2O28A

Crystal structure of gnpnat1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
182
Chain Sequence
PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Crystal Structure of Glucosamine-Phosphate N-Acetyltransferase 1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2o28A01
2H5MA 1UFHA 1GHEA 3BLNA 1QSMA 2EUIA 5JPHA 4XPLA 1MJAA 4L8AA 2CY2A 3W6XA 4CRZB 4GS4A 2ZXVA 4XNHB 2PQ8A 4R87A 3DDDA 2OU2A 3FRMA 2FE7A 1KUXA 2PSWA 2FL4A 4L89A 3TE4A 4KOXA 4MHDA 3TO9A 4K30A 4ORFA 5GCNA 1Q2DA 3TOBA 4MY0A 4KOVA 1KZFA 2I00A 3TTHA 5ISVA 3IGRA 4AVCA 4H89A 4CRYB 1MK4A 2BUEA 2B58A 5IB0A 2R8VA 3FNCA 4AG9A 2DXQA 1J4JA 2HUZA 3ZJ0A 5C88A 5CNPA 4KVOE 4LUAA 4OADA 1NE9A 4HKFA 2QECA 4R3KA 4KOYA 4IF5A 2Y0MA 1QSRA 5H86A 1BOBA 1KUYA 1Z9UA 4NEXA 1NSLA 2AJ6A 4KUBA 4QUSA 4KOSA 4KOWA 4KUAA 2Z11A 5HH1A 4JD6A 1I1DA 2X7BA 2Q4VA 4ZBGA 2ZPAA 1IIDA 2PR1A 3I3GA 1NMTA 3SHPA 2P6EA 2FT0A 3DR6A 2F5IA 1B87A 4MI4A 2B3UA 2ARHA 4PSWA 1KUVA 4LX9A 1I12A 5F49A 4II9A 2OZGA 5E96A 1P0HA 4Y49C 5F47A 3CXPA 3D2PA 2D4PA 1V0CA 3R9EA 1S7NA 4AVBA 4PK2A 1XE4A 2Q7BA 4J3GA 4HNXB 3QB8A 4KVME 2FCKA 2R1IA 3DR8A 3VWDA 3I9SA 4XPDC 1XMTA 4KVXA 4MJ8A 4KLWA 2JDCA 4UWJA 3S6HA 2VZZA 4X5KA 5F48A 1Y9WA 3S6GA 5H84A 1XEBA 2J8RA 2JEVA 1Z4RA 3TO7A 3D3SA 4XNHC 4YFJA 1L0CA 1Q2CA 2B4BA 4MBUA 4QC6A 2WPWA 1YREA 2GIVA 4AB7A 5IV0A 4B5OA 4ONUA 5IX3A 3GY9A 3TOAA 1VKCA 2B5GB 3EXNA 3G3SA 4EVYA 1I21A 4PSXA 1WK4A 2Z10A 4NCZA 3EC4A 1S7KA 4CS0B 2CNTA 4IUSA 1ON0A 2KCWA 4JLYA 1S60A 2ZW4A 4UA3A 5KTAA 4NSQA 3IWGA 3TFYA 1RXTA 3PZJA 5F46A 3EO4A 3KKWA 4KZTA 2REFA 1YVOA 1YLEA 3BJ8A 1SQHA 4CAVA 4UBRA 1Z4EA 4QBJA 1QSTA 3NE7A 4AVAA 3QAHA 1TIQA 5DWMA 2FIWA 3T90A 1MJBA 2CNMA 5KTCA 3SXNA 4HNYB 3DNSA 5JQ4A 3FIXA 1S3ZA 3SXOA 1P4NA 3DSBA 4OLLA 1CJWA 3TO6A 4YRHA 4QB9A 3GKRA 3T9YA 4BMHA 4RI1A 2BSWA 4MY3A 2QIRA 2I79A 3PP9A 3EY5A 1VHSA 2HQYA 2HV2A 4H6UA 1QSNA 4KOUA 4PK3A 3R9GA 1Y9KA 1R57A 3JVNA 3VWEA 4NXYA 2K5TA 4PV6A 2J8MA 3R95A 1YK3A 1YR0A 1LRZA 1XF8A 2Q4YA 4FD4A 1N71A 2B4DB 1Y7RA 2B5GA 2OB0A 1K4JA 4FD5A 3WR7A 1BO4A 2ZW6A 4B5PB 3C26A 4CAWA 3B8GA 3LD2A 2JLMA 1M4DA 2ATRA 4H6ZA 2FXFA 1Q2YA 3FXTA 4YGOA 2JDDA 4HNWB 4I49A 2VQYA 5KTDA 3P2FA 4U9ZA 3K9UA 2GE3A 5HMNA 4XPDB 1M4IA 4F6AA 1OZPA 2WPXA 3EFAA 5EBVA 2VI7A 3S6FA 4AG7A 2D4OA 3FB3A 4FD6A 3R1KA 3TT2A 2B3VA 3W91A 1XIXA 1M44A 2FSRA 3CXSA 3F5BA 1S7LA 3D8PA 3R9FA 1B6BA 4JXQA 2P0WA 4E2AA 2BEIA 1MJ9A 1IICA 3FYNA 3P2HA 5FVJA 2OZUA 5C82A 3RYOA 3OWCA 4E8OA 3N7ZA 3S6KA 1WWZA 1YVKA 2NMTA 2P6FA 2P6GA 2VXKA 1S7FA 2QMLA 5DWNA 1PU9A 4R9MA 3BJ7A 3MGDA 4M85A 2EVNA 4NF1A 4R3LA 1YX0A 2RC4A 4KORA 3R96A 1IYKA 4E0AA 3GYAA 3D2MA 1IYLA 3JUWA 4JXRA 1M4GA 3PGPA 3F0AA 2PRBA 2OH1A 5J8FA 2G3TA 2PC1A 2B4DA 3FBUA 4FD7A 5J8CA 3F8KA 2FS5A 4UWIA 1M1DA 4U9YA 2BL1A 4U5YA 4B5PA 1FY7A 2ZW5A 3TCVA 2Z0ZA 2Q0YA 3CXQA 4F0YA 2G0BA 3G8WA 3UY5A 4R57A 4XPKA 2O28A 3E0KA 1PUAA 2GANA 2Q04A 1CM0A 4KOTA 4JJXA 2PR8A 1QSOA 2CNSA 2OZHA 4JWPA 2FIAA 2REEA 3H4QA 4KLVA 4M3SA 1RO5A 2VZYA 4Y49B 4RS2A 3LODA 2G3AA 4QVTA 4CAXA 3W6SA 4OAEA 1U6MA 2J8NA 3ZZIA 4DNCA 1S5KA 2IL4A 2Q44A 2PDOA 1IB1E 2R98A 2AE6A 2R7HA 1YGHA 2A4NA 2C27A 2VEZA 2ZW7A 3V8IA 5I0CA 5EC4A 2VBQA
chains in the Genus database with same CATH superfamily
4YWYA 2H5MA 2YGWA 3HUVA 4UF4A 3NH8A 1UFHA 3FEDA 2QJ8A 1GHEA 3BLNA 1QSMA 3NFZA 4ZX9A 2EUIA 2DF5A 5JPHA 1YSJA 4XPLA 4ZY2A 3WC5A 1MJAA 4JYWA 1Z5RA 4L8AA 3KGQA 2CY2A 4Q7AA 3W6XA 3D66A 2C6PA 2ZXVA 4GS4A 4GXHA 4NGMA 4CRZB 1NSAA 2EO8A 4XNHB 2PQ8A 4P4IA 4R87A 3GB0A 3DDDA 2OU2A 2ZEMA 5HVHA 3FRMA 2FE7A 1KUXA 2PSWA 2FL4A 2OOTA 2J9AA 4L89A 4UEFA 5G21A 3TE4A 4KOXA 1H8LA 4MHDA 4OKOA 3TO9A 4K30A 4ORFA 4CPAA 5GCNA 6CPAA 4Q36A 1Q2DA 4CAEA 3TOBA 4MY0A 7CPAA 3N5FA 5DS0A 4UIBA 4KOVA 1KZFA 2I00A 3KL9A 3CT9A 4G1PA 4F0XA 2I3CA 3TTHA 3V38A 2GU2A 4FUUA 4O23A 5ISVA 4P45A 2IMOA 2QYVA 3IGRA 4H89A 3GLJA 4MFQA 3GUXA 4AVCA 3NA6A 4CRYB 5K8NA 1MK4A 1X12A 1YLOA 2BUEA 2O4HA 4MFPA 5EMIA 5K8MA 2B58A 4UIAA 5IB0A 3A9LA 1HEEA 2R8VA 3ISZA 4A30A 5D29A 3FNCA 3S9NA 2ABZA 4IHMA 1EE3P 2Q7SA 4UFWA 4AG9A 4EFDA 