2O2GA

Crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
216
Chain Sequence
b'HQPQEYAVSVSVGEVKLKGNLVIPNGATGIVLFAHGSGSSRYSPRNRYVAEVLQQAGLATLLIDLLTQEEEEIDLRTRHLRFDIGLLASRLVGATDWLTHNPDTQHLKVGYFGASTGGGAALVAAAERPETVQAVVSRGGRPDLAPSALPHVKAPTLLIVGGYDLPVIAMNEDALEQLQTSKRLVIIPRASHLFEEPGALTAVAQLASEWFMHYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dienelactone hydrolase
molecule tags Hydrolase
source organism Anabaena variabilis
publication title Crystal structure of Dienelactone hydrolase (YP_324580.1) from Anabaena variabilis ATCC 29413 at 1.92 A resolution
rcsb
total genus 71
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o2gA00
1LPSA 5C8XA 4MXDA 4X71A 1L7RA 3L1HA 4UBMA 1LPNA 3WK4A 4BP8A 2VTVA 2PSJA 3I1IA 2ACKA 4JNCA 4M0MA 3MUOA 3UUFA 5C8VA 4KE8A 4DMCA 1YS1X 1BN7A 1N1MA 4XVCA 2DQYA 4XJVA 1FFCA 1X2EA 4WY8A 5AP9A 4W1RA 2AJCA 4K6HA 2WSLA 1EDEA 1NX9A 1VA5A 5AIBA 4FTWA 2I78A 5ALEA 2QMQA 3WKAA 2C0QA 3G9TA 3H2IA 1GQRA 2ZYRA 5AKZA 3WIBA 2PUHA 1HPLA 4Y2SA 1UKBA 1OCEA 1UOOA 4BCDA 2WFLB 1QFMA 3QVMA 4FDMA 3C8HA 3NGMA 4HRXA 3OG9A 4PQEA 1EDDA 3O0DA 4OSEA 2YASA 2G5PA 4B84A 5ALRA 2VEOA 5ALJA 4B6GA 1FFAA 5KWIA 3WWEA 1EB9A 4M0EA 3LP5A 5HQ3B 1K6EA 1JJIA 4UBKA 2K2QB 3R3WA 3DNMA 2OGSA 5ALQA 2QXTA 1JT2A 4ARBA 4GW3A 1BEZA 4X3CA 3PICA 5EHNA 3V48A 3WK7A 1EA5A 3G9ZA 1UK8A 4GHWA 5FKJA 3YASA 5CH8A 1SCIA 3H19A 1CUIA 5BOVA 2QVBA 5C81A 3A6ZA 1XRLA 3AZOA 4FBMA 4HAIA 3STTA 3RARA 5CRIA 4L9AA 5HQ3A 4Y2TA 1X70A 1F0NA 1G42A 5JZ9A 1W6RA 2G5TA 2XUJA 1LPBB 4ROTA 4X6XA 1CUAA 3M3DA 2XMZA 2WHQA 1MX9A 1CUJA 5LZ9A 1LNSA 1ODSA 4UBOA 3G02A 5CT9A 5AKIA 3ZV7A 3IUMA 2FX5A 3I28A 1XZFA 3FLBA 3VJKA 3G7NA 5FRDA 3PFCA 3ZPXA 5AM3A 3VDXA 1R88A 2PVSA 2Q0XA 4EY5A 3DYVA 1R9NA 3HXKA 5JZSA 1A8QA 4N8DA 1XKTA 2XE4A 1EINA 1DX4A 1QIJA 5BWCA 4GDMA 2X76A 1F0PA 4Y2UA 2AJBA 3OM8A 5C7YA 3WWDA 1EX9A 1J2EA 5LKAA 1XQWA 4FMPA 1TRHA 5ALIA 5YASA 4DMFA 1XKLA 1XZMA 1ZI6A 4LXHA 1OXMA 3VJLA 1QOZA 4RNCA 2Y2UA 4C6HA 3IURA 1ZD2P 3WL8A 5AKKA 5I8PA 3C45A 1CPYA 3UMJA 1TCCA 2PSHA 5JD6A 2ZSHA 4ZREA 2GYWA 5AHXA 5H3HA 4AZ3A 2B61A 2BCEA 1YSCA 2H7XA 2AXEA 3F9CA 4U2FA 3S8YA 2QR5A 1ACJA 4A23A 1CUFA 1O6GA 1ZIYA 3C87A 5EHQA 2OGZA 2WUDA 4EZIA 5LZ5A 1VA4A 1QTIA 2PL5A 2OLEA 5DYWA 1DWPA 2HADA 5T4FA 4TGLA 4G9EA 7YASA 1ZGBA 3STWA 3UUEA 1CUWA 3ESCA 3DKRA 3T52A 1MPXA 1CEXA 1M33A 1QJ4A 4X95A 3WZMA 2WM2A 5ALLA 4N5IX 3QMWA 3GBSA 1LZKA 1DT5A 1BCRA 1EVEA 1VXOA 1Y7IA 1H2ZA 4BDSA 4GEGA 5HFAA 2IIVA 3DS8A 4U2EA 3M81A 2Z8ZA 4N5HX 2HM7A 4RPCA 3AINA 3HC7A 1ORWA 4NZZA 4Y2VA 2QJWA 4K2AA 2XMDA 4WY5A 4X00A 2XQFA 3CCCA 2DHDA 1BS9A 1YA8A 1QLWA 4PO3X 4C89A 1YAJA 3V1NA 2XLCA 1E8MA 3CN7A 3F8SA 3I2FA 3B3QA 3G8YA 1E8DA 1BEEA 1GKLA 4MQMA 5E4JA 2YXPX 3A70A 3EQ9A 1IUPA 5ALXA 3VISA 3MUNA 1ZI8A 2RONA 1O6FA 3C43A 4W1SA 3FSGD 4J0GA 3HJUA 4MQLA 2GYUA 5ALZA 2VT7A 5K3CA 1EK1A 1CUZA 1DX6A 2C7BA 3FSGA 3BDIA 4FLEA 4AN1A 1JMKC 3HABA 1CUDA 1PFQA 2XUHA 5CBKA 2P8SA 4IH1A 4KRXA 3RM3A 5HF6A 1ZD3A 4BE9A 3I6YA 2QOEA 3QPCA 3D3NA 4BZZA 5J3JA 3Q0TA 4UHHA 1CQZA 1GXSA 3VKFA 3HZOA 4UBNA 3STUA 5ALYA 5AOAA 5SYNA 2XUAA 2XDWA 1MO2A 2HA4A 3GUUA 1TAHA 3H2KA 2YYSA 3VVLA 2JF0A 4Y2JA 4KJXA 3NWOA 3PUHA 5FP0A 2J4FA 4J7AA 4BC1A 1QO9A 4LIPD 5JYCA 3KDAA 5DNVA 3ESBA 4OD0A 4BDTA 4X93A 1J1IA 2DR0A 3PI6A 1R4ZA 1SFRA 3A2LA 2H9YA 4XX1A 1USWA 4X91A 4C01A 3QM1A 1GPKA 4D9JA 1MX1A 2WIKA 1WHSA 1MN6A 2PX6A 2RHWA 3C70A 4EBBA 3DCNA 1CUVA 2BKLA 2EDCA 4HZGA 5LZ4A 2XLBA 4HXFB 4LYDA 3BWXA 2R8BA 4AMYA 2D0DA 2OCKA 5D7BA 1QE3A 4H7EA 3FLEA 1EI9A 5AI8A 1GQSA 1L7AA 3GROA 1XZJA 2BGNA 2XI4A 2ZJ7A 4BRSA 1UFOA 3G0GA 4CIAA 2PKYX 2RIPA 3PDCA 2DFPA 2FJPA 4DNFA 4Q1VA 5KWJA 5HK8A 3G0CA 1A88A 3BDVA 5DJ5A 3O4JA 4LYEA 2GBGA 3IA2A 4WFIA 2Y2VA 3WL5A 5HK9A 2EEPA 2QUBA 3WYDA 4Y7DA 1G5FA 4H77A 3ANTA 3FNBA 3WA6A 1FFEA 4IQ4A 3I2GA 2ONCA 3S2ZA 1TK3A 3HACA 1A8UA 1H2WA 3PF9A 5JD4A 4X85A 1Q84A 2B20A 1ETHA 2VF2A 1W75A 1JMYA 4PV7A 2O7RA 3OC0A 4MEAA 1FJ2A 2QRUA 3L1IA 4U2CA 4ZGBA 3WL7A 5ALOA 4B9AA 1XQXA 4CCWA 3I2IA 4LXGA 2ZYHA 5AKEA 5AJHA 2CKMA 3TEJA 2WIGA 5A71A 3HEAA 1HQDA 3MVEA 4FKBA 3K6KA 5ALSA 5DNUA 5ALGA 1GPLA 2XUDA 5ALMA 4MWSA 2XQIA 2DHCA 5DYYA 5JAPA 4KAFA 3WQHA 3A2NA 4DM7A 1QIHA 3BXPA 4BP9A 3HYSA 2OPHA 5CXXA 4Y9SA 3STXA 3TJMA 4V2IA 1J07A 1SC9A 1XRNA 2CZQA 3FYUB 4UHDA 4NS4A 3WK8A 2XQKA 2E3JA 3E1GA 5EHZA 3LS2A 1QZ3A 4B85A 4KAJA 1JJFA 2JGJA 4H7FA 2DCMA 2ZJ6A 2WTNA 3WJ1A 4G1FA 1ISPA 3O4GA 3W9BA 1S8OA 1IUOA 3GZJA 3BF7A 1AC5A 4Q3OA 3WK9A 3F97A 5AKHA 1HKHA 1H23A 4QDTA 4X7BA 4ARAA 5HFNA 1CUUA 4M0FA 2R11A 3JW8A 1P0PA 4X94A 4DMHA 5AK4A 1SCKA 2ORYA 1UK7A 4F5ZA 1YS2X 1UKCA 4Y2XA 2ZYIA 1CUCA 3RKSA 3ZLVA 4H7KA 3WK5A 5ALNA 1GGVA 3BE8A 4DMKA 1DQYA 3AILA 4WDRA 4BATA 2WLSA 4GXNA 5EIHA 2VJDA 4MYSA 3AUKA 5CH3A 2RAUA 1CFJA 4GBGA 1QIGA 2OQIA 3H1AA 1EDBA 1PV1A 4A16A 1K8QA 3WA7A 1XZIA 3MGAA 3IDAA 4YK7A 3O4IA 2XUOA 2H7YA 4YX9A 4Q3LA 1WM1A 4J3JA 1DQZA 4QA9A 1YB7A 1XZBA 4MEBA 3JWEA 2LIPA 4J0IA 2HDWA 1Y37A 2G63A 2JGFA 4BB0A 5EFZA 1WHTA 3W04A 5CT8A 1NU6A 4L0CA 5A7GA 4YPVA 2WKWA 3O95A 2VAXA 5D3KA 2WHPA 4J0HA 3AZPA 4NMWA 2PSDA 3G0BA 1THTA 3WL6A 5AM1A 3B5EA 3VVMA 3R3ZA 3WWOA 