2O2GA

Crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
216
Chain Sequence
HQPQEYAVSVSVGEVKLKGNLVIPNGATGIVLFAHGSGSSRYSPRNRYVAEVLQQAGLATLLIDLLTQEEEEIDLRTRHLRFDIGLLASRLVGATDWLTHNPDTQHLKVGYFGASTGGGAALVAAAERPETVQAVVSRGGRPDLAPSALPHVKAPTLLIVGGYDLPVIAMNEDALEQLQTSKRLVIIPRASHLFEEPGALTAVAQLASEWFMHYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dienelactone hydrolase
publication title Crystal structure of Dienelactone hydrolase (YP_324580.1) from Anabaena variabilis ATCC 29413 at 1.92 A resolution
rcsb
source organism Anabaena variabilis
molecule tags Hydrolase
total genus 71
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o2gA00
3AFIA 2AXEA 2ZVDA 3OPMA 1WB5A 4PSUA 5DNVA 1RYYA 2VQ6A 3CXUA 1UKCA 1WHSA 2VATA 3WWOA 4YPVA 4P08A 3LIPA 2FX5A 2XUPA 1BN7A 3AIMA 2HA2A 1ZD5A 2B20A 4UFNA 5EFZA 4BP8A 5DTIA 2QTBA 3GELA 4GEGA 5HZGA 1MX5A 2XB6A 4C4XA 4OCZA 4NMWA 3ZI7A 4FLFA 3STVA 2PBLA 4X95A 5C7YA 1JU3A 1WPRA 3QMWA 4PW0A 3OC0A 4LHEA 4G8BA 3G0CA 4P93A 4ZI5A 4GW3A 3EQ8A 4AQDA 5AM0A 2IX9A 4EY8A 3F98A 1CLEA 2PSEA 3UMJA 2BKLA 5A7GA 3HYSA 1DWPA 4H7DA 4CIAA 1B6GA 5ALEA 3PE6A 4UHEA 2ZYIA 4BRSA 3DD5A 1XRQA 3STYA 4WDRA 1DQYA 3TEJA 4DIUA 5AOCA 2FUKA 4UHFA 3JWEA 1C7JA 3ICWA 3WMRA 4DSAA 4Y2RA 4U2CA 5AKKA 1FSSA 1IUNA 2PX6A 1F0NA 4MXDA 5IH7A 5CT6A 2PVSA 2OAGA 1FFCA 1WPXA 3FWHA 1VXOA 2QJWA 2PU7A 3O95A 1K8QA 2VT7A 2WLSA 4EBBA 1EA5A 1J1IA 1HPLA 3BF8A 1O6GA 1A8SA 3FLEA 5JD4A 4XIIA 1EDBA 5DLPA 2H9YA 3W2TA 3G0GA 3SC2A 4PSCA 2WU4A 4L3WA 4X97A 5K3FA 4I19A 3MUNA 3RM3A 2VSQA 3K9BA 3RKSA 1T4MA 4CG3A 2WJ4A 5K3FB 2HA5A 5ALZA 4F0JA 1R88A 3PF8A 4QA9A 5CW2A 3DKRA 5JARA 3G0BA 1CIJA 5IKXA 3PFCA 1R3DA 2BUCA 3QH4A 5FLKA 4AMZA 4AZ0A 