3QNVA 4DYOA 4PXDA 2DXQA 1J4JA 2EWBA 2HUZA 3ZJ0A 4PQAA 5C88A 2NSMA 5CNPA 4KVOE 4LUAA 4R6TA 4OADA 2RB7A 1NE9A 1CP6A 4HKFA 2QECA 4R3KA 4KOYA 4IF5A 3RNZA 1KWMA 2Y0MA 1QSRA 3KR4A 3FX6A 5H86A 3KQZA 1TF9A 1TKFA 1BOBA 1DE4C 4ZX8A 4MHNA 1KUYA 1Z9UA 4WJBA 2EK9A 4MHPA 3H8EA 4NEXA 1NSLA 1FNOA 2AJ6A 4KUBA 2QVPA 4AXVA 2CTCA 4QUSA 4KOSA 2AFUA 4KOWA 4KUAA 2Z11A 3D7GA 5HH1A 4JD6A 3DLJA 4CYQA 1I1DA 1R43A 3B7IA 1TKJA 1Z8WA 2X7BA 3B3WA 2Q4VA 3IC1A 4A31A 5CBMA 4ZBGA 2ZPAA 4M6IA 4C2XA 1F57A 4KSIA 1IIDA 2PJ6A 1Q7LA 2PR1A 4CYPA 2XEIA 1RTQA 1AUGA 3BI1A 3I3GA 4P4BA 4OMEA 3D67A 3GIUA 1NMTA 4ZY1A 4RUHA 1LFWA 3SHPA 2P6EA 2ZEPA 2FT0A 1BAVA 3DR6A 4M6GA 2F5IA 1B87A 4MI4A 5LYFA 4F9VA 2B3UA 2ARHA 3H5ZA 3DGVA 3LMSA 4MCRA 1KUVA 4LX9A 4PSWA 4R76A 3BI0A 1CP7A 2G9DA 1I12A 2GLJA 3JTKA 5F49A 5LYDA 2OZGA 5E96A 4II9A 1P0HA 1XOVA 4Y49C 4A39A 5F47A 3CXPA 3I1UA 4YU9A 3FJUA 2PVWA 3D2PA 1YQEA 2PVVA 2D4PA 1V0CA 3R9EA 1F2OA 1S7NA 2Q43A 3PBBA 4AVBA 4C68A 2HB6A 4PK2A 1XE4A 2Q7BA 4B10A 4J3GA 1X10A 4DUKA 4HNXB 4MRIA 4P4FA 3QB8A 4F8ZA 2V8DA 2PJ3A 4KVME 2CIJA 2FCKA 2R1IA 3DR8A 3VWDA 1JQGA 1VGYA 3I9SA 2IJZA 4XPDC 4EMEA 5JGFA 1XMTA 2PJBA 4KVXA 2XEJA 4MJ8A 5LRGA 4JZ0A 4A94A 4KLWA 5D8NA 2JDCA 4UWJA 3IFEA 2VZZA 2AFZA 4X5KA 5F48A 3S6HA 3VARA 1Y9WA 2V8HA 4ZGYB 3S6GA 3SJXA 5H84A 1FT7A 1XEBA 3MRUA 4CYNA 2J8RA 2JEVA 1CPXA 1Z4RA 2PJ0A 3TO7A 4ZYQA 3D3SA 4OC0A 5AG4A 4XNHC 4MCQA 4YFJA 1L0CA 1Y0YA 4B6ZA 1Q2CA 2B4BA 4MBUA 4MXUA 2WPWA 4QC6A 4C7IA 3LWUA 1YREA 2GIVA 4A32A 4AB7A 4NGPA 5IV0A 4B5OA 4OIWA 4ONUA 5IX3A 2F7VA 3GY9A 3TOAA 4NJRA 1VKCA 4P44A 5HVFA 1A2ZA 5G22A 2B5GB 1Z2LA 3EXNA 1TF8A 2GLFA 1BPNA 2PJ7A 3PB6X 3G3SA 4CAFA 4EVYA 1I21A 3RAMA 4NGTA 5J1QA 4PSXA 3IEHA 1DTDA 5AG6A 4LQ6A 1WK4A 2Z10A 4NCZA 3EC4A 4F9UA 3KASA 1S7KA 3B3CA 2WYRA 5LYIA 4CS0B 1Z8TA 2CNTA 2PJ4A 4IUSA 4MMOA 5LRKA 1ON0A 3FMCA 4PXBA 4P4JA 2KCWA 4JLYA 4B13A 1S60A 4UCPA 2ZW4A 4UA3A 2PJCA 5KTAA 4NSQA 3BHXA 3IWGA 3TFYA 2EK8A 1RXTA 2ZEOA 3PZJA 2HC9A 3CZXA 4K3NA 5F46A 3EO4A 3K9TA 2ZOGA 3KKWA 3D7HA 4KZTA 2JBKA 3SI0A 2WUUA 5F09A 4LQGA 4B14A 2REFA 3KQXA 1QQ9A 1YVOA 1YLEA 4KSAA 3VH9A 3BJ8A 2WZNA 2Q4ZA 1SQHA 2NYQA 1VHEA 4UBRA 3B35A 4CAVA 2ZEDA 1Z4EA 4QBJA 1LCPA 1QSTA 3NE7A 3D68A 4AVAA 2AFXA 3QAHA 1TIQA 1Z8LA 5DWMA 2FIWA 3PB4X 4KS9A 3T90A 1MJBA 2Z3KA 2CNMA 5KTCA 2GREA 3MN8A 3SXNA 2CXAA 4HNYB 2BO9A 3DNSA 3FIXA 5IB9A 5JQ4A 1S3ZA 4UCMA 3RO0A 3SXOA 1P4NA 4FBEA 3DSBA 4OLLA 2POKA 3IWEA 2AFMA 2V8VA 1CJWA 3D7DA 3TO6A 4C7HA 4YRHA 1XRYA 1VIXA 2ZEGA 2Z3LA 2FVGA 4QB9A 3GKRA 1AMPA 4CGLA 4OC5A 4IAVA 4A95A 2ANPA 4HPSA 3T9YA 4OC4A 1YW6A 4M6HA 3TX8A 4BMHA 4RI1A 2RFHA 2BSWA 4MY3A 2QIRA 2JEWA 5AG5A 2I79A 3NE8A 3PB8X 3PP9A 3PFEA 3EY5A 1VHSA 1ELMP 1ZG8A 2HQYA 2HV2A 2XEGA 4H6UA 1QSNA 4KOUA 4PK3A 3R9GA 4A2ZA 4BBHA 1Y9KA 3B3SA 1R57A 2CF4A 3KZWA 4H2KA 1ARMA 3JVNA 5G20A 3IWWA 4B11A 5K8OA 5AGEA 3VWEA 4NXYA 2K5TA 3PBEA 3V7ZA 4UEZA 4PPZA 4PV6A 2J8MA 3R95A 1YK3A 1CG2A 1YR0A 3WABA 3SJGA 1TXRA 1LRZA 1XF8A 2Q4YA 2Q51A 4FD4A 1Y7EA 1N71A 2B4DB 4NGNA 1Y7RA 4Q38A 2B5GA 1LANA 2OB0A 1K4JA 5LYLA 4X2TA 4FD5A 4PXEA 4OP4A 3WR7A 1BO4A 2AFOA 2ZW6A 4C2ZA 4CGNA 1HDQA 1Z8XA 4B5PB 4WWVA 3C26A 3H8FA 3VATA 2YNCA 4P10A 2PRQA 4CAWA 3B8GA 3LD2A 2JLMA 3TC8A 1M4DA 2ATRA 4MFZA 4H6ZA 2XEFA 2FXFA 2DPSA 3SJFA 4A37A 1Q2YA 3FXTA 4YGOA 2JDDA 2ZEHA 4HNWB 4I49A 5I4MA 2VQYA 5KTDA 4CGMA 2YNEA 3P2FA 3K9UA 2GE3A 4U9ZA 5HMNA 2C6CA 4MCPA 4XPDB 1M4IA 4F6AA 1OZPA 1ZLHA 2WPXA 3EFAA 5EBVA 2VI7A 5HVGA 3H8GA 1LAPA 2PJ2A 3S6FA 3IO1A 4AG7A 2D4OA 2PJ1A 4P6YA 2V77A 3FB3A 2EBJA 4FD6A 3R1KA 3TT2A 4FAIA 2PCUA 2B3VA 3W91A 5JH9A 1XIXA 1IY7A 2Z3NA 4UFXA 4BD9A 1M44A 2FSRA 3CXSA 2WSAA 3F5BA 1S7LA 2ZOFA 1YW4A 3D8PA 3R9FA 1B6BA 2IQ6A 4JXQA 3WC7A 4MFLA 2P0WA 2YNCC 2AFSA 2YNDA 5AG7A 4E2AA 2BEIA 1MJ9A 3B3TA 1IICA 2OR4A 3FYNA 3P2HA 3IU2A 5FVJA 3SI1A 2PJ8A 4FWUA 1ZG7A 2OZUA 3KHXA 5C82A 3RYOA 3FH4A 1TKHA 2PJAA 4P4EA 3OWCA 3NH4A 3WC6A 4E8OA 1Y0RA 1LAMA 4UEEA 1LOKA 3N7ZA 2C1CA 3S6KA 1QMUA 1WWZA 1YVKA 3LACA 2ZEEA 2NMTA 2PIYA 4NGQA 4MFJA 1ZLIA 3ISXA 2P6FA 2P6GA 2VXKA 