3C5VA 4X90A 1UZAA 2JGMA 4BAZA 4Q82A 4JYMA 5ALDA 4FWBA 4C4XA 4E11A 4BAUA 5JATA 3IUJA 5A2GA 1VLQA 3AZQA 5KBYA 3FBWA 1AZWA 2WIDA 4H7IA 4ETWA 2XMBA 3WKEA 4CG3A 4EY6A 1E89A 5D3ZA 4BVJA 5HF9A 4KE6A 1W4LA 4H7DA 2GBFA 3STYA 2JIDA 1YAHA 2QM0A 2CB9A 2JEZA 1JU3A 3DDUA 2XQGA 2WHPB 3BIWA 3E4DA 3EF3A 2OQVA 1R50A 4F60A 5FPPA 4INZA 4KAAA 4DNQA 2WG0A 5JADA 4ZRDA 2HRQA 3I6ZA 1JJBA 3PUIA 3I2KA 3F98A 2WFMA 4Y2QA 3EQ8A 4IH9A 5BWBA 2QUAA 1EK2A 2C0PA 3OURA 4J0KA 3H17A 2CEKA 1LPPA 3W05A 3BIXA 4LHEA 2JGKA 1QIFA 3C6YA 4X6YA 2WJ3A 2AJLI 2IITA 3ZLTA 2GZRA 2BUBA 2OCLA 1BU8A 1MTZA 5EIEA 4K6GA 3F67A 3I6MA 4BE4A 4DYHA 3HLKA 4Z49A 1MNQA 1YA4A 5CTAA 1UOPA 3X3HA 4J0JA 1BE0A 4KEAA 2CJPA 5E4TA 2XMRA 1F6WA 1LPMA 5T4HA 1LZLA 2IX9A 3KSRA 3R40A 4UUQA 3R3YA 4G5XA 5AOCA 1VZ3A 4GLBA 1D07A 4CI9A 3B12A 1VXRA 2XUPA 5AKXA 4GI1A 1G66A 3SC2A 4B80A 3G0DA 3ZLUA 4JH0A 5E2IA 5IVDA 4F0JA 1XZAA 1XRPA 1IVYA 2ZVDA 2VATA 2OAEA 3SK0A 5IVHA 4QE3A 3G9XA 2I3ZA 4J0DA 1ZI9A 4UBLA 5CT5A 4UFPA 2ECFA 4QLAA 1QTRA 1R3DA 3KWFA 1MAHA 2D5LA 1JI3A 2VSQA 1XFDA 2WFLA 4W1QA 3WWCA 2WILA 2PSEA 3KXPA 3FOBA 1NU8A 3H1BA 4IHAA 5AICA 4B0OA 5FXMA 1IUNA 4QWMA 2PU7A 4BAGA 3R3XA 1QIIA 4QNNA 3H04A 4G8CA 2WUEA 3I2HA 1BROA 4OU5A 3OPMA 5AI5A 3H0CA 4EA6A 1DU4A 3L1JA 3ICWA 5EI5A 4IH4A 1MAAA 2Z8XA 3FVTA 1WB6A 1MJ5A 5CURA 5K3BA 4OUKX 1XRRA 4BCBA 1CUSA 1XRMA 1ZOIA 3ILSA 1CR6A 3V1MA 5AK6A 2WJ4A 1J06A 2V9ZA 3R3UA 1TQHA 4AO6A 1PJAA 2GBCA 5A6VA 2BUAA 4CIBA 3AIMA 3QYJA 1XLWA 3FCXA 2W6CX 5K3AA 4A5SA 4TPKA 5AM5A 2WU3A 1YCDA 1T4MA 3I2JA 3EQ7A 3QMMA 5ALPA 1C7IA 1X2BA 4PNZA 2BJHA 2BGRA 4RE5A 5DWDA 1DWQA 4U2GA 4QDXA 3IULA 3D2AA 3IIIA 4OCZA 1QIMA 1KEZA 3FYUC 1A8SA 4EY8A 2EDAA 4FBLA 5IKXA 4H18A 4L72A 1DT3A 5AKLA 1XZDA 3O9MA 3I1YA 5DNWA 1UWCA 2OAGA 2VAVA 2BAGA 1THGA 5EGNA 3QMVA 4YASA 3WKDA 3PE6A 2BUCA 5ALFA 5AIAA 4DNPA 1SCQA 4Y2PA 2X5XA 2B4KA 3IVMA 2O2GA 1ZD4A 5HCUA 4B82A 4K5QA 1QGED 4HVTA 1FFDA 3QBJA 4UHCA 3C6BA 3RLIA 1RP1A 4AB1A 1HLGA 4G8DA 3H2JA 5JZBA 3LIIA 3VXKA 2UZ0A 4G4IA 1LBTA 2J4CA 2PUJA 4P92A 5ISMA 4J0CA 5A7FA 2WFZA 2CMFA 3D4LA 1UK6A 1QONA 2WTMA 1BRTA 2I3DA 5ALVA 3A2MA 1Z68A 2FUKA 1MX5A 4HXEB 4DNOA 2ACEA 4GWLA 2O7VA 2VJAA 2HFJA 3NUZA 2HU8A 1CUHA 2W22A 3W9UA 5FV4A 3DOIA 3DQZA 4QEKA 5DYTA 2V96A 4HTAA 1U8EA 4FNMA 2XUIA 1EH5A 3D0KA 4WCVA 1CUEA 2WG1A 2OCGA 4IO0A 4QWWA 5K5EA 2VQ6A 1YR2A 2GZSA 2JBWA 3M83A 3D2BA 2AJDA 5ESRA 3WK6A 3WZLA 4L3WA 3WJ2A 4H7HA 2DSNA 1ZICA 1LLFA 3DKKA 1B6GA 1JU4A 3IBTA 2HIHA 5DTIA 1QO7A 1W1IA 1LPAB 1YASA 4P08A 2X8BA 1CVLA 5AKJA 4HS9A 4E46A 1H2XA 3VJMA 1KU6A 4BBZA 2HA7A 4G4JA 5AKGA 3HSSA 5C8ZA 4EY4A 1XLVA 4WJLA 1XZGA 1VE7A 3EIOA 3DD5A 4UBIA 4FHZA 3WKCA 4XIIA 4PSDA 6YASA 3R3VA 4BZWA 5JALA 1XZEA 3SWWA 5K3FB 1VE6A 4ZXFA 3C6XA 5HZGA 3BL8A 3D7RA 3KWJA 4AN0A 4AZ0A 3STVA 3NOXA 5LZ7A 1TKRA 5JD5A 4Q34A 1TCBA 4H0CA 3Q8WA 5EIAA 4BRZA 1OILA 4OB7A 1CUGA 3ZI7A 3IUQA 2C5GA 5LZ8A 2ZJFA 3E0XA 1E66A 1F8UA 3ZWQA 2HHAA 2XMQA 2GBIA 4B7ZA 1DINA 2O2HA 3PFBA 1AUOA 4AMZA 2VA9A 2Z3WA 3KOOA 2O2IA 4N8EA 5HF5A 5FPQA 5JARA 5JAOA 3FAKA 2B9VA 4EY7A 2ZSIA 4I4CA 4DGQA 3M82A 3PF8A 2OGTA 5FOQA 4Y2RA 4DTCA 5FLKA 2C5FA 3LIPA 1AQLA 3CN9A 4AQDA 2DQZA 1XZHA 4PSCA 3DL4A 3RK4A 1MT3A 3C6ZA 3ED1A 4RGYA 4G4GA 2XB6A 1ZD5A 4G8BA 5ALTA 4P9NA 5T4BA 1UXOA 2RHTA 3AJAA 3ESDA 2I03A 3V1KA 4QZVA 4ZV9A 2OXEA 4B83A 1ZGCA 1EHYA 2WU4A 3LCRA 5AKYA 5LKRA 3QH4A 1K63A 3N0TA 3AIKA 1H2YA 1LGYA 4X6UA 1QFSA 2XUFA 5A7HA 3FYTA 2Z5GA 4F21A 3IB3A 5AH0A 3HRHA 1JFRA 3R0VA 4CCYB 3DL7A 2H7CA 2Z3ZA 5BV7A 5AO9A 4PF1A 3W2TA 3N2ZB 5LIPA 5CW2A 3QPAA 5I9IA 2QTBA 1HL7A 1C7JA 4AX4A 1XQYA 5E4YA 2WQZA 5IH7A 4EUSA 1DTEA 2AJ8A 4CG1A 2CBGA 3FWHA 5AI0A 2CUTA 4GECA 3V1LA 3D59A 5HKBA 4KYVA 3AIOA 4TVKA 5AI6A 4C87A 4BYMA 1WPRA 1P0IA 1HBJA 5CT4A 1WPXA 4DIUA 2XMCA 4LKOA 4EHBA 4UPDA 2H1IA 5LYYA 3SX4A 3H2HA 1EB8A 2XQJA 5K3DA 4U2DA 4B9EA 1JKMA 1R9MA 2OCIA 2HA5A 1GKKA 2Y6VA 4QDOA 5FUMA 2WJ6A 1R1DA 4KE9A 1QIEA 3BJMA 3LLCA 3WLAA 2QT9A 1Q83A 1K5PA 1ODCA 2FJ0A 1T2NA 4H7JA 3E3AA 1QIKA 5A62A 4CFSA 2J3DA 2YH2A 3DEAA 5CH5A 4CG2A 1W76A 2QZPA 5AI9A 2C58A 2V97A 3C5WP 4JUIA 4OYYA 2VT6A 3H2GA 5EHXA 1UKAA 3GA7A 3QPDA 4I19A 1WOMA 1XZKA 5D6OA 5DLPA 4AXBA 4WFKA 3QZUA 3U0VA 2JGLA 1EVQA 1Q0ZA 1YB6A 1VJ5A 2XMGA 3FLAA 4J03A 2HA3A 3WYNA 1CRLA 3HI4A 5AM4A 4WDQA 1IZ8A 5AK5A 5DTJA 2HA0A 5JIBA 1GZ7A 1RYYA 4FFWA 5ALWA 4P93A 4FLMA 1VKHA 4MYDA 4I3FA 4K6KA 1N5RA 3ICVA 1U65A 2HRRA 4B81A 1GT6A 3DLTA 5F4ZA 2V98A 1I6WA 1N5MA 4OPMA 3G0IA 4ITVA 1U4NA 4AO7A 4E15A 1WCYA 2XMSA 4HXGA 4CCYA 1XZCA 4JEIA 4HRYA 2GYVA 4Y2YA 2ES4A 2HA6A 1IMJA 4BVKA 1WB5A 1AGYA 1XQVA 3GFFA 4PW0A 2VJBA 5IVIA 4DLNA 4BVLA 2HL6A 5KREA 1E3QA 1VOTA 2XUKA 4BCCA 3WI7A 4DSAA 1CQWA 1UOQA 2ROQA 2PM8A 2JEYA 2QJRA 1MU0A 1IZ7A 3OOSA 1N8SA 3KD2A 2PU5A 4KACA 3G9UA 4ZWNA 1AX9A 1E8NA 1P0MA 1ZJ5A 1P0QA 4H35A 1Y7HA 1XLUA 4OB6A 4UFOA 5T4EA 2Y6UA 2RGUA 4O08A 3D2CA 3D5EA 5AI4A 3ANSA 5JAUA 4UBJA 3U1TA 1AKNA 4KRYA 4BC0A 5CMLA 4XWGA 4ZV7A 1RWQA 2ZYSA 2XT0A 1B41A 2JGIA 3WMRA 3K2IA 3FCYA 3GELA 4N8SA 2HFKA 2XUGA 1ACLA 5HKAA 3DOHA 1ORVA 3BF8A 4EB0A 2WG2A 1TCAA 4OU4A 5K3EA 4QDUA 2PPLA 5CT6A 2PSFA 4B0PA 5LZ2A 5ALHA 2NW6A 