2O28A

Crystal structure of gnpnat1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
182
Chain Sequence
PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Glucosamine-Phosphate N-Acetyltransferase 1
rcsb
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2o28A01
2VQYA 3VWEA 3JUWA 3F0AA 2FL4A 2HV2A 3P2HA 3QB8A 5F48A 1KZFA 4ORFA 3N7ZA 4QB9A 1Z9UA 1XEBA 2ZW4A 2PSWA 4EVYA 1S7FA 3R1KA 2JDDA 4XPDC 2JDCA 1S7NA 2ZXVA 4KVOE 4U5YA 2PR8A 4I49A 1ON0A 4AG7A 1L0CA 5C82A 1MJ9A 2VBQA 4LUAA 2OB0A 4R3LA 1S3ZA 4U9YA 4KOYA 2J8RA 4JD6A 2J8NA 3TTHA 3GY9A 1I21A 3BJ8A 1LRZA 4RS2A 1OZPA 2Z11A 3KKWA 3P2FA 1S60A 2Z10A 4X5KA 2B3VA 3JVNA 4QVTA 2D4OA 2F5IA 1Z4EA 2DXQA 1B87A 2Y0MA 2G0BA 3TOBA 2GANA 3R96A 4KZTA 1CJWA 4XNHC 4LX9A 2ZPAA 4QBJA 1Q2CA 3DDDA 2Q7BA 3D2MA 5J8CA 4FD6A 4R57A 1V0CA 1K4JA 1KUXA 3R9GA 5CNPA 3S6HA 2REFA 4UBRA 4CRYB 2Q4YA 5HH1A 4YFJA 2REEA 4IUSA 1IICA 2Q44A 4KOUA 3ZZIA 1UFHA 1IYLA 3CXQA 2NMTA 1RXTA 2GE3A 1Y7RA 2G3AA 3EXNA 4Y49B 1QSOA 3T9YA 1I1DA 4KVXA 1Q2DA 1S7KA 4AB7A 3OWCA 4AVCA 1WK4A 4KVME 3QAHA 4IF5A 3TE4A 4B5PA 4FD5A 4MY3A 3TT2A 4E2AA 1BO4A 2I00A 1Z4RA 3CXPA 4PK3A 1QSMA 4GS4A 1FY7A 3LD2A 2K5TA 4H6UA 1NMTA 2WPXA 2EUIA 3TOAA 1M1DA 2OZHA 4PV6A 1YVKA 2G3TA 5DWNA 1XE4A 5I0CA 3D8PA 2ZW7A 3FYNA 5EC4A 1QSNA 3R9FA 2HQYA 4MHDA 3K9UA 4J3GA 5FVJA 2PRBA 5KTAA 4YGOA 1VKCA 2OZUA 3ZJ0A 2O28A 5ISVA 3EC4A 1YK3A 2P6GA 2FS5A 4OLLA 3PGPA 3FB3A 4B5OA 4PK2A 2BSWA 2C27A 4E8OA 3SXNA 4E0AA 3TFYA 2FIAA 4KOVA 2B5GA 2VXKA 4R87A 1M4DA 4MI4A 3FRMA 3BLNA 4KOTA 3VWDA 3FIXA 3E0KA 3G8WA 4JWPA 4L8AA 4MBUA 2R8VA 1M4GA 4II9A 5JQ4A 4K30A 4PSXA 4HNXB 3S6GA 4XPKA 4ZBGA 1NE9A 1SQHA 3WR7A 4NSQA 4CAWA 4UWJA 1Y9WA 4KOWA 4CRZB 4R9MA 2P6EA 2B4DB 4KUAA 4L89A 3W6SA 3TO9A 4RI1A 1R57A 4CS0B 2FE7A 2VZZA 5GCNA 2Q0YA 2EVNA 3DR6A 1M44A 4NXYA 1YREA 2ZW5A 4MY0A 3D2PA 1PUAA 3CXSA 2RC4A 1MJBA 2OZGA 2VZYA 2J8MA 2B58A 4QUSA 4KLVA 1PU9A 1MK4A 1S7LA 4JJXA 5EBVA 2PDOA 3V8IA 3S6FA 4BMHA 4FD4A 2QECA 3C26A 1IIDA 3DNSA 4KUBA 5C88A 4HNYB 3R95A 1NSLA 1P0HA 3IGRA 2X7BA 1YLEA 1QSTA 1KUYA 4Y49C 1Y9KA 4KORA 2PC1A 2BL1A 4CAVA 4YRHA 4XPDB 2PQ8A 5IB0A 2KCWA 4MJ8A 5IX3A 3G3SA 2B3UA 2FIWA 3F8KA 3FNCA 1QSRA 3EO4A 4PSWA 1KUVA 4NCZA 4AVAA 2AJ6A 2CNSA 4M3SA 3FXTA 1IB1E 2B4BA 3S6KA 3NE7A 3EFAA 3EY5A 4KOSA 3IWGA 3TO7A 5F46A 2FT0A 1IYKA 3LODA 3PZJA 2VEZA 1J4JA 2ARHA 2HUZA 2FSRA 1I12A 4XNHB 3DR8A 3W6XA 3D3SA 2I79A 5H86A 4OADA 1CM0A 1YGHA 1GHEA 2ATRA 2JEVA 1S5KA 2CNTA 2R7HA 4NF1A 4H89A 2Z0ZA 3B8GA 5IV0A 2R98A 2Q04A 4KLWA 3DSBA 4XPLA 2JLMA 2ZW6A 2GIVA 2BEIA 4H6ZA 3W91A 3SXOA 2CNMA 1BOBA 4UA3A 4HKFA 1TIQA 4NEXA 5KTDA 1WWZA 3TCVA 4B5PB 1XMTA 2R1IA 3UY5A 5J8FA 3H4QA 4AG9A 5HMNA 4AVBA 3I3GA 2P0WA 1Q2YA 4JXQA 2VI7A 3R9EA 3I9SA 3BJ7A 4R3KA 1YX0A 2QMLA 5E96A 1U6MA 4U9ZA 4QC6A 1XF8A 2D4PA 2OH1A 3GKRA 2FCKA 5F47A 2CY2A 5H84A 4F6AA 1YR0A 4FD7A 5DWMA 5KTCA 4DNCA 1B6BA 2P6FA 3TO6A 1VHSA 2A4NA 1YVOA 2BUEA 4UWIA 3T90A 4M85A 2B4DA 3SHPA 4F0YA 5F49A 2FXFA 3GYAA 3RYOA 4JXRA 2WPWA 3FBUA 4JLYA 4OAEA 4ONUA 3F5BA 2PR1A 4KOXA 1N71A 1XIXA 2IL4A 3MGDA 5JPHA 1P4NA 2Q4VA 2AE6A 1M4IA 2B5GB 1MJAA 2QIRA 1RO5A 4HNWB 2OU2A 4CAXA 2H5MA 3PP9A
chains in the Genus database with same CATH superfamily
3D7GA 2C6CA 2VQYA 4OC3A 3SI2A 3VWEA 3JUWA 4M6IA 2CTCA 3WC7A 3F0AA 1CP6A 2FL4A 2HV2A 2Z3NA 3P2HA 3QB8A 1CPXA 2HB6A 5F48A 5I4MA 1KZFA 4OC4A 4ORFA 3N7ZA 1R3NA 4QB9A 1Z9UA 4C2XA 1XEBA 3NFZA 1TF9A 4TNUA 2ZW4A 2PSWA 4EVYA 1S7FA 3R1KA 2GLFA 2JDDA 4XPDC 2JDCA 1S7NA 3JRUA 4MFKA 1Z5RA 2PJ4A 2ZXVA 3NH8A 4KVOE 4U5YA 4FWUA 2PR8A 1ARLA 3D68A 3B35A 4I49A 1ON0A 5THWA 4AG7A 2IQ6A 1L0CA 5C82A 1MJ9A 2VBQA 5F46A 2ZEGA 4LUAA 2OB0A 2PE3A 3FH4A 3IIBA 4MFQA 4R3LA 1S3ZA 3B3SA 4U9YA 4KOYA 4RUHA 2J8RA 4JD6A 4F8ZA 2J8NA 3TTHA 1ZO0A 1YW4A 2C1CA 1H8LA 1I21A 3GY9A 1FT7A 3BJ8A 1LRZA 4NGMA 2ZEDA 4B12A 4RS2A 1OZPA 2Z11A 3KKWA 3P2FA 1S60A 2PCUA 1TKFA 2Z10A 2CTBA 4X5KA 3JTKA 2B3VA 1OBRA 3JVNA 4KSFA 4QVTA 2O53A 4UCMA 2D4OA 4CGNA 2F5IA 2CIJA 1Z4EA 3IU1A 2Z3OA 2DXQA 3WT4A 1B87A 4ZY2A 2F7VA 2Y0MA 2NSMA 1HEEA 4FBEA 