1XZHA 4ETWA 4GLBA 1EVQA 5LKRA 5AKXA 4OB6A 4Q3KA 3GA7A 1GKKA 4D9JA 1WB4A 3H2IA 3QMVA 1U4NA 4WFIA 5FXMA 3R40A 2HIHA 5F4ZA 3QMMA 4X6YA 1CUAA 3FOBA 1UOQA 1ETHA 5HKAA 2RONA 3X3HA 2GBCA 3G9XA 3WKCA 2JEYA 5E4TA 1M33A 3H2JA 1VZ3A 3FLAA 1XQYA 4BZZA 1MU0A 4UHBA 3G0DA 4MWSA 2B61A 1XQVA 2XQKA 3MGAA 2VJAA 2XUFA 3BJMA 3B5EA 4LXGA 3H1AA 1UXOA 2H7XA 3Q0TA 4BVKA 1TIBA 1N5RA 3PI6A 5C81A 1R9MA 4LIPD 2BAGA 3QITA 5I9IA 2WILA 4EHBA 3PUHA 1B41A 1VA4A 1MJ5A 5T4HA 4IH1A 2GZSA 3FLBA 2OPHA 3H04A 4X85A 3WL5A 5ALDA 5JD5A 2JEZA 4LYDA 3ZPXA 3KXPA 5HQ3A 2DHEA 4C4YA 1A8UA 1UOPA 1Q0ZA 5HQ3B 1UK6A 1EB8A 2XMDA 1J2EA 1W52X 4WY8A 1AC5A 2XMRA 3HZOA 1EK1A 3R3YA 4FKBA 4DYHA 4FWBA 4G4IA 1QIDA 3ESCA 5AKEA 3UUFA 4BAUA 3NUZA 4N5IX 1R9NA 3D3NA 1KEZA 4ARAA 1ZD4A 5AI4A 3IIIA 1LPMA 2XMQA 3FCYA 2CUTA 1YS2X 3H0CA 3D2CA 4W63A 1NX9A 7YASA 4BVLA 4MYSA 2HRRA 4RGYA 2C5GA 3R3WA 5ALKA 1XZAA 5KBYA 5HK8A 4Y2VA 4XVCA 1MX9A 5I8PA 5I7UA 4O08A 4UBJA 5KWIA 1LZKA 3I2GA 4BE9A 2HFJA 5ALJA 5ALQA 3QZUA 4C87A 1VE7A 1Y7HA 5AKIA 1YB6A 3T52A 1W4LA 5HCUA 3DEAA 4E46A 1SCQA 2R8BA 1XZDA 1UFOA 2WG2A 2HU7A 3D7RA 2Z8XA 4TVKA 5ALPA 4HAIA 1JFRA 4JEIA 1VZ2A 4I3FA 5A2GA 1QIMA 1USWA 4C01A 1IUPA 3OG9A 2JGLA 2QXTA 3ANSA 3ANTA 1E8MA 3DDUA 1SOMA 4QDOA 4RE5A 2W6CX 1HDEA 1F6WA 5ALXA 2CZQA 1VKHA 1YASA 2I03A 1H2ZA 1W1IA 4G4JA 3WLAA 2OCGA 3WL6A 1UOOA 4G9GA 4QNNA 3I6YA 1CUZA 4B83A 3R3UA 3B3QA 3WWPA 4J0CA 1LPNA 4GBGA 4Y2YA 2J3QA 3R3VA 3DL7A 4KAJA 3ESDA 4JUIA 1R4ZA 4U2DA 1CUEA 3GFFA 2ZJFA 3FNBA 3DOHA 3WIBA 3A6ZA 5T4EA 4FMPA 1PV1A 4UBMA 1ODTC 4Y9SA 3HC7A 4L72A 3QM1A 2O2HA 3D4LA 3M83A 2XUIA 4W1PA 3FAKA 2GYWA 4K6HA 4GI1A 1GGVA 2ZSIA 3H1BA 5ALRA 3FVRA 1WCYA 3WJ2A 2RAUA 2H7CA 1TCAA 5ISMA 1Q0RA 