3F96A 3OTQA 3AFIA 1U2EA 3IUNA 3DYIA 2Y1KA 3DJYA 1MNAA 2HU7A 2PBLA 1CLEA 1L7QA 2RI6A 4X97A 1QIDA 1Q0RA 4C4ZA 1CUBA 3FYUA 2G4LA 3FVRA 2BFNA 4X92A 4QLOA 5HF8A 2WUFA 3O9VA 3EBLA 2WIJA 5I7UA 4QDZA 3WKBA 4JYPA 1KU0A 1BCSA 5AOBA 1ZIXA 3TGLA 3O4HA 4KE7A 4UHBA 4OYLA 5JANA 5SYMA 4UHEA 1G4HA 1FFBA 3W06A 3R41A 1A7UA 4C88A 3CCBA 1TIBA 4G9GA 5IVKA 2DHEA 1EXWA 1FSSA 1GPNA 4PSUA 1CIJA 2WIFA 1H22A 3ESAA 2WUGA 5AK3A 1XZLA 2XUQA 4S0XA 1HDEA 4FNGA 4MJ3A 5LLSA 4UHFA 3T4UA 1AURA 4BTLA 4UFNA 2VJCA 1UK9A 5LP1A 1C4XA 1ZJ4A 2QS9A 4W1PA 1LPOA 2JGEA 2HU5A 3JYHA 4OB8A 4E14A 5K3FA 2J3QA 4FLFA 4U2BA 3H18A 4WFJA 4AO8A 2WHRA 5ALUA 4W9RA 1WB4A 1XRQA 4NVRA 4RE6A 1CUYA 4FFVA 1CUXA 1XROA 3TRDA 3K9BA 2QXUA 1BN6A 5ALKA 5JAHA 1AMNA 1ODTC 3BJRA 4KR0A 4Q05A 5FDFA 2OG1A 3P2MA 1DWOA 4FOLA 1K4YA 4Q3KA 4W63A 1SOMA 4ZI5A 3WIOA 1VZ2A 1LBSA 4C4YA 5AM2A 3C8DA 2C4HA 5AM0A 1UT6A 2HA2A 3QITA 3V9AA 1W52X 1CV2A 4MWTA 5JASA 5CXUA 2QKYA 3CXUA 1E5TA 3WWPA 4LXIA 4BTVA 4DSZA
chains in the Genus database with same CATH superfamily
1RZVA 2PRSA 4MGIR 2Z8YA 1Y1LA 1LPSA 3CLSD 1OIWA 2FFHA 4HSGA 4O2BB 2P9YA 3EG9B 4LBWA 5C8XA 3FD8A 3E8MA 4XPIA 5KCMA 5CFLA 2A9OA 1KKMA 4MYCA 1FQWA 2VWQA 3K1JA 3AFNA 1G9XA 1QRAA 4GC9A 1XMPA 4PAOA 2R00C 1K89A 1OFVA 1M75A 2P9GA 3K96A 4DMGA 4JIMA 2W2LA 3M33A 4R16A 1KPIA 2BM1A 3JD2A 1ZM7A 2UZ3A 4MHOA 2ZRKA 2KW5A 4V3CA 3U7IA 2C59A 2ONKA 3DBLB 3E9CA 4XYGA 1J2UA 1C2TA 1XO1A 4KLNA 4TT3A 1QHSA 4I0WB 3E9MA 4CF3A 2JRCA 3EGDB 4GBED 3VSDA 1NN1A 4C30A 2O1WA 4DZTA 3GJ6A 3UUFA 3HJAA 2DECA 3CX8A 3KUXA 1I10A 4DMMA 4U5QA 4BS9A 2Z58A 4R7GA 1YS1X 1N1MA 2DOKA 5L7WA 2DPGA 1KP2A 2M6RA 3L79A 4JU9A 2PGNA 5ER9A 2QJFA 2DQYA 2ZJ4A 3X1DA 1ZR4A 3I8OA 5LC1A 2A5GA 2M2IA 5CFOA 9MHTA 4W5WA 1QNLA 3VYUB 4GPD1 4W1RA 2JI9A 3U39A 4PS0A 4B75A 1UPTA 2MIIA 2Z1MA 4K6HA 4OF4A 1ZNXA 3NEPX 4HLCA 4HSEA 2SKCA 1WTCA 2D54A 2MYPA 4BFSA 4FTWA 1H8ED 1T2AA 2Q2VA 3R9IA 2I76A 4DRXA 2E4XA 2RGXA 1RJ9A 2C0QA 2JFVA 3G9TA 3PFWO 4MV3A 3IGFA 1C7EA 3KBBA 1JKJA 1UZNA 2I2CA 2ZYRA 1S3IA 4JHXA 3WIBA 1WSWA 2PUHA 2A94A 2Q9UA 1P29A 3MOIA 3QBDA 4Z7QB 4MUHA 1QGUB 1USKA 3WGMA 1KFEB 1UKBA 4OQNA 2Q0HA 4D7AA 3ILVA 2NVWA 1OCEA 2FPMA 3HYLA 1UOOA 4ID9A 4WESA 1AO0A 4WKPA 1Z2OX 3ADBA 3KT8A 4W6QA 4CEHA 3L4KA 4FKZA 4G1CA 2OXIA 5JCOA 2MR5A 3DGEC 2ZRNA 1MW9X 2JASA 3IEUA 3DTVA 3BMNB 4MVJA 5BR8B 1CY1A 5I9MA 3NWBA 5LMCA 3GT3A 3ELDA 5GIPE 3PGXA 2PT5A 4DLVA 4CIDA 1PX2A 1PJBA 2YASA 3IOEA 1FVXA 1Q7EA 2IKSA 4RD2A 1Q0QA 2BH9A 1Z07A 5BSGA 9LDTA 2CXOA 4RORA 4JYZA 7MHTA 3P7MA 2IA5A 2AJTA 1FFAA 2LKCA 1GPJA 1V3TA 2RBKA 4IDAA 1R2QA 1T2FA 3OIYA 4JBGA 3CX3A 5EAIA 5GIOE 4K05A 3EARA 4E1AA 3AI3A 4QBGB 1XV5A 1VB5A 4LISA 5C9ZA 4G25A 2X9NA 3AEUA 4BQRA 2J5BA 2ZSJA 3VNVA 1PZGA 3OPVA 4RZXA 3FCEA 4LOIA 2A9KA 1J0CA 1V1MB 4DLTA 4PYOA 3GFGA 1NAHA 4R40A 1U9IA 2EP7A 1SU4A 4UVDA 3NAMA 5E6UB 3VM6A 2O5VA 2OGSA 2NNWB 5ALQA 3KFVA 4Z0PA 1BHQ1 5F4BA 4C08A 2C57A 2FW9A 3QKRB 3UMSA 2VA8A 4Y6LA 4YMIA 5L4SA 3RS3A 4B3GA 2ASVA 4RELA 1E2BA 4PVCA 5SY6A 1QDUA 3CLHA 4CM7A 5LD2B 1K66A 5BOSA 4YUZA 1SCAA 1GZDA 1QP8A 2JI6A 3F74A 3O93A 5KYWA 4KFRA 4QUAA 1PSZA 2RHMA 3GUVA 1M2VA 1TM7E 3IKLA 2RG7A 4PVDA 4Y7CA 1ZW6A 1JLMA 3CB4A 2XYVA 3H1TA 2P9CA 1AXGA 3RSLA 1BQEA 2OHXA 3I01M 3UMFA 3AUYA 2JAQA 3IIMA 2H5EA 3PLRA 5JBQA 3M6UA 2IYEA 4RY0A 2FH5B 4MVCA 1YQUA 4GLOA 4QVIA 3IEKA 4BV3A 1ZUWA 2C8VA 4KFTA 4KQ6A 3GP8A 2OKCA 3G0OA 4RHXA 4UXHA 3GLIE 3IPLA 3KWLA 3ZDZB 1I4EB 2AZMA 4HPXB 2G25A 1T8RA 2XYHA 1TYBE 1ZGHA 2JAHA 4S12A 5LR6A 5M2QA 1ZPDA 1AS0A 1CUIA 2OP0A 2A3NA 4MV9A 5BOVA 2QVBA 3A6ZA 1XKQA 2DY0A 1NJ5A 3ZH2A 2OYCA 4B2PA 4IO1A 2BTEA 3ZGLA 1NTRA 2QPTA 1TGYA 2X3FA 3WDSA 4R8RA 2J9ZB 5FWYA 1BDJA 2HBQA 2CXTA 2I6TA 4RHFA 3V4VB 1PLKA 2YXDA 1H0HA 2AN5A 3M5PA 4PRZA 1HM5A 2WJGA 3VTFA 5PGMA 2JD0A 4L22A 5A0FA 4V1CB 5DSXA 1G42A 2JFWA 4KLAA 2Q5OA 3K9NA 4J29A 5DRTA 4JXJA 4I4NA 3LCJA 4XFDA 2P4HX 2X8JA 2R25B 2D1YA 4FYKA 4QJ3A 1UBLS 4ZYYA 3NHJA 3LPAA 3L8FA 1QU2A 3G1UA 1LX7A 3JV7A 4WXMA 4DEXA 5BR1A 3TSAA 2XMZA 4O0LA 1USGA 5J2TB 3WLHA 1P1FA 3U7FB 3KV1A 2PEZA 3E2IA 3IKJA 3ZZUA 1YCFA 4O2AB 5KQRA 3OM1A 4PICA 1A4XA 2JJMA 4R2WA 1J9EA 1LDEA 4YGXB 4INAA 5AQEA 2QL7A 2N42A 3QWBA 2W5UA 4DR7B 4CFYA 5T5QA 1OFHA 4WLOA 4BX0A 2GJ9A 1VFNA 2B82A 2KYRA 3DO5A 3P9PA 5HE9A 1NMEA 2C29D 4P2GA 5DXFA 3EXIB 2ABWA 1R88A 2PVSA 2WP8J 1RJWA 4XAQA 4TXNA 3F5SA 1RW4A 2QYHA 2YWEA 3G2NA 1RXCA 4M9RA 4OY3A 3ZUGA 4XRGA 3HKBA 1DZ3A 2PCJA 4TKMA 5LXTA 3ASZA 3V2GA 3CJTA 2QVYX 4EBFA 3EWSA 4Q4LA 3RF6A 2VRNA 4JLNA 1QH9A 3F3SA 4M22A 4B4UA 2X5KO 1E6LA 3FIJA 1DX4A 5CA0A 4B7AA 2H2FA 5F7XA 1QO0D 1PVOA 2Q5QA 4LYAA 4C76A 2KMLA 2AJBA 3CB2A 3OM8A 3WR5A 1J2EA 5AUPB 3ROPA 4B3JA 1Q0HA 4KGZA 1TRHA 1GZ6A 2G88A 1TAQA 4UZFA 5EIFA 1XKLA 3C1OA 4WTOA 3ZXIA 4B79A 3EFBA 3LDUA 3HWX1 4OMDA 4RNCA 2I0FA 4Q03A 4F72A 2VBCA 4ZC1A 1PFYA 4R5HA 2D4HA 1NF2A 4RZIA 1ADYA 5DX1A 3I45A 4KCGA 4B40A 5EHGA 1HQYE 1C9NA 2C7VA 3VYRB 3OIVA 4CM3A 3HTXA 2PSHA 4RD6A 4P3PA 5JD6A 1I7SB 4G2NA 1X7DA 4AZWA 5JVDA 4GZ3A 1L5GB 2GYWA 3SJBA 2VPWA 4O4IB 4XA8A 5AHXA 7ABPA 1L7DA 5H3HA 4P35A 4QPNA 1I3KA 3BVPA 2CDAA 5F52A 4AZ3A 2PT9A 3EVTA 1DO8A 2ANBA 2AFHE 