3PFEA 1LFWA 2G0BA 3TOBA 4R7MA 1XMBA 2PJ9A 4EMEA 2GANA 3SI1A 3R96A 2PJ3A 4KZTA 1CJWA 2ZENA 4XNHC 4LX9A 2XEJA 3ISZA 3SJGA 2ZPAA 4QBJA 1Q2CA 4F9UA 3DDDA 2Q7BA 4P4JA 3D2MA 4MHZA 4FAIA 4PXBA 1ELLP 2YGWA 4YWYA 5J8CA 4FD6A 5JGFA 4PPZA 4R57A 1V0CA 2ZOFA 4B13A 3NH5A 3BHXA 2YNCA 3I1UA 3HLPA 4OC5A 4EWTA 1BPNA 1BAVA 5F09A 1K4JA 4A39A 1KUXA 3R9GA 1YQEA 5CNPA 4BD9A 2AFZA 3S6HA 2REFA 2V8HA 3TC8A 4LQ6A 2ABZA 4UBRA 1JWQA 4CRYB 2Q4YA 3RNZA 5HH1A 1YSJA 4YFJA 3D7FA 5G21A 4C68A 2REEA 3IEHA 4IUSA 1Y7EA 4P45A 1IICA 2CF4A 4A31A 2Q44A 4KOUA 5LYLA 2VL1A 2ZEEA 3ZZIA 1UFHA 3PB4X 1IYLA 3IFEA 2PJCA 3CXQA 2ZEPA 3H8EA 4W9YA 2NMTA 1EE3P 1RXTA 2EK9A 2GE3A 1Y7RA 2G3AA 3EXNA 4Y49B 1AYEA 1IY7A 5AG4A 1QSOA 4F0XA 3T9YA 5JM6A 1I1DA 3CPXA 4MHPA 3PFOA 4KVXA 1Q2DA 4B14A 1S7KA 3FVLA 3VARA 4AB7A 3OWCA 5LRJA 4AVCA 1WK4A 1R43A 1IOFA 4KVME 1XFOA 3QAHA 4IF5A 3TX8A 4A95A 3TE4A 4B5PA 2POKA 1ZG7A 4FD5A 4MY3A 3PB7X 4P6YA 2GFQA 3WABA 1QQ9A 3TT2A 4E2AA 1BO4A 2I00A 2V8DA 1HDUA 1Z4RA 2EBJA 1IU8A 3CXPA 4PK3A 1QSMA 3V38A 3IWWA 5CBMA 4GS4A 1FY7A 3LD2A 4MCQA 5LYDA 3WC5A 2K5TA 4H6UA 1F57A 3L2NA 1NMTA 2WPXA 2PRQA 2Q4ZA 2EUIA 2Q7SA 2NYQA 3TOAA 1M1DA 2OZHA 3QAYA 4PV6A 1YVKA 2G3TA 1GYTA 3BI0A 5DWNA 1XE4A 1ZG9A 3ISXA 4O23A 5I0CA 3D8PA 4KSIA 2AFMA 5AGEA 2Z3PA 2ZW7A 4B10A 3FYNA 1Q7LA 1Z8TA 5EC4A 2DPSA 1QSNA 3PRTA 5K8OA 2AFXA 4P4IA 4UCNA 5EMIA 3R9FA 4B11A 2HQYA 4MHDA 3K9UA 4J3GA 5FVJA 5A27A 1X10A 2PRBA 5KTAA 2GLJA 1VKCA 2BOAA 4X2TA 4YGOA 1NSAA 2OZUA 4MCRA 4NGNA 3ZJ0A 3KI9A 4A33A 1XOVA 5G22A 2O28A 5ISVA 3EC4A 1YK3A 2P6GA 5LYFA 4ZI6A 3KQZA 2FS5A 1LOKA 3S9NA 4OLLA 3PGPA 3FB3A 4MFLA 1YLOA 4B5OA 2PJ6A 4PK2A 3LWUA 1DE4C 2BSWA 2C27A 3DGVA 3FX6A 4JYWA 4DUKA 4CGLA 4IHMA 3SXNA 4E0AA 4E8OA 3S9MA 4CPAA 3TFYA 2FIAA 4KOVA 3RO0A 2B5GA 4PXEA 1IGBA 2VXKA 1YMEA 2PIYA 4R87A 1M4DA 4MI4A 3FJUA 3FRMA 1ZLIA 3QNVA 4OIDA 4UCPA 3BLNA 3CDXA 3NA6A 1JQGA 3MRUA 3FIXA 4KOTA 3E0KA 3VWDA 3G8WA 4A37A 4JWPA 4P10A 4L8AA 2IJZA 4ZY0A 2WZNA 2AFWA 3MN8A 4MBUA 2EWBA 1LAPA 2R8VA 1M4GA 4II9A 3NE8A 1YW6A 2G9DA 1PYTB 4K30A 4PSXA 4HNXB 5G1ZA 4C7HA 3S6GA 5JQ4A 2Q43A 4XPKA 4OP4A 4ZBGA 5G20A 1NE9A 4G1PA 1SQHA 3WR7A 2ZELA 4NSQA 1ARMA 4CAWA 4UWJA 1Y9WA 4KOWA 1AMPA 4R9MA 2P6EA 4CRZB 2B4DB 2C6GA 2JEWA 4KUAA 4L89A 2PVVA 4HPSA 3KR4A 1VGYA 3W6SA 4ZY1A 3TO9A 1M4LA 1LCPA 4KSAA 1R57A 4RI1A 4CS0B 3B3CA 2FE7A 2VZZA 1UWYA 5GCNA 2Q0YA 2EVNA 3DR6A 4ZGYB 1M44A 2J9AA 1YREA 4NXYA 2ZW5A 4MY0A 3GB0A 4X8IA 4YU9A 4CYOA 3D2PA 1VHOA 3K2KA 2QJ8A 4GXHA 4TWEA 5ELYA 3FECA 1PUAA 1RTQA 2FVGA 6CPAA 1AUGA 2AFUA 2WYRA 5AG7A 3CXSA 2RC4A 3KZWA 4CGOA 2PJ2A 1MJBA 2YNDA 2OZGA 2PJ8A 2VZYA 4OIWA 2OOTA 5JH9A 2J8MA 2B58A 3KGQA 4QUSA 4A30A 2Z3KA 1Y0YA 4KLVA 3IJ3A 1PU9A 1MK4A 1S7LA 3IO1A 4JJXA 5HVFA 5EBVA 4JZ0A 3RZAA 2PDOA 4UFWA 1FNOA 4IAVA 2QYVA 4A2ZA 3SI0A 2RFHA 4K3NA 3PB6X 5HVGA 2EK8A 3V8IA 4IK2A 3D7DA 1F2OA 2CXAA 3KQXA 3S6FA 3S9LA 2RB7A 3PB9X 4UFVA 2IMOA 4BMHA 3D67A 3DLJA 4FD4A 1DTDA 3CZXA 2QECA 3C26A 3KL9A 4C2YA 1IIDA 3DNSA 4KUBA 3WC6A 5D29A 1Z2LA 5C88A 4HNYB 1KWMA 1VHEA 1Z8WA 3R95A 3SJXA 4NGSA 4UEFA 1NSLA 1P0HA 3IGRA 2X7BA 4CYQA 3V7ZA 3KHZA 1YLEA 4ZYQA 1QSTA 1KUYA 5HVHA 2V8GA 1Y9KA 4Y49C 2DPTA 4ZX8A 2ZOGA 4KORA 2PC1A 2BL1A 4Q7AA 4CAVA 4YRHA 4XPDB 1CG2A 2PQ8A 2ZEFA 3K9TA 5IB0A 4Q36A 1Y0RA 4P4BA 8CPAA 2KCWA 4EFDA 4MJ8A 4MMOA 3G3SA 5IX3A 2B3UA 1CX8A 4CAFA 3BXMA 1ELMP 3GIUA 2FIWA 3KR5A 3F8KA 3FNCA 3VH9A 3FEDA 1QSRA 3EO4A 5J1QA 4PSWA 2PVWA 2Z3MA 3CT9A 4DJLA 4P4FA 1KUVA 3N5FA 1F2PA 4NCZA 4AVAA 4FUUA 2BCOA 3NH4A 2AJ6A 2CNSA 4CAEA 4C2ZA 1X12A 2I3CA 2XEIA 1XJOA 2DF5A 2AFSA 4M3SA 4UIAA 3FXTA 4H2KA 2PJBA 1IB1E 4MRIA 4A38A 4NFRA 2PJAA 5AG6A 2B4BA 3S6KA 2EO8A 3NE7A 3EFAA 5BWAB 3EY5A 4KOSA 1CP7A 2WUUA 1LANA 2FT0A 2HC9A 3IWGA 1IYKA 3TO7A 4CYNA 3LODA 3B7IA 3PZJA 4P4DA 5DS0A 2VEZA 1J4JA 3IU2A 2ARHA 3H8GA 1A2ZA 2F8HA 2HUZA 4MHYA 3RBUA 4UEEA 2FSRA 1I12A 4A32A 1QMUA 1ZLHA 2V77A 3GUXA 4XNHB 4X3RA 5CPAA 2BO9A 3D7HA 3DR8A 3D4UA 3D3SA 3W6XA 2I79A 5H86A 2JBKA 4UIBA 5HXDA 4OADA 1CM0A 1YGHA 7CPAA 4BINA 1GHEA 1TF8A 1Z8LA 4UF4A 5AG5A 