3D59A 1RWQA 1CUHA 3STXA 2DQZA 2HL6A 4OB8A 5CBKA 3DYVA 4B9EA 4G1FA 1BEEA 4B84A 4OSEA 5AIBA 1XZIA 2WIFA 1XRNA 1YAJA 4OU5A 5IVDA 3M81A 2OGSA 3BF7A 3DQZA 4CIBA 2PSHA 3BE8A 4UBKA 4IHAA 3VDXA 1LBTA 1SC9A 4KYVA 5HF6A 3LIIA 4EA6A 4K6KA 3GUUA 2GBIA 1RP1A 4H7HA 2E3JA 3D2BA 5EHXA 2OG1A 3IVMA 2YYSA 1MNAA 1TAHA 5AJHA 1X2BA 2RIPA 2WUEA 4UBNA 4G9EA 1G5FA 1XZLA 1X2EA 1VXRA 5T4FA 1QLWA 2DHDA 4A5SA 5JATA 3V9AA 2DHCA 2ZYSA 4W1QA 1H2YA 2WUFA 3WK7A 4GDMA 5H3HA 5A71A 4MEAA 1CUVA 3WKBA 4OU4A 3IUNA 5FP0A 3H18A 4OUKX 3VVLA 1NU8A 2WJ6A 4DMFA 5DJ5A 2WFLA 5LZ7A 3NGMA 3AZQA 3QVMA 2WU3A 4HRYA 2HA0A 2WFLB 1UZAA 1EK2A 3A2MA 3F9CA 1CR6A 4IH4A 4EY7A 5AOAA 3I2FA 2B4KA 5ALIA 2Q0XA 2Y6VA 1DWQA 1N1MA 1QTRA 1E8DA 2C4HA 4F21A 2VF2A 1AURA 1I6WA 2EDCA 1C7IA 2XMSA 2XLBA 4W1SA 4DMHA 1XZGA 3NWOA 2QXUA 4UBOA 1ZOIA 4X93A 1UKBA 1AX9A 3LS2A 5AK3A 4M0FA 3SX4A 2Y1KA 1F8UA 4FLMA 1X70A 5JZBA 4FNMA 1S8OA 3E0XA 1BCSA 5CT5A 1ZJ4A 3KOOA 1Y37A 5AM3A 5LP1A 3TRDA 1UWCA 2XDWA 4JNCA 3K2IA 2HA6A 2OGTA 3G8YA 3DKKA 5AKZA 1THGA 2XUKA 3I6MA 4ZXFA 1Z68A 1SCIA 5IVKA 1AZWA 4N8DA 5IVIA 1QIJA 4X71A 5SYMA 4QLOA 2WSLA 5BOVA 1OILA 1AKNA 4Q3LA 4IH9A 2HFKA 4QDUA 5A6VA 2VTVA 5DYTA 1DT3A 4AZ3A 5FDFA 2EDAA 5BV7A 3FYUA 3SK0A 3CN7A 2D0DA 2Z5GA 4BVJA 4WY5A 2JGJA 4FDMA 5KWJA 5ALMA 2G4LA 3FYUB 2G5PA 2DFPA 3AZPA 1HLGA 1QO7A 4J0HA 4A23A 1H23A 4HXEB 1ZGBA 3HSSA 5AO9A 5YASA 2O2GA 1EDEA 1W6RA 2XUAA 4DNQA 5AKJA 5HF9A 4BAZA 1WB6A 4LYEA 5AM2A 3FYTA 3WYNA 2XT0A 1MAHA 3VKFA 2WM2A 2CMFA 4LXHA 4BC1A 1GKLA 1ZICA 2WTNA 1E5TA 1CUYA 4P9NA 3HI4A 1VE6A 1U8EA 3PDCA 1K4YA 4Y2JA 2OGZA 1IZ7A 2NW6A 3AIKA 4BYMA 4WDQA 1BRTA 1CQZA 3AILA 3FSGA 3VVMA 4DM7A 4H7KA 2CBGA 2HA7A 1L7AA 3GZJA 3ED1A 4B9AA 