3ZBTA 1EXDA 2XUZA 3MEQA 1KH1A 4CKBA 2BE9A 1Q21A 2XADA 4DIEA 4ZN6A 1LH0A 2H7XA 4U2FA 1M0WA 4M87A 4HN2A 3S8YA 3KEGA 2FXVA 2Q3JA 3QGMA 3IBSA 1CK4A 1MENA 5FPKA 1ACJA 4A23A 2YRWA 5A03A 4CW7A 2P3QA 1MAUA 2RK3A 1ZIYA 4IDPA 2GZDA 4HQKA 5EHQA 5H5JA 3QRWA 3QVOA 1T26A 2QROA 1NVVQ 2A33A 4JBYA 4UTVA 2A67A 1KEVA 3H2YA 5EJAA 4IEEA 3QUSA 1A2OA 4RHUA 4MHTA 1ISFA 4EECA 2FWMX 3UAVA 2OLEA 3TTXA 1G8FA 1ITZA 2ZXEA 4R8MA 4DF3A 2OR3A 1HYEA 1SVSA 2PKXA 1GUYA 2EQ5A 2QMHA 4PLFA 1XWFA 1MDBA 4ZHSA 3EIUA 5DLYA 1XGKA 4I50B 4K9MA 3F4BA 1NM5A 3PC6A 4IFBA 2FV8A 5H9WA 1CBUA 3WLPA 3EZNA 2CMDA 5DYIA 4BLPA 2FPRA 3I2YX 3KFXA 4G3XA 1XLTC 3UUEA 1Y34E 5EXEA 4CUZA 3FOZA 4RANA 5JWRA 2B4RO 3K1AB 1CUWA 3WYCA 4CMJA 4WCFC 4YDQA 5L6LB 3B5IA 3ETNA 2Q9CA 3M1AA 1VBFA 2IYXA 2NT3A 2J6CA 3RREA 1MPXA 3T52A 1U3GA 4ECAA 1JXAA 2P9EA 1M33A 2QLTA 1QDEA 4QGHA 4WA8A 3T7RA 3TM5A 4PZAA 3C3KA 1KI6B 4KDRA 4X95A 4IFTA 4FX5A 3JQPA 2FTKE 2FY8A 1GKIA 1PJ8A 4FT2A 5FB3A 1PTJC 2YFHA 1BS2A 3HS3A 4GICA 3EPHA 4KODA 3RHTA 2OZKA 4E7OA 5AK0A 2NTEA 3OCXA 2PZMA 4M1KA 4XIJA 4Y1FA 5JVDB 5K3SA 1JAYA 3D54D 2XODA 4CFZA 5A4AA 1NVUQ 2VDQB 3NIFB 4LA4A 2FW8A 4O3FA 1Y7IA 1H2ZA 4BDSA 1HYHA 2X6RA 2HD4A 1HYQA 3UN1A 3R6TA 2IIVA 2QAGA 3JQBC 1J1UA 1NBMA 2VSXA 3DS8A 4JEHA 5EVJA 1W1WA 1UBMS 4ESOA 1GLVA 2WKRA 2G83A 1NX6A 4GWGA 3HDVA 1RPZA 1G2IA 1NQWA 2XY4A 4JASB 4RPCA 4YRMA 2Q2OA 2Q6IA 3VR5A 3HUDA 3GD7A 3DCIA 3UMBA 4DCJA 4NZZA 3JATA 1FYFA 4DCCA 4TKLA 3EVZA 3N59A 4MUEA 2JFYA 4N9QA 4DILA 3ZGNA 5DOZA 4WY5A 4FW8A 2GUWA 4NZPA 2P6MA 4X00A 3OFJA 4Z4CA 3P2YA 3I0ZA 2QP3A 2ZAGA 2PFSA 3CRNA 1DHRA 3HPQA 5AW1A 1L5VA 2TS1A 1UMCA 2W00A 4C9BA 2E49A 1JGTA 4HDMA 1N5IA 4C6TB 4NCBA 2V0NA 2RKBA 1SQ0A 2XLCA 3ZTYA 4YRBA 2X0IA 1IUKA 2JJ8A 4RGBA 4GZ6A 2O2EA 5K8IA 5EPOA 3RVSA 3D8SA 1OIVA 5ECWA 3RTEA 3D4OA 3TZQA 2VQEB 4HNRA 1EE1A 1GKLA 1RRVA 3IE0A 1QV9A 3DMPA 4JSRA 3Q4GA 4MRNA 4FZVA 4G0XA 4ZZ2A 2IIBA 3HE3A 2R62A 4P4TA 5JEEA 2PD6A 2X8AA 5ALXA 2C4NA 5G41A 1M1YB 3VISA 3WGTA 4EDFA 5LPNA 4R68A 4I4LA 2ZUWA 2VNKA 4IIYA 4JJ4A 3ZH9B 4P58A 4S04A 1KDTA 4MWEA 1U0OC 3TM4A 2I9KA 1LLDA 3LDFA 4JUBA 4ENQA 2Q41A 1NW3A 3BMXA 2QN6A 1Z12A 4IDHA 4Q3DA 4U8HA 5DM70 2HYDA 2JFUA 1NBWB 3GCDA 4ZXPA 4WUTA 3ITEA 1H3FA 1YDMA 1LTQA 2GQ0A 1EK1A 1WQ1R 5H80A 2OBMA 1CUZA 3SC6A 3VR5H 1KXJA 3ZWVA 1UBFA 1R0ZA 2AFRA 3E8XA 4F11A 3PC8C 1SPBS 4AJKA 4TTAA 4CWAA 3HABA 4U7FA 1P1JA 3T3IA 1CDZA 5G3YA 3NB0A 5ITZB 4Q1FA 1WCXA 1PFQA 1ZWKA 3KOXA 2WOOA 1SU7A 4UCQA 5D5PA 4BPRA 1KBOA 1ABBA 5LMNB 3MGKA 5BY2A 2C1XA 2VBIA 1QUEA 1T2CA 3EVEA 3DTVB 5ABPA 3AGPA 2II6A 1Z4QA 1U0NA 3N75A 2CFIA 4WIAA 5HF6A 1OAAA 4WN9B 5ECDA 1GUDA 2ZRPA 3NXSA 4YRIA 2W6ZA 1K2VN 3BT7A 3HDJA 1MJHA 5ED0A 5GGXA 1J09A 4Y1RB 4HGQA 1P77A 3KPUA 4UHHA 3VNSA 2OECA 4ZI7B 5BPHA 3VKFA 1B8VA 2XCIA 3QBVA 4UW9A 3X0DA 4OH7A 3HZOA 3KTDA 5F5LA 1P2FA 4LZWA 1ZUHA 4DJDC 5K20A 1J5XA 5G3ZA 5EIOA 4MV0A 5SYNA 3ZYZA 1S2MA 1YFKA 5CVCA 3HBMA 2XDWA 2EIXA 3DEJA 4IFIA 1KTIA 1JEEA 4ZT7A 4B46A 5MN6A 1N6LA 5C4MA 1V3VA 3QFSA 3VH1A 2RCYA 3CZAA 4DQDA 4NOLA 2C77A 4YI5A 2JHPA 1X8JA 5J4VA 1B0AA 5CDFE 5JS8A 1NW8A 3FOAA 4ED9A 2SNIE 1RD4A 2A1TS 2H08A 2YOFA 3HJRA 3CW9A 1X8KA 2OMKA 3EGCA 3KHSA 4RQBA 1WZIA 3TIFA 1X1CA 4Q5IA 4DA7A 4E32A 4YCMA 3SDSA 3UG6A 4J7AA 4GPZA 4XYMA 1ZITA 1OFIA 3AF3A 1GGFA 3F6EX 3KDAA 1U8YA 3JSXA 4OD0A 3U3OA 4M49A 1J1IA 3K1TA 3GGGA 3H5NA 2EJTA 3KR0A 4R9NA 5KDLA 2C98A 2YDXA 1SWWA 3HADA 1LK7A 3A4MA 4MJXA 3W79A 3MM4A 2A0YA 3ZOZA 2HK9A 3O4VA 2O6LA 3G0HA 1LUAA 4V0LA 5EIWA 1P5HA 5BSEA 3A2LA 5IAEA 3CT4A 1OWMA 3OHMA 3DUWA 2FN7A 1DCTA 5HDQA 4C01A 4MZDA 1R6TA 3QM1A 4ZQIA 5TVKA 1E3IA 3IEIA 3A4TA 1O0SA 3MD9A 1EX6A 1MX1A 2WIKA 3OPXA 4A3SA 4UPEA 3O90A 2WSMA 1QORA 5F78A 4MRMB 4ZOEA 1SAYA 3RSFA 4TLLB 1ILEA 1CUVA 1XAHA 2BKLA 2EDCA 3IRVA 1PGNA 4WKCA 3RHZA 3VMMA 3U6KA 2XLBA 1SO8A 1RE0A 5HEKA 1RT9A 3TAUA 2IRWA 1MQAA 3SAJA 1FDIA 1PDVA 3P9YA 2MHCA 3VOTA 1E6WA 4AMYA 1RCFA 4LJAA 4TZ6A 1RMTA 4IHQA 1Z17A 2OCKA 4GVXA 2O2CA 1FW8A 4JROA 3RUDA 4Q3AA 2X14A 5KJCA 1NKVA 1TAUA 3A7DA 5E1DA 3GGPA 5CJ2A 1H4TA 2PFGA 3TEFA 2JI7A 3UZUA 1UC5B 4J0QA 1L7AA 1YIOA 3IPRA 3OX4A 4MX8A 2P9HA 2BGNA 1S2DA 3EDRA 1G7TA 1J0AA 2E5WA 4QTZA 2Y76A 1GZ5A 2Z2XA 3GB9A 5TY0A 2LCIA 4HDSA 4AC9A 4H4DA 1REQA 3AUJB 5F2KA 5FL3A 1GNLA 1BEUB 4HBGA 4BUCA 3DBHB 3DZDA 5HK9A 3ZD6A 1FFXB 1IIBA 2QDKA 1YL7A 2N1MA 2OO7A 3W7VA 3AV0B 1ZYUA 2D5BA 3WGIA 1PI3A 2CY0A 4GMXA 3BCRA 4NYIQ 4D0GA 4FOPA 5DHAA 5KWJA 2W6JA 3IUPA 3M4ZA 3BDVA 3PRKE 3IQIX 4Y2GA 2XT9A 2R8OA 1O0CA 2EKDA 1PW5A 1ZN7A 2VT2A 2XCLA 3Q6NA 2PXCA 2WKSA 3IA2A 2HSWA 4WFIA 2Y2VA 3TBFA 1LLCA 3LX6A 4MR7A 1VPTA 1WKVA 4DQLA 1WCWA 2EEPA 3H6HA 1T1IA 3TJRA 1MO4A 2CLOB 1DPGA 1U3DA 3LC1O 3U4GA 2DEUA 3IAFA 4O02B 4UM9D 1J99A 3H0EA 4R6XA 3NLLA 5DV9A 1MC1A 1KSHA 2FRDC 3A9SA 3WQSB 1FFEA 1TW2A 4HGNA 4IQ4A 2FPGA 2FWIA 2J5KA 3K6SB 4DEYA 3Q9UA 1AXRA 3DKIA 5JS7A 2G0AA 1FSPA 2ZM5A 5BN4B 1E6EA 2WYOA 3EGXB 4LV5B 5K8JB 1SPXA 2FPSA 4H59A 3NNSA 3LUHA 1FU4A 3FGOA 3NEAA 1H2WA 1K7XB 2J1LA 4ZGWA 5JDCA 2O2DA 2MJLA 4COKA 3ZJ5A 3JQ9A 4G0UA 1LF0A 1T8UA 4K8RB 4TXLA 4QNRA 4B7CA 3ZNQA 3LY8A 4ALKA 1QB7A 2FYTA 1WZEA 3G82C 4J91A 1F48A 1JMYA 