2ATRA 3LACA 4P44A 4CGMA 2DEAA 3LMSA 2JEVA 1S5KA 2CNTA 2R7HA 4NF1A 4H89A 4MHNA 4OKOA 3CPAA 2Z0ZA 3B8GA 5IV0A 3SJEA 5K8MA 1CBXA 1TKHA 2R98A 2Q04A 3FEEA 4KLWA 4OC2A 3D66A 5IB9A 5LRKA 3DSBA 2O4HA 4XPLA 2JLMA 1CPSA 2ZW6A 2GIVA 4GM5A 2BEIA 4ONWA 4H6ZA 2ZEOA 4R8FA 3W91A 3H8FA 4C7IA 2YNEA 2ODFA 4PQAA 3KHXA 4MFPA 5LRGA 1TKJA 2CNMA 1BOBA 4MXUA 3SXOA 4R76A 2ANPA 4UA3A 2YNCC 4HKFA 1TIQA 4NEXA 5KTDA 3B2YA 3IC1A 4KS9A 1WWZA 3TCVA 4B5PB 1XMTA 2Q51A 1PCAA 1Z8XA 2R1IA 3RAMA 3UY5A 5J8FA 1HDQA 3H4QA 4NGTA 4Q38A 4AG9A 4AVBA 3I3GA 2P0WA 1LAMA 5HMNA 4CGPA 1Q2YA 4JXQA 3BI1A 3T8WA 1ZG8A 2VI7A 3R9EA 3I9SA 2ZEMA 3BJ7A 4R3KA 3GLJA 1YX0A 2AFOA 2QMLA 3FMCA 5E96A 1U6MA 4U9ZA 4QC6A 3SJFA 1XF8A 2D4PA 2OH1A 3GKRA 2FCKA 5F47A 2CY2A 5H84A 4B6ZA 5K8PA 4MCSA 4F6AA 1YR0A 4FD7A 5DWMA 5KTCA 4DNCA 2PJ1A 1B6BA 3H5ZA 2P6FA 3TO6A 1VHSA 2A4NA 1YVOA 2PJ0A 2GU2A 2BUEA 4OC0A 2PJ5A 1IOIA 4UWIA 3HUVA 3T90A 4M85A 2PJ7A 3KASA 2B4DA 3SHPA 4MFZA 4NJRA 4UEZA 3B3TA 4F0YA 5F49A 1XRYA 2FXFA 3GYAA 4DYOA 2JBJA 4JXRA 3RYOA 5K8NA 2WPWA 1BPMA 4NGRA 2PIZA 3FBUA 4NJQA 3A9LA 4PXCA 2XEFA 4JLYA 4UFXA 4OAEA 2V8VA 4ONUA 4F9VA 3F5BA 3B3WA 5A28A 4AXVA 2PR1A 4R6TA 3PEIA 4RN7A 4WWVA 3IWEA 2QVPA 4P4EA 5D8NA 4WJBA 4PXDA 2ZEHA 1XBUA 2C6PA 4KOXA 4NGPA 1N71A 2XEGA 1XIXA 3PB8X 2IL4A 3MGDA 4LQGA 5JPHA 3PBBA 5LYIA 1P4NA 2GREA 4M6HA 2Q4VA 4Z65A 4A94A 4OMEA 1TXRA 2AE6A 4MFJA 2OR4A 1M4IA 4OC1A 2B5GB 4ZX9A 4CYPA 3PBEA 1MJAA 2Z3LA 2QIRA 4M6GA 3VATA 1RO5A 4HNWB 2OU2A 4MCPA 4CAXA 1VIXA 4NGQA 1BLLE 3B3VA 3FF3A 4BBHA 2WSAA 2H5MA 3PP9A
chains in the Genus database with same CATH topology
2VQYA 3VWEA 3JUWA 3F0AA 2FL4A 2HV2A 2Z3NA 3P2HA 3QB8A 5F48A 1KZFA 4ORFA 3N7ZA 4QB9A 1Z9UA 4C2XA 1XEBA 2ZW4A 2PSWA 4EVYA 1S7FA 3R1KA 2JDDA 4XPDC 2JDCA 1S7NA 4MFKA 2ZXVA 4KVOE 4U5YA 2PR8A 4I49A 1ON0A 4AG7A 1L0CA 5C82A 1MJ9A 2VBQA 4LUAA 2OB0A 4R3LA 4MFQA 1S3ZA 4U9YA 4KOYA 2J8RA 4JD6A 2J8NA 3TTHA 1ZO0A 3GY9A 1I21A 3BJ8A 1LRZA 4B12A 4RS2A 1OZPA 2Z11A 3KKWA 3P2FA 1S60A 2Z10A 4X5KA 3JTKA 2B3VA 4KSFA 3JVNA 4QVTA 4UCMA 2D4OA 4CGNA 2F5IA 1Z4EA 3IU1A 2Z3OA 2DXQA 1B87A 2Y0MA 2G0BA 3TOBA 2GANA 3R96A 4KZTA 1CJWA 4XNHC 4LX9A 2ZPAA 4QBJA 1Q2CA 3DDDA 2Q7BA 3D2MA 2YGWA 5J8CA 4FD6A 4R57A 1V0CA 4B13A 2YNCA 1K4JA 1KUXA 3R9GA 5CNPA 3S6HA 2REFA 4UBRA 4CRYB 2Q4YA 5HH1A 4YFJA 4C68A 5G21A 2REEA 4IUSA 1IICA 4A31A 2Q44A 4KOUA 3ZZIA 1UFHA 1IYLA 3CXQA 2NMTA 1RXTA 2GE3A 1Y7RA 2G3AA 3EXNA 4Y49B 5AG4A 1QSOA 4F0XA 3T9YA 1I1DA 4KVXA 1Q2DA 4B14A 1S7KA 4AB7A 3OWCA 4AVCA 1WK4A 4KVME 3QAHA 4IF5A 4A95A 3TE4A 4B5PA 4FD5A 4MY3A 3TT2A 4E2AA 1BO4A 2I00A 1Z4RA 3CXPA 4PK3A 1QSMA 4GS4A 1FY7A 3LD2A 2K5TA 4H6UA 1NMTA 2WPXA 2EUIA 3TOAA 1M1DA 2OZHA 4PV6A 1YVKA 2G3TA 5DWNA 1XE4A 5I0CA 3D8PA 5AGEA 2Z3PA 2ZW7A 4B10A 3FYNA 5EC4A 2DPSA 1QSNA 4UCNA 3R9FA 4B11A 2HQYA 4MHDA 3K9UA 4J3GA 5FVJA 5A27A 2PRBA 5KTAA 4YGOA 1VKCA 2OZUA 3ZJ0A 4A33A 5G22A 2O28A 5ISVA 3EC4A 1YK3A 2P6GA 2FS5A 4OLLA 3PGPA 3FB3A 4MFLA 4B5OA 4PK2A 2BSWA 2C27A 4CGLA 4E8OA 3SXNA 4E0AA 3TFYA 2FIAA 4KOVA 2B5GA 2VXKA 4R87A 1M4DA 4MI4A 3FRMA 4UCPA 3BLNA 4KOTA 3VWDA 3FIXA 3E0KA 3G8WA 4JWPA 4L8AA 4MBUA 2R8VA 1M4GA 4II9A 5JQ4A 5G1ZA 4K30A 4PSXA 4HNXB 4C7HA 3S6GA 4XPKA 4ZBGA 5G20A 1NE9A 1SQHA 3WR7A 4NSQA 4CAWA 4UWJA 1Y9WA 4KOWA 4CRZB 4R9MA 2P6EA 2B4DB 4KUAA 4L89A 3W6SA 3TO9A 4KSAA 4RI1A 1R57A 4CS0B 2FE7A 2VZZA 5GCNA 2Q0YA 2EVNA 3DR6A 4ZGYB 1M44A 4NXYA 1YREA 2ZW5A 4MY0A 4CYOA 3D2PA 1PUAA 5AG7A 3CXSA 2RC4A 4CGOA 1MJBA 2YNDA 2OZGA 2VZYA 2J8MA 2B58A 4QUSA 4A30A 2Z3KA 4KLVA 1PU9A 1MK4A 1S7LA 4JJXA 5EBVA 2PDOA 4UFWA 4A2ZA 3V8IA 2CXAA 3S6FA 4UFVA 4BMHA 4FD4A 2QECA 3C26A 4C2YA 1IIDA 3DNSA 4KUBA 5C88A 4HNYB 3R95A 1NSLA 1P0HA 3IGRA 2X7BA 4CYQA 1YLEA 1QSTA 1KUYA 4Y49C 1Y9KA 2DPTA 4KORA 2PC1A 2BL1A 4CAVA 4YRHA 4XPDB 2PQ8A 5IB0A 4Q36A 2KCWA 4MJ8A 5IX3A 3G3SA 2B3UA 4CAFA 2FIWA 3F8KA 3FNCA 1QSRA 3EO4A 4PSWA 2Z3MA 1KUVA 4NCZA 4AVAA 2AJ6A 2CNSA 4CAEA 4C2ZA 4M3SA 3FXTA 1IB1E 5AG6A 2B4BA 3S6KA 3NE7A 3EFAA 5BWAB 3EY5A 4KOSA 3IWGA 2WUUA 3TO7A 2FT0A 4CYNA 5F46A 1IYKA 3LODA 