2PUJA 3WK5A 3W9UA 1XRPA 1IMJA 1CEXA 3P2MA 1XFDA 1WM1A 5A7HA 3WZLA 5JZSA 1XQWA 2J4FA 1YA4A 2ECFA 5HF8A 1MO2A 4MQMA 4XJVA 4J0IA 2AJDA 5LZ5A 1FFAA 2GYVA 4DMCA 4S0XA 4BAGA 1GT6A 3JYHA 1JT2A 1THTA 4J03A 2ACKA 4HZGA 5CH3A 5AHXA 1BEZA 5D3KA 4KE6A 3EIOA 1E8NA 3M3DA 1XLUA 1JMYA 4L9AA 4BDTA 2PSDA 4OYYA 2C0QA 2XMCA 3STWA 1LPPA 2ZYHA 4INZA 1QE3A 4WCVA 1A88A 4RPCA 1UT6A 4BRZA 3WK9A 4YASA 3BXPA 2WKWA 2JGMA 2I78A 1PJAA 3C8HA 1GQSA 4Y2QA 5JAHA 4DNFA 4PV7A 3KWJA 4PSDA 1XZMA 2JGKA 4ZREA 3EF3A 2OCLA 1ZI9A 2ZSHA 4Q3OA 4JYMA 2XUHA 4BATA 1UK7A 1XLWA 4J0JA 1EXWA 4RE6A 2B9VA 1XZEA 2HU8A 5ALGA 1YAHA 4P92A 3STTA 5LIPA 2ZJ6A 3BDIA 2OQVA 4DNPA 4EY4A 5T4BA 1CUFA 4PQEA 4U2GA 2Y2VA 5ALNA 3A2NA 2Y2UA 4AO8A 1DQZA 3E3AA 2BJHA 2RHWA 5FRDA 2OAEA 1G42A 5D3ZA 4E11A 2QRUA 2HM7A 5IVHA 4X94A 4XWGA 2HDWA 5AM5A 1DWOA 4IQ4A 4TGLA 3K6KA 4UBLA 4U2BA 2YH2A 2C0PA 3WWEA 1C4XA 3ZWQA 2PL5A 5ALOA 1CRLA 2WIDA 2YXPX 4AMYA 3STUA 4B85A 1QZ3A 3C6BA 1QFSA 3VJLA 5LLSA 1TCBA 4NZZA 4B80A 1FJ2A 5CT4A 3O0DA 4DLNA 2P8SA 3DL4A 5JAOA 1JMKC 1KU0A 2UZ0A 4G5XA 1YSCA 3O4JA 3OTQA 3FVTA 2VJBA 4UBIA 4UFPA 4QWWA 4BCBA 3DYIA 4UFOA 3GROA 2XUDA 1CUXA 3AIOA 3KDAA 3KD2A 3EBLA 1JU4A 1ZGCA 3A70A 1A7UA 3QBJA 4H7EA 3QYJA 4BB0A 3G9TA 4CG1A 3IULA 5AICA 4LXIA 1CUCA 5CMLA 1CUDA 4E15A 2Z8ZA 3WK8A 1LPSA 2HA4A 5DTJA 3UUEA 3DS8A 3CN9A 1HQDA 3V1KA 5JYCA 4AN1A 5AM4A 1GXSA 2Z3ZA 1DX4A 3ILSA 1CUIA 3IUQA 2WTMA 2JGEA 1XLVA 3WWDA 4FFWA 5AI0A 2XQFA 1EB9A 5CRIA 5CXXA 2QUBA 2V98A 4G4GA 4MJ3A 1TRHA 1LLFA 4KEAA 3BJRA 3D5EA 1D07A 4PNZA 4OYLA 3O9MA 5HFNA 1ACLA 5JZ9A 3G7NA 4AO7A 3F96A 4HXGA 1HKHA 4H7JA 1LZLA 1IVYA 2DSNA 4X3CA 2ONCA 1JJBA 4UPDA 5FPQA 3H2KA 1EINA 5EHNA 4W9RA 3BL8A 4K2AA 3ESAA 4YX9A 