2JAUA 2M6KA 3JVVA 2O7RA 4QXAA 4DLLA 1QGOA 4ZCRA 2NV0A 3CVYA 3V2HA 1OH6A 3KHKA 4OHZA 3MB5A 2KS6A 1QP4A 3FMFA 3HLTA 3N7UA 1EP1B 2BHLA 1FFXA 4QJBA 1V5FA 3C8ZA 3AUTA 4R41A 3QVUA 1D4FA 1UKZA 2VXBA 1KY3A 1M2HA 3L1IA 5L3ZA 1DLJA 3MA0A 4BGVA 3QKWA 3TRKA 1KS2A 2FFQA 3ZXXA 8MHTA 4KSYA 4UMVA 4YXWA 3IP5A 1ISGA 3A3KA 4B9AA 1EFHA 3K0FA 4DR4B 1RIFA 3MCZA 3A8TA 4ZZ3A 1PG5A 1WZ2A 3A0RB 1TA4A 4J3NA 4YMGA 1KRWA 4RY9A 2CKMA 3DFIA 3ZIAD 3QHQA 1YJAA 2WIGA 4NFLA 4DBVO 2V9CA 2P6PA 4LE1A 5A3SA 3PL5A 3A06A 2B0JA 3D81A 2VSYA 3AR4A 4P5EA 2BT4A 2PQMA 3GJ5A 2UZAA 3F7TA 3OT1A 4WOPA 4FFRA 1GNVA 4O2AF 5ALGA 2QN8A 3U44B 4MW7A 3OH8A 1SXJB 1SCDA 1T9GR 5EWLA 5GV7A 1MG5A 2HPVA 2R1UA 1ZVKA 1SELA 5ALMA 1SURA 5DYYA 3ZKAA 2PXXA 5JAPA 1XJCA 1DC3A 1KKUA 4NS1A 2EP8A 3O2JA 3ZBPA 3UT6A 5LJLA 3I09A 2Q3EA 1RYFA 2J0UB 3RFVA 3TW0A 4AQYB 2WEKA 4DM7A 3G17A 3MAJA 5TDHA 5CB6A 4XVUA 4CCAA 1O97C 1XHLA 2XE6A 3HYSA 3QUTA 4BGIA 1DAMA 2JJ2D 3TJMA 1M83A 5G0TA 1GGHA 1XRNA 2CZQA 2IPMA 1P44A 2CFSA 4L4SA 5KTSA 1RBYA 4I1UA 3PYMA 1RXSA 4NS4A 1EHIA 3QY9A 1W19A 3BH7A 3HSYA 1FDSA 4ES6A 2Q99A 2NP7A 4GGMX 5H3LA 4IUDS 3VPDA 4EHAA 1QZ3A 4B85A 4C07A 2A5DA 4TV9B 1RTTA 2VDJA 1CJKC 1L7OA 3LPNA 4LK2A 4BQSA 4XEHA 1KARA 2ZJ6A 2YVUA 3WJ1A 5EQFA 3QUQA 1R27A 4G1FA 3WBFA 4BKQA 2R4QA 3LW7A 5FL7A 4MMXB 5L3SB 2NX2A 1RP7A 3VDRA 4LZPA 4G6ZA 2R8YA 3NYRA 4XB1A 1GKYA 3LE8A 2QIOA 1G5HA 3O4GA 3Q85A 1G3MA 1AGXA 3CG4A 3HLYA 4YAOA 1S8OA 4D45A 5KX5F 5LOVF 2KWIA 3T34A 4CEIB 4A6EA 2H8KA 4HWGA 4NEHB 1KDRA 2WWVD 2Q5HA 2BCJQ 4FJ2A 4GYJA 1GQOA 3MUEA 2BGJA 1SVKA 3RSQA 1YS6A 3KPVA 1KJ9A 4XRRA 5THQA 5K6AC 2NAPA 3V34A 1DPFA 4XUEA 5HFNA 4C6SA 1CUUA 3IXLA 4M0FA 3VC7A 3GI1A 1P5ZB 4E0BA 3AU8A 3MSCA 5EE0A 3U31A 5CDGA 5ESDA 1IXYA 2ZRJA 1VKZA 2JLWA 1WCIB 1QZXA 4MI6A 1JVNA 1LW6E 3S2SA 1F9EA 1UKCA 4AT1A 4EHLA 1O6CA 2ZYIA 3JQ7A 3SSMA 2GARA 4ENVA 2VAPA 2P78A 5A4FS 2BTQA 1R18A 2WV9A 3HVHA 1SVIA 3KTOA 3RKSA 3ZWKA 1ZCBA 3M6AA 1CHDA 2PIAA 3OZXA 2AOVA 4NU5A 4YRQA 5E9JA 5H16A 3ZX5A 2JFOA 2NVBA 4MW5A 4RIFA 7GPBA 4A6DA 1BDIA 2V5VA 2H0RA 3BE8A 2OILA 3TCKA 3PHHA 2A0XA 2ZT7A 4IJ5A 1V11A 2PUTA 4NBKA 2XA9A 1J8QA 3V8EA 2V7QD 2NQ2C 1SVMA 1UKYA 4AAYA 3DL2A 1EVKA 1ZN8A 2QMYA 3JWPA 3L4BC 1XXHB 3HBAA 4J1SA 4MYRA 1AKUA 5CIYA 1JLKA 2C2YA 5CH3A 3R7WB 1W34A 3ASUA 1TD1A 4MR9B 1HE2A 4FOTA 1MZVA 3M7IA 4GBGA 2OQIA 4PAGA 4EPXA 4LQCA 4ME6A 4JCOA 4D80A 3RADC 3GDFA 1EDBA 2W2XA 3I04A 4Y0AA 3MPOA 5JY1A 3E7XA 3N8NA 3ZIAA 2GJAA 3WA7A 1T0BA 1XZIA 1JHPA 1G19A 2AR0A 2WUWE 3AX6A 1RS0A 3IDAA 5B1EA 3L04A 3LK6A 3RODA 5P21A 2ZR7A 2XUOA 2AB0A 2H7YA 4DRYA 1C9YA 1KYZA 4YX9A 2FFRA 3KEFA 4JDUA 2X3YA 4Q3LA 3VVCA 4AJ2A 1RQNA 4RQAA 1DQZA 2OT3B 1MXHA 2ZJ3A 3AB8A 1WD5A 1U9IC 2OXCA 3NJ4A 1GQFA 3W5CA 3UT5A 1YJXA 2GZ1A 3ZV6A 1RWNA 4RVNA 4C78A 4DSUA 2AN1A 5KJ1A 1OXKB 3PRJA 4HGOA 4MWCA 3N2EA 3U48A 4D8TA 3GLKA 2WWIA 5KOJB 4MDEA 4JVOA 2J7KA 2VRWA 3OC6A 4TV8B 4J4TA 3W5AA 3H5WA 3CGGA 2EQAA 2XITA 5EFZA 1LC0A 1LI5A 1SG9A 2CXSA 2DLNA 2TMGA 3BFKA 2F17A 3HCDA 4ID3A 2OLKA 4PYNA 1NV8A 1OI2A 1WG8A 2A58A 4NF2A 3W04A 1RXUA 3PVZA 4CHTA 1IQ0A 1F14A 1S89A 3NAZA 1BTOA 1YQXA 4TQUS 5CT8A 1Z88A 4RDHA 3SYMA 3D4BA 4MR7B 5EJ7A 3NYWA 4UC0A 2L2QA 1R12A 1MA0A 4QBIA 3INRA 4WERA 3AZPA 4PCUA 4HL6A 3QVVA 5FEMA 2D2XA 1VBKA 3WNQA 4UMDA 3LGAA 4DOMA 5KX5A 4QSHA 5LOVA 3R6WA 1TEZA 2O8FB 1PT6A 4UTXA 5AM1A 3GHYA 5F76A 3OY2A 1PEYA 3ED5A 2F1OA 2YRFA 3OWHA 1Y4UA 1Y42X 1YE3A 4I1VA 4TVBA 2GAAA 3N7TA 4MTCA 1YRLA 2FQWA 2NTNA 2REQA 2P65A 1UJNA 4HUTA 2AK3A 1B6SA 2L18A 4FWBA 3I5YA 2WAMA 4KK4A 4MV1A 3LD9A 1U6JA 3WLQA 4A8JA 1QWSA 3TX2A 3KVNA 4JMLA 4B8ZA 1HDGO 4H1HA 5C5DA 2FETA 4GI5A 3U3KA 3V7UA 1SUDA 4FOSA 1QM5A 3SYNA 5F3WB 2XBMA 2B4TO 4IVNA 3RI3A 3RUFA 2VJLA 3UK0A 4QQKA 1Y33E 5LWHA 2ZJ5A 4MUXA 3BE4A 3N2GA 4H7IA 4XJSA 1W0JA 1DEOA 2FWJA 2P9JA 5FOTA 4DR6B 3EY9A 4I2NA 2P7IA 3AR8A 4L75A 5JS6A 2A1TR 2CMHA 4WUVA 1RQPA 4QJIA 3WKEA 2IF2A 5I8WA 1VE5A 4PLTA 1LDBA 1YDFA 4O25A 4NABA 4OHOA 1L5MA 2AUTA 2J3IA 1LWNA 2YIMA 2XSZD 1BC5A 3NDJA 4V38A 5HF9A 1VRVA 1EBFA 4EAQA 1FF9A 1XNGA 2VPZA 1HGXA 1W8DA 1X7GA 1SIWA 2JIDA 3KG2A 2QTVB 2QM0A 3PRHA 3DZCA 3SLGA 4AIIA 3FHLA 1EWTA 4BMOB 2PS3A 4MUNA 2QE7D 3IHLA 4O8ZA 3QXSA 1WSDA 3ROGA 2V8BA 4DARA 5IKOA 1MAWA 2B83A 2GFHA 3GDHA 2HYIC 4MQEB 3RGWS 2P4SA 1R74A 3E4DA 4O1HA 4ZIRA 5B4VA 4KP7A 3UOGA 1EYZA 4MNTA 4Q19A 2UZIR 2VVTA 4BQPA 4EPWA 2HRDA 4MV8A 4KR2A 5EL0A 1FNSA 1TYCA 4N3CA 5CU7A 1MRSA 3L6DA 1KTVA 1BRMA 5DTQA 1W85A 3TQHA 5GZ1A 3MTIA 5JXGA 3U62A 3RTBA 1N6RA 3SF8A 4CM4A 2W4IA 4HB3A 4ARZB 3T5GA 3ND8A 3CNOA 1B6TA 3K8QA 4QKQA 1TKCA 2HRQA 4MV4A 3I9OA 4OBBA 4KITB 4PLWA 3ZEIA 1MA3A 1UQRA 4S05A 2O19A 4C3VA 3PUIA 1YVEI 2HF7A 3KVYA 2E82A 4W7SA 4D2IA 1T0UA 5ERYA 4MKHA 4XX0B 1F2UA 2QZJA 4EJSA 3PGKA 4JWTA 2Q6VA 4KGXA 1I0ZA 1PBTA 2GAFA 3EQ8A 4WXEA 3IR5A 3TRHA 5A4MS 3O03A 5FWXA 1UWKA 4LF4B 5BWBA 4O4IA 5FLYA 3B9RA 1G6OA 2YN0A 4HTFB 3CR7A 3PD0A 2O23A 3ZIUA 1PZHA 2DQKA 5MN4A 3OE4A 2NUAA 4F4FA 4LF5B 3LWBA 4QTXA 3WMGA 4E2ZA 1G63A 2LKDA 2YW9A 3BIXA 5HUQA 3M3HA 1FPMA 3A4YA 5IF3A 4KWIA 3TQRA 5CLHA 4IP0A 2NO0A 4LHYA 4X6YA 1Z13A 5JH7A 5HILA 1ORIA 4WCFB 1I4LD 5EJ9A 3ZBUA 5IASA 2IITA 3S28A 3ZLTA 1ZIOA 1NBOA 4M0CA 2FEMA 2GZRA 2OY0A 1PJZA 2CCJA 1XD8A 2QJTA 1CWUA 3K0HA 3ZHXA 5EIEA 4K6GA 3H4TA 4L0MA 3I6MA 3RC7A 4DJJA 4JP5A 1PZXA 4BE4A 1QC5B 4BUJA 3HLKA 1A2BA 2NZ8A 2C9YA 1LDYA 3IDOA 3JZDA 2BSAA 1IBMB 2DFVA 3CLVA 4Z49A 1CY6A 5C3UA 4YO7A 5F1YA 1L5HB 4X7RA 5BSRA 2VJQA 5CTAA 1E2NA 3ZZMA 2YYZA 2V7TA 4EA8A 3CRQA 1J0DA 1O77A 2XAUA 3NBQA 5DFAA 4D46A 5JRJA 1XU7A 3VYVA 2JPDA 4G0OA 1X7XB 5ANRB 3SX0A 3GGOA 3LPLA 1C1HA 5E4TA 5TQ2A 4BPBA 3IT2A 3CE9A 1PVVA 3U16A 4DZZA 5G1NA 2ZPUA 1C3JA 1RQRA 1V35A 4V0RA 4AX8A 5JMPA 2I6FA 2FUG1 5LP6F 1DQNA 4RVHA 5T4HA 4ETIA 4TS9A 1O8CA 4QYTA 3L07A 1TEVA 1HO3A 3M1LA 3RTCA 1JFFA 3TB6A 4DN6A 4G84A 2I8CA 5BURA 1EFKA 1Z45A 3E9QA 3PUKA 1QYWA 2RKOA 2NXWA 2V7BA 4CI9A 4AK9A 4BNWA 2P2GA 3DH0A 5D2CA 3FFXA 4DLBA 2XUPA 4I8IA 3HA7A 1ADJA 3GDGA 5AKXA 1AM4D 1ZVMA 3U7JA 5J4KA 3KPWA 5AESA 2JIOA 3B1VA 2ZLBA 3G0DA 4NYMQ 1IJEA 1I8TA 4JH0A 3ZE1B 4P7KA 5KCZA 3LMKA 3RVQA 3MBIA 4YQFA 3QX8A 1XRPA 1OAOC 1BCRB 1KY4A 1KEEB 1AQ6A 4C14A 5IMBA 4PG4A 1XAIA 3G59A 1F3OA 3G7UA 4HG2A 4D8YA 3TXYA 2PS1A 1CNEA 4WA7A 4Q4CA 4Z7NB 5HP4A 4TV9A 1OXSC 1CJVC 4AJ4A 5CJPA 2XV1A 4J0DA 3NBUA 2IC5A 3QIVA 3Q2IA 5JCXA 3PWZA 1TKAA 3NEYA 1M7HA 1O8BA 4H0FA 4UBLA 3ZI4A 4FFBB 5I9NA 1OAOA 4JUAA 3MJCA 1VSUA 1PZNA 1M5UA 2HSJA 3GARA 5TRTA 3W1WA 5CT5A 4IIUA 1C0KA 4KQHA 3QE2A 4NCNA 2ADFA 4Q7MB 5B1HA 3TUJC 5HBGA 2DHRA 3CRZA 4N0MA 4A4DA 4UFPA 3GP3A 5C7LO 2O1SA 2PX4A 5DULA 2DETA 1P62B 4KUHA 4ZCMA 1PTJA 3GLFE 1MAHA 4PR3A 1JHDA 2VSQA 3D7LA 5IKEA 1OW3B 3I9V6 3A3OA 3WWCA 1UBCA 4TKUB 2X8WA 1JX6A 1NU8A 2XIJA 1DGQA 4IHAA 2IELA 5CVJA 1XUOA 1CLUA 3BQMB 1JKIA 4C29A 3WLJA 4B0OA 3EZFA 4NBVA 3I9MA 2OV4A 3ZVKA 2BH2A 5IHPA 1WE2A 2YY6A 4ZK2A 2I4LA 4FFSA 2QRVA 3RROA 4PZ9A 4BAGA 3T7AA 3F6SA 2KM1A 4R2JA 2EERA 2F3TA 2ASEA 4QNNA 2DT8A 3H04A 1VJDA 4XM0A 4WVFA 3TLYA 4C0WA 2BSQA 2NUAB 1DQRA 1UIRA 5A3RA 1AKQA 1BROA 2WJIA 2WVJA 2C07A 3Q3IA 3GEHA 4OU5A 3E48A 1X7HA 4RVOA 1L3BA 4DJFC 1AZLA 3TRIA 4R0MA 2HU2A 3DMNA 3L1JA 3RU3A 4XQGA 3BC1A 2IHYA 4UU8A 3ICWA 4TSFA 5JCOC 4MDFA 4AKGA 1TYDE 1NDHA 5IDYA 2H52A 3LNCA 5FKJA 3GEMA 4IH4A 3OZFA 2QY6A 3FVTA 1I51A 4JEMA 5KOHB 4DS3A 5K3BA 4TS1A 721PA 3SIPA 1OKKA 4BCBA 3CF6R 1XC7A 1IHYA 2DFDA 2W6OA 1A98A 4IIBA 4M98A 1MP0A 3RU2A 4DCPA 4U7HA 1CR6A 4I3HA 5I7EA 5CBPB 1R0XA 3ETEA 1A5AB 3O8DA 5AK6A 4D25A 4LFBB 1VYTA 1G3IA 1YKFA 2ECKA 2W98A 3A9CA 4JC8A 4X84A 5D3QA 3UK2A 3WMEA 2MTBA 5ARBA 5K0JA 2CHEA 2BUAA 1NBME 1Z37A 2CNKA 5FA5A 1JDNA 3AIMA 1AQJA 5K3AA 3ONFA 3DXFA 1LX6A 4MLPA 2EWWA 4KSBA 2CFTA 2OC4A 4DM3A 1FFYA 1ULZA 1XMVA 4LAFA 1YCDA 4AI6A 4CUJA 2G1AA 4M88A 3PTZA 4JX8A 5EY5B 3WHLA 1A5BB 1C7IA 3ESZA 4BEJA 2ZJ0A 1DP4A 1X2BA 2V7PA 2BJHA 7REQA 3FTFA 4EI8A 4RE5A 5IUJC 3V4RA 3NVMB 5HIAA 3W77A 1VSBA 2X7XA 1MOZA 5F5NA 1YMVA 2VWGA 4NCJA 2WJAA 3G2MA 4Q3NA 4QDXA 4Z4GA 4F9FA 1EM6A 1NJ6A 4NYMR 4QBHA 2PKEA 4MW0A 3S0JA 3DF9A 3IIIA 3D3JA 3DBIA 4IMRA 4U02A 4PYJA 5AFSA 1IY8A 3K94A 4BIIA 5H7XA 1RYMA 1KEZA 5KOYA 2HSGA 3FYUC 1GCGA 1KAMA 4MUYA 4EY8A 4MJ7A 1QX3A 2HKIA 1LLQA 4H18A 5KC8A 1BOOA 1QG0A 2OFOA 3B13B 2GAJA 3KKMA 3MCVA 1A9SA 4L72A 4KV7A 4R7ZA 4UVIA 4Z0HO 4E6EA 4FMBB 1KYXA 1XA0A 3FPEA 1T2EA 3PTLA 3O9MA 4OV6B 4PC7A 4QPCA 3ZDAA 1Z6AA 4ZVRA 5DNWA 1TT7A 1CR1A 1AKMA 1JBQA 4Z4HA 3NH9A 5GVRA 3TIIA 4LHZA 5EGNA 4X3OA 3FSJX 4IZHA 5K2MA 4W7HA 3Q8XB 1ZEJA 2UUOA 4EJ2A 5JWOA 1IHDA 4XGIA 3CF4G 3G1TA 3K09A 3PFGA 5BWMA 3WC4A 1UIMA 1UAAA 3CIOA 5KVCA 4Z2YA 1MW8X 3WKDA 1L4EA 4ARZA 4CZ2A 1SU8A 4MGEA 3GJXC 2Z6AA 2V7WA 3OUTA 2BUCA 2O1EA 1N9ZA 4ZVMA 4JKIA 1BH2A 1H8HA 2HPHA 3O3CA 2AN4A 4RK6A 4RMNA 2MDTA 4YRDA 2EXXA 5FPSA 4NWIA 4B6JA 5ICMA 4JI8B 2VJMB 1NKSA 5GJVC 3PTAA 3LQFA 3TLJA 4NRDA 3FOEC 1R8QA 3MYRA 4RVFA 3IP8A 4RSGA 1MVLA 1KQPA 2OCAA 4G0ZA 2RGRA 3IB6A 4YHHB 1ZL0A 3FNHA 3UYKA 1CFZA 2UDPA 1Q7GA 3DW3X 4E2XA 2QRHA 1CJBA 1N6NA 1PHPA 3MQ2A 4KB5A 4UHCA 1RLMA 4C0JA 1IHPA 2J7PA 3RLIA 5EP3A 1CQXA 3ENKA 1DBSA 4AB1A 4G8DA 3WISA 1ZFNA 4ZYUA 4BJ1A 5DPMA 1CQPA 1U0FA 4EA9A 5IJ9B 1PR5A 2YZ7A 5L4NA 3IAS1 2YKGA 2FK7A 3VXKA 3QU9A 2B2CA 2GVZC 2YWJA 2OHHA 4ZCTA 1EIZA 1VPEA 1QG6A 4IHKA 3DMTA 1U9ZA 4P92A 2JNWA 4J0CA 4RFLA 4D98A 1ESEA 3GLHB 5TPZA 4P53A 4HV4A 4LVNA 2HXSA 3ZNNA 1LDMA 4JGIA 421PA 4C7OA 2IUTA 3EXFB 3SPXA 1R8JA 3PDIA 1JL3A 3IMCA 4RVCA 4S1OA 4YUVA 1QGAA 2VHUA 3IOMA 3JZAA 3SR3A 3PHJA 1IG0A 1NF9A 1TXGA 2L82A 3KSZO 3UF0A 4UTPA 2FSGA 2IW1A 3Q6MA 4HXEB 4BFZA 4RTSA 4C0QC 4H6WA 1Z36A 4OL0A 1U99A 2IDZA 4Y8VA 4TRMA 5FWYB 4WHMA 3RBXA 4DNOA 5CVTA 1TD9A 1Z06A 3PHCA 4MRVA 1I6KA 1ENZA 2EX1A 3AETB 4DUZB 1RKVA 1JU9A 4AJOA 5CEJA 4EARA 3NUZA 2FZCA 3HYRA 1CX9B 1D6SA 1SHZA 5BVGB 4GXQA 4UM9B 4U5XA 1Y9AA 1L0BA 3W9UA 3FTDA 3IHWA 3P5SA 1TDJA 4PHFA 2VP2A 4PCVA 3EHDA 3AFMA 1Y6ZA 4AECA 1I4WA 2R8PA 4BLRA 1X9HA 3DOIA 3HKCA 4S24A 4Q66C 4NU0A 2V96A 4HTAA 1U8EA 3HU2A 2IS2A 3IT1A 4K03A 1UJ4A 2XTAA 2WZQA 4RTQA 3E22A 1EH5A 3D0KA 3HDYA 4WCVA 2NAFA 4RK5A 5I7HA 1QLJA 2OCGA 2YZKA 3OEWA 4N1AA 4EL0A 3ZJTA 5K5EA 3F47A 1TJ4A 1PHRA 3JZIA 3FIUA 4N49A 3SEQA 3H84A 1HE3A 3LBFA 4RWEA 1IONA 4UU1A 5KPDA 4U6SA 1Y98A 3LUDA 5KWSA 3V7YA 1JZTA 2GEJA 2C3PA 4H7HA 1NVWQ 2H31A 