2O2BA

Spectroscopic and structural study of the heterotropic linkage between halide and proton ion binding to gfp proteins: e2(gfp)-i complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
234
structure length
233
Chain Sequence
GIDPFTVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Green fluorescent protein
publication title Spectroscopic and Structural Study of Proton and Halide Ion Cooperative Binding to GFP.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 68
structure length 233
sequence length 234
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2o2bA00
4KW9A 1KYPA 4XOWA 4BDUA 4R6BA 1KP5A 3G9AA 4DXIA 4PPJA 1XA9A 2Z1OA 1MOVA 3ED8A 2H5OA 2V4EB 3LVDA 4W6RA 5DPIA 4B30B 3H1RA 2OJKA 3GB3A 4W6TA 3SSPA 2FZUA 2Q57A 1W7SA 4H47A 3DQMA 5FHVA 5FVFA 3SVRA 4ZBLA 2BTJA 1GGXA 4W6NA 4EMQA 2C9JA 2AWKA 4ZF3A 3VHTB 4IK8A 4DXNA 4HQ9A 3GJ1A 1RM9A 3ZTFA 4AR7A 1H6RA 4W6JA 3U8CA 1QYQA 2PXSA 4J89A 3CB9A 5HZOA 4U2VA 2JADA 3SS0A 2VADA 3DQDA 3SVUA 3EK4A 2WHSA 4OJ0A 1Q4CA 5BTTA 3IR8A 3SSYA 1JC1A 1QYFA 2ZO7A 3ST3A 3BXCA 3P8UA 4ZFSA 3W1DA 4JFGA 2PXWA 3CGLA 4PFEA 3DQ8A 3PJ7A 4KF5A 3ZULA 3KCSA 3LSAA 2POXA 1EMEA 5F9GA 3AKOA 4KGFA 1RRXA 2A54B 3PIBA 3TMTA 4DKNA 4LJBA 4RYSA 1XSSA 3EK7A 1S6ZA 4GOBA 5BTTB 4XOVA 4Q9XA 3M24A 5EHUA 3U0MA 5DTLA 3ST4A 1YJ2A 2QU1A 3DQEA 4DXMA 2Z6XA 4IK4A 3ZUJA 5DRGA 2YFPA 5DTYA 5DQBA 2H5RA 4LJDC 2DUFA 2VVHA 1GL4A 2EMNA 2VVJA 4H48A 2AWLA 4KPIA 4W6GA 2RH7A 4R6DA 4KAGA 4I2YA 3BXAA 4J8AA 2Z6ZA 2H9WA 1YHGA 3NEZA 2VVIA 4W6SA 4EULA 3CFAA 2WHTA 3CD1A 3DQJA 4IZNA 5HBDA 2HGYA 4XL5A 2YE0A 4W6UA 5HW9A 2AHAA 1YHHA 3ADFA 4EDOA 3DQIA 2OGRA 1YHIA 5J2OA 1YFPA 4W76A 4ZF5A 2AWJA 3SVBA 1BFPA 2DUHA 3IP2A 5DPJA 4AS8A 3U0NA 1Z1QA 4P1QA 1MOUA 3DQFA 3U8PA 4W7DA 4W75A 2QRFA 3LS3A 1Z1PA 3CBEA 3DQ4A 4LQUA 4W6LA 4HE4A 2P4MA 3SG4A 4W6PA 2EMOA 4ORNA 4KGEA 4JRBA 3I19A 1F0BA 1RMPA 2YDZA 4JEOA 1Q4AA 2DUIA 4HQCA 5DY6A 3CD9A 1C4FA 2WISA 4P76A 3W1CA 4L13A 2G3OA 3BX9A 5DPGA 3WLCA 1QYOA 3O78A 1EMMA 5T3IA 2ZMUA 4RYWA 2AH8A 3SVDA 3SG5A 3EVPA 1JBZA 3DQ9A 3U8AA 3DQ5A 5FVIA 2B3QA 3DQ7A 3LF4B 3OGOA 3MGFA 3NF0A 2H6VA 2A50B 3SG6A 3DQ2A 2EMDA 3A8SA 2OKYA 4JF9A 4RTCA 3SRYA 2VAEA 4W7CA 1HUYA 5DRFA 1W7UA 1KYRA 2GW4B 2G6EA 1ZGOA 4W6OA 4TZAA 2QLHA 3DQAA 5HGEA 5LTPA 3SSVA 2G6YA 4W7RA 5FVGA 4ZINA 4L12A 3RWAA 5EXUA 3SSLA 3DPWA 2IB6A 1F09A 4W6MA 3LF3A 4HQ8A 1ZGQA 4IK1A 1XAEA 2GX2A 5H88A 5HZTA 3M22A 1B9CA 3DQKA 2QT2A 4GESB 1XMZA 4DXOA 4HVFA 2Z6YA 2ZMWA 4KW4A 4H3NA 2HFCA 4W6FA 4W69A 4KW8A 1H4UA 3GL4A 2ICRA 2OTBA 2GX0A 3RWTA 3ZUFA 2WIQA 4N3DA 5H89A 4Z4KA 2H8QA 4Q9WA 3SSKA 3AI5A 4H3MA 4LJDA 2IOVA 5DPHA 4W6CA 4DXQA 4IK3A 1JBYA 3CFFA 1W7TA 4IK5A 4W6IA 2OKWA 2B3PA 3VK1A 4W6KA 1XQMA 1EMAA 2H5QA 4ZB1A 4W6BA 3EKJA 3U0LA 3SVEA 4LQTA 2QLIA 4W7EA 3WCKA 1GFLA 5BT0A 2A53B 1EMCA 1OXFA 3EVUA 4JGEA 5AQBB 1Q4EA 2G6XA 3SSTA 3DQUA 3ST2A 2V4EC 3NEDA 3O77A 1Q4DA 4XVPA 3E5VA 4W77A 1OXDA 3LVCA 2DDDA 2GW3A 3E5TA 2DD9A 5LTQA 5DU0A 2Y0GA 2HPWA 3EK8A 4Q7RA 2G16B 4Q7UA 3GEXA 4J88A 1HCJA 5EBJA 4IK9A 1RMMA 2H5PA 3DQ3A 5DTZA 3S05A 3H1OA 1MYWA 2WSNA 5EB6A 3UG0A 3DPXA 3DPZA 1EMFA 2A46A 3LA1A 3BXBA 4L1IA 2Q6PA 3SSHA 4Z4MA 4LJCA 4UTSA 4KEXA 2ARLA 4W6HA 4GF6B 2O2BA 1YJFA 3SVNA 2G2SB 4W72A 2HJOA 2C9IA 5DTXA 2HGDA 3EVVA 2A47A 5LTRA 2DDCA 2DUGA 2G5ZB 4W7AA 3ST0A 3E5WA 2VZXA 4OY4A 4W7XA 3CFHA 4KA9A 3WLDA 2DD7A 2IB5A 1OXEA 4EDSA 3EVRA 4W6AA 4XGYA 4Q7TA 1Q73A 5EB7A 3SG7A 3SV5A 3SG2A 3LVAA 4ZF4A 3KCTA 5HZUA 4B5YA 5LK4A 3DQCA 4OQWA 3VICA 2WSOA 5EXCI 3UFZA 4LW5A 4KF5C 2HQKA 4W6DA 5DQMA 1EMLA 3OSQA 3OSRA 3DQNA 3PJ5A 3NT9A 2IE2A 2A48A 1CV7A 4OHSA 3PJBA 2WHUA 3NT3A 2A56B 4ZIOA 1G7KA 4NWSA 5BQLA 1ZUXA 4H3LA 3U0KA 2YE1A 4JC2A 3DQ6A 3DQHA 3SG3A 2O29A 2AWMA 5EXBA 2FL1A 2QLEA 2QLGA 2QZ0A 2HQZA 2O24A 1UISA 5EJUA 3DQ1A 2FWQA 3K1KA 5KTGA 4PPLA 1QY3A 1EMBA 2HCGA 4W7FA 1KYSA 3SVSA 1EMGA 3DQOA 1QXTA 4DXPA 4KF4A 4EN1A 1Q4BA 3GJ2A 4PPKA 2V4EA 2ZO6A 1EMKA 3AI4A 4ANJA 4DKMA 4B30A 2OTEA 4W73A 1YZWA 4OGSA 5H87A 3EKHA 2A52B 3SVCA 2WURA 4W74A 2G3DB 5HZSA 3VHTA 3SVOA 3DQLA 1JC0A 1RMOA 1ZGPA 4TZGA 2DUEA 3V3DA 2QLGB 2HRSA 3P28A 3TMRA
chains in the Genus database with same CATH superfamily
4KW9A 1KYPA 4XOWA 4BDUA 4R6BA 1KP5A 3G9AA 4DXIA 4PPJA 1XA9A 2Z1OA 1MOVA 3ED8A 2H5OA 2V4EB 3LVDA 4W6RA 5DPIA 4B30B 3H1RA 2OJKA 3GB3A 4W6TA 3SSPA 2FZUA 2Q57A 1W7SA 4H47A 3DQMA 5FHVA 5FVFA 3SVRA 4ZBLA 2BTJA 1GGXA 4W6NA 4EMQA 2C9JA 2AWKA 4ZF3A 3VHTB 4IK8A 4DXNA 4HQ9A 3GJ1A 1RM9A 3ZTFA 4AR7A 1H6RA 4W6JA 3U8CA 1QYQA 2PXSA 4J89A 3CB9A 5HZOA 4U2VA 2JADA 3SS0A 2VADA 3DQDA 3SVUA 3EK4A 2WHSA 4OJ0A 1Q4CA 5BTTA 3IR8A 3SSYA 1JC1A 1QYFA 2ZO7A 3ST3A 3BXCA 3P8UA 4ZFSA 3W1DA 4JFGA 2PXWA 3CGLA 4PFEA 3DQ8A 3PJ7A 4KF5A 3ZULA 3KCSA 3LSAA 2POXA 1EMEA 5F9GA 3AKOA 4KGFA 1RRXA 2A54B 3PIBA 3TMTA 4DKNA 4LJBA 4RYSA 1XSSA 3EK7A 1S6ZA 4GOBA 5BTTB 4XOVA 4Q9XA 3M24A 5EHUA 3U0MA 5DTLA 3ST4A 1YJ2A 2QU1A 3DQEA 4DXMA 2Z6XA 4IK4A 3ZUJA 5DRGA 2YFPA 5DTYA 5DQBA 2H5RA 4LJDC 2DUFA 2VVHA 1GL4A 2EMNA 2VVJA 4H48A 2AWLA 4KPIA 4W6GA 2RH7A 4R6DA 4KAGA 4I2YA 3BXAA 4J8AA 2Z6ZA 2H9WA 1YHGA 3NEZA 2VVIA 4W6SA 4EULA 3CFAA 2WHTA 3CD1A 3DQJA 4IZNA 5HBDA 2HGYA 4XL5A 2YE0A 4W6UA 5HW9A 2AHAA 1YHHA 3ADFA 4EDOA 3DQIA 2OGRA 1YHIA 5J2OA 1YFPA 4W76A 4ZF5A 2AWJA 3SVBA 1BFPA 2DUHA 3IP2A 5DPJA 4AS8A 3U0NA 1Z1QA 4P1QA 1MOUA 3DQFA 3U8PA 4W7DA 4W75A 2QRFA 3LS3A 1Z1PA 3CBEA 3DQ4A 4LQUA 4W6LA 4HE4A 2P4MA 3SG4A 4W6PA 2EMOA 4ORNA 4KGEA 4JRBA 3I19A 1F0BA 1RMPA 2YDZA 4JEOA 1Q4AA 2DUIA 4HQCA 5DY6A 3CD9A 1C4FA 2WISA 4P76A 3W1CA 4L13A 2G3OA 3BX9A 5DPGA 3WLCA 1QYOA 3O78A 1EMMA 5T3IA 2ZMUA 4RYWA 2AH8A 3SVDA 3SG5A 3EVPA 1JBZA 3DQ9A 3U8AA 3DQ5A 5FVIA 2B3QA 3DQ7A 3LF4B 3OGOA 3MGFA 3NF0A 2H6VA 2A50B 3SG6A 3DQ2A 2EMDA 3A8SA 2OKYA 4JF9A 4RTCA 3SRYA 2VAEA 4W7CA 1HUYA 5DRFA 1W7UA 1KYRA 2GW4B 2G6EA 1ZGOA 4W6OA 4TZAA 2QLHA 3DQAA 5HGEA 5LTPA 3SSVA 2G6YA 4W7RA 5FVGA 4ZINA 4L12A 3RWAA 5EXUA 3SSLA 3DPWA 2IB6A 1F09A 4W6MA 3LF3A 4HQ8A 1ZGQA 4IK1A 1XAEA 2GX2A 5H88A 5HZTA 3M22A 1B9CA 3DQKA 2QT2A 4GESB 1XMZA 4DXOA 4HVFA 2Z6YA 2ZMWA 4KW4A 4H3NA 2HFCA 4W6FA 4W69A 4KW8A 1H4UA 3GL4A 2ICRA 2OTBA 2GX0A 3RWTA 3ZUFA 2WIQA 4N3DA 5H89A 4Z4KA 2H8QA 4Q9WA 3SSKA 3AI5A 4H3MA 4LJDA 2IOVA 5DPHA 4W6CA 4DXQA 4IK3A 1JBYA 3CFFA 1W7TA 4IK5A 4W6IA 2OKWA 2B3PA 3VK1A 4W6KA 1XQMA 1EMAA 2H5QA 4ZB1A 4W6BA 3EKJA 3U0LA 3SVEA 4LQTA 2QLIA 4W7EA 3WCKA 1GFLA 5BT0A 2A53B 1EMCA 1OXFA 3EVUA 4JGEA 5AQBB 1Q4EA 2G6XA 3SSTA 3DQUA 3ST2A 2V4EC 3NEDA 3O77A 1Q4DA 4XVPA 3E5VA 4W77A 1OXDA 3LVCA 2DDDA 2GW3A 3E5TA 2DD9A 5LTQA 5DU0A 2Y0GA 2HPWA 3EK8A 4Q7RA 2G16B 4Q7UA 3GEXA 4J88A 1HCJA 5EBJA 4IK9A 1RMMA 2H5PA 3DQ3A 5DTZA 3S05A 3H1OA 1MYWA 2WSNA 5EB6A 3UG0A 3DPXA 3DPZA 1EMFA 2A46A 3LA1A 3BXBA 4L1IA 2Q6PA 3SSHA 4Z4MA 4LJCA 4UTSA 4KEXA 2ARLA 4W6HA 4GF6B 2O2BA 1YJFA 3SVNA 2G2SB 4W72A 2HJOA 2C9IA 5DTXA 2HGDA 3EVVA 2A47A 5LTRA 2DDCA 2DUGA 2G5ZB 4W7AA 3ST0A 3E5WA 2VZXA 4OY4A 4W7XA 3CFHA 4KA9A 3WLDA 2DD7A 2IB5A 1OXEA 4EDSA 3EVRA 4W6AA 4XGYA 4Q7TA 1Q73A 5EB7A 3SG7A 3SV5A 3SG2A 3LVAA 4ZF4A 3KCTA 5HZUA 4B5YA 5LK4A 3DQCA 4OQWA 3VICA 2WSOA 5EXCI 3UFZA 4LW5A 4KF5C 2HQKA 4W6DA 5DQMA 1EMLA 3OSQA 3OSRA 3DQNA 3PJ5A 3NT9A 2IE2A 2A48A 1CV7A 4OHSA 3PJBA 2WHUA 3NT3A 2A56B 4ZIOA 1G7KA 4NWSA 5BQLA 1ZUXA 4H3LA 3U0KA 2YE1A 4JC2A 3DQ6A 3DQHA 3SG3A 2O29A 2AWMA 5EXBA 2FL1A 2QLEA 2QLGA 2QZ0A 2HQZA 2O24A 1UISA 5EJUA 3DQ1A 2FWQA 3K1KA 5KTGA 4PPLA 1QY3A 1EMBA 2HCGA 4W7FA 1KYSA 3SVSA 1EMGA 3DQOA 1QXTA 4DXPA 4KF4A 4EN1A 1Q4BA 3GJ2A 4PPKA 2V4EA 2ZO6A 1EMKA 3AI4A 4ANJA 4DKMA 4B30A 2OTEA 4W73A 1YZWA 4OGSA 5H87A 3EKHA 2A52B 3SVCA 2WURA 4W74A 2G3DB 5HZSA 3VHTA 3SVOA 3DQLA 1JC0A 1RMOA 1ZGPA 4TZGA 2DUEA 3V3DA 2QLGB 2HRSA 3P28A 3TMRA
chains in the Genus database with same CATH topology
4KW9A 1KYPA 4XOWA 4BDUA 4R6BA 1KP5A 3G9AA 4DXIA 4PPJA 1XA9A 2Z1OA 1MOVA 3ED8A 2H5OA 2V4EB 3LVDA 4W6RA 5DPIA 4B30B 3H1RA 2OJKA 3GB3A 4W6TA 3SSPA 2FZUA 2Q57A 1W7SA 4H47A 3DQMA 5FHVA 5FVFA 3SVRA 4ZBLA 2BTJA 1GGXA 4W6NA 4EMQA 2C9JA 2AWKA 4ZF3A 3VHTB 4IK8A 4DXNA 4HQ9A 3GJ1A 1RM9A 3ZTFA 4AR7A 1H6RA 4W6JA 3U8CA 1QYQA 2PXSA 4J89A 3CB9A 5HZOA 4U2VA 2JADA 3SS0A 2VADA 3DQDA 3SVUA 3EK4A 2WHSA 4OJ0A 1Q4CA 5BTTA 3IR8A 3SSYA 1JC1A 1QYFA 2ZO7A 3ST3A 3BXCA 3P8UA 4ZFSA 3W1DA 4JFGA 2PXWA 3CGLA 4PFEA 3DQ8A 3PJ7A 4KF5A 3ZULA 3KCSA 3LSAA 2POXA 1EMEA 5F9GA 3AKOA 4KGFA 1RRXA 2A54B 3PIBA 3TMTA 4DKNA 4LJBA 4RYSA 1XSSA 3EK7A 1S6ZA 4GOBA 5BTTB 4XOVA 4Q9XA 3M24A 5EHUA 3U0MA 5DTLA 3ST4A 1YJ2A 2QU1A 3DQEA 4DXMA 2Z6XA 4IK4A 3ZUJA 5DRGA 2YFPA 5DTYA 5DQBA 2H5RA 4LJDC 2DUFA 2VVHA 1GL4A 2EMNA 2VVJA 4H48A 2AWLA 4KPIA 4W6GA 2RH7A 4R6DA 4KAGA 4I2YA 3BXAA 4J8AA 2Z6ZA 2H9WA 1YHGA 3NEZA 2VVIA 4W6SA 4EULA 3CFAA 2WHTA 3CD1A 3DQJA 4IZNA 5HBDA 2HGYA 4XL5A 2YE0A 4W6UA 5HW9A 2AHAA 1YHHA 3ADFA 4EDOA 3DQIA 2OGRA 1YHIA 5J2OA 1YFPA 4W76A 4ZF5A 2AWJA 3SVBA 1BFPA 2DUHA 3IP2A 5DPJA 4AS8A 3U0NA 1Z1QA 4P1QA 1MOUA 3DQFA 3U8PA 4W7DA 4W75A 2QRFA 3LS3A 1Z1PA 3CBEA 3DQ4A 4LQUA 4W6LA 4HE4A 2P4MA 3SG4A 4W6PA 2EMOA 4ORNA 4KGEA 4JRBA 3I19A 1F0BA 1RMPA 2YDZA 4JEOA 1Q4AA 2DUIA 4HQCA 5DY6A 3CD9A 1C4FA 2WISA 4P76A 3W1CA 4L13A 2G3OA 3BX9A 5DPGA 3WLCA 1QYOA 3O78A 1EMMA 5T3IA 2ZMUA 4RYWA 2AH8A 3SVDA 3SG5A 3EVPA 1JBZA 3DQ9A 3U8AA 3DQ5A 5FVIA 2B3QA 3DQ7A 3LF4B 3OGOA 3MGFA 3NF0A 2H6VA 2A50B 3SG6A 3DQ2A 2EMDA 3A8SA 2OKYA 4JF9A 4RTCA 3SRYA 2VAEA 4W7CA 1HUYA 5DRFA 1W7UA 1KYRA 2GW4B 2G6EA 1ZGOA 4W6OA 4TZAA 2QLHA 3DQAA 5HGEA 5LTPA 3SSVA 2G6YA 4W7RA 5FVGA 4ZINA 4L12A 3RWAA 5EXUA 3SSLA 3DPWA 2IB6A 1F09A 4W6MA 3LF3A 4HQ8A 1ZGQA 4IK1A 1XAEA 2GX2A 5H88A 5HZTA 3M22A 1B9CA 3DQKA 2QT2A 4GESB 1XMZA 4DXOA 4HVFA 2Z6YA 2ZMWA 4KW4A 4H3NA 2HFCA 4W6FA 4W69A 4KW8A 1H4UA 3GL4A 2ICRA 2OTBA 2GX0A 3RWTA 3ZUFA 2WIQA 4N3DA 5H89A 4Z4KA 2H8QA 4Q9WA 3SSKA 3AI5A 4H3MA 4LJDA 2IOVA 5DPHA 4W6CA 4DXQA 4IK3A 1JBYA 3CFFA 1W7TA 4IK5A 4W6IA 2OKWA 2B3PA 3VK1A 4W6KA 1XQMA 1EMAA 2H5QA 4ZB1A 4W6BA 3EKJA 3U0LA 3SVEA 4LQTA 2QLIA 4W7EA 3WCKA 1GFLA 5BT0A 2A53B 1EMCA 1OXFA 3EVUA 4JGEA 5AQBB 1Q4EA 2G6XA 3SSTA 3DQUA 3ST2A 2V4EC 3NEDA 3O77A 1Q4DA 4XVPA 3E5VA 4W77A 1OXDA 3LVCA 2DDDA 2GW3A 3E5TA 2DD9A 5LTQA 5DU0A 2Y0GA 2HPWA 3EK8A 4Q7RA 2G16B 4Q7UA 3GEXA 4J88A 1HCJA 5EBJA 4IK9A 1RMMA 2H5PA 3DQ3A 5DTZA 3S05A 3H1OA 1MYWA 2WSNA 5EB6A 3UG0A 3DPXA 3DPZA 1EMFA 2A46A 3LA1A 3BXBA 4L1IA 2Q6PA 3SSHA 4Z4MA 4LJCA 4UTSA 4KEXA 2ARLA 4W6HA 4GF6B 2O2BA 1YJFA 3SVNA 2G2SB 4W72A 2HJOA 2C9IA 5DTXA 2HGDA 3EVVA 2A47A 5LTRA 2DDCA 2DUGA 2G5ZB 4W7AA 3ST0A 3E5WA 2VZXA 4OY4A 4W7XA 3CFHA 4KA9A 3WLDA 2DD7A 2IB5A 1OXEA 4EDSA 3EVRA 4W6AA 4XGYA 4Q7TA 1Q73A 5EB7A 3SG7A 3SV5A 3SG2A 3LVAA 4ZF4A 3KCTA 5HZUA 4B5YA 5LK4A 3DQCA 4OQWA 3VICA 2WSOA 5EXCI 3UFZA 4LW5A 4KF5C 2HQKA 4W6DA 5DQMA 1EMLA 3OSQA 3OSRA 3DQNA 3PJ5A 3NT9A 2IE2A 2A48A 1CV7A 4OHSA 3PJBA 2WHUA 3NT3A 2A56B 4ZIOA 1G7KA 4NWSA 5BQLA 1ZUXA 4H3LA 3U0KA 2YE1A 4JC2A 3DQ6A 3DQHA 3SG3A 2O29A 2AWMA 5EXBA 2FL1A 2QLEA 2QLGA 2QZ0A 2HQZA 2O24A 1UISA 5EJUA 3DQ1A 2FWQA 3K1KA 5KTGA 4PPLA 1QY3A 1EMBA 2HCGA 4W7FA 1KYSA 3SVSA 1EMGA 3DQOA 1QXTA 4DXPA 4KF4A 4EN1A 1Q4BA 3GJ2A 4PPKA 2V4EA 2ZO6A 1EMKA 3AI4A 4ANJA 4DKMA 4B30A 2OTEA 4W73A 1YZWA 4OGSA 5H87A 3EKHA 2A52B 3SVCA 2WURA 4W74A 2G3DB 5HZSA 3VHTA 3SVOA 3DQLA 1JC0A 1RMOA 1ZGPA 4TZGA 2DUEA 3V3DA 2QLGB 2HRSA 3P28A 3TMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KW9 A;  1KYP A;  4XOW A;  4BDU A;  4R6B A;  1KP5 A;  3G9A A;  4DXI A;  4PPJ A;  1XA9 A;  2Z1O A;  1MOV A;  3ED8 A;  2H5O A;  2V4E B;  3LVD A;  4W6R A;  5DPI A;  4B30 B;  3H1R A;  2OJK A;  3GB3 A;  4W6T A;  3SSP A;  2FZU A;  2Q57 A;  1W7S A;  4H47 A;  3DQM A;  5FHV A;  5FVF A;  3SVR A;  4ZBL A;  2BTJ A;  1GGX A;  4W6N A;  4EMQ A;  2C9J A;  2AWK A;  4ZF3 A;  3VHT B;  4IK8 A;  4DXN A;  4HQ9 A;  3GJ1 A;  1RM9 A;  3ZTF A;  4AR7 A;  1H6R A;  4W6J A;  3U8C A;  1QYQ A;  2PXS A;  4J89 A;  3CB9 A;  5HZO A;  4U2V A;  2JAD A;  3SS0 A;  2VAD A;  3DQD A;  3SVU A;  3EK4 A;  2WHS A;  4OJ0 A;  1Q4C A;  5BTT A;  3IR8 A;  3SSY A;  1JC1 A;  1QYF A;  2ZO7 A;  3ST3 A;  3BXC A;  3P8U A;  4ZFS A;  3W1D A;  4JFG A;  2PXW A;  3CGL A;  4PFE A;  3DQ8 A;  3PJ7 A;  4KF5 A;  3ZUL A;  3KCS A;  3LSA A;  2POX A;  1EME A;  5F9G A;  3AKO A;  4KGF A;  1RRX A;  2A54 B;  3PIB A;  3TMT A;  4DKN A;  4LJB A;  4RYS A;  1XSS A;  3EK7 A;  1S6Z A;  4GOB A;  5BTT B;  4XOV A;  4Q9X A;  3M24 A;  5EHU A;  3U0M A;  5DTL A;  3ST4 A;  1YJ2 A;  2QU1 A;  3DQE A;  4DXM A;  2Z6X A;  4IK4 A;  3ZUJ A;  5DRG A;  2YFP A;  5DTY A;  5DQB A;  2H5R A;  4LJD C;  2DUF A;  2VVH A;  1GL4 A;  2EMN A;  2VVJ A;  4H48 A;  2AWL A;  4KPI A;  4W6G A;  2RH7 A;  4R6D A;  4KAG A;  4I2Y A;  3BXA A;  4J8A A;  2Z6Z A;  2H9W A;  1YHG A;  3NEZ A;  2VVI A;  4W6S A;  4EUL A;  3CFA A;  2WHT A;  3CD1 A;  3DQJ A;  4IZN A;  5HBD A;  2HGY A;  4XL5 A;  2YE0 A;  4W6U A;  5HW9 A;  2AHA A;  1YHH A;  3ADF A;  4EDO A;  3DQI A;  2OGR A;  1YHI A;  5J2O A;  1YFP A;  4W76 A;  4ZF5 A;  2AWJ A;  3SVB A;  1BFP A;  2DUH A;  3IP2 A;  5DPJ A;  4AS8 A;  3U0N A;  1Z1Q A;  4P1Q A;  1MOU A;  3DQF A;  3U8P A;  4W7D A;  4W75 A;  2QRF A;  3LS3 A;  1Z1P A;  3CBE A;  3DQ4 A;  4LQU A;  4W6L A;  4HE4 A;  2P4M A;  3SG4 A;  4W6P A;  2EMO A;  4ORN A;  4KGE A;  4JRB A;  3I19 A;  1F0B A;  1RMP A;  2YDZ A;  4JEO A;  1Q4A A;  2DUI A;  4HQC A;  5DY6 A;  3CD9 A;  1C4F A;  2WIS A;  4P76 A;  3W1C A;  4L13 A;  2G3O A;  3BX9 A;  5DPG A;  3WLC A;  1QYO A;  3O78 A;  1EMM A;  5T3I A;  2ZMU A;  4RYW A;  2AH8 A;  3SVD A;  3SG5 A;  3EVP A;  1JBZ A;  3DQ9 A;  3U8A A;  3DQ5 A;  5FVI A;  2B3Q A;  3DQ7 A;  3LF4 B;  3OGO A;  3MGF A;  3NF0 A;  2H6V A;  2A50 B;  3SG6 A;  3DQ2 A;  2EMD A;  3A8S A;  2OKY A;  4JF9 A;  4RTC A;  3SRY A;  2VAE A;  4W7C A;  1HUY A;  5DRF A;  1W7U A;  1KYR A;  2GW4 B;  2G6E A;  1ZGO A;  4W6O A;  4TZA A;  2QLH A;  3DQA A;  5HGE A;  5LTP A;  3SSV A;  2G6Y A;  4W7R A;  5FVG A;  4ZIN A;  4L12 A;  3RWA A;  5EXU A;  3SSL A;  3DPW A;  2IB6 A;  1F09 A;  4W6M A;  3LF3 A;  4HQ8 A;  1ZGQ A;  4IK1 A;  1XAE A;  2GX2 A;  5H88 A;  5HZT A;  3M22 A;  1B9C A;  3DQK A;  2QT2 A;  4GES B;  1XMZ A;  4DXO A;  4HVF A;  2Z6Y A;  2ZMW A;  4KW4 A;  4H3N A;  2HFC A;  4W6F A;  4W69 A;  4KW8 A;  1H4U A;  3GL4 A;  2ICR A;  2OTB A;  2GX0 A;  3RWT A;  3ZUF A;  2WIQ A;  4N3D A;  5H89 A;  4Z4K A;  2H8Q A;  4Q9W A;  3SSK A;  3AI5 A;  4H3M A;  4LJD A;  2IOV A;  5DPH A;  4W6C A;  4DXQ A;  4IK3 A;  1JBY A;  3CFF A;  1W7T A;  4IK5 A;  4W6I A;  2OKW A;  2B3P A;  3VK1 A;  4W6K A;  1XQM A;  1EMA A;  2H5Q A;  4ZB1 A;  4W6B A;  3EKJ A;  3U0L A;  3SVE A;  4LQT A;  2QLI A;  4W7E A;  3WCK A;  1GFL A;  5BT0 A;  2A53 B;  1EMC A;  1OXF A;  3EVU A;  4JGE A;  5AQB B;  1Q4E A;  2G6X A;  3SST A;  3DQU A;  3ST2 A;  2V4E C;  3NED A;  3O77 A;  1Q4D A;  4XVP A;  3E5V A;  4W77 A;  1OXD A;  3LVC A;  2DDD A;  2GW3 A;  3E5T A;  2DD9 A;  5LTQ A;  5DU0 A;  2Y0G A;  2HPW A;  3EK8 A;  4Q7R A;  2G16 B;  4Q7U A;  3GEX A;  4J88 A;  1HCJ A;  5EBJ A;  4IK9 A;  1RMM A;  2H5P A;  3DQ3 A;  5DTZ A;  3S05 A;  3H1O A;  1MYW A;  2WSN A;  5EB6 A;  3UG0 A;  3DPX A;  3DPZ A;  1EMF A;  2A46 A;  3LA1 A;  3BXB A;  4L1I A;  2Q6P A;  3SSH A;  4Z4M A;  4LJC A;  4UTS A;  4KEX A;  2ARL A;  4W6H A;  4GF6 B;  2O2B A;  1YJF A;  3SVN A;  2G2S B;  4W72 A;  2HJO A;  2C9I A;  5DTX A;  2HGD A;  3EVV A;  2A47 A;  5LTR A;  2DDC A;  2DUG A;  2G5Z B;  4W7A A;  3ST0 A;  3E5W A;  2VZX A;  4OY4 A;  4W7X A;  3CFH A;  4KA9 A;  3WLD A;  2DD7 A;  2IB5 A;  1OXE A;  4EDS A;  3EVR A;  4W6A A;  4XGY A;  4Q7T A;  1Q73 A;  5EB7 A;  3SG7 A;  3SV5 A;  3SG2 A;  3LVA A;  4ZF4 A;  3KCT A;  5HZU A;  4B5Y A;  5LK4 A;  3DQC A;  4OQW A;  3VIC A;  2WSO A;  5EXC I;  3UFZ A;  4LW5 A;  4KF5 C;  2HQK A;  4W6D A;  5DQM A;  1EML A;  3OSQ A;  3OSR A;  3DQN A;  3PJ5 A;  3NT9 A;  2IE2 A;  2A48 A;  1CV7 A;  4OHS A;  3PJB A;  2WHU A;  3NT3 A;  2A56 B;  4ZIO A;  1G7K A;  4NWS A;  5BQL A;  1ZUX A;  4H3L A;  3U0K A;  2YE1 A;  4JC2 A;  3DQ6 A;  3DQH A;  3SG3 A;  2O29 A;  2AWM A;  5EXB A;  2FL1 A;  2QLE A;  2QLG A;  2QZ0 A;  2HQZ A;  2O24 A;  1UIS A;  5EJU A;  3DQ1 A;  2FWQ A;  3K1K A;  5KTG A;  4PPL A;  1QY3 A;  1EMB A;  2HCG A;  4W7F A;  1KYS A;  3SVS A;  1EMG A;  3DQO A;  1QXT A;  4DXP A;  4KF4 A;  4EN1 A;  1Q4B A;  3GJ2 A;  4PPK A;  2V4E A;  2ZO6 A;  1EMK A;  3AI4 A;  4ANJ A;  4DKM A;  4B30 A;  2OTE A;  4W73 A;  1YZW A;  4OGS A;  5H87 A;  3EKH A;  2A52 B;  3SVC A;  2WUR A;  4W74 A;  2G3D B;  5HZS A;  3VHT A;  3SVO A;  3DQL A;  1JC0 A;  1RMO A;  1ZGP A;  4TZG A;  2DUE A;  3V3D A;  2QLG B;  2HRS A;  3P28 A;  3TMR A; 
#chains in the Genus database with same CATH topology
 4KW9 A;  1KYP A;  4XOW A;  4BDU A;  4R6B A;  1KP5 A;  3G9A A;  4DXI A;  4PPJ A;  1XA9 A;  2Z1O A;  1MOV A;  3ED8 A;  2H5O A;  2V4E B;  3LVD A;  4W6R A;  5DPI A;  4B30 B;  3H1R A;  2OJK A;  3GB3 A;  4W6T A;  3SSP A;  2FZU A;  2Q57 A;  1W7S A;  4H47 A;  3DQM A;  5FHV A;  5FVF A;  3SVR A;  4ZBL A;  2BTJ A;  1GGX A;  4W6N A;  4EMQ A;  2C9J A;  2AWK A;  4ZF3 A;  3VHT B;  4IK8 A;  4DXN A;  4HQ9 A;  3GJ1 A;  1RM9 A;  3ZTF A;  4AR7 A;  1H6R A;  4W6J A;  3U8C A;  1QYQ A;  2PXS A;  4J89 A;  3CB9 A;  5HZO A;  4U2V A;  2JAD A;  3SS0 A;  2VAD A;  3DQD A;  3SVU A;  3EK4 A;  2WHS A;  4OJ0 A;  1Q4C A;  5BTT A;  3IR8 A;  3SSY A;  1JC1 A;  1QYF A;  2ZO7 A;  3ST3 A;  3BXC A;  3P8U A;  4ZFS A;  3W1D A;  4JFG A;  2PXW A;  3CGL A;  4PFE A;  3DQ8 A;  3PJ7 A;  4KF5 A;  3ZUL A;  3KCS A;  3LSA A;  2POX A;  1EME A;  5F9G A;  3AKO A;  4KGF A;  1RRX A;  2A54 B;  3PIB A;  3TMT A;  4DKN A;  4LJB A;  4RYS A;  1XSS A;  3EK7 A;  1S6Z A;  4GOB A;  5BTT B;  4XOV A;  4Q9X A;  3M24 A;  5EHU A;  3U0M A;  5DTL A;  3ST4 A;  1YJ2 A;  2QU1 A;  3DQE A;  4DXM A;  2Z6X A;  4IK4 A;  3ZUJ A;  5DRG A;  2YFP A;  5DTY A;  5DQB A;  2H5R A;  4LJD C;  2DUF A;  2VVH A;  1GL4 A;  2EMN A;  2VVJ A;  4H48 A;  2AWL A;  4KPI A;  4W6G A;  2RH7 A;  4R6D A;  4KAG A;  4I2Y A;  3BXA A;  4J8A A;  2Z6Z A;  2H9W A;  1YHG A;  3NEZ A;  2VVI A;  4W6S A;  4EUL A;  3CFA A;  2WHT A;  3CD1 A;  3DQJ A;  4IZN A;  5HBD A;  2HGY A;  4XL5 A;  2YE0 A;  4W6U A;  5HW9 A;  2AHA A;  1YHH A;  3ADF A;  4EDO A;  3DQI A;  2OGR A;  1YHI A;  5J2O A;  1YFP A;  4W76 A;  4ZF5 A;  2AWJ A;  3SVB A;  1BFP A;  2DUH A;  3IP2 A;  5DPJ A;  4AS8 A;  3U0N A;  1Z1Q A;  4P1Q A;  1MOU A;  3DQF A;  3U8P A;  4W7D A;  4W75 A;  2QRF A;  3LS3 A;  1Z1P A;  3CBE A;  3DQ4 A;  4LQU A;  4W6L A;  4HE4 A;  2P4M A;  3SG4 A;  4W6P A;  2EMO A;  4ORN A;  4KGE A;  4JRB A;  3I19 A;  1F0B A;  1RMP A;  2YDZ A;  4JEO A;  1Q4A A;  2DUI A;  4HQC A;  5DY6 A;  3CD9 A;  1C4F A;  2WIS A;  4P76 A;  3W1C A;  4L13 A;  2G3O A;  3BX9 A;  5DPG A;  3WLC A;  1QYO A;  3O78 A;  1EMM A;  5T3I A;  2ZMU A;  4RYW A;  2AH8 A;  3SVD A;  3SG5 A;  3EVP A;  1JBZ A;  3DQ9 A;  3U8A A;  3DQ5 A;  5FVI A;  2B3Q A;  3DQ7 A;  3LF4 B;  3OGO A;  3MGF A;  3NF0 A;  2H6V A;  2A50 B;  3SG6 A;  3DQ2 A;  2EMD A;  3A8S A;  2OKY A;  4JF9 A;  4RTC A;  3SRY A;  2VAE A;  4W7C A;  1HUY A;  5DRF A;  1W7U A;  1KYR A;  2GW4 B;  2G6E A;  1ZGO A;  4W6O A;  4TZA A;  2QLH A;  3DQA A;  5HGE A;  5LTP A;  3SSV A;  2G6Y A;  4W7R A;  5FVG A;  4ZIN A;  4L12 A;  3RWA A;  5EXU A;  3SSL A;  3DPW A;  2IB6 A;  1F09 A;  4W6M A;  3LF3 A;  4HQ8 A;  1ZGQ A;  4IK1 A;  1XAE A;  2GX2 A;  5H88 A;  5HZT A;  3M22 A;  1B9C A;  3DQK A;  2QT2 A;  4GES B;  1XMZ A;  4DXO A;  4HVF A;  2Z6Y A;  2ZMW A;  4KW4 A;  4H3N A;  2HFC A;  4W6F A;  4W69 A;  4KW8 A;  1H4U A;  3GL4 A;  2ICR A;  2OTB A;  2GX0 A;  3RWT A;  3ZUF A;  2WIQ A;  4N3D A;  5H89 A;  4Z4K A;  2H8Q A;  4Q9W A;  3SSK A;  3AI5 A;  4H3M A;  4LJD A;  2IOV A;  5DPH A;  4W6C A;  4DXQ A;  4IK3 A;  1JBY A;  3CFF A;  1W7T A;  4IK5 A;  4W6I A;  2OKW A;  2B3P A;  3VK1 A;  4W6K A;  1XQM A;  1EMA A;  2H5Q A;  4ZB1 A;  4W6B A;  3EKJ A;  3U0L A;  3SVE A;  4LQT A;  2QLI A;  4W7E A;  3WCK A;  1GFL A;  5BT0 A;  2A53 B;  1EMC A;  1OXF A;  3EVU A;  4JGE A;  5AQB B;  1Q4E A;  2G6X A;  3SST A;  3DQU A;  3ST2 A;  2V4E C;  3NED A;  3O77 A;  1Q4D A;  4XVP A;  3E5V A;  4W77 A;  1OXD A;  3LVC A;  2DDD A;  2GW3 A;  3E5T A;  2DD9 A;  5LTQ A;  5DU0 A;  2Y0G A;  2HPW A;  3EK8 A;  4Q7R A;  2G16 B;  4Q7U A;  3GEX A;  4J88 A;  1HCJ A;  5EBJ A;  4IK9 A;  1RMM A;  2H5P A;  3DQ3 A;  5DTZ A;  3S05 A;  3H1O A;  1MYW A;  2WSN A;  5EB6 A;  3UG0 A;  3DPX A;  3DPZ A;  1EMF A;  2A46 A;  3LA1 A;  3BXB A;  4L1I A;  2Q6P A;  3SSH A;  4Z4M A;  4LJC A;  4UTS A;  4KEX A;  2ARL A;  4W6H A;  4GF6 B;  2O2B A;  1YJF A;  3SVN A;  2G2S B;  4W72 A;  2HJO A;  2C9I A;  5DTX A;  2HGD A;  3EVV A;  2A47 A;  5LTR A;  2DDC A;  2DUG A;  2G5Z B;  4W7A A;  3ST0 A;  3E5W A;  2VZX A;  4OY4 A;  4W7X A;  3CFH A;  4KA9 A;  3WLD A;  2DD7 A;  2IB5 A;  1OXE A;  4EDS A;  3EVR A;  4W6A A;  4XGY A;  4Q7T A;  1Q73 A;  5EB7 A;  3SG7 A;  3SV5 A;  3SG2 A;  3LVA A;  4ZF4 A;  3KCT A;  5HZU A;  4B5Y A;  5LK4 A;  3DQC A;  4OQW A;  3VIC A;  2WSO A;  5EXC I;  3UFZ A;  4LW5 A;  4KF5 C;  2HQK A;  4W6D A;  5DQM A;  1EML A;  3OSQ A;  3OSR A;  3DQN A;  3PJ5 A;  3NT9 A;  2IE2 A;  2A48 A;  1CV7 A;  4OHS A;  3PJB A;  2WHU A;  3NT3 A;  2A56 B;  4ZIO A;  1G7K A;  4NWS A;  5BQL A;  1ZUX A;  4H3L A;  3U0K A;  2YE1 A;  4JC2 A;  3DQ6 A;  3DQH A;  3SG3 A;  2O29 A;  2AWM A;  5EXB A;  2FL1 A;  2QLE A;  2QLG A;  2QZ0 A;  2HQZ A;  2O24 A;  1UIS A;  5EJU A;  3DQ1 A;  2FWQ A;  3K1K A;  5KTG A;  4PPL A;  1QY3 A;  1EMB A;  2HCG A;  4W7F A;  1KYS A;  3SVS A;  1EMG A;  3DQO A;  1QXT A;  4DXP A;  4KF4 A;  4EN1 A;  1Q4B A;  3GJ2 A;  4PPK A;  2V4E A;  2ZO6 A;  1EMK A;  3AI4 A;  4ANJ A;  4DKM A;  4B30 A;  2OTE A;  4W73 A;  1YZW A;  4OGS A;  5H87 A;  3EKH A;  2A52 B;  3SVC A;  2WUR A;  4W74 A;  2G3D B;  5HZS A;  3VHT A;  3SVO A;  3DQL A;  1JC0 A;  1RMO A;  1ZGP A;  4TZG A;  2DUE A;  3V3D A;  2QLG B;  2HRS A;  3P28 A;  3TMR A; 
#chains in the Genus database with same CATH homology
 4KW9 A;  1KYP A;  4XOW A;  4BDU A;  4R6B A;  1KP5 A;  3G9A A;  4DXI A;  4PPJ A;  1XA9 A;  2Z1O A;  1MOV A;  3ED8 A;  2H5O A;  2V4E B;  3LVD A;  4W6R A;  5DPI A;  4B30 B;  3H1R A;  2OJK A;  3GB3 A;  4W6T A;  3SSP A;  2FZU A;  2Q57 A;  1W7S A;  4H47 A;  3DQM A;  5FHV A;  5FVF A;  3SVR A;  4ZBL A;  2BTJ A;  1GGX A;  4W6N A;  4EMQ A;  2C9J A;  2AWK A;  4ZF3 A;  3VHT B;  4IK8 A;  4DXN A;  4HQ9 A;  3GJ1 A;  1RM9 A;  3ZTF A;  4AR7 A;  1H6R A;  4W6J A;  3U8C A;  1QYQ A;  2PXS A;  4J89 A;  3CB9 A;  5HZO A;  4U2V A;  2JAD A;  3SS0 A;  2VAD A;  3DQD A;  3SVU A;  3EK4 A;  2WHS A;  4OJ0 A;  1Q4C A;  5BTT A;  3IR8 A;  3SSY A;  1JC1 A;  1QYF A;  2ZO7 A;  3ST3 A;  3BXC A;  3P8U A;  4ZFS A;  3W1D A;  4JFG A;  2PXW A;  3CGL A;  4PFE A;  3DQ8 A;  3PJ7 A;  4KF5 A;  3ZUL A;  3KCS A;  3LSA A;  2POX A;  1EME A;  5F9G A;  3AKO A;  4KGF A;  1RRX A;  2A54 B;  3PIB A;  3TMT A;  4DKN A;  4LJB A;  4RYS A;  1XSS A;  3EK7 A;  1S6Z A;  4GOB A;  5BTT B;  4XOV A;  4Q9X A;  3M24 A;  5EHU A;  3U0M A;  5DTL A;  3ST4 A;  1YJ2 A;  2QU1 A;  3DQE A;  4DXM A;  2Z6X A;  4IK4 A;  3ZUJ A;  5DRG A;  2YFP A;  5DTY A;  5DQB A;  2H5R A;  4LJD C;  2DUF A;  2VVH A;  1GL4 A;  2EMN A;  2VVJ A;  4H48 A;  2AWL A;  4KPI A;  4W6G A;  2RH7 A;  4R6D A;  4KAG A;  4I2Y A;  3BXA A;  4J8A A;  2Z6Z A;  2H9W A;  1YHG A;  3NEZ A;  2VVI A;  4W6S A;  4EUL A;  3CFA A;  2WHT A;  3CD1 A;  3DQJ A;  4IZN A;  5HBD A;  2HGY A;  4XL5 A;  2YE0 A;  4W6U A;  5HW9 A;  2AHA A;  1YHH A;  3ADF A;  4EDO A;  3DQI A;  2OGR A;  1YHI A;  5J2O A;  1YFP A;  4W76 A;  4ZF5 A;  2AWJ A;  3SVB A;  1BFP A;  2DUH A;  3IP2 A;  5DPJ A;  4AS8 A;  3U0N A;  1Z1Q A;  4P1Q A;  1MOU A;  3DQF A;  3U8P A;  4W7D A;  4W75 A;  2QRF A;  3LS3 A;  1Z1P A;  3CBE A;  3DQ4 A;  4LQU A;  4W6L A;  4HE4 A;  2P4M A;  3SG4 A;  4W6P A;  2EMO A;  4ORN A;  4KGE A;  4JRB A;  3I19 A;  1F0B A;  1RMP A;  2YDZ A;  4JEO A;  1Q4A A;  2DUI A;  4HQC A;  5DY6 A;  3CD9 A;  1C4F A;  2WIS A;  4P76 A;  3W1C A;  4L13 A;  2G3O A;  3BX9 A;  5DPG A;  3WLC A;  1QYO A;  3O78 A;  1EMM A;  5T3I A;  2ZMU A;  4RYW A;  2AH8 A;  3SVD A;  3SG5 A;  3EVP A;  1JBZ A;  3DQ9 A;  3U8A A;  3DQ5 A;  5FVI A;  2B3Q A;  3DQ7 A;  3LF4 B;  3OGO A;  3MGF A;  3NF0 A;  2H6V A;  2A50 B;  3SG6 A;  3DQ2 A;  2EMD A;  3A8S A;  2OKY A;  4JF9 A;  4RTC A;  3SRY A;  2VAE A;  4W7C A;  1HUY A;  5DRF A;  1W7U A;  1KYR A;  2GW4 B;  2G6E A;  1ZGO A;  4W6O A;  4TZA A;  2QLH A;  3DQA A;  5HGE A;  5LTP A;  3SSV A;  2G6Y A;  4W7R A;  5FVG A;  4ZIN A;  4L12 A;  3RWA A;  5EXU A;  3SSL A;  3DPW A;  2IB6 A;  1F09 A;  4W6M A;  3LF3 A;  4HQ8 A;  1ZGQ A;  4IK1 A;  1XAE A;  2GX2 A;  5H88 A;  5HZT A;  3M22 A;  1B9C A;  3DQK A;  2QT2 A;  4GES B;  1XMZ A;  4DXO A;  4HVF A;  2Z6Y A;  2ZMW A;  4KW4 A;  4H3N A;  2HFC A;  4W6F A;  4W69 A;  4KW8 A;  1H4U A;  3GL4 A;  2ICR A;  2OTB A;  2GX0 A;  3RWT A;  3ZUF A;  2WIQ A;  4N3D A;  5H89 A;  4Z4K A;  2H8Q A;  4Q9W A;  3SSK A;  3AI5 A;  4H3M A;  4LJD A;  2IOV A;  5DPH A;  4W6C A;  4DXQ A;  4IK3 A;  1JBY A;  3CFF A;  1W7T A;  4IK5 A;  4W6I A;  2OKW A;  2B3P A;  3VK1 A;  4W6K A;  1XQM A;  1EMA A;  2H5Q A;  4ZB1 A;  4W6B A;  3EKJ A;  3U0L A;  3SVE A;  4LQT A;  2QLI A;  4W7E A;  3WCK A;  1GFL A;  5BT0 A;  2A53 B;  1EMC A;  1OXF A;  3EVU A;  4JGE A;  5AQB B;  1Q4E A;  2G6X A;  3SST A;  3DQU A;  3ST2 A;  2V4E C;  3NED A;  3O77 A;  1Q4D A;  4XVP A;  3E5V A;  4W77 A;  1OXD A;  3LVC A;  2DDD A;  2GW3 A;  3E5T A;  2DD9 A;  5LTQ A;  5DU0 A;  2Y0G A;  2HPW A;  3EK8 A;  4Q7R A;  2G16 B;  4Q7U A;  3GEX A;  4J88 A;  1HCJ A;  5EBJ A;  4IK9 A;  1RMM A;  2H5P A;  3DQ3 A;  5DTZ A;  3S05 A;  3H1O A;  1MYW A;  2WSN A;  5EB6 A;  3UG0 A;  3DPX A;  3DPZ A;  1EMF A;  2A46 A;  3LA1 A;  3BXB A;  4L1I A;  2Q6P A;  3SSH A;  4Z4M A;  4LJC A;  4UTS A;  4KEX A;  2ARL A;  4W6H A;  4GF6 B;  2O2B A;  1YJF A;  3SVN A;  2G2S B;  4W72 A;  2HJO A;  2C9I A;  5DTX A;  2HGD A;  3EVV A;  2A47 A;  5LTR A;  2DDC A;  2DUG A;  2G5Z B;  4W7A A;  3ST0 A;  3E5W A;  2VZX A;  4OY4 A;  4W7X A;  3CFH A;  4KA9 A;  3WLD A;  2DD7 A;  2IB5 A;  1OXE A;  4EDS A;  3EVR A;  4W6A A;  4XGY A;  4Q7T A;  1Q73 A;  5EB7 A;  3SG7 A;  3SV5 A;  3SG2 A;  3LVA A;  4ZF4 A;  3KCT A;  5HZU A;  4B5Y A;  5LK4 A;  3DQC A;  4OQW A;  3VIC A;  2WSO A;  5EXC I;  3UFZ A;  4LW5 A;  4KF5 C;  2HQK A;  4W6D A;  5DQM A;  1EML A;  3OSQ A;  3OSR A;  3DQN A;  3PJ5 A;  3NT9 A;  2IE2 A;  2A48 A;  1CV7 A;  4OHS A;  3PJB A;  2WHU A;  3NT3 A;  2A56 B;  4ZIO A;  1G7K A;  4NWS A;  5BQL A;  1ZUX A;  4H3L A;  3U0K A;  2YE1 A;  4JC2 A;  3DQ6 A;  3DQH A;  3SG3 A;  2O29 A;  2AWM A;  5EXB A;  2FL1 A;  2QLE A;  2QLG A;  2QZ0 A;  2HQZ A;  2O24 A;  1UIS A;  5EJU A;  3DQ1 A;  2FWQ A;  3K1K A;  5KTG A;  4PPL A;  1QY3 A;  1EMB A;  2HCG A;  4W7F A;  1KYS A;  3SVS A;  1EMG A;  3DQO A;  1QXT A;  4DXP A;  4KF4 A;  4EN1 A;  1Q4B A;  3GJ2 A;  4PPK A;  2V4E A;  2ZO6 A;  1EMK A;  3AI4 A;  4ANJ A;  4DKM A;  4B30 A;  2OTE A;  4W73 A;  1YZW A;  4OGS A;  5H87 A;  3EKH A;  2A52 B;  3SVC A;  2WUR A;  4W74 A;  2G3D B;  5HZS A;  3VHT A;  3SVO A;  3DQL A;  1JC0 A;  1RMO A;  1ZGP A;  4TZG A;  2DUE A;  3V3D A;  2QLG B;  2HRS A;  3P28 A;  3TMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...