5ALLA 1N5MA 2QS9A 4Q05A 1AGYA 3V1MA 5HFAA 5FUMA 1R1DA 1ZJ5A 4H18A 1QOZA 3OOSA 5EI5A 1E3QA 4PO3X 5AP9A 5E2IA 1GPLA 1CFJA 1LPAB 5HK9A 1MTZA 4HVTA 3HEAA 3U1TA 2H1IA 4J7AA 2WHRA 4GWLA 3C5WP 2QR5A 2WHPA 1L7QA 5ALTA 4H0CA 4B81A 1W76A 2WHPB 2BGNA 4ZV9A 2PKYX 2AJ8A 5AI8A 1GPNA 4E14A 1BROA 1YCDA 3WK6A 5J3JA 1HL7A 1JJIA 3TGLA 2QZPA 4G8DA 3HLKA 5DNUA 4QLAA 3ZLVA 1XKLA 2OCIA 2QJRA 5EGNA 2O2IA 3I6ZA 3B12A 1P0PA 4BTVA 1BCRA 4J0DA 4B7ZA 2ZYRA 4X91A 2IITA 1ZD3A 1UK9A 5CT9A 4BC0A 5DYYA 1CUJA 3R0VA 4UUQA 1P0MA 5K5EA 1K63A 2WFZA 3RARA 1JKMA 1CV2A 1XQXA 4FOLA 1EH5A 3C5VA 1QFMA 1P0IA 2QOEA 3E1GA 3CCBA 1MNQA 1OXMA 5SYNA 3EQ7A 2BCEA 5E4YA 5JALA 2J4CA 2BGRA 1H2XA 3DLTA 1FFBA 4FBLA 2PUHA 5AH0A 1DT5A 2EEPA 1DINA 4KACA 4JH0A 1G4HA 5AKYA 2XI4A 1AMNA 5ALYA 1XKTA 3IBTA 4ITVA 5FKJA 5EHQA 3FYUC 2VT6A 3D2AA 3VJKA 2V97A 1LBSA 5FOQA 2H7YA 2XE4A 1K6EA 1CQWA 4QE3A 4HS9A 4Y7DA 3I1YA 3WWCA 4U2FA 5ALUA 1XZBA 2I3ZA 2OLEA 2VAXA 1XZKA 1A8QA 3F8SA 4WJLA 2LIPA 3BWXA 4J0GA 4QWMA 4N8SA 3KSRA 4EB0A 4X6XA 5ALHA 4CCWA 4KAAA 2AJCA 3R3ZA 2XMBA 4Y2PA 3AJAA 5JD6A 3WK4A 3R41A 3W06A 3C87A 4BTLA 1PFQA 1W75A 4B82A 2ZJ7A 3L1JA 5EIEA 2QUAA 1GPKA 2YASA 3VXKA 3SWWA 4FNGA 2JGIA 4QZVA 2FJ0A 4C89A 2VA9A 4BDSA 4HXFB 3C6ZA 2JGFA 1U65A 1KU6A 2X5XA 1BE0A 2GZRA 3S8YA 3W04A 4QDTA 5JANA 4B0PA 3IA2A 1Y7IA 1BS9A 2PSJA 1H22A 3PUIA 1QIEA 5D6OA 5ESRA 4AX4A 4PF1A 3WA6A 3FBWA 2JF0A 2WFMA 4MQLA 2Y6UA 2D5LA 2OQIA 3I2JA 1MPXA 1CUBA 3IUJA 3V48A 3I2HA 1VJ5A 5EHZA 2X76A 3D0KA 4NS4A 4XX1A 5ALWA 4F5ZA 1YB7A 3I1IA 2HHAA 1LPBB 1U2EA 1DX6A 5KREA 5ALVA 4GXNA 2O7RA 4G8CA 4X00A 2V96A 2PU5A 4KE8A 2WIJA 2JIDA 2WIGA 3ZLTA 1QJ4A 4J0KA 4ZRDA 4ZWNA 4CI9A 3F67A 1DU4A 4FBMA 3R3XA 2I3DA 