3PRJA 2QRLA 1O08A 3IEPA 4GMHA 3KWJA 4KLRA 2QVYX 3CUUA 3EVAA 4IVPA 2BFNA 4L8GA 2B37A 3P4UA 4ITUA 5LC1A 2JIZA 2BI8A 1XMIA 4LF6B 1U8YA 3BE6A 1YCFA 3ADPA 3Q6MA 1HYHA 3QKWA 1E5LA 4V38A 1BGXT 2O1XA 2C5BA 4F3YA 3ES9A 3LWBA 4Q7JB 3NI2A 4G0NA 1IBCA 2OWDA 3SNKA 1NBMD 4RVUA 3MWGA 3LLUA 2WG2A 4ILKA 3TZKA 5ICGA 5L95A 1DUSA 1ZH0A 1OLUA 3D0KA 4X20B 3DFKA 3K72B 16PKA 1IQPA 5LXTF 1E0DA 2C2OA 1RP1A 4O8CA 5DBEX 3RIXA 4D6YA 3P8ZA 3AVTA 3IC5A 5F1OA 1TO2E 5A0VA 3ZWAA 1UBHS 1E7QA 2C5AA 1A0OA 3LQQA 1I2MA 2BGTA 3K2EA 3W8EA 4F1JA 3T5MA 3I6ZA 3O8OB 1XBTA 3V1LA 2Q4TA 4Y9UA 2YN0A 1D9ZA 1DJQA 5HJ7A 2PX5A 2XUJA 2Y1DA 4N47A 4NBVA 4Y0VA 1KPHA 2DUWA 2G7ZA 3L79A 3VDNB 4EQ6B 1NBHA 4MGIR 1GKYA 3PHCA 4CM9A 3L6DA 3SJCA 1RE0A 3ONEA 4JIGA 4NI5A 1W6RA 1U0EA 2Q07A 4HAWA 4UFNA 5ALXA 1LF0A 2BZ1A 4BWVA 3EXIA 3O3CA 3O0DA 5FOUA 4GMXA 2K2WA 1JVNA 4IPTA 3UMRA 2CVPA 1C81A 5LFAA 1KIMA 4P7GA 1NKSA 2WWGA 4JJIA 2ZRBA 1E2NA 1ECBA 4K6HA 1H94A 1NL3A 3QRWA 4DMKA 2ZJ6A 1E9FA 3C6MA 3S2IA 4P6VF 5EFZA 1PG2A 3WQRA 1SQ0A 4QYIB 1XFDA 2QRGA 3B70A 3LUBA 3P5SA 3FWPA 4YRRA 5IN4A 4M6WA 2V7UA 2COKA 3BCUA 4OQXA 1Q14A 2LBPA 2ZUUA 4KWHA 2X5JO 4RFSB 5EKTA 3B1XA 5T6MA 2BMAA 3AHDA 4Q47A 3GUHA 4UEQA 1A4UA 3HMKA 2YWEA 1XVTA 2G07A 4K9SA 3ADKA 3ZU3A 4U3JA 4L9SA 2WSMA 1KEEB 4HGZA 5BO5A 2FRDC 2P3QA 4BKMA 3GI1A 1Z15A 4KYVA 4O2BB 3A58B 4U6SA 2FXVA 1W7AA 3ET5A 3EXG2 2RAVA 1VCHA 4IVNA 1MAAA 1CUIA 2H85A 5CIWA 1PYDA 4E2WA 4YUWA 3AIOA 4C3ZA 3NOQA 3SOZA 1O94D 3DOUA 3RG2A 1I2BA 1G7CA 2F17A 3CE9A 4OHRA 4OP1A 3MAGA 1HT0A 4L78A 4XPIB 4E3ZA 1BFDA 4U8HA 3VPFA 5L3VA 3EX7C 4LZZA 5K3EA 2PY6A 1A9RA 3FVVA 1M0WA 5J5CA 1GPNA 3PP8A 5JZVA 4LJLA 3N8HA 2Q5HA 2OILA 3QJYA 5EMKA 1XDWA 4TS1A 1W2WB 2WHPB 1VDMA 3PD0A 4R2HA 1S2IA 1JMKC 1R64A 4NH4A 4X6YA 4ABYA 2WP8J 2LRHA 5DZSA 3DV9A 2SKDA 4ZAGA 3C4VA 3JWGA 4Y2GA 1W76A 5AM5A 3P2YA 2YFYA 1QFJA 3OEEA 1JQDA 4PLFA 4QVIA 3LRTA 5LLTA 4M83A 4V2IA 1MIOA 2GASA 1DOZA 1FYWA 2ZSDA 5DB4A 2JEZA 2M98A 1A1SA 2FRDA 4QHTA 1E58A 1ESCA 4DSZA 4D8TA 5K6AA 4I4LA 3DMFA 1RPAA 3ROPA 2NT4A 1Q83A 2OBNA 1R5BA 3IAHA 4HG2A 1GLVA 3PEVA 4QDTA 4QTTB 1T10A 3RUPA 4KUEA 2PGAA 1A8UA 2ZRQA 2EEZA 3OBBA 2W4IA 1G41A 3B6JA 5LWQA 2BFBB 4HN9A 1ZBDA 2WIDA 3ZCRA 4UPEA 2C4KA 1FRFS 5FR2A 3MXTA 4LF8B 5CTAA 4YDSA 3RBAA 1ZGAA 3M8KA 1MT0A 2A0YA 4C6TB 2G04A 1DTEA 3BERA 3EY9A 4BQQA 4E4RA 4UMFA 1D0VA 2VSNA 4RKFA 3DKKA 1XAGA 1GQYA 5KC8A 2AE2A 1W9MA 5KWIA 1MQSA 3Q8LA 1CYEA 3LCRA 1SXHA 3OLXA 1XZNA 4UUMA 1R74A 4O4HA 3KOZA 3U3JA 5JQGA 3HQ4O 4L3VA 3M49A 3RBVA 3TVYA 1Z4QA 5DNUA 4IHQA 5CB6A 4LQCA 4NWIA 5FNVB 5CVJA 5AM3A 4YRGA 3K9NA 2ORED 5K03A 2BLLA 3UHAA 4BFVA 4E4TA 4G97A 4XH9B 2Z5FA 1MT3A 4Q1AA 3NRCA 2HA4A 1FFWA 1I7PA 5DEIA 4CQLA 2GD1O 4ZU3A 4W8OA 5B3JA 5JNRA 4QVGA 1LI4A 1CZLA 2HQ1A 4KYUA 4O59O 2AJTA 1R4ZA 1O77A 1YDMA 3AUFA 3JQAD 1YL5A 5HR5A 4CTJA 2VDWA 1CUVA 4PG7A 3M9XA 2JFQA 5DK4A 3BGIA 4HGQA 4EARA 1A9OA 2QQEA 2MHCA 2BE9A 1DQPA 3EQ6A 3TEJA 4AZ3A 5CX1A 1QOPB 1VSQA 2R4UA 5IZ4A 3Q8MA 1SM4A 2WHRA 4Y2RA 1G16A 2V4MA 5EJ5A 2XGJA 1RQ7A 4RPLA 4QREA 4BNVA 4B74A 2XUOA 1Q0PA 2JRLA 4MGYR 2O2XA 5FTNA 3S27A 3UJ3X 1FX1A 3T6KA 1BDIA 1UFQA 4Q12A 3JQEA 2FWAA 2AQIA 3QVVA 4UVDA 5JASA 4HV4A 2ZBFA 1T4GA 4NULA 4HATA 2PS0A 3S28A 5B37A 2IF2A 1UIRA 4OHBA 3V4FA 1O95C 4CKCA 2PBLA 4KQFA 2AN3A 5B4UA 4QX6A 1GU1A 3FCYA 1FMTA 5LQDA 3G0IA 1T5IA 3AF1A 3CJQA 3S40A 1JYFA 5L7YA 3THYA 3PEEA 3HB1A 4L74A 4Q01A 1QHYA 4CI9A 2AVNA 3P9QA 2QRKA 2WVJA 4IZHA 2PGOA 4MKRA 4ARZA 1NXOA 2JCXA 3L7BA 4OP2A 3EF1A 3FB1A 4D0RA 3PQ2A 2HV9A 1V4NA 3G0BA 3PFWO 3PXBA 3WY9A 3AJDA 5C4IA 4HEJA 1QP8A 1PCXA 3HACA 2IT1A 3JQAB 5JANA 2XDQB 4BO8A 1HFEL 1DKRA 3QOFA 3QIAA 4DUGD 2IH4A 4OTZA 1AOXA 1T26A 4RAOA 4OSEA 4UASA 5DJ5A 2X7XA 1PV2A 2ONCA 2VH2A 3O1HB 3EE6A 3VHRA 3BRQA 3LPLA 4XUCA 2EFJA 2Z2KA 3EXFA 4ISBA 3RGGA 3QA3E 4EBBA 4MW4A 1GCOA 3SOPA 1WOYA 4E6PA 4EKDA 3R20A 5AXCA 4PQGA 2Z2IA 5GWXA 3RIMA 1B16A 1VL2A 2EKQA 4LWQA 4A0HA 2VUHB 4H3SA 2CHEA 1AQJA 2D7CA 4Y6SA 4UM8B 5JAHA 4JGGA 1F12A 1H0KA 1RT9A 3LKVA 4MAMA 2RK4A 5T57A 1LQUA 3RBXA 1RJ9B 3VGJA 5K6AC 1OA0A 2QWXA 2Z0MA 4PPYA 3KUXA 5EJEA 2HF9A 3A3YA 4JQYA 3T99A 5KKNB 3PTZA 5AI0A 4Z8YA 1EK1A 4PWYA 5E1MA 3V4PB 5JNTA 1Z8HA 1M8FA 1JHZA 1CJUC 1ECCA 4Z8XA 2CNDA 4MYHA 2VSYA 4CMGA 4BMZA 4D4KA 3COVA 3DFIA 1JEYA 2QV7A 3AJRA 1MZVA 5ARBA 2IOYA 3L8MA 4XOUA 1B0AA 2NXWA 4E7OA 1WD5A 2FMUA 3QBVA 4W9RA 3LCCA 5DCUA 3ACCA 4PTLA 2JEOA 5CDUA 1PLKA 3HPRA 4TS9A 1W29A 3N6VA 3UV3A 2UKDA 1CC1S 2Z6VA 1QLHA 1ZWLA 3NXSA 4PAGA 3KG2A 2YZ7A 5AJYA 2ZTVA 4JCCA 2H1FA 3LZ6A