3CDXA 1S7FA 3S9LA 2QMLA 4W9YA 2ZENA 5DWNA 3D4UA 4OC3A 1PU9A 2BCOA 4R9MA 1ARLA 4TWEA 3BJ7A 3MGDA 4M85A 2EVNA 3D7FA 2PE3A 4NF1A 1YX0A 3QAYA 4R3LA 5CPAA 4DJLA 2RC4A 3CPXA 3PB9X 4KORA 4OIDA 5ELYA 3R96A 3PFOA 1IYKA 3KHZA 4E0AA 3L2NA 1OBRA 3GYAA 4Z65A 1YMEA 3D2MA 3JRUA 4ONWA 1IYLA 2C6GA 2JBJA 3JUWA 1M4GA 2GFQA 2ODFA 4JXRA 3PGPA 5G1ZA 5LRJA 4A38A 3F0AA 3IU1A 2PIZA 2PRBA 1PCAA 2AFWA 1IGBA 1IU8A 2OH1A 3KI9A 5J8FA 2G3TA 2PC1A 2B4DA 4MFKA 3CPAA 4UCNA 1R3NA 1VHOA 3FBUA 1AYEA 4FD7A 5J8CA 4ZY0A 3F8KA 1XJOA 2FS5A 4UWIA 1M1DA 1UWYA 4U9YA 1F2PA 2BL1A 4U5YA 4R7MA 2V8GA 4RN7A 3WT4A 1IOIA 2O53A 3PEIA 1FY7A 1GYTA 4B5PA 2ZW5A 1BLLE 3TCVA 2VL1A 2Z0ZA 5A27A 4BINA 4P4DA 2Q0YA 4NGRA 4NFRA 3CXQA 4R8FA 4F0YA 2G0BA 3KR5A 2ZEFA 3G8WA 3B3VA 3FEEA 1XFOA 4X8IA 4R57A 4XPKA 3UY5A 2O28A 4CGPA 3FVLA 2DPTA 4OC1A 3E0KA 3SI2A 1CX8A 3PRTA 1PUAA 5HXDA 2F8HA 2GANA 2Q04A 1CM0A 4KOTA 4JJXA 2PR8A 1QSOA 4GM5A 2CNSA 2OZHA 3IIBA 4JWPA 5A28A 2FIAA 2REEA 2BOAA 3H4QA 4KLVA 4M3SA 1RO5A 4MHYA 3PB7X 2ZELA 3FECA 4MHZA 4A33A 1HDUA 4NJQA 1CPSA 1BPMA 2VZYA 4Y49B 4ZI6A 3S9MA 4CGOA 4RS2A 3LODA 1IOFA 3RBUA 2Z3PA 2G3AA 1ELLP 3T8WA 4EWTA 4MCSA 3SJEA 3BXMA 3HLPA 4QVTA 4CAXA 4TNUA 3W6SA 3IJ3A 3FF3A 4OAEA 3RZAA 1U6MA 2J8NA 3ZZIA 4CYOA 4DNCA 1S5KA 2IL4A 3NH5A 1ZO0A 2Z3OA 2Z3MA 1ZG9A 2Q44A 4C2YA 4PXCA 2PDOA 2PJ5A 2PJ9A 4X3RA 2CTBA 1IB1E 4OC2A 5THWA 1XMBA 2R98A 8CPAA 1JWQA 2AE6A 2R7HA 1YGHA 4IK2A 2A4NA 2C27A 2VEZA 5BWAB 5K8PA 1PYTB 2ZW7A 4KSFA 3K2KA 3B2YA 3V8IA 4B12A 1CBXA 1M4LA 5I0CA 5JM6A 2DEAA 4UFVA 5EC4A 4NGSA 1XBUA 2VBQA
chains in the Genus database with same CATH topology
2H5MA 2YGWA 1UFHA 1GHEA 3BLNA 1QSMA 2EUIA 5JPHA 4XPLA 1MJAA 4L8AA 2CY2A 3W6XA 4CRZB 4GS4A 2ZXVA 4XNHB 2PQ8A 4R87A 3DDDA 2OU2A 3FRMA 2FE7A 1KUXA 2PSWA 2FL4A 4L89A 5G21A 3TE4A 4KOXA 4MHDA 3TO9A 4K30A 4ORFA 5GCNA 4Q36A 1Q2DA 4CAEA 3TOBA 4MY0A 4KOVA 1KZFA 2I00A 4F0XA 3TTHA 5ISVA 3IGRA 4AVCA 4H89A 4MFQA 4CRYB 1MK4A 2BUEA 4MFPA 2B58A 5IB0A 3A9LA 2R8VA 4A30A 3FNCA 4UFWA 4AG9A 2DXQA 1J4JA 2HUZA 3ZJ0A 5C88A 5CNPA 4KVOE 4LUAA 4OADA 1NE9A 4HKFA 2QECA 4R3KA 4KOYA 4IF5A 2Y0MA 1QSRA 5H86A 1BOBA 1KUYA 1Z9UA 4NEXA 1NSLA 2AJ6A 4KUBA 4QUSA 4KOSA 4KOWA 4KUAA 2Z11A 5HH1A 4JD6A 4CYQA 1I1DA 2X7BA 4A31A 2Q4VA 4ZBGA 2ZPAA 4C2XA 1IIDA 2PR1A 4CYPA 3I3GA 1NMTA 3SHPA 2P6EA 2FT0A 3DR6A 2F5IA 1B87A 4MI4A 2B3UA 3H5ZA 2ARHA 4PSWA 1KUVA 4LX9A 1I12A 3JTKA 5F49A 4II9A 2OZGA 5E96A 1P0HA 4Y49C 5F47A 3CXPA 3D2PA 2D4PA 1V0CA 3R9EA 1S7NA 4AVBA 4C68A 4PK2A 1XE4A 2Q7BA 4B10A 4J3GA 4HNXB 3QB8A 4KVME 2FCKA 2R1IA 3DR8A 3VWDA 3I9SA 4XPDC 1XMTA 4KVXA 4MJ8A 4KLWA 2JDCA 4UWJA 3S6HA 2VZZA 4X5KA 5F48A 1Y9WA 4ZGYB 3S6GA 5H84A 1XEBA 4CYNA 2J8RA 2JEVA 1Z4RA 3TO7A 3D3SA 5AG4A 4XNHC 4YFJA 1L0CA 1Q2CA 2B4BA 4MBUA 4QC6A 2WPWA 4C7IA 1YREA 2GIVA 4A32A 4AB7A 5IV0A 4B5OA 4ONUA 5IX3A 3GY9A 3TOAA 1VKCA 5G22A 2B5GB 3EXNA 4CAFA 3G3SA 4EVYA 1I21A 4PSXA 5AG6A 1WK4A 2Z10A 4NCZA 3EC4A 1S7KA 4CS0B 2CNTA 4IUSA 1ON0A 2KCWA 4JLYA 4B13A 1S60A 4UCPA 2ZW4A 4UA3A 5KTAA 4NSQA 3IWGA 3TFYA 1RXTA 3PZJA 5F46A 3EO4A 3KKWA 4KZTA 2WUUA 4B14A 2REFA 1YVOA 1YLEA 4KSAA 3BJ8A 1SQHA 4CAVA 4UBRA 1Z4EA 4QBJA 1QSTA 3NE7A 4AVAA 3QAHA 1TIQA 5DWMA 2FIWA 3T90A 4KS9A 1MJBA 2Z3KA 2CNMA 5KTCA 3SXNA 2CXAA 4HNYB 3DNSA 5JQ4A 3FIXA 1S3ZA 4UCMA 3SXOA 1P4NA 3DSBA 4OLLA 3IWEA 1CJWA 3TO6A 4C7HA 4YRHA 2Z3LA 4QB9A 3GKRA 4CGLA 4A95A 3T9YA 4BMHA 4RI1A 2BSWA 4MY3A 2QIRA 5AG5A 2I79A 3PP9A 3EY5A 1VHSA 2HQYA 2HV2A 4H6UA 1QSNA 4KOUA 4PK3A 3R9GA 4A2ZA 4BBHA 1Y9KA 5G20A 1R57A 4B11A 3JVNA 5AGEA 3VWEA 4NXYA 2K5TA 4PV6A 2J8MA 3R95A 1YK3A 1YR0A 1LRZA 1XF8A 2Q4YA 4FD4A 1N71A 2B4DB 4Q38A 1Y7RA 2B5GA 2OB0A 1K4JA 4FD5A 3WR7A 1BO4A 2ZW6A 4C2ZA 4CGNA 4B5PB 3C26A 4CAWA 2YNCA 3B8GA 3LD2A 2JLMA 1M4DA 2ATRA 4MFZA 4H6ZA 2FXFA 2DPSA 1Q2YA 3FXTA 4YGOA 2JDDA 4HNWB 4I49A 2VQYA 5KTDA 4CGMA 2YNEA 3P2FA 3K9UA 2GE3A 4U9ZA 5HMNA 4XPDB 1M4IA 4F6AA 1OZPA 2WPXA 3EFAA 5EBVA 2VI7A 3S6FA 4AG7A 2D4OA 3FB3A 4FD6A 3R1KA 3TT2A 2B3VA 3W91A 1XIXA 2Z3NA 4UFXA 1M44A 2FSRA 3CXSA 2WSAA 3F5BA 1S7LA 3D8PA 3R9FA 1B6BA 4JXQA 4MFLA 2P0WA 2YNCC 4E2AA 2YNDA 5AG7A 2BEIA 1MJ9A 1IICA 3FYNA 3P2HA 3IU2A 5FVJA 2OZUA 5C82A 3RYOA 3OWCA 4E8OA 3N7ZA 3S6KA 1WWZA 1YVKA 2NMTA 4MFJA 2P6FA 2P6GA 2VXKA 1S7FA 2QMLA 5DWNA 1PU9A 4R9MA 3BJ7A 3MGDA 4M85A 2EVNA 4NF1A 4R3LA 1YX0A 2RC4A 4KORA 3R96A 1IYKA 4E0AA 3GYAA 3D2MA 1IYLA 3JUWA 4JXRA 1M4GA 3PGPA 5G1ZA 3F0AA 3IU1A 2PRBA 2OH1A 5J8FA 2G3TA 2PC1A 2B4DA 4MFKA 4UCNA 3FBUA 4FD7A 5J8CA 3F8KA 2FS5A 4UWIA 1M1DA 4U9YA 2BL1A 4U5YA 4B5PA 1FY7A 2ZW5A 3TCVA 2Z0ZA 5A27A 2Q0YA 3CXQA 4F0YA 2G0BA 3G8WA 3UY5A 4R57A 4XPKA 2O28A 4CGPA 2DPTA 3E0KA 1PUAA 2GANA 2Q04A 1CM0A 4KOTA 4JJXA 2PR8A 1QSOA 2CNSA 2OZHA 4JWPA 5A28A 2FIAA 2REEA 3H4QA 4KLVA 4M3SA 1RO5A 4A33A 2VZYA 4Y49B 4CGOA 4RS2A 3LODA 2Z3PA 2G3AA 4QVTA 4CAXA 3W6SA 4OAEA 1U6MA 2J8NA 3ZZIA 4CYOA 4DNCA 1S5KA 2IL4A 1ZO0A 2Z3OA 2Z3MA 2Q44A 4C2YA 2PDOA 1IB1E 2R98A 2AE6A 2R7HA 1YGHA 2A4NA 2C27A 2VEZA 5BWAB 2ZW7A 4KSFA 3V8IA 4B12A 5I0CA 4UFVA 5EC4A 2VBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5M A;  1UFH A;  1GHE A;  3BLN A;  1QSM A;  2EUI A;  5JPH A;  4XPL A;  1MJA A;  4L8A A;  2CY2 A;  3W6X A;  4CRZ B;  4GS4 A;  2ZXV A;  4XNH B;  2PQ8 A;  4R87 A;  3DDD A;  2OU2 A;  3FRM A;  2FE7 A;  1KUX A;  2PSW A;  2FL4 A;  4L89 A;  3TE4 A;  4KOX A;  4MHD A;  3TO9 A;  4K30 A;  4ORF A;  5GCN A;  1Q2D A;  3TOB A;  4MY0 A;  4KOV A;  1KZF A;  2I00 A;  3TTH A;  5ISV A;  3IGR A;  4AVC A;  4H89 A;  4CRY B;  1MK4 A;  2BUE A;  2B58 A;  5IB0 A;  2R8V A;  3FNC A;  4AG9 A;  2DXQ A;  1J4J A;  2HUZ A;  3ZJ0 A;  5C88 A;  5CNP A;  4KVO E;  4LUA A;  4OAD A;  1NE9 A;  4HKF A;  2QEC A;  4R3K A;  4KOY A;  4IF5 A;  2Y0M A;  1QSR A;  5H86 A;  1BOB A;  1KUY A;  1Z9U A;  4NEX A;  1NSL A;  2AJ6 A;  4KUB A;  4QUS A;  4KOS A;  4KOW A;  4KUA A;  2Z11 A;  5HH1 A;  4JD6 A;  1I1D A;  2X7B A;  2Q4V A;  4ZBG A;  2ZPA A;  1IID A;  2PR1 A;  3I3G A;  1NMT A;  3SHP A;  2P6E A;  2FT0 A;  3DR6 A;  2F5I A;  1B87 A;  4MI4 A;  2B3U A;  2ARH A;  4PSW A;  1KUV A;  4LX9 A;  1I12 A;  5F49 A;  4II9 A;  2OZG A;  5E96 A;  1P0H A;  4Y49 C;  5F47 A;  3CXP A;  3D2P A;  2D4P A;  1V0C A;  3R9E A;  1S7N A;  4AVB A;  4PK2 A;  1XE4 A;  2Q7B A;  4J3G A;  4HNX B;  3QB8 A;  4KVM E;  2FCK A;  2R1I A;  3DR8 A;  3VWD A;  3I9S A;  4XPD C;  1XMT A;  4KVX A;  4MJ8 A;  4KLW A;  2JDC A;  4UWJ A;  3S6H A;  2VZZ A;  4X5K A;  5F48 A;  1Y9W A;  3S6G A;  5H84 A;  1XEB A;  2J8R A;  2JEV A;  1Z4R A;  3TO7 A;  3D3S A;  4XNH C;  4YFJ A;  1L0C A;  1Q2C A;  2B4B A;  4MBU A;  4QC6 A;  2WPW A;  1YRE A;  2GIV A;  4AB7 A;  5IV0 A;  4B5O A;  4ONU A;  5IX3 A;  3GY9 A;  3TOA A;  1VKC A;  2B5G B;  3EXN A;  3G3S A;  4EVY A;  1I21 A;  4PSX A;  1WK4 A;  2Z10 A;  4NCZ A;  3EC4 A;  1S7K A;  4CS0 B;  2CNT A;  4IUS A;  1ON0 A;  2KCW A;  4JLY A;  1S60 A;  2ZW4 A;  4UA3 A;  5KTA A;  4NSQ A;  3IWG A;  3TFY A;  1RXT A;  3PZJ A;  5F46 A;  3EO4 A;  3KKW A;  4KZT A;  2REF A;  1YVO A;  1YLE A;  3BJ8 A;  1SQH A;  4CAV A;  4UBR A;  1Z4E A;  4QBJ A;  1QST A;  3NE7 A;  4AVA A;  3QAH A;  1TIQ A;  5DWM A;  2FIW A;  3T90 A;  1MJB A;  2CNM A;  5KTC A;  3SXN A;  4HNY B;  3DNS A;  5JQ4 A;  3FIX A;  1S3Z A;  3SXO A;  1P4N A;  3DSB A;  4OLL A;  1CJW A;  3TO6 A;  4YRH A;  4QB9 A;  3GKR A;  3T9Y A;  4BMH A;  4RI1 A;  2BSW A;  4MY3 A;  2QIR A;  2I79 A;  3PP9 A;  3EY5 A;  1VHS A;  2HQY A;  2HV2 A;  4H6U A;  1QSN A;  4KOU A;  4PK3 A;  3R9G A;  1Y9K A;  1R57 A;  3JVN A;  3VWE A;  4NXY A;  2K5T A;  4PV6 A;  2J8M A;  3R95 A;  1YK3 A;  1YR0 A;  1LRZ A;  1XF8 A;  2Q4Y A;  4FD4 A;  1N71 A;  2B4D B;  1Y7R A;  2B5G A;  2OB0 A;  1K4J A;  4FD5 A;  3WR7 A;  1BO4 A;  2ZW6 A;  4B5P B;  3C26 A;  4CAW A;  3B8G A;  3LD2 A;  2JLM A;  1M4D A;  2ATR A;  4H6Z A;  2FXF A;  1Q2Y A;  3FXT A;  4YGO A;  2JDD A;  4HNW B;  4I49 A;  2VQY A;  5KTD A;  3P2F A;  4U9Z A;  3K9U A;  2GE3 A;  5HMN A;  4XPD B;  1M4I A;  4F6A A;  1OZP A;  2WPX A;  3EFA A;  5EBV A;  2VI7 A;  3S6F A;  4AG7 A;  2D4O A;  3FB3 A;  4FD6 A;  3R1K A;  3TT2 A;  2B3V A;  3W91 A;  1XIX A;  1M44 A;  2FSR A;  3CXS A;  3F5B A;  1S7L A;  3D8P A;  3R9F A;  1B6B A;  4JXQ A;  2P0W A;  4E2A A;  2BEI A;  1MJ9 A;  1IIC A;  3FYN A;  3P2H A;  5FVJ A;  2OZU A;  5C82 A;  3RYO A;  3OWC A;  4E8O A;  3N7Z A;  3S6K A;  1WWZ A;  1YVK A;  2NMT A;  2P6F A;  2P6G A;  2VXK A;  1S7F A;  2QML A;  5DWN A;  1PU9 A;  4R9M A;  3BJ7 A;  3MGD A;  4M85 A;  2EVN A;  4NF1 A;  4R3L A;  1YX0 A;  2RC4 A;  4KOR A;  3R96 A;  1IYK A;  4E0A A;  3GYA A;  3D2M A;  1IYL A;  3JUW A;  4JXR A;  1M4G A;  3PGP A;  3F0A A;  2PRB A;  2OH1 A;  5J8F A;  2G3T A;  2PC1 A;  2B4D A;  3FBU A;  4FD7 A;  5J8C A;  3F8K A;  2FS5 A;  4UWI A;  1M1D A;  4U9Y A;  2BL1 A;  4U5Y A;  4B5P A;  1FY7 A;  2ZW5 A;  3TCV A;  2Z0Z A;  2Q0Y A;  3CXQ A;  4F0Y A;  2G0B A;  3G8W A;  3UY5 A;  4R57 A;  4XPK A;  2O28 A;  3E0K A;  1PUA A;  2GAN A;  2Q04 A;  1CM0 A;  4KOT A;  4JJX A;  2PR8 A;  1QSO A;  2CNS A;  2OZH A;  4JWP A;  2FIA A;  2REE A;  3H4Q A;  4KLV A;  4M3S A;  1RO5 A;  2VZY A;  4Y49 B;  4RS2 A;  3LOD A;  2G3A A;  4QVT A;  4CAX A;  3W6S A;  4OAE A;  1U6M A;  2J8N A;  3ZZI A;  4DNC A;  1S5K A;  2IL4 A;  2Q44 A;  2PDO A;  1IB1 E;  2R98 A;  2AE6 A;  2R7H A;  1YGH A;  2A4N A;  2C27 A;  2VEZ A;  2ZW7 A;  3V8I A;  5I0C A;  5EC4 A;  2VBQ A; 
#chains in the Genus database with same CATH topology
 4YWY A;  2H5M A;  2YGW A;  3HUV A;  4UF4 A;  3NH8 A;  1UFH A;  3FED A;  2QJ8 A;  1GHE A;  3BLN A;  1QSM A;  3NFZ A;  4ZX9 A;  2EUI A;  2DF5 A;  5JPH A;  1YSJ A;  4XPL A;  4ZY2 A;  3WC5 A;  1MJA A;  4JYW A;  1Z5R A;  4L8A A;  3KGQ A;  2CY2 A;  4Q7A A;  3W6X A;  3D66 A;  2C6P A;  2ZXV A;  4GS4 A;  4GXH A;  4NGM A;  4CRZ B;  1NSA A;  2EO8 A;  4XNH B;  2PQ8 A;  4P4I A;  4R87 A;  3GB0 A;  3DDD A;  2OU2 A;  2ZEM A;  5HVH A;  3FRM A;  2FE7 A;  1KUX A;  2PSW A;  2FL4 A;  2OOT A;  2J9A A;  4L89 A;  4UEF A;  5G21 A;  3TE4 A;  4KOX A;  1H8L A;  4MHD A;  4OKO A;  3TO9 A;  4K30 A;  4ORF A;  4CPA A;  5GCN A;  6CPA A;  4Q36 A;  1Q2D A;  4CAE A;  3TOB A;  4MY0 A;  7CPA A;  3N5F A;  5DS0 A;  4UIB A;  4KOV A;  1KZF A;  2I00 A;  3KL9 A;  3CT9 A;  4G1P A;  4F0X A;  2I3C A;  3TTH A;  3V38 A;  2GU2 A;  4FUU A;  4O23 A;  5ISV A;  4P45 A;  2IMO A;  2QYV A;  3IGR A;  4H89 A;  3GLJ A;  4MFQ A;  3GUX A;  4AVC A;  3NA6 A;  4CRY B;  5K8N A;  1MK4 A;  1X12 A;  1YLO A;  2BUE A;  2O4H A;  4MFP A;  5EMI A;  5K8M A;  2B58 A;  4UIA A;  5IB0 A;  3A9L A;  1HEE A;  2R8V A;  3ISZ A;  4A30 A;  5D29 A;  3FNC A;  3S9N A;  2ABZ A;  4IHM A;  1EE3 P;  2Q7S A;  4UFW A;  4AG9 A;  4EFD A;  3QNV A;  4DYO A;  4PXD A;  2DXQ A;  1J4J A;  2EWB A;  2HUZ A;  3ZJ0 A;  4PQA A;  5C88 A;  2NSM A;  5CNP A;  4KVO E;  4LUA A;  4R6T A;  4OAD A;  2RB7 A;  1NE9 A;  1CP6 A;  4HKF A;  2QEC A;  4R3K A;  4KOY A;  4IF5 A;  3RNZ A;  1KWM A;  2Y0M A;  1QSR A;  3KR4 A;  3FX6 A;  5H86 A;  3KQZ A;  1TF9 A;  1TKF A;  1BOB A;  1DE4 C;  4ZX8 A;  4MHN A;  1KUY A;  1Z9U A;  4WJB A;  2EK9 A;  4MHP A;  3H8E A;  4NEX A;  1NSL A;  1FNO A;  2AJ6 A;  4KUB A;  2QVP A;  4AXV A;  2CTC A;  4QUS A;  4KOS A;  2AFU A;  4KOW A;  4KUA A;  2Z11 A;  3D7G A;  5HH1 A;  4JD6 A;  3DLJ A;  4CYQ A;  1I1D A;  1R43 A;  3B7I A;  1TKJ A;  1Z8W A;  2X7B A;  3B3W A;  2Q4V A;  3IC1 A;  4A31 A;  5CBM A;  4ZBG A;  2ZPA A;  4M6I A;  4C2X A;  1F57 A;  4KSI A;  1IID A;  2PJ6 A;  1Q7L A;  2PR1 A;  4CYP A;  2XEI A;  1RTQ A;  1AUG A;  3BI1 A;  3I3G A;  4P4B A;  4OME A;  3D67 A;  3GIU A;  1NMT A;  4ZY1 A;  4RUH A;  1LFW A;  3SHP A;  2P6E A;  2ZEP A;  2FT0 A;  1BAV A;  3DR6 A;  4M6G A;  2F5I A;  1B87 A;  4MI4 A;  5LYF A;  4F9V A;  2B3U A;  2ARH A;  3H5Z A;  3DGV A;  3LMS A;  4MCR A;  1KUV A;  4LX9 A;  4PSW A;  4R76 A;  3BI0 A;  1CP7 A;  2G9D A;  1I12 A;  2GLJ A;  3JTK A;  5F49 A;  5LYD A;  2OZG A;  5E96 A;  4II9 A;  1P0H A;  1XOV A;  4Y49 C;  4A39 A;  5F47 A;  3CXP A;  3I1U A;  4YU9 A;  3FJU A;  2PVW A;  3D2P A;  1YQE A;  2PVV A;  2D4P A;  1V0C A;  3R9E A;  1F2O A;  1S7N A;  2Q43 A;  3PBB A;  4AVB A;  4C68 A;  2HB6 A;  4PK2 A;  1XE4 A;  2Q7B A;  4B10 A;  4J3G A;  1X10 A;  4DUK A;  4HNX B;  4MRI A;  4P4F A;  3QB8 A;  4F8Z A;  2V8D A;  2PJ3 A;  4KVM E;  2CIJ A;  2FCK A;  2R1I A;  3DR8 A;  3VWD A;  1JQG A;  1VGY A;  3I9S A;  2IJZ A;  4XPD C;  4EME A;  5JGF A;  1XMT A;  2PJB A;  4KVX A;  2XEJ A;  4MJ8 A;  5LRG A;  4JZ0 A;  4A94 A;  4KLW A;  5D8N A;  2JDC A;  4UWJ A;  3IFE A;  2VZZ A;  2AFZ A;  4X5K A;  5F48 A;  3S6H A;  3VAR A;  1Y9W A;  2V8H A;  4ZGY B;  3S6G A;  3SJX A;  5H84 A;  1FT7 A;  1XEB A;  3MRU A;  4CYN A;  2J8R A;  2JEV A;  1CPX A;  1Z4R A;  2PJ0 A;  3TO7 A;  4ZYQ A;  3D3S A;  4OC0 A;  5AG4 A;  4XNH C;  4MCQ A;  4YFJ A;  1L0C A;  1Y0Y A;  4B6Z A;  1Q2C A;  2B4B A;  4MBU A;  4MXU A;  2WPW A;  4QC6 A;  4C7I A;  3LWU A;  1YRE A;  2GIV A;  4A32 A;  4AB7 A;  4NGP A;  5IV0 A;  4B5O A;  4OIW A;  4ONU A;  5IX3 A;  2F7V A;  3GY9 A;  3TOA A;  4NJR A;  1VKC A;  4P44 A;  5HVF A;  1A2Z A;  5G22 A;  2B5G B;  1Z2L A;  3EXN A;  1TF8 A;  2GLF A;  1BPN A;  2PJ7 A;  3PB6 X;  3G3S A;  4CAF A;  4EVY A;  1I21 A;  3RAM A;  4NGT A;  5J1Q A;  4PSX A;  3IEH A;  1DTD A;  5AG6 A;  4LQ6 A;  1WK4 A;  2Z10 A;  4NCZ A;  3EC4 A;  4F9U A;  3KAS A;  1S7K A;  3B3C A;  2WYR A;  5LYI A;  4CS0 B;  1Z8T A;  2CNT A;  2PJ4 A;  4IUS A;  4MMO A;  5LRK A;  1ON0 A;  3FMC A;  4PXB A;  4P4J A;  2KCW A;  4JLY A;  4B13 A;  1S60 A;  4UCP A;  2ZW4 A;  4UA3 A;  2PJC A;  5KTA A;  4NSQ A;  3BHX A;  3IWG A;  3TFY A;  2EK8 A;  1RXT A;  2ZEO A;  3PZJ A;  2HC9 A;  3CZX A;  4K3N A;  5F46 A;  3EO4 A;  3K9T A;  2ZOG A;  3KKW A;  3D7H A;  4KZT A;  2JBK A;  3SI0 A;  2WUU A;  5F09 A;  4LQG A;  4B14 A;  2REF A;  3KQX A;  1QQ9 A;  1YVO A;  1YLE A;  4KSA A;  3VH9 A;  3BJ8 A;  2WZN A;  2Q4Z A;  1SQH A;  2NYQ A;  1VHE A;  4UBR A;  3B35 A;  4CAV A;  2ZED A;  1Z4E A;  4QBJ A;  1LCP A;  1QST A;  3NE7 A;  3D68 A;  4AVA A;  2AFX A;  3QAH A;  1TIQ A;  1Z8L A;  5DWM A;  2FIW A;  3PB4 X;  4KS9 A;  3T90 A;  1MJB A;  2Z3K A;  2CNM A;  5KTC A;  2GRE A;  3MN8 A;  3SXN A;  2CXA A;  4HNY B;  2BO9 A;  3DNS A;  3FIX A;  5IB9 A;  5JQ4 A;  1S3Z A;  4UCM A;  3RO0 A;  3SXO A;  1P4N A;  4FBE A;  3DSB A;  4OLL A;  2POK A;  3IWE A;  2AFM A;  2V8V A;  1CJW A;  3D7D A;  3TO6 A;  4C7H A;  4YRH A;  1XRY A;  1VIX A;  2ZEG A;  2Z3L A;  2FVG A;  4QB9 A;  3GKR A;  1AMP A;  4CGL A;  4OC5 A;  4IAV A;  4A95 A;  2ANP A;  4HPS A;  3T9Y A;  4OC4 A;  1YW6 A;  4M6H A;  3TX8 A;  4BMH A;  4RI1 A;  2RFH A;  2BSW A;  4MY3 A;  2QIR A;  2JEW A;  5AG5 A;  2I79 A;  3NE8 A;  3PB8 X;  3PP9 A;  3PFE A;  3EY5 A;  1VHS A;  1ELM P;  1ZG8 A;  2HQY A;  2HV2 A;  2XEG A;  4H6U A;  1QSN A;  4KOU A;  4PK3 A;  3R9G A;  4A2Z A;  4BBH A;  1Y9K A;  3B3S A;  1R57 A;  2CF4 A;  3KZW A;  4H2K A;  1ARM A;  3JVN A;  5G20 A;  3IWW A;  4B11 A;  5K8O A;  5AGE A;  3VWE A;  4NXY A;  2K5T A;  3PBE A;  3V7Z A;  4UEZ A;  4PPZ A;  4PV6 A;  2J8M A;  3R95 A;  1YK3 A;  1CG2 A;  1YR0 A;  3WAB A;  3SJG A;  1TXR A;  1LRZ A;  1XF8 A;  2Q4Y A;  2Q51 A;  4FD4 A;  1Y7E A;  1N71 A;  2B4D B;  4NGN A;  1Y7R A;  4Q38 A;  2B5G A;  1LAN A;  2OB0 A;  1K4J A;  5LYL A;  4X2T A;  4FD5 A;  4PXE A;  4OP4 A;  3WR7 A;  1BO4 A;  2AFO A;  2ZW6 A;  4C2Z A;  4CGN A;  1HDQ A;  1Z8X A;  4B5P B;  4WWV A;  3C26 A;  3H8F A;  3VAT A;  2YNC A;  4P10 A;  2PRQ A;  4CAW A;  3B8G A;  3LD2 A;  2JLM A;  3TC8 A;  1M4D A;  2ATR A;  4MFZ A;  4H6Z A;  2XEF A;  2FXF A;  2DPS A;  3SJF A;  4A37 A;  1Q2Y A;  3FXT A;  4YGO A;  2JDD A;  2ZEH A;  4HNW B;  4I49 A;  5I4M A;  2VQY A;  5KTD A;  4CGM A;  2YNE A;  3P2F A;  3K9U A;  2GE3 A;  4U9Z A;  5HMN A;  2C6C A;  4MCP A;  4XPD B;  1M4I A;  4F6A A;  1OZP A;  1ZLH A;  2WPX A;  3EFA A;  5EBV A;  2VI7 A;  5HVG A;  3H8G A;  1LAP A;  2PJ2 A;  3S6F A;  3IO1 A;  4AG7 A;  2D4O A;  2PJ1 A;  4P6Y A;  2V77 A;  3FB3 A;  2EBJ A;  4FD6 A;  3R1K A;  3TT2 A;  4FAI A;  2PCU A;  2B3V A;  3W91 A;  5JH9 A;  1XIX A;  1IY7 A;  2Z3N A;  4UFX A;  4BD9 A;  1M44 A;  2FSR A;  3CXS A;  2WSA A;  3F5B A;  1S7L A;  2ZOF A;  1YW4 A;  3D8P A;  3R9F A;  1B6B A;  2IQ6 A;  4JXQ A;  3WC7 A;  4MFL A;  2P0W A;  2YNC C;  2AFS A;  2YND A;  5AG7 A;  4E2A A;  2BEI A;  1MJ9 A;  3B3T A;  1IIC A;  2OR4 A;  3FYN A;  3P2H A;  3IU2 A;  5FVJ A;  3SI1 A;  2PJ8 A;  4FWU A;  1ZG7 A;  2OZU A;  3KHX A;  5C82 A;  3RYO A;  3FH4 A;  1TKH A;  2PJA A;  4P4E A;  3OWC A;  3NH4 A;  3WC6 A;  4E8O A;  1Y0R A;  1LAM A;  4UEE A;  1LOK A;  3N7Z A;  2C1C A;  3S6K A;  1QMU A;  1WWZ A;  1YVK A;  3LAC A;  2ZEE A;  2NMT A;  2PIY A;  4NGQ A;  4MFJ A;  1ZLI A;  3ISX A;  2P6F A;  2P6G A;  2VXK A;  3CDX A;  1S7F A;  3S9L A;  2QML A;  4W9Y A;  2ZEN A;  5DWN A;  3D4U A;  4OC3 A;  1PU9 A;  2BCO A;  4R9M A;  1ARL A;  4TWE A;  3BJ7 A;  3MGD A;  4M85 A;  2EVN A;  3D7F A;  2PE3 A;  4NF1 A;  1YX0 A;  3QAY A;  4R3L A;  5CPA A;  4DJL A;  2RC4 A;  3CPX A;  3PB9 X;  4KOR A;  4OID A;  5ELY A;  3R96 A;  3PFO A;  1IYK A;  3KHZ A;  4E0A A;  3L2N A;  1OBR A;  3GYA A;  4Z65 A;  1YME A;  3D2M A;  3JRU A;  4ONW A;  1IYL A;  2C6G A;  2JBJ A;  3JUW A;  1M4G A;  2GFQ A;  2ODF A;  4JXR A;  3PGP A;  5G1Z A;  5LRJ A;  4A38 A;  3F0A A;  3IU1 A;  2PIZ A;  2PRB A;  1PCA A;  2AFW A;  1IGB A;  1IU8 A;  2OH1 A;  3KI9 A;  5J8F A;  2G3T A;  2PC1 A;  2B4D A;  4MFK A;  3CPA A;  4UCN A;  1R3N A;  1VHO A;  3FBU A;  1AYE A;  4FD7 A;  5J8C A;  4ZY0 A;  3F8K A;  1XJO A;  2FS5 A;  4UWI A;  1M1D A;  1UWY A;  4U9Y A;  1F2P A;  2BL1 A;  4U5Y A;  4R7M A;  2V8G A;  4RN7 A;  3WT4 A;  1IOI A;  2O53 A;  3PEI A;  1FY7 A;  1GYT A;  4B5P A;  2ZW5 A;  1BLL E;  3TCV A;  2VL1 A;  2Z0Z A;  5A27 A;  4BIN A;  4P4D A;  2Q0Y A;  4NGR A;  4NFR A;  3CXQ A;  4R8F A;  4F0Y A;  2G0B A;  3KR5 A;  2ZEF A;  3G8W A;  3B3V A;  3FEE A;  1XFO A;  4X8I A;  4R57 A;  4XPK A;  3UY5 A;  2O28 A;  4CGP A;  3FVL A;  2DPT A;  4OC1 A;  3E0K A;  3SI2 A;  1CX8 A;  3PRT A;  1PUA A;  5HXD A;  2F8H A;  2GAN A;  2Q04 A;  1CM0 A;  4KOT A;  4JJX A;  2PR8 A;  1QSO A;  4GM5 A;  2CNS A;  2OZH A;  3IIB A;  4JWP A;  5A28 A;  2FIA A;  2REE A;  2BOA A;  3H4Q A;  4KLV A;  4M3S A;  1RO5 A;  4MHY A;  3PB7 X;  2ZEL A;  3FEC A;  4MHZ A;  4A33 A;  1HDU A;  4NJQ A;  1CPS A;  1BPM A;  2VZY A;  4Y49 B;  4ZI6 A;  3S9M A;  4CGO A;  4RS2 A;  3LOD A;  1IOF A;  3RBU A;  2Z3P A;  2G3A A;  1ELL P;  3T8W A;  4EWT A;  4MCS A;  3SJE A;  3BXM A;  3HLP A;  4QVT A;  4CAX A;  4TNU A;  3W6S A;  3IJ3 A;  3FF3 A;  4OAE A;  3RZA A;  1U6M A;  2J8N A;  3ZZI A;  4CYO A;  4DNC A;  1S5K A;  2IL4 A;  3NH5 A;  1ZO0 A;  2Z3O A;  2Z3M A;  1ZG9 A;  2Q44 A;  4C2Y A;  4PXC A;  2PDO A;  2PJ5 A;  2PJ9 A;  4X3R A;  2CTB A;  1IB1 E;  4OC2 A;  5THW A;  1XMB A;  2R98 A;  8CPA A;  1JWQ A;  2AE6 A;  2R7H A;  1YGH A;  4IK2 A;  2A4N A;  2C27 A;  2VEZ A;  5BWA B;  5K8P A;  1PYT B;  2ZW7 A;  4KSF A;  3K2K A;  3B2Y A;  3V8I A;  4B12 A;  1CBX A;  1M4L A;  5I0C A;  5JM6 A;  2DEA A;  4UFV A;  5EC4 A;  4NGS A;  1XBU A;  2VBQ A; 
#chains in the Genus database with same CATH homology
 2H5M A;  2YGW A;  1UFH A;  1GHE A;  3BLN A;  1QSM A;  2EUI A;  5JPH A;  4XPL A;  1MJA A;  4L8A A;  2CY2 A;  3W6X A;  4CRZ B;  4GS4 A;  2ZXV A;  4XNH B;  2PQ8 A;  4R87 A;  3DDD A;  2OU2 A;  3FRM A;  2FE7 A;  1KUX A;  2PSW A;  2FL4 A;  4L89 A;  5G21 A;  3TE4 A;  4KOX A;  4MHD A;  3TO9 A;  4K30 A;  4ORF A;  5GCN A;  4Q36 A;  1Q2D A;  4CAE A;  3TOB A;  4MY0 A;  4KOV A;  1KZF A;  2I00 A;  4F0X A;  3TTH A;  5ISV A;  3IGR A;  4AVC A;  4H89 A;  4MFQ A;  4CRY B;  1MK4 A;  2BUE A;  4MFP A;  2B58 A;  5IB0 A;  3A9L A;  2R8V A;  4A30 A;  3FNC A;  4UFW A;  4AG9 A;  2DXQ A;  1J4J A;  2HUZ A;  3ZJ0 A;  5C88 A;  5CNP A;  4KVO E;  4LUA A;  4OAD A;  1NE9 A;  4HKF A;  2QEC A;  4R3K A;  4KOY A;  4IF5 A;  2Y0M A;  1QSR A;  5H86 A;  1BOB A;  1KUY A;  1Z9U A;  4NEX A;  1NSL A;  2AJ6 A;  4KUB A;  4QUS A;  4KOS A;  4KOW A;  4KUA A;  2Z11 A;  5HH1 A;  4JD6 A;  4CYQ A;  1I1D A;  2X7B A;  4A31 A;  2Q4V A;  4ZBG A;  2ZPA A;  4C2X A;  1IID A;  2PR1 A;  4CYP A;  3I3G A;  1NMT A;  3SHP A;  2P6E A;  2FT0 A;  3DR6 A;  2F5I A;  1B87 A;  4MI4 A;  2B3U A;  3H5Z A;  2ARH A;  4PSW A;  1KUV A;  4LX9 A;  1I12 A;  3JTK A;  5F49 A;  4II9 A;  2OZG A;  5E96 A;  1P0H A;  4Y49 C;  5F47 A;  3CXP A;  3D2P A;  2D4P A;  1V0C A;  3R9E A;  1S7N A;  4AVB A;  4C68 A;  4PK2 A;  1XE4 A;  2Q7B A;  4B10 A;  4J3G A;  4HNX B;  3QB8 A;  4KVM E;  2FCK A;  2R1I A;  3DR8 A;  3VWD A;  3I9S A;  4XPD C;  1XMT A;  4KVX A;  4MJ8 A;  4KLW A;  2JDC A;  4UWJ A;  3S6H A;  2VZZ A;  4X5K A;  5F48 A;  1Y9W A;  4ZGY B;  3S6G A;  5H84 A;  1XEB A;  4CYN A;  2J8R A;  2JEV A;  1Z4R A;  3TO7 A;  3D3S A;  5AG4 A;  4XNH C;  4YFJ A;  1L0C A;  1Q2C A;  2B4B A;  4MBU A;  4QC6 A;  2WPW A;  4C7I A;  1YRE A;  2GIV A;  4A32 A;  4AB7 A;  5IV0 A;  4B5O A;  4ONU A;  5IX3 A;  3GY9 A;  3TOA A;  1VKC A;  5G22 A;  2B5G B;  3EXN A;  4CAF A;  3G3S A;  4EVY A;  1I21 A;  4PSX A;  5AG6 A;  1WK4 A;  2Z10 A;  4NCZ A;  3EC4 A;  1S7K A;  4CS0 B;  2CNT A;  4IUS A;  1ON0 A;  2KCW A;  4JLY A;  4B13 A;  1S60 A;  4UCP A;  2ZW4 A;  4UA3 A;  5KTA A;  4NSQ A;  3IWG A;  3TFY A;  1RXT A;  3PZJ A;  5F46 A;  3EO4 A;  3KKW A;  4KZT A;  2WUU A;  4B14 A;  2REF A;  1YVO A;  1YLE A;  4KSA A;  3BJ8 A;  1SQH A;  4CAV A;  4UBR A;  1Z4E A;  4QBJ A;  1QST A;  3NE7 A;  4AVA A;  3QAH A;  1TIQ A;  5DWM A;  2FIW A;  3T90 A;  4KS9 A;  1MJB A;  2Z3K A;  2CNM A;  5KTC A;  3SXN A;  2CXA A;  4HNY B;  3DNS A;  5JQ4 A;  3FIX A;  1S3Z A;  4UCM A;  3SXO A;  1P4N A;  3DSB A;  4OLL A;  3IWE A;  1CJW A;  3TO6 A;  4C7H A;  4YRH A;  2Z3L A;  4QB9 A;  3GKR A;  4CGL A;  4A95 A;  3T9Y A;  4BMH A;  4RI1 A;  2BSW A;  4MY3 A;  2QIR A;  5AG5 A;  2I79 A;  3PP9 A;  3EY5 A;  1VHS A;  2HQY A;  2HV2 A;  4H6U A;  1QSN A;  4KOU A;  4PK3 A;  3R9G A;  4A2Z A;  4BBH A;  1Y9K A;  5G20 A;  1R57 A;  4B11 A;  3JVN A;  5AGE A;  3VWE A;  4NXY A;  2K5T A;  4PV6 A;  2J8M A;  3R95 A;  1YK3 A;  1YR0 A;  1LRZ A;  1XF8 A;  2Q4Y A;  4FD4 A;  1N71 A;  2B4D B;  4Q38 A;  1Y7R A;  2B5G A;  2OB0 A;  1K4J A;  4FD5 A;  3WR7 A;  1BO4 A;  2ZW6 A;  4C2Z A;  4CGN A;  4B5P B;  3C26 A;  4CAW A;  2YNC A;  3B8G A;  3LD2 A;  2JLM A;  1M4D A;  2ATR A;  4MFZ A;  4H6Z A;  2FXF A;  2DPS A;  1Q2Y A;  3FXT A;  4YGO A;  2JDD A;  4HNW B;  4I49 A;  2VQY A;  5KTD A;  4CGM A;  2YNE A;  3P2F A;  3K9U A;  2GE3 A;  4U9Z A;  5HMN A;  4XPD B;  1M4I A;  4F6A A;  1OZP A;  2WPX A;  3EFA A;  5EBV A;  2VI7 A;  3S6F A;  4AG7 A;  2D4O A;  3FB3 A;  4FD6 A;  3R1K A;  3TT2 A;  2B3V A;  3W91 A;  1XIX A;  2Z3N A;  4UFX A;  1M44 A;  2FSR A;  3CXS A;  2WSA A;  3F5B A;  1S7L A;  3D8P A;  3R9F A;  1B6B A;  4JXQ A;  4MFL A;  2P0W A;  2YNC C;  4E2A A;  2YND A;  5AG7 A;  2BEI A;  1MJ9 A;  1IIC A;  3FYN A;  3P2H A;  3IU2 A;  5FVJ A;  2OZU A;  5C82 A;  3RYO A;  3OWC A;  4E8O A;  3N7Z A;  3S6K A;  1WWZ A;  1YVK A;  2NMT A;  4MFJ A;  2P6F A;  2P6G A;  2VXK A;  1S7F A;  2QML A;  5DWN A;  1PU9 A;  4R9M A;  3BJ7 A;  3MGD A;  4M85 A;  2EVN A;  4NF1 A;  4R3L A;  1YX0 A;  2RC4 A;  4KOR A;  3R96 A;  1IYK A;  4E0A A;  3GYA A;  3D2M A;  1IYL A;  3JUW A;  4JXR A;  1M4G A;  3PGP A;  5G1Z A;  3F0A A;  3IU1 A;  2PRB A;  2OH1 A;  5J8F A;  2G3T A;  2PC1 A;  2B4D A;  4MFK A;  4UCN A;  3FBU A;  4FD7 A;  5J8C A;  3F8K A;  2FS5 A;  4UWI A;  1M1D A;  4U9Y A;  2BL1 A;  4U5Y A;  4B5P A;  1FY7 A;  2ZW5 A;  3TCV A;  2Z0Z A;  5A27 A;  2Q0Y A;  3CXQ A;  4F0Y A;  2G0B A;  3G8W A;  3UY5 A;  4R57 A;  4XPK A;  2O28 A;  4CGP A;  2DPT A;  3E0K A;  1PUA A;  2GAN A;  2Q04 A;  1CM0 A;  4KOT A;  4JJX A;  2PR8 A;  1QSO A;  2CNS A;  2OZH A;  4JWP A;  5A28 A;  2FIA A;  2REE A;  3H4Q A;  4KLV A;  4M3S A;  1RO5 A;  4A33 A;  2VZY A;  4Y49 B;  4CGO A;  4RS2 A;  3LOD A;  2Z3P A;  2G3A A;  4QVT A;  4CAX A;  3W6S A;  4OAE A;  1U6M A;  2J8N A;  3ZZI A;  4CYO A;  4DNC A;  1S5K A;  2IL4 A;  1ZO0 A;  2Z3O A;  2Z3M A;  2Q44 A;  4C2Y A;  2PDO A;  1IB1 E;  2R98 A;  2AE6 A;  2R7H A;  1YGH A;  2A4N A;  2C27 A;  2VEZ A;  5BWA B;  2ZW7 A;  4KSF A;  3V8I A;  4B12 A;  5I0C A;  4UFV A;  5EC4 A;  2VBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...