3V1NA 2GYUA 5A62A 3GBSA 3FSGD 3Q8WA 4X7BA 3OURA 2HU5A 5DWDA 2GBFA 1ZD2P 1BN6A 2XQGA 4MEBA 1CUWA 2C5FA 4Y2XA 3HACA 1P0QA 5CT8A 4CG2A 2WIKA 1QO9A 1EX9A 4IO0A 2PSFA 1ZIXA 5EIHA 4BP9A 3DOIA 1XRRA 1K5PA 1MAAA 3H17A 4M0EA 3DJYA 2HRQA 1E66A 4MWTA 4CFSA 3YASA 3C70A 5AM1A 4ZGBA 1CVLA 2PPLA 2DQYA 3I2KA 5EIAA 1ZI6A 3DNMA 5AK5A 2FJPA 4EY6A 5JASA 4C4ZA 2J3DA 4C6HA 5K3DA 5LZ9A 1ZI8A 3A2LA 3ZV7A 2GBGA 1F0PA 3S2ZA 1GQRA 4KJXA 1ODSA 4RNCA 4Z49A 1ISPA 1N8SA 3WKDA 3HRHA 2WG0A 3C6XA 6YASA 2VEOA 4ZV7A 2R11A 4H7IA 4K6GA 3V1LA 5BWCA 2QKYA 2ROQA 3ESBA 3G0IA 2HA3A 3C43A 1XZJA 1J06A 3C45A 2WUDA 4AN0A 4AXBA 1EHYA 5FPPA 2QVBA 3BDVA 2CEKA 3IUMA 3WQHA 1YS1X 4M0MA 3L1HA 4AB1A 2ORYA 3U0VA 4N5HX 4Y2UA 3PFBA 4KE7A 3WZMA 3MVEA 1BU8A 1QGED 4WFJA 2XQIA 1TK3A 1LPOA 5CH8A 5ALFA 5JAUA 1IZ8A 5AI9A 2XMZA 2G63A 2W22A 2CKMA 4B0OA 3BIXA 4J3JA 4UHDA 4UHHA 2VJCA 1YR2A 2QT9A 3I28A 2WJ3A 4BBZA 3HABA 3WL8A 3AUKA 5CH5A 1SFRA 5HKBA 3AZOA 3O4GA 4EZIA 2AJLI 4KAFA 4A16A 3IDAA 2OCKA 4FHZA 3WKEA 1QIGA 5JADA 3WA7A 2RHTA 2AJBA 1G66A 3CCCA 2XLCA 2BUAA 1XZCA 5AOBA 4UHCA 3PF9A 2DCMA 3N2ZB 1FFEA 2K2QB 3C8DA 4BZWA 3O4HA 3HJUA 5LZ8A 5DNWA 3N0TA 5D7BA 1JJFA 1L7RA 3G9UA 5AKHA 5AKLA 2IIVA 4K5QA 5C8XA 3W05A 2OXEA 5JAPA 2XUJA 4B6GA 3QPDA 3T4UA 4DSZA 2V9ZA 2ES4A 1QIIA 1TQHA 4Q34A 4DTCA 5K3CA 1NU6A 1OCEA 4QEKA 3EQ9A 4MYDA 3ZLUA 3VISA 5AKGA 4Y2SA 3WIOA 5CXUA 1JI3A 2JBWA 5E4JA 4FFVA 1QONA 2QM0A 3WI7A 5FV4A 1LNSA 1ORWA 2XQJA 4LKOA 3MUOA 3L1IA 4JYPA 5C8ZA 1YA8A 4KR0A 1ODCA 3AINA 4FLEA 4H77A 3W9BA 3E4DA 4NVRA 1QIKA 1SCKA 1VA5A 4BE4A 3IURA 5C8VA 2VAVA 2CJPA 4KRYA 5HF5A 1VOTA 2G5TA 4QDXA 1AUOA 5LYYA 3WKAA 1Q84A 4OD0A 4AO6A 4DNOA 2XUOA 1QIFA 4OPMA 4ARBA 5AI6A 2CB9A 2XMGA 