2PL9A 3GAFA 2DSNA 2IY7A 1UPCA 1RLOA 2E89A 4GQBA 3U0BA 1BQ3A 3CBQA 4IXNA 3WRWA 5JAIA 2BI4A 3HUUA 3WLRA 1GLNA 2CW5A 3N5KA 4K0RA 2R66A 3E9EA 1FFGA 1B6GA 4TSFD 2DT5A 2QQ0A 3C3BA 2FSHA 4LKRA 1VI5A 1JFLA 1U2ZA 3COWA 4MMYB 2H51A 1OLUA 2ZJ2A 3IP9A 4LVCA 3OJ0A 2ZJBA 4Y98A 3TI9A 4W5NA 2ZUFA 3GJZA 1CZRA 4QICA 5THKA 1H2XA 4LEIA 3Q12A 5KKCA 4G5GA 5KJFA 2P1DA 1F4PA 3D02A 4HYYA 1NVXQ 3BL6A 4KQWA 5H70A 4BBZA 4CV2A 3DDSA 1D5CA 3T12A 4LJ9A 3GRZA 4HN9A 2VHXA 2ZIXA 3EFOB 3GAZA 4PSVA 1V9CA 4WZAB 2XZPA 3QYFA 4NHEA 1N2XA 2IE0A 4WZAA 4FM9A 3BS4A 3IQHX 1DAEA 1VE7A 4UUNA 4M0KA 3NCHA 4G0NA 2EFYA 2AG1A 5KQPA 4UBIA 1JFSA 3H97A 4Q39A 4RCVA 1NULA 3OE7D 4FHZA 1UDBA 4UTOA 1NQUA 1M2NA 1TQ6A 2AYYA 2E1RA 2FWNA 2KJQA 4PSDA 4PQFA 1IPHA 2VQFB 1LS6A 4IJVA 4D9GA 1NIPA 4F2HA 2VPPA 3FTEA 4OMFG 2R3SA 4D56A 2NLOA 3RK1A 3C3EA 3MT9A 1XZEA 4ENPA 2OCPA 3K9LA 4I6GA 2Q5EA 3NVDA 5HZGA 4NJMB 4UEOA 1SQ5A 1DKPA 4D9NA 2C42A 1B6RA 4J7XA 2AFHA 1CZHA 2FPIA 4BO5A 2H9AA 3BTSA 3LHSA 4AG5A 4OYHA 2NU8A 1RJEA 3DB2A 4Q4DA 3EUAA 4FSDA 2HPAA 5JD5A 4YCAA 4JP1A 4B3FX 1P75A 3GGCA 4I4TB 4H0CA 3TRJA 4XKJA 4TTQA 5B58C 3UMYA 2D7DA 2G06A 4Y30A 1OILA 4JQOA 3SQLA 4EEXA 1CUGA 4I1RA 4C2AA 5TPZD 4ZOAA 1V8DA 2P9FA 4ONEA 2FSSA 2WMOB 4ENUA 2IXGA 3O47A 1DAKA 3AF6A 4GEKA 3FPJA 2JA1A 4FINA 4NLLA 4MSUA 4CDMA 1H0RA 1FXWA 5KNBD 3ELUA 4Z4IA 3H9CA 4UCFA 5ER6A 3DLAA 4LMRA 1GCOA 1L7XA 2C1EA 1X74A 2CZCA 2OQ2A 4QODA 5B3JA 1R4NA 2IZ0A 4MLCA 2WI8A 4FUTA 2XGMA 3ZVLA 4WT7A 1LBHA 3X1JA 2B7BA 3OF2A 3IESA 3UUGA 3NBMA 1KMHA 1NW5A 3AUSA 3HHPA 1NI4A 3T5BA 3EX7C 3QEOA 1ZJZA 1L6IA 4QDJA 1S3GA 1WMAA 3CS3A 3JWJA 5DSZA 1Q1BA 1YBMA 2R751 5HJEA 5JSYA 3T9FA 1HNZB 1R0RE 3R7WA 5CX4A 4N8EA 4PYIA 3HBNA 4TQAA 1NJSA 3GOQA 1ULHA 3OFNA 4ASUD 2B69A 3OLXA 4MQ5A 4DIKA 1LFDB 1Y48E 3CTMA 3FAKA 1MJFA 3MLAA 1DBIA 4R1LA 4ODIA 1XD9A 1GUFA 4JI6B 4EY7A 1O54A 4BFXA 2ZVQX 1XJ5A 2VP3A 1J0BA 2RHGB 3LBHA 1U7TA 1LRKA 3N9IA 1A9XA 1GA6A 3M82A 1RYDA 3LP8A 1HTWA 1O95A 2M98A 2O6HA 1TO2E 4M86A 1WUHS 4BMSA 5FOQA 2ST1A 2J0UA 4Y2RA 1RM5A 4DTCA 4DSTA 1VDZA 1GD1O 1UJMA 3ICPA 1JA1A 1U31A 2P77A 2EFEB 3LZDA 4P7GA 4Y2HA 3AESA 1TE2A 4XTCS 3WL3A 2VC2B 1AOXA 1KVSA 1ODIA 2GGSA 1D09A 2VDRB 3P2JA 2BHRA 5D5HA 3S1AA 4DV3B 4GP7A 4PSCA 4RA9B 1NBAA 3D3EA 4J2OA 1VJGA 2OOKA 3LHIA 3OX2A 4G89A 5L6MB 3JVUA 3DPIA 1Z35A 1MPTA 3QXHA 1JPJA 2HZBA 2WE7A 3IALA 4N0PA 2GPWA 1MT3A 1LI4A 3HZRA 3LUPA 4AROA 3GFRA 3NWEA 3QNMA 2H7VA 3GRUA 2OTCA 4RV4A 5EA2A 2FQXA 2CVPA 4H4EA 3QLVA 5B1DA 3W6UA 1C3OA 1DAFA 2EP5A 4HDKB 4KI7A 5K0NA 3TNLA 4ZEMA 1P39A 2IYYA 4DEVA 4N39A 5I9LA 1YR3A 3RRZA 2QTVA 4RK7A 1ZOLA 1WHSB 3FETA 3WTBA 2DPXA 2Q46A 2OFXA 5EJ4A 2P8JA 2I03A 2BFDA 2RB5A 3A1WA 3SX2A 2PKQO 2BM0A 2GD0A 4MKGA 3G5TA 3LBIA 4X65B 4RS4A 4POAA 1RTKA 3BHNA 4M0UA 1KIFA 1EHYA 1Q19A 2QMEA 2V3CC 1CEQA 1O08A 3D7KA 1F12A 1KHTA 4MRSA 1Z08A 5LKRA 1X39A 3P2OA 3OX3A 3QH4A 4FB5A 1T3GA 2B8NA 3QHPA 1FS4A 3DE6X 5IM4A 3H11B 3LQQA 1Q1EA 4W5OA 2ENUA 4OL9A 4N5MA 1BMFA 2A9FA 2GNAA 2CWDA 1J7JA 2Q2NA 1CULC 1V8ZA 5E4JA 1JF8A 1LGYA 3PZBA 1QFSA 4U9UA 2Y1FA 5A7HA 3FYTA 5AWFC 3OLZA 4KW7A 4LJ8A 1G98A 2Y0DA 4O4HF 1QRTA 1R5BA 3IB3A 3SQMA 3LU1A 3OPNA 3HRHA 4RK0A 3EVDA 4M3NA 4XXHA 3GJTA 1Y5RA 4OHPA 4Q1CA 4WEOA 1MX3A 3AF1A 3E9RA 3KYJB 4YCSA 1DJPA 3R0VA 3ZWCA 5BSMA 4MVYA 3BHJA 4D0LB 3INGA 4BO4A 1K97A 3Q7SA 4U3JA 4GI3A 4RD4A 5FOUA 3CPHA 3HJTA 3RIEA 2GRAA 1CZNA 2PXAA 1Z2CA 4PF1A 3SFVA 3T95A 3W2TA 3WNDA 4NNJA 3OOJA 2W8BB 2ZB2A 4IIDA 1WUTA 3CJRA 1GRCA 1SUBA 4CGYA 3ADKA 3Q3VA 4MRMA 3UTCA 2UYYA 5F1KA 4Z4EA 1G8PA 5KTKA 3K35A 3OZIA 3PDWA 4FJ1A 5IH7A 1YS9A 1Y8AA 3B6KA 1BWRA 2QG4A 1KAHA 3GEBA 5JDCC 3WV4A 1XB2A 4PLVA 3ZHRA 4ZU3A 4YCNA 1EG7A 2AJ8A 1D9ZA 1KO5A 1XNHA 2YV5A 2JIBA 3A14A 3FWHA 2W93A 3DFFA 4N5DA 3RT1A 1CD5A 5AI0A 3ZQJA 4B6FA 3ZU4A 1P4AA 4ZZ1A 1E4VA 4KWTA 1H6DA 2BPOA 2HK7A 4A73A 4DMLA 1RZRD 2F8SA 3E35A 3B3AA 4JHLA 2GCNA 3RYHA 3N2LA 1DDGA 1NONA 4OQLA 3V4LA 4XDZA 1QS0B 2BMDA 3A1UA 4KLRA 1VGVA 4Y9DA 3ZVMA 1N92A 5AW4A 3MHTA 1CVIA 1V1JA 4NCKA 1S9DA 2GXUA 1EGAA 4C87A 2V3VA 1QH0A 1EUQA 3IDQA 4RJJA 5H83A 3GH1A 4EYEA 4AJLA 1HBJA 4KC0A 4QYIB 4OI1A 1X3LA 4B4OA 4DIUA 3DV0A 2WSSA 3IIEA 1BJRE 1VP3A 2XMCA 5GOTA 3T0GA 2IYZA 3SBDA 4EHBA 1GJRA 2FLVA 4R8SA 3UM9A 5BVHB 1WBDA 3FM9A 5IK2D 1DG9A 1FNCA 1O9GA 1YJ5A 4E4TA 5EINA 2XH8A 2XQJA 5A04A 2BY4A 2WPNA 3L40A 1FTGA 1BNCA 3TGWA 3WBJA 3MFYA 1NGSA 3PQ5A 1KQFA 1R9MA 3SS8A 3S2YA 3HFSA 3ONDA 2YVQA 4FHEA 3HJNA 1N7JA 4L8WB 1QRUA 4HH3C 4FCTA 3AG6A 1JQBA 1IXRC 4P7BA 1H2FA 2WRZA 1KNXA 2NVOA 3VHRA 2O1XA 4D57A 2Q1YA 4DDUA 3DE4X 4K26A 1I3MA 1ONBA 2FSIA 1Q3KA 2GYYA 3C16C 3IQWA 3KR9A 4IIJA 4DREA 2XTZA 1S02A 4JR1A 1IY0A 1FFWA 1GNTA 4IJKA 2QT9A 2A8YA 5JJIA 1YTLA 4QQFA 2HQSA 1Q83A 4KQXA 2H2GA 3HCWA 2WICA 4CV0A 1JXOA 4FI3C 1ODCA 4Q4JA 1D4AA 3NTLA 3N7AA 1P0CA 2C2WA 5A02A 5BSFA 2QL5A 4BB5A 5EIBD 2ZAOA 4H7JA 4HOYA 2BHNA 4UQLA 4RLHA 1U81A 2D8AA 2CD7A 3NJRA 3QBTA 4O4LF 2NU6A 5A62A 2IEBA 1K75A 4ND8B 4CFSA 2G09A 4M9XA 1L4MA 1KRXA 1LRJA 1SUCA 3LO8A 2JGAA 3PUJA 4BFVA 2C58A 2V97A 3C5WP 3FDFA 3KCQA 4MYHA 4RLQA 3MZ0A 4JUIA 3HDGA 3L7OA 2VT6A 3H2GA 1P4RA 1JDBC 2Q49A 1QE5A 5HYVA 3M2PA 3GA7A 4ZDJA 2H16A 4I19A 1WOMA 3L01A 2R1TB 4IX9A 1XZKA 2HJ9A 3EULA 2GBPA 4WFKA 2J3JA 3N87A 1OVMA 3GA5A 2JGLA 3Q9SA 1P1IA 1EVQA 1XP8A 1DFIA 5IH3A 3OE7A 2NPFA 2PH1A 2OD2A 4JLVA 2JFQA 4E2WA 2XNKA 1Q7RA 1HETA 1BD4A 3LJKA 2HA3A 1TI7A 3L4SO 4HEA1 3HM2A 4L5IA 3W4KA 2GM3A 3DE5X 4EG3A 1CRLA 1VCNA 4WLNA 1JB1A 5L8VA 1GXSB 2IHJA 2I7CA 2YV1A 3JVEA 2AZTA 4OEHA 1F60A 1M6VA 1YZVA 1IZ8A 3HUTA 3K0AA 1IEWA 4WDQA 5EJ2A 1NW7A 1EKXA 1QZZA 1KFBB 2C00A 3D6FA 1Q92A 4GM0A 1FBNA 2BBOA 1Y81A 2PT7A 5DTJA 3AVXA 3N0VA 2VPYA 1W93A 1I1OA 2VUSA 1GZ7A 1PQWA 3HB4X 4ZALA 2CYCA 4P93A 2IBSA 3NXKA 5DVZA 1C3VA 4OBWA 5B3KA 2JI8A 1C9EA 1GUAA 3CWZA 2GCGA 3C74A 3PHGA 1X1QA 3WB2A 1MT0A 5CYFA 4JIGA 4QOEA 1FJXA 1GL9B 1EJ6A 1HQKA 2GZ3A 3HR7A 4O2BF 1E1LA 4F7WA 2X3UA 2ZU6A 3DLTA 4QIHA 2O2YA 1W5FA 2V98A 2GPSA 3D8BA 2ID8A 1GZVA 2ILVA 1A7AA 2WUVA 4O4HA 2GXAA 1I6WA 3H99A 3MERA 2B94A 2D74A 4OPMA 3ZLBA 2FR1A 4RULA 4K2HA 3WSWA 4LYJA 4RQTA 1VGRA 2ZQ5A 1S2GA 4LJSA 4E15A 1OI4A 3T3NA 4KUEA 2FWRA 3KT3A 4EUFA 1NP3A 1XZCA 2QU7A 4JEIA 4MUAA 3ZIDA 3VKGA 1F38A 3GA0A 3IEVA 4FEAA 2W48A 4AP5A 4WZ6A 4URYR 1U0LA 4KN6A 2J31A 2JBAB 4X63A 1DC6A 2ES4A 4MVJI 3R5JA 5DXAA 5GADl 4NH4A 1WB5A 3ZQKA 1Q57A 3FTCA 1XQVA 2HJGA 1VG8A 4V0SA 3H83A 1SVLA 2VJBA 3FSEA 4IUYA 4S35A 5BN5B 4BVLA 4EB6A 1OXUA 4UMFA 4LFAB 1ONPA 1E3DA 2YWCA 1EGVB 5ITWA 2FF7A 1JZSA 1S8FA 3IT0A 4BO6A 2B1IA 2VCYA 4ZP1A 1UOQA 3GMTA 2QLFA 3LG2A 3CSDA 5E7IA 2AC4A 2Y4OA 1HNXB 3P9RA 3E5HA 2VFAA 2DTEA 3P0HA 2BGTA 4JITA 2R0QC 2WNIA 3KKQA 5AJUA 1COZA 4RKEA 4KACA 3RG2A 4I50A 2Q9BA 2DJ5A 3PIRA 3CC8A 2F67A 1E8NA 5DK6A 1J2RA 1RWOA 1ZXXA 2FPKA 1DDOA 4ENTA 2V59A 1RI5A 4ARSA 1Y7HA 5EMMA 1YXMA 3PQCA 1XLUA 4CLRA 3C2QA 4Y67A 1EVLA 2PTGA 3A32A 4MS3B 1U0GA 1UZUA 4MWBA 4UFOA 2YFQA 2HGZA 3JATB 3U26A 1S1CA 3KQPA 4WINA 4E5PA 1OU0A 3LK7A 2JC3A 4KXLA 3C3AA 5DBHX 3SZ3A 3ANSA 1XVAA 3HZHA 5K8LA 4XOUA 1AKNA 3MLEA 3QA3E 3VAAA 4B3XA 2BWJA 1DC8A 4ND2A 4J3FA 1RQ7A 4BC0A 2IT1A 1Z82A 5GZ6A 4XWGA 2NG1A 3HCPA 1YDGA 3URKA 1BD3A 1X42A 3DA8A 1NIJA 2GZ2A 1VYVA 2XT0A 2VLIA 5IBQA 5CFMA 3FPAA 4JBHA 4C2TA 1P7ZA 1B41A 1G1AA 2BR5A 2FZLA 2X7HA 2YIJA 3E7PA 1DOAA 2DBZA 3LA8A 4I9HA 4QREA 1JIUA 4TTVA 4TYMA 2Q8PA 4IILA 1W49A 2ZS9A 2IYOA 2OK7A 2PGIA 4P4GA 4BQNA 4CMEA 4BXOB 3NHUA 1PK9A 2JCSA 4C4OA 5H02A 1FSFA 3QWAA 5CTJA 2ZTUA 3DOHA 1JWLA 2QAJA 2GZHA 3KE8A 5FADA 3W6NA 4RY8A 1A04A 2Q6TA 5EKUA 3GLGB 4QUEA 2Q2WA 3AMVA 2BKUA 1Y3HA 2YIDA 1G0NA 1PFVA 3KZOA 4HB2A 4BRWA 2X6TA 4LVUA 2REQB 5EXXA 4E5KA 3INTA 3PJGA 3R0JA 2QR3A 4ZAVA 2XB8A 1R0SA 1U2DC 4OU4A 5TARA 3NATA 3W2IA 5K3EA 2PSFA 2R60A 1GGKA 3OMLA 4GMKA 1BMTA 2CLHB 2NW6A 3DV0B 3F96A 1V1RB 2P3OA 4HWTA 1E4OA 2I6QA 3B9BA 5CA0B 3SYLA 1DE0A 4KLCA 4CMIB 2Q62A 3FNQA 3IODA 5DYGA 1QHHB 3OZGA 1XDSA 3TPZA 4YAGA 1BMFD 1U7WA 3WB9A 4W5QA 1A1VA 3E4CA 3F2IA 2N46A 4KWEA 2W42A 1E1CA 1PR3A 2B6NA 1UT8A 5AJVB 3WLFA 1QIDA 1N36B 1IWBB 2YJ6A 1CUBA 2QTHA 3AUFA 4CM6A 2N1BA 3BRWA 3F3KA 5KVAA 1ECJA 1JPNA 1VMIA 2BFNA 1O89A 2NTVA 2WYHA 5C4GB 1ZWLA 3NBYC 2H1OA 1ZH6A 4LXUA 3CTPA 5I7UA 4O4LA 2A57A 3V1YA 3O91A 1NVMB 2ZJOA 4IV8A 4OJQA 1W0JD 3VC2A 3WKBA 2BGGA 4BEBA 1PJ2A 5DLQC 1E9DA 4MB0A 2M1ZA 1SC3A 4URHA 1E60A 4BVGA 5KIAA 2ZJ1A 1E0DA 4CKYA 2RARA 1K9VF 1TA0A 2FMHA 4KE7A 1TQ8A 4MPDA 4OYRA 4TWIA 3Q3EA 3K8OE 3WB0A 3A10A 5IN5A 3H75A 1XZNA 1YHNA 3KKNA 3SDZA 5EZQA 3WVNA 5TEWA 3W06A 4YP9A 4O5AA 4O4IF 1CF4A 1K7SN 3R41A 3SQWA 2H0QA 4C88A 4C0BA 3NYQA 4NR0A 1SC4A 1JDVA 1V45E 3KB8A 1YR9A 2BKXA 2AZ4A 3LLVA 2GX6A 4UE3S 3DDNA 1KQ3A 2O3RA 1N6OA 2ZB3A 4FX2A 5HBRA 3NC4A 1QWOA 3PEFA 1AKWA 1HMPA 1IE3A 1COWA 1GPNA 2J07A 2ODPA 3OPQA 5CD1A 4B32A 3UEOA 3UJ9A 2I4RA 2Q07A 3ZTTA 1U8CB 2WIFA 2X4GA 3ID6C 4NYJQ 4QT4A 2XTJA 1FNMA 5C8YF 1M1XB 4AMGA 1W36B 4KO2S 4D4GA 1H22A 3AJ8A 3CZ5A 3TAXA 2WUGA 2LV8A 4M6WA 4E5DA 1RSZA 3FMOB 1PQUA 2AG0A 4NZNA 1OTXA 3Q2OA 2YWDA 4FNGA 5JW6A 2A1IA 5LLSA 4HX5A 3IMEA 1JR3D 4JJ7A 1MQSA 3KSAC 1VLLA 3LUKA 4U9IS 3NHAA 4NJOA 4BTLA 2CN1A 1IJBA 3UHJA 3NHYA 4UFNA 4I6JA 2IP4A 2WT4A 4WY2A 9ABPA 4J1NA 3QXGA 3GDOA 4AKHA 1AH2A 2C84A 3AH8A 1ID8A 2VWPA 1ZJ4A 4PG8A 2BMFA 1PO7A 2EKBA 3C98A 2WP0A 3KYDB 3SF0A 4X41A 4KPEC 2HGSA 2ZBRA 4GMGA 4W1PA 1JUDA 3THYA 2WWFA 4HCJA 2YYYA 1NA5A 1LSOA 1Z39A 3R6LA 4JS0A 2JGEA 3DT9A 1SQGA 3FRJA 3KDSE 1E3JA 4OIFA 1E2DA 1WXDA 2AWNA 3JYHA 4FMDF 4NQZA 3THSA 1JG6A 4WXYB 4IMIB 3PDHA 1POWA 5CCBA 4K40A 3WJ7A 1N5OX 1VRCA 2N0SA 4MVXA 3JQFC 2YS6A 2BEVA 3M1IA 5LQNA 1US8A 4WFJA 5G4KA 1AB6A 2ATXA 3G79A 1F20A 4KOEC 4A8PA 3OD5A 4AO8A 5HTOA 3H65A 2A7QA 2NV2B 3PCXA 2Q8NA 3TS1A 1U7OA 1WB4A 3VZBA 2H3HA 1EX1A 4GFDA 4PFSA 4RE6A 3RSGA 1CP3A 3BMOA 3H3XA 4KYUA 4N12A 1A8IA 2YJGA 3KYCA 1BN6A 2Y68A 4ZQCB 5ALKA 2O8DA 3HB5X 5DGCA 1LY1A 4KG7A 4YUAA 3COJA 3TFQA 4F38A 3HH8A 1ZAKA 3FUXA 5CXSA 1K88A 5EKXA 4B4DA 2QW0X 4KN9S 2OG1A 3GR6A 3OCCA 4YJ2B 5J2UF 4M1YA 1GRVA 1Z5GA 3T61A 4BKOA 2G17A 2JW5A 1SBZA 1P6QA 1XVVA 4AWXA 5HKLA 4KQFA 3L84A 3IA7A 4W63A 3G8AA 1PWEA 4ESVA 1B0UA 3DPSA 4ZPJA 3WIOA 2QVGA 1JQ3A 3JWHA 4MYUA 2UXDB 2NO7A 4RIHA 2QRZA 1E5XA 1QMPA 4CU2A 1KAQA 3I6QA 4FU0A 4GQIA 2YXLA 3T5AA 1P19A 4OLAA 1E3SA 1YQEA 4ZO9A 4F8EA 5CAEB 1G5QA