3PZJA 2VEZA 1J4JA 3IU2A 2ARHA 2HUZA 2FSRA 1I12A 4A32A 4XNHB 3DR8A 3W6XA 3D3SA 2I79A 5H86A 4OADA 1CM0A 1YGHA 1GHEA 5AG5A 2ATRA 4CGMA 2JEVA 1S5KA 2CNTA 2R7HA 4NF1A 4H89A 2Z0ZA 3B8GA 5IV0A 2R98A 2Q04A 4KLWA 3DSBA 4XPLA 2JLMA 2ZW6A 2GIVA 2BEIA 4H6ZA 3W91A 4C7IA 2YNEA 4MFPA 3SXOA 2CNMA 1BOBA 4UA3A 2YNCC 4HKFA 1TIQA 4NEXA 5KTDA 4KS9A 1WWZA 3TCVA 4B5PB 1XMTA 2R1IA 3UY5A 5J8FA 3H4QA 4Q38A 4AG9A 5HMNA 4AVBA 3I3GA 2P0WA 4CGPA 1Q2YA 4JXQA 2VI7A 3R9EA 3I9SA 3BJ7A 4R3KA 1YX0A 2QMLA 5E96A 1U6MA 4U9ZA 4QC6A 1XF8A 2D4PA 2OH1A 3GKRA 2FCKA 5F47A 2CY2A 5H84A 4F6AA 1YR0A 4FD7A 5DWMA 5KTCA 4DNCA 1B6BA 3H5ZA 2P6FA 3TO6A 1VHSA 2A4NA 1YVOA 2BUEA 4UWIA 3T90A 4M85A 2B4DA 3SHPA 4MFZA 4F0YA 5F49A 2FXFA 3GYAA 3RYOA 4JXRA 2WPWA 3FBUA 3A9LA 4JLYA 4UFXA 4OAEA 4ONUA 3F5BA 5A28A 2PR1A 3IWEA 4KOXA 1N71A 1XIXA 2IL4A 3MGDA 5JPHA 1P4NA 2Q4VA 2AE6A 4MFJA 1M4IA 2B5GB 4CYPA 1MJAA 2Z3LA 2QIRA 1RO5A 4HNWB 2OU2A 4CAXA 4BBHA 2WSAA 2H5MA 3PP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQY A;  3VWE A;  3JUW A;  3F0A A;  2FL4 A;  2HV2 A;  3P2H A;  3QB8 A;  5F48 A;  1KZF A;  4ORF A;  3N7Z A;  4QB9 A;  1Z9U A;  1XEB A;  2ZW4 A;  2PSW A;  4EVY A;  1S7F A;  3R1K A;  2JDD A;  4XPD C;  2JDC A;  1S7N A;  2ZXV A;  4KVO E;  4U5Y A;  2PR8 A;  4I49 A;  1ON0 A;  4AG7 A;  1L0C A;  5C82 A;  1MJ9 A;  2VBQ A;  4LUA A;  2OB0 A;  4R3L A;  1S3Z A;  4U9Y A;  4KOY A;  2J8R A;  4JD6 A;  2J8N A;  3TTH A;  3GY9 A;  1I21 A;  3BJ8 A;  1LRZ A;  4RS2 A;  1OZP A;  2Z11 A;  3KKW A;  3P2F A;  1S60 A;  2Z10 A;  4X5K A;  2B3V A;  3JVN A;  4QVT A;  2D4O A;  2F5I A;  1Z4E A;  2DXQ A;  1B87 A;  2Y0M A;  2G0B A;  3TOB A;  2GAN A;  3R96 A;  4KZT A;  1CJW A;  4XNH C;  4LX9 A;  2ZPA A;  4QBJ A;  1Q2C A;  3DDD A;  2Q7B A;  3D2M A;  5J8C A;  4FD6 A;  4R57 A;  1V0C A;  1K4J A;  1KUX A;  3R9G A;  5CNP A;  3S6H A;  2REF A;  4UBR A;  4CRY B;  2Q4Y A;  5HH1 A;  4YFJ A;  2REE A;  4IUS A;  1IIC A;  2Q44 A;  4KOU A;  3ZZI A;  1UFH A;  1IYL A;  3CXQ A;  2NMT A;  1RXT A;  2GE3 A;  1Y7R A;  2G3A A;  3EXN A;  4Y49 B;  1QSO A;  3T9Y A;  1I1D A;  4KVX A;  1Q2D A;  1S7K A;  4AB7 A;  3OWC A;  4AVC A;  1WK4 A;  4KVM E;  3QAH A;  4IF5 A;  3TE4 A;  4B5P A;  4FD5 A;  4MY3 A;  3TT2 A;  4E2A A;  1BO4 A;  2I00 A;  1Z4R A;  3CXP A;  4PK3 A;  1QSM A;  4GS4 A;  1FY7 A;  3LD2 A;  2K5T A;  4H6U A;  1NMT A;  2WPX A;  2EUI A;  3TOA A;  1M1D A;  2OZH A;  4PV6 A;  1YVK A;  2G3T A;  5DWN A;  1XE4 A;  5I0C A;  3D8P A;  2ZW7 A;  3FYN A;  5EC4 A;  1QSN A;  3R9F A;  2HQY A;  4MHD A;  3K9U A;  4J3G A;  5FVJ A;  2PRB A;  5KTA A;  4YGO A;  1VKC A;  2OZU A;  3ZJ0 A;  2O28 A;  5ISV A;  3EC4 A;  1YK3 A;  2P6G A;  2FS5 A;  4OLL A;  3PGP A;  3FB3 A;  4B5O A;  4PK2 A;  2BSW A;  2C27 A;  4E8O A;  3SXN A;  4E0A A;  3TFY A;  2FIA A;  4KOV A;  2B5G A;  2VXK A;  4R87 A;  1M4D A;  4MI4 A;  3FRM A;  3BLN A;  4KOT A;  3VWD A;  3FIX A;  3E0K A;  3G8W A;  4JWP A;  4L8A A;  4MBU A;  2R8V A;  1M4G A;  4II9 A;  5JQ4 A;  4K30 A;  4PSX A;  4HNX B;  3S6G A;  4XPK A;  4ZBG A;  1NE9 A;  1SQH A;  3WR7 A;  4NSQ A;  4CAW A;  4UWJ A;  1Y9W A;  4KOW A;  4CRZ B;  4R9M A;  2P6E A;  2B4D B;  4KUA A;  4L89 A;  3W6S A;  3TO9 A;  4RI1 A;  1R57 A;  4CS0 B;  2FE7 A;  2VZZ A;  5GCN A;  2Q0Y A;  2EVN A;  3DR6 A;  1M44 A;  4NXY A;  1YRE A;  2ZW5 A;  4MY0 A;  3D2P A;  1PUA A;  3CXS A;  2RC4 A;  1MJB A;  2OZG A;  2VZY A;  2J8M A;  2B58 A;  4QUS A;  4KLV A;  1PU9 A;  1MK4 A;  1S7L A;  4JJX A;  5EBV A;  2PDO A;  3V8I A;  3S6F A;  4BMH A;  4FD4 A;  2QEC A;  3C26 A;  1IID A;  3DNS A;  4KUB A;  5C88 A;  4HNY B;  3R95 A;  1NSL A;  1P0H A;  3IGR A;  2X7B A;  1YLE A;  1QST A;  1KUY A;  4Y49 C;  1Y9K A;  4KOR A;  2PC1 A;  2BL1 A;  4CAV A;  4YRH A;  4XPD B;  2PQ8 A;  5IB0 A;  2KCW A;  4MJ8 A;  5IX3 A;  3G3S A;  2B3U A;  2FIW A;  3F8K A;  3FNC A;  1QSR A;  3EO4 A;  4PSW A;  1KUV A;  4NCZ A;  4AVA A;  2AJ6 A;  2CNS A;  4M3S A;  3FXT A;  1IB1 E;  2B4B A;  3S6K A;  3NE7 A;  3EFA A;  3EY5 A;  4KOS A;  3IWG A;  3TO7 A;  5F46 A;  2FT0 A;  1IYK A;  3LOD A;  3PZJ A;  2VEZ A;  1J4J A;  2ARH A;  2HUZ A;  2FSR A;  1I12 A;  4XNH B;  3DR8 A;  3W6X A;  3D3S A;  2I79 A;  5H86 A;  4OAD A;  1CM0 A;  1YGH A;  1GHE A;  2ATR A;  2JEV A;  1S5K A;  2CNT A;  2R7H A;  4NF1 A;  4H89 A;  2Z0Z A;  3B8G A;  5IV0 A;  2R98 A;  2Q04 A;  4KLW A;  3DSB A;  4XPL A;  2JLM A;  2ZW6 A;  2GIV A;  2BEI A;  4H6Z A;  3W91 A;  3SXO A;  2CNM A;  1BOB A;  4UA3 A;  4HKF A;  1TIQ A;  4NEX A;  5KTD A;  1WWZ A;  3TCV A;  4B5P B;  1XMT A;  2R1I A;  3UY5 A;  5J8F A;  3H4Q A;  4AG9 A;  5HMN A;  4AVB A;  3I3G A;  2P0W A;  1Q2Y A;  4JXQ A;  2VI7 A;  3R9E A;  3I9S A;  3BJ7 A;  4R3K A;  1YX0 A;  2QML A;  5E96 A;  1U6M A;  4U9Z A;  4QC6 A;  1XF8 A;  2D4P A;  2OH1 A;  3GKR A;  2FCK A;  5F47 A;  2CY2 A;  5H84 A;  4F6A A;  1YR0 A;  4FD7 A;  5DWM A;  5KTC A;  4DNC A;  1B6B A;  2P6F A;  3TO6 A;  1VHS A;  2A4N A;  1YVO A;  2BUE A;  4UWI A;  3T90 A;  4M85 A;  2B4D A;  3SHP A;  4F0Y A;  5F49 A;  2FXF A;  3GYA A;  3RYO A;  4JXR A;  2WPW A;  3FBU A;  4JLY A;  4OAE A;  4ONU A;  3F5B A;  2PR1 A;  4KOX A;  1N71 A;  1XIX A;  2IL4 A;  3MGD A;  5JPH A;  1P4N A;  2Q4V A;  2AE6 A;  1M4I A;  2B5G B;  1MJA A;  2QIR A;  1RO5 A;  4HNW B;  2OU2 A;  4CAX A;  2H5M A;  3PP9 A; 
#chains in the Genus database with same CATH topology
 3D7G A;  2C6C A;  2VQY A;  4OC3 A;  3SI2 A;  3VWE A;  3JUW A;  4M6I A;  2CTC A;  3WC7 A;  3F0A A;  1CP6 A;  2FL4 A;  2HV2 A;  2Z3N A;  3P2H A;  3QB8 A;  1CPX A;  2HB6 A;  5F48 A;  5I4M A;  1KZF A;  4OC4 A;  4ORF A;  3N7Z A;  1R3N A;  4QB9 A;  1Z9U A;  4C2X A;  1XEB A;  3NFZ A;  1TF9 A;  4TNU A;  2ZW4 A;  2PSW A;  4EVY A;  1S7F A;  3R1K A;  2GLF A;  2JDD A;  4XPD C;  2JDC A;  1S7N A;  3JRU A;  4MFK A;  1Z5R A;  2PJ4 A;  2ZXV A;  3NH8 A;  4KVO E;  4U5Y A;  4FWU A;  2PR8 A;  1ARL A;  3D68 A;  3B35 A;  4I49 A;  1ON0 A;  5THW A;  4AG7 A;  2IQ6 A;  1L0C A;  5C82 A;  1MJ9 A;  2VBQ A;  5F46 A;  2ZEG A;  4LUA A;  2OB0 A;  2PE3 A;  3FH4 A;  3IIB A;  4MFQ A;  4R3L A;  1S3Z A;  3B3S A;  4U9Y A;  4KOY A;  4RUH A;  2J8R A;  4JD6 A;  4F8Z A;  2J8N A;  3TTH A;  1ZO0 A;  1YW4 A;  2C1C A;  1H8L A;  1I21 A;  3GY9 A;  1FT7 A;  3BJ8 A;  1LRZ A;  4NGM A;  2ZED A;  4B12 A;  4RS2 A;  1OZP A;  2Z11 A;  3KKW A;  3P2F A;  1S60 A;  2PCU A;  1TKF A;  2Z10 A;  2CTB A;  4X5K A;  3JTK A;  2B3V A;  1OBR A;  3JVN A;  4KSF A;  4QVT A;  2O53 A;  4UCM A;  2D4O A;  4CGN A;  2F5I A;  2CIJ A;  1Z4E A;  3IU1 A;  2Z3O A;  2DXQ A;  3WT4 A;  1B87 A;  4ZY2 A;  2F7V A;  2Y0M A;  2NSM A;  1HEE A;  4FBE A;  3PFE A;  1LFW A;  2G0B A;  3TOB A;  4R7M A;  1XMB A;  2PJ9 A;  4EME A;  2GAN A;  3SI1 A;  3R96 A;  2PJ3 A;  4KZT A;  1CJW A;  2ZEN A;  4XNH C;  4LX9 A;  2XEJ A;  3ISZ A;  3SJG A;  2ZPA A;  4QBJ A;  1Q2C A;  4F9U A;  3DDD A;  2Q7B A;  4P4J A;  3D2M A;  4MHZ A;  4FAI A;  4PXB A;  1ELL P;  2YGW A;  4YWY A;  5J8C A;  4FD6 A;  5JGF A;  4PPZ A;  4R57 A;  1V0C A;  2ZOF A;  4B13 A;  3NH5 A;  3BHX A;  2YNC A;  3I1U A;  3HLP A;  4OC5 A;  4EWT A;  1BPN A;  1BAV A;  5F09 A;  1K4J A;  4A39 A;  1KUX A;  3R9G A;  1YQE A;  5CNP A;  4BD9 A;  2AFZ A;  3S6H A;  2REF A;  2V8H A;  3TC8 A;  4LQ6 A;  2ABZ A;  4UBR A;  1JWQ A;  4CRY B;  2Q4Y A;  3RNZ A;  5HH1 A;  1YSJ A;  4YFJ A;  3D7F A;  5G21 A;  4C68 A;  2REE A;  3IEH A;  4IUS A;  1Y7E A;  4P45 A;  1IIC A;  2CF4 A;  4A31 A;  2Q44 A;  4KOU A;  5LYL A;  2VL1 A;  2ZEE A;  3ZZI A;  1UFH A;  3PB4 X;  1IYL A;  3IFE A;  2PJC A;  3CXQ A;  2ZEP A;  3H8E A;  4W9Y A;  2NMT A;  1EE3 P;  1RXT A;  2EK9 A;  2GE3 A;  1Y7R A;  2G3A A;  3EXN A;  4Y49 B;  1AYE A;  1IY7 A;  5AG4 A;  1QSO A;  4F0X A;  3T9Y A;  5JM6 A;  1I1D A;  3CPX A;  4MHP A;  3PFO A;  4KVX A;  1Q2D A;  4B14 A;  1S7K A;  3FVL A;  3VAR A;  4AB7 A;  3OWC A;  5LRJ A;  4AVC A;  1WK4 A;  1R43 A;  1IOF A;  4KVM E;  1XFO A;  3QAH A;  4IF5 A;  3TX8 A;  4A95 A;  3TE4 A;  4B5P A;  2POK A;  1ZG7 A;  4FD5 A;  4MY3 A;  3PB7 X;  4P6Y A;  2GFQ A;  3WAB A;  1QQ9 A;  3TT2 A;  4E2A A;  1BO4 A;  2I00 A;  2V8D A;  1HDU A;  1Z4R A;  2EBJ A;  1IU8 A;  3CXP A;  4PK3 A;  1QSM A;  3V38 A;  3IWW A;  5CBM A;  4GS4 A;  1FY7 A;  3LD2 A;  4MCQ A;  5LYD A;  3WC5 A;  2K5T A;  4H6U A;  1F57 A;  3L2N A;  1NMT A;  2WPX A;  2PRQ A;  2Q4Z A;  2EUI A;  2Q7S A;  2NYQ A;  3TOA A;  1M1D A;  2OZH A;  3QAY A;  4PV6 A;  1YVK A;  2G3T A;  1GYT A;  3BI0 A;  5DWN A;  1XE4 A;  1ZG9 A;  3ISX A;  4O23 A;  5I0C A;  3D8P A;  4KSI A;  2AFM A;  5AGE A;  2Z3P A;  2ZW7 A;  4B10 A;  3FYN A;  1Q7L A;  1Z8T A;  5EC4 A;  2DPS A;  1QSN A;  3PRT A;  5K8O A;  2AFX A;  4P4I A;  4UCN A;  5EMI A;  3R9F A;  4B11 A;  2HQY A;  4MHD A;  3K9U A;  4J3G A;  5FVJ A;  5A27 A;  1X10 A;  2PRB A;  5KTA A;  2GLJ A;  1VKC A;  2BOA A;  4X2T A;  4YGO A;  1NSA A;  2OZU A;  4MCR A;  4NGN A;  3ZJ0 A;  3KI9 A;  4A33 A;  1XOV A;  5G22 A;  2O28 A;  5ISV A;  3EC4 A;  1YK3 A;  2P6G A;  5LYF A;  4ZI6 A;  3KQZ A;  2FS5 A;  1LOK A;  3S9N A;  4OLL A;  3PGP A;  3FB3 A;  4MFL A;  1YLO A;  4B5O A;  2PJ6 A;  4PK2 A;  3LWU A;  1DE4 C;  2BSW A;  2C27 A;  3DGV A;  3FX6 A;  4JYW A;  4DUK A;  4CGL A;  4IHM A;  3SXN A;  4E0A A;  4E8O A;  3S9M A;  4CPA A;  3TFY A;  2FIA A;  4KOV A;  3RO0 A;  2B5G A;  4PXE A;  1IGB A;  2VXK A;  1YME A;  2PIY A;  4R87 A;  1M4D A;  4MI4 A;  3FJU A;  3FRM A;  1ZLI A;  3QNV A;  4OID A;  4UCP A;  3BLN A;  3CDX A;  3NA6 A;  1JQG A;  3MRU A;  3FIX A;  4KOT A;  3E0K A;  3VWD A;  3G8W A;  4A37 A;  4JWP A;  4P10 A;  4L8A A;  2IJZ A;  4ZY0 A;  2WZN A;  2AFW A;  3MN8 A;  4MBU A;  2EWB A;  1LAP A;  2R8V A;  1M4G A;  4II9 A;  3NE8 A;  1YW6 A;  2G9D A;  1PYT B;  4K30 A;  4PSX A;  4HNX B;  5G1Z A;  4C7H A;  3S6G A;  5JQ4 A;  2Q43 A;  4XPK A;  4OP4 A;  4ZBG A;  5G20 A;  1NE9 A;  4G1P A;  1SQH A;  3WR7 A;  2ZEL A;  4NSQ A;  1ARM A;  4CAW A;  4UWJ A;  1Y9W A;  4KOW A;  1AMP A;  4R9M A;  2P6E A;  4CRZ B;  2B4D B;  2C6G A;  2JEW A;  4KUA A;  4L89 A;  2PVV A;  4HPS A;  3KR4 A;  1VGY A;  3W6S A;  4ZY1 A;  3TO9 A;  1M4L A;  1LCP A;  4KSA A;  1R57 A;  4RI1 A;  4CS0 B;  3B3C A;  2FE7 A;  2VZZ A;  1UWY A;  5GCN A;  2Q0Y A;  2EVN A;  3DR6 A;  4ZGY B;  1M44 A;  2J9A A;  1YRE A;  4NXY A;  2ZW5 A;  4MY0 A;  3GB0 A;  4X8I A;  4YU9 A;  4CYO A;  3D2P A;  1VHO A;  3K2K A;  2QJ8 A;  4GXH A;  4TWE A;  5ELY A;  3FEC A;  1PUA A;  1RTQ A;  2FVG A;  6CPA A;  1AUG A;  2AFU A;  2WYR A;  5AG7 A;  3CXS A;  2RC4 A;  3KZW A;  4CGO A;  2PJ2 A;  1MJB A;  2YND A;  2OZG A;  2PJ8 A;  2VZY A;  4OIW A;  2OOT A;  5JH9 A;  2J8M A;  2B58 A;  3KGQ A;  4QUS A;  4A30 A;  2Z3K A;  1Y0Y A;  4KLV A;  3IJ3 A;  1PU9 A;  1MK4 A;  1S7L A;  3IO1 A;  4JJX A;  5HVF A;  5EBV A;  4JZ0 A;  3RZA A;  2PDO A;  4UFW A;  1FNO A;  4IAV A;  2QYV A;  4A2Z A;  3SI0 A;  2RFH A;  4K3N A;  3PB6 X;  5HVG A;  2EK8 A;  3V8I A;  4IK2 A;  3D7D A;  1F2O A;  2CXA A;  3KQX A;  3S6F A;  3S9L A;  2RB7 A;  3PB9 X;  4UFV A;  2IMO A;  4BMH A;  3D67 A;  3DLJ A;  4FD4 A;  1DTD A;  3CZX A;  2QEC A;  3C26 A;  3KL9 A;  4C2Y A;  1IID A;  3DNS A;  4KUB A;  3WC6 A;  5D29 A;  1Z2L A;  5C88 A;  4HNY B;  1KWM A;  1VHE A;  1Z8W A;  3R95 A;  3SJX A;  4NGS A;  4UEF A;  1NSL A;  1P0H A;  3IGR A;  2X7B A;  4CYQ A;  3V7Z A;  3KHZ A;  1YLE A;  4ZYQ A;  1QST A;  1KUY A;  5HVH A;  2V8G A;  1Y9K A;  4Y49 C;  2DPT A;  4ZX8 A;  2ZOG A;  4KOR A;  2PC1 A;  2BL1 A;  4Q7A A;  4CAV A;  4YRH A;  4XPD B;  1CG2 A;  2PQ8 A;  2ZEF A;  3K9T A;  5IB0 A;  4Q36 A;  1Y0R A;  4P4B A;  8CPA A;  2KCW A;  4EFD A;  4MJ8 A;  4MMO A;  3G3S A;  5IX3 A;  2B3U A;  1CX8 A;  4CAF A;  3BXM A;  1ELM P;  3GIU A;  2FIW A;  3KR5 A;  3F8K A;  3FNC A;  3VH9 A;  3FED A;  1QSR A;  3EO4 A;  5J1Q A;  4PSW A;  2PVW A;  2Z3M A;  3CT9 A;  4DJL A;  4P4F A;  1KUV A;  3N5F A;  1F2P A;  4NCZ A;  4AVA A;  4FUU A;  2BCO A;  3NH4 A;  2AJ6 A;  2CNS A;  4CAE A;  4C2Z A;  1X12 A;  2I3C A;  2XEI A;  1XJO A;  2DF5 A;  2AFS A;  4M3S A;  4UIA A;  3FXT A;  4H2K A;  2PJB A;  1IB1 E;  4MRI A;  4A38 A;  4NFR A;  2PJA A;  5AG6 A;  2B4B A;  3S6K A;  2EO8 A;  3NE7 A;  3EFA A;  5BWA B;  3EY5 A;  4KOS A;  1CP7 A;  2WUU A;  1LAN A;  2FT0 A;  2HC9 A;  3IWG A;  1IYK A;  3TO7 A;  4CYN A;  3LOD A;  3B7I A;  3PZJ A;  4P4D A;  5DS0 A;  2VEZ A;  1J4J A;  3IU2 A;  2ARH A;  3H8G A;  1A2Z A;  2F8H A;  2HUZ A;  4MHY A;  3RBU A;  4UEE A;  2FSR A;  1I12 A;  4A32 A;  1QMU A;  1ZLH A;  2V77 A;  3GUX A;  4XNH B;  4X3R A;  5CPA A;  2BO9 A;  3D7H A;  3DR8 A;  3D4U A;  3D3S A;  3W6X A;  2I79 A;  5H86 A;  2JBK A;  4UIB A;  5HXD A;  4OAD A;  1CM0 A;  1YGH A;  7CPA A;  4BIN A;  1GHE A;  1TF8 A;  1Z8L A;  4UF4 A;  5AG5 A;  2ATR A;  3LAC A;  4P44 A;  4CGM A;  2DEA A;  3LMS A;  2JEV A;  1S5K A;  2CNT A;  2R7H A;  4NF1 A;  4H89 A;  4MHN A;  4OKO A;  3CPA A;  2Z0Z A;  3B8G A;  5IV0 A;  3SJE A;  5K8M A;  1CBX A;  1TKH A;  2R98 A;  2Q04 A;  3FEE A;  4KLW A;  4OC2 A;  3D66 A;  5IB9 A;  5LRK A;  3DSB A;  2O4H A;  4XPL A;  2JLM A;  1CPS A;  2ZW6 A;  2GIV A;  4GM5 A;  2BEI A;  4ONW A;  4H6Z A;  2ZEO A;  4R8F A;  3W91 A;  3H8F A;  4C7I A;  2YNE A;  2ODF A;  4PQA A;  3KHX A;  4MFP A;  5LRG A;  1TKJ A;  2CNM A;  1BOB A;  4MXU A;  3SXO A;  4R76 A;  2ANP A;  4UA3 A;  2YNC C;  4HKF A;  1TIQ A;  4NEX A;  5KTD A;  3B2Y A;  3IC1 A;  4KS9 A;  1WWZ A;  3TCV A;  4B5P B;  1XMT A;  2Q51 A;  1PCA A;  1Z8X A;  2R1I A;  3RAM A;  3UY5 A;  5J8F A;  1HDQ A;  3H4Q A;  4NGT A;  4Q38 A;  4AG9 A;  4AVB A;  3I3G A;  2P0W A;  1LAM A;  5HMN A;  4CGP A;  1Q2Y A;  4JXQ A;  3BI1 A;  3T8W A;  1ZG8 A;  2VI7 A;  3R9E A;  3I9S A;  2ZEM A;  3BJ7 A;  4R3K A;  3GLJ A;  1YX0 A;  2AFO A;  2QML A;  3FMC A;  5E96 A;  1U6M A;  4U9Z A;  4QC6 A;  3SJF A;  1XF8 A;  2D4P A;  2OH1 A;  3GKR A;  2FCK A;  5F47 A;  2CY2 A;  5H84 A;  4B6Z A;  5K8P A;  4MCS A;  4F6A A;  1YR0 A;  4FD7 A;  5DWM A;  5KTC A;  4DNC A;  2PJ1 A;  1B6B A;  3H5Z A;  2P6F A;  3TO6 A;  1VHS A;  2A4N A;  1YVO A;  2PJ0 A;  2GU2 A;  2BUE A;  4OC0 A;  2PJ5 A;  1IOI A;  4UWI A;  3HUV A;  3T90 A;  4M85 A;  2PJ7 A;  3KAS A;  2B4D A;  3SHP A;  4MFZ A;  4NJR A;  4UEZ A;  3B3T A;  4F0Y A;  5F49 A;  1XRY A;  2FXF A;  3GYA A;  4DYO A;  2JBJ A;  4JXR A;  3RYO A;  5K8N A;  2WPW A;  1BPM A;  4NGR A;  2PIZ A;  3FBU A;  4NJQ A;  3A9L A;  4PXC A;  2XEF A;  4JLY A;  4UFX A;  4OAE A;  2V8V A;  4ONU A;  4F9V A;  3F5B A;  3B3W A;  5A28 A;  4AXV A;  2PR1 A;  4R6T A;  3PEI A;  4RN7 A;  4WWV A;  3IWE A;  2QVP A;  4P4E A;  5D8N A;  4WJB A;  4PXD A;  2ZEH A;  1XBU A;  2C6P A;  4KOX A;  4NGP A;  1N71 A;  2XEG A;  1XIX A;  3PB8 X;  2IL4 A;  3MGD A;  4LQG A;  5JPH A;  3PBB A;  5LYI A;  1P4N A;  2GRE A;  4M6H A;  2Q4V A;  4Z65 A;  4A94 A;  4OME A;  1TXR A;  2AE6 A;  4MFJ A;  2OR4 A;  1M4I A;  4OC1 A;  2B5G B;  4ZX9 A;  4CYP A;  3PBE A;  1MJA A;  2Z3L A;  2QIR A;  4M6G A;  3VAT A;  1RO5 A;  4HNW B;  2OU2 A;  4MCP A;  4CAX A;  1VIX A;  4NGQ A;  1BLL E;  3B3V A;  3FF3 A;  4BBH A;  2WSA A;  2H5M A;  3PP9 A; 
#chains in the Genus database with same CATH homology
 2VQY A;  3VWE A;  3JUW A;  3F0A A;  2FL4 A;  2HV2 A;  2Z3N A;  3P2H A;  3QB8 A;  5F48 A;  1KZF A;  4ORF A;  3N7Z A;  4QB9 A;  1Z9U A;  4C2X A;  1XEB A;  2ZW4 A;  2PSW A;  4EVY A;  1S7F A;  3R1K A;  2JDD A;  4XPD C;  2JDC A;  1S7N A;  4MFK A;  2ZXV A;  4KVO E;  4U5Y A;  2PR8 A;  4I49 A;  1ON0 A;  4AG7 A;  1L0C A;  5C82 A;  1MJ9 A;  2VBQ A;  4LUA A;  2OB0 A;  4R3L A;  4MFQ A;  1S3Z A;  4U9Y A;  4KOY A;  2J8R A;  4JD6 A;  2J8N A;  3TTH A;  1ZO0 A;  3GY9 A;  1I21 A;  3BJ8 A;  1LRZ A;  4B12 A;  4RS2 A;  1OZP A;  2Z11 A;  3KKW A;  3P2F A;  1S60 A;  2Z10 A;  4X5K A;  3JTK A;  2B3V A;  4KSF A;  3JVN A;  4QVT A;  4UCM A;  2D4O A;  4CGN A;  2F5I A;  1Z4E A;  3IU1 A;  2Z3O A;  2DXQ A;  1B87 A;  2Y0M A;  2G0B A;  3TOB A;  2GAN A;  3R96 A;  4KZT A;  1CJW A;  4XNH C;  4LX9 A;  2ZPA A;  4QBJ A;  1Q2C A;  3DDD A;  2Q7B A;  3D2M A;  2YGW A;  5J8C A;  4FD6 A;  4R57 A;  1V0C A;  4B13 A;  2YNC A;  1K4J A;  1KUX A;  3R9G A;  5CNP A;  3S6H A;  2REF A;  4UBR A;  4CRY B;  2Q4Y A;  5HH1 A;  4YFJ A;  4C68 A;  5G21 A;  2REE A;  4IUS A;  1IIC A;  4A31 A;  2Q44 A;  4KOU A;  3ZZI A;  1UFH A;  1IYL A;  3CXQ A;  2NMT A;  1RXT A;  2GE3 A;  1Y7R A;  2G3A A;  3EXN A;  4Y49 B;  5AG4 A;  1QSO A;  4F0X A;  3T9Y A;  1I1D A;  4KVX A;  1Q2D A;  4B14 A;  1S7K A;  4AB7 A;  3OWC A;  4AVC A;  1WK4 A;  4KVM E;  3QAH A;  4IF5 A;  4A95 A;  3TE4 A;  4B5P A;  4FD5 A;  4MY3 A;  3TT2 A;  4E2A A;  1BO4 A;  2I00 A;  1Z4R A;  3CXP A;  4PK3 A;  1QSM A;  4GS4 A;  1FY7 A;  3LD2 A;  2K5T A;  4H6U A;  1NMT A;  2WPX A;  2EUI A;  3TOA A;  1M1D A;  2OZH A;  4PV6 A;  1YVK A;  2G3T A;  5DWN A;  1XE4 A;  5I0C A;  3D8P A;  5AGE A;  2Z3P A;  2ZW7 A;  4B10 A;  3FYN A;  5EC4 A;  2DPS A;  1QSN A;  4UCN A;  3R9F A;  4B11 A;  2HQY A;  4MHD A;  3K9U A;  4J3G A;  5FVJ A;  5A27 A;  2PRB A;  5KTA A;  4YGO A;  1VKC A;  2OZU A;  3ZJ0 A;  4A33 A;  5G22 A;  2O28 A;  5ISV A;  3EC4 A;  1YK3 A;  2P6G A;  2FS5 A;  4OLL A;  3PGP A;  3FB3 A;  4MFL A;  4B5O A;  4PK2 A;  2BSW A;  2C27 A;  4CGL A;  4E8O A;  3SXN A;  4E0A A;  3TFY A;  2FIA A;  4KOV A;  2B5G A;  2VXK A;  4R87 A;  1M4D A;  4MI4 A;  3FRM A;  4UCP A;  3BLN A;  4KOT A;  3VWD A;  3FIX A;  3E0K A;  3G8W A;  4JWP A;  4L8A A;  4MBU A;  2R8V A;  1M4G A;  4II9 A;  5JQ4 A;  5G1Z A;  4K30 A;  4PSX A;  4HNX B;  4C7H A;  3S6G A;  4XPK A;  4ZBG A;  5G20 A;  1NE9 A;  1SQH A;  3WR7 A;  4NSQ A;  4CAW A;  4UWJ A;  1Y9W A;  4KOW A;  4CRZ B;  4R9M A;  2P6E A;  2B4D B;  4KUA A;  4L89 A;  3W6S A;  3TO9 A;  4KSA A;  4RI1 A;  1R57 A;  4CS0 B;  2FE7 A;  2VZZ A;  5GCN A;  2Q0Y A;  2EVN A;  3DR6 A;  4ZGY B;  1M44 A;  4NXY A;  1YRE A;  2ZW5 A;  4MY0 A;  4CYO A;  3D2P A;  1PUA A;  5AG7 A;  3CXS A;  2RC4 A;  4CGO A;  1MJB A;  2YND A;  2OZG A;  2VZY A;  2J8M A;  2B58 A;  4QUS A;  4A30 A;  2Z3K A;  4KLV A;  1PU9 A;  1MK4 A;  1S7L A;  4JJX A;  5EBV A;  2PDO A;  4UFW A;  4A2Z A;  3V8I A;  2CXA A;  3S6F A;  4UFV A;  4BMH A;  4FD4 A;  2QEC A;  3C26 A;  4C2Y A;  1IID A;  3DNS A;  4KUB A;  5C88 A;  4HNY B;  3R95 A;  1NSL A;  1P0H A;  3IGR A;  2X7B A;  4CYQ A;  1YLE A;  1QST A;  1KUY A;  4Y49 C;  1Y9K A;  2DPT A;  4KOR A;  2PC1 A;  2BL1 A;  4CAV A;  4YRH A;  4XPD B;  2PQ8 A;  5IB0 A;  4Q36 A;  2KCW A;  4MJ8 A;  5IX3 A;  3G3S A;  2B3U A;  4CAF A;  2FIW A;  3F8K A;  3FNC A;  1QSR A;  3EO4 A;  4PSW A;  2Z3M A;  1KUV A;  4NCZ A;  4AVA A;  2AJ6 A;  2CNS A;  4CAE A;  4C2Z A;  4M3S A;  3FXT A;  1IB1 E;  5AG6 A;  2B4B A;  3S6K A;  3NE7 A;  3EFA A;  5BWA B;  3EY5 A;  4KOS A;  3IWG A;  2WUU A;  3TO7 A;  2FT0 A;  4CYN A;  5F46 A;  1IYK A;  3LOD A;  3PZJ A;  2VEZ A;  1J4J A;  3IU2 A;  2ARH A;  2HUZ A;  2FSR A;  1I12 A;  4A32 A;  4XNH B;  3DR8 A;  3W6X A;  3D3S A;  2I79 A;  5H86 A;  4OAD A;  1CM0 A;  1YGH A;  1GHE A;  5AG5 A;  2ATR A;  4CGM A;  2JEV A;  1S5K A;  2CNT A;  2R7H A;  4NF1 A;  4H89 A;  2Z0Z A;  3B8G A;  5IV0 A;  2R98 A;  2Q04 A;  4KLW A;  3DSB A;  4XPL A;  2JLM A;  2ZW6 A;  2GIV A;  2BEI A;  4H6Z A;  3W91 A;  4C7I A;  2YNE A;  4MFP A;  3SXO A;  2CNM A;  1BOB A;  4UA3 A;  2YNC C;  4HKF A;  1TIQ A;  4NEX A;  5KTD A;  4KS9 A;  1WWZ A;  3TCV A;  4B5P B;  1XMT A;  2R1I A;  3UY5 A;  5J8F A;  3H4Q A;  4Q38 A;  4AG9 A;  5HMN A;  4AVB A;  3I3G A;  2P0W A;  4CGP A;  1Q2Y A;  4JXQ A;  2VI7 A;  3R9E A;  3I9S A;  3BJ7 A;  4R3K A;  1YX0 A;  2QML A;  5E96 A;  1U6M A;  4U9Z A;  4QC6 A;  1XF8 A;  2D4P A;  2OH1 A;  3GKR A;  2FCK A;  5F47 A;  2CY2 A;  5H84 A;  4F6A A;  1YR0 A;  4FD7 A;  5DWM A;  5KTC A;  4DNC A;  1B6B A;  3H5Z A;  2P6F A;  3TO6 A;  1VHS A;  2A4N A;  1YVO A;  2BUE A;  4UWI A;  3T90 A;  4M85 A;  2B4D A;  3SHP A;  4MFZ A;  4F0Y A;  5F49 A;  2FXF A;  3GYA A;  3RYO A;  4JXR A;  2WPW A;  3FBU A;  3A9L A;  4JLY A;  4UFX A;  4OAE A;  4ONU A;  3F5B A;  5A28 A;  2PR1 A;  3IWE A;  4KOX A;  1N71 A;  1XIX A;  2IL4 A;  3MGD A;  5JPH A;  1P4N A;  2Q4V A;  2AE6 A;  4MFJ A;  1M4I A;  2B5G B;  4CYP A;  1MJA A;  2Z3L A;  2QIR A;  1RO5 A;  4HNW B;  2OU2 A;  4CAX A;  4BBH A;  2WSA A;  2H5M A;  3PP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...