4DMKA 1IUOA 3LLCA 3WJ1A 1J07A 1H2WA 2PM8A 1MT3A 1ACJA 3H2HA 1TCCA 4YK7A 2O7VA 3O4IA 1EI9A 1TKRA 4V2IA 1CUSA 3VJMA 1WHTA 5AIAA 3RK4A 4C88A 5A7FA 3C6YA 5AI5A 5K3BA 5AK4A 2WG1A 2DR0A 3NOXA 1HBJA 4Q1VA 1UK8A 1EVEA 4F60A 3IB3A 5AK6A 1AQLA 1DTEA 2WHQA 4L0CA 3RLIA 4DGQA 3JW8A 2ACEA 4W1RA 2Z3WA 3H2GA 3O9VA 2RI6A 1T2NA 1FFDA 1E89A 3FCXA 1CUUA 3ICVA 4X92A 5LKAA 2WUGA 3PICA 3H19A 4U2EA 1MN6A 1QTIA 1ORVA 4KE9A 5CURA 3G02A 3BIWA 5K3EA 1GZ7A 1MX1A 3LP5A 3OM8A 4TPKA 1QIHA 1XZFA 3KWFA 5K3AA 3QPCA 4GECA 3I2IA 3G9ZA 4BCDA 4OB7A 4H7FA 4BCCA 2HADA 1R50A 4CCYA 5BWBA 5DYWA 2QMQA 4CCYB 3DCNA 2C58A 1VLQA 5ALSA 2BFNA 3LCRA 4X90A 2RGUA 3HXKA 2WQZA 1Q83A 1EDDA 2XUQA 1CUGA 1CPYA 5JIBA 5LZ4A 4QDZA 2C7BA 4FTWA 1LGYA 2BUBA 3TJMA 4WFKA 1WOMA 1XRLA 5LZ2A 2X8BA 4KRXA 4EUSA 4Y2TA 2VJDA 5CTAA 2XUGA 4GHWA 4X6UA 4HTAA 4ROTA 4EY5A 3QPAA 3M82A 1UKAA 3WL7A 3F97A 4H35A 1O6FA 1XROA 1XRMA 4N8EA 3WYDA 4HRXA 1ZIYA 4I4CA 4Q82A
chains in the Genus database with same CATH superfamily
3U4AA 1ZD1A 3PFGA 2RAFA 4D81A 1Q0PA 3NW9A 2ZVDA 3RFXA 3PXCX 2E4VA 1V4BA 3B53X 2DZDA 3OPMA 1X13A 4JLUA 1FCJA 5EC8A 5LXTA 2DX7A 2B35A 1IWPB 4ND2A 1B8VA 3ZGYA 1FYDA 1FNDA 2VATA 3CIFA 3N5CA 3PFIA 3Q10A 5CCBA 1SZCA 3U17A 3KSUA 5DP2A 3TNJA 3VDNB 2BOVA 3L0BA 5LXTB 1JILA 2JLZA 1ISJA 3OE7D 1YCHA 2G72A 4WGGA 3TGWA 2I6XA 5HRUA 2ZI7A 1M7BA 3VZRA 1J8VA 1P44A 1SA0A 4CIXA 4HLCA 4TOIA 5EFZA 4B4UA 4F3RA 1BA3A 4BP8A 5BP7A 4G5QA 1JR3A 4E2WA 3UATA 4AJ9A 5HGJA 3SF8A 1QUFA 4EYQA 1EAYA 1MV5A 1MX5A 5F9MA 3TFOA 5EKSA 5FBRB 4EA8A 1SA0B 3FCUB 2YZMA 4EYEA 1GSOA 4C4XA 5ICGA 4I5DA 3SBXA 1VFPA 4IXWA 4GS5A 4D0NA 3KBOA 1PIWA 4PFSA 4NMWA 1R8QA 3SF8B 5B4TA 1K7XB 2FEOA 4X95A 3UMGA 1YRHA 4QYIA 4RH0A 3QKSA 5F1PA 3Q5DA 1NBEA 1EHCA 1YT5A 4EAQA 4V0OA 3THRA 1VHTA 4MYUA 3SYKA 4TROA 3UBTA 3Q98A 1UAYA 3MEQA 3VPBA 2ZUSA 5BR1A 5K8LA 3RVPA 4QYIB 4ITRC 1BDBA 3QKSB 3ROPA 4BNKA 2FA9A 1WPRA 4AN4A 4AKGA 1Z15A 3LQFA 3VC7A 3LY5A 3DZDA 4JA0A 3ZBTA 2ECPA 5K05A 4G8BA 1R6DA 2Q6TA 2BIFA 3G0CA 2GVNA 1DKRA 3C74A 3EVAA 3M6XA 2WPDD 5JPCA 1B73A 1RFLA 3EQ8A 3RS7A 3UJDA 1RP7A 3W3AH 4B4OA 2IX9A 2X4GA 1TB4A 1CLEA 3VM6A 2ZPTX 4AROA 2BKLA 1AUXA 3K0BA 2IPLA 5CLHA 1DWPA 1GAXA 3AVUA 1DV2A 2J0EA 1ZJZA 2OKCA 3RFUA 1IXYA 4Q3BA 5GJBA 3JQRA 3RHZA 4LRUA 1RS0A 3TRHA 4QU9A 4HATA 3ZY5A 1EWTA 5KYYA 3CVWA 3WLQA 1FQWA 4P4TA 1T9ZA 3H9JA 1WU7A 3MHTA 4FSXA 1GL9B 2JIRA 1U8YA 3ORQA 4KQFA 4CETA 4GYJA 5JNLA 5FLEX 2R1VA 2O2ZA 2CMKA 3F3SA 3LMKA 5C7LO 3STYA 5KYYB 3IX7A 1Q7EA 4GPEA 5F3RA 3M4NA 3V4ZA 3WLNA 4DLTA 3NONA 1KFJB 4R9SA 4D0SA 1OH6A 2R7KA 1TM2A 2IF2A 5J23A 2QNRA 3TEJA 1SUCA 4DIUA 2R1VB 4CMIA 1W4BA 2FUG6 2JLYA 5DPMA 1KK0A 1OBHA 2QAJA 4L6AA 2DLNA 2W90A 2YHSA 3IPXA 3SIWA 1R0KA 3OUTA 5B1DA 4CMIB 3O4FA 4U9IS 3NEAA 2XE6A 4GZ3A 1P2DA 4FINA 4TVBA 5T5QA 4P3OA 3BORA 3KZCA 4U6QA 4G84A 4JLKA 2JH3A 2EQ5A 2I4NA 2PNFA 3QVUA 4U2CA 1RZRA 5TSDA 4TLEA 2IY8A 5AKKA 2PX6A 1IUNA 1HDGO 1DO8A 2H06A 4LYYA 4EI8A 5IH7A 1EX6A 3HA7A 4B6SA 5DCWA 3FUVA 1XKXA 3W79A 3WGGA 4M0DA 1CIPA 4KBGA 4ON9A 1FFCA 4W8GA 3T99A 3H9GA 3MT7A 1WPXA 1PX2A 1VXOA 2AZXA 4EUKA 3SC4A 4FCCA 1P1JA 5D3MA 4HQLA 521PA 5C5CA 2RKOA 1NFFA 5E9AA 3ETNA 1HT3A 1Z06A 2DU8A 2YJNA 4HADA 2JKVA 2PGJA 4R31A 4C3VA 4S04A 5D8DA 1L4FA 3C3MA 3AG5A 3P9YA 1N3IA 1T4CA 4OHMA 1VC2A 4LSZA 4XIIA 3LW7A 5D3MB 1A97A 1IDOA 1P74A 3WWZA 5BSGA 1JYSA 1O94C 5HYVA 3W8NA 5I7RA 3TPZA 2UXDB 1T4CB 1E2IA 2VXCA 1NDUA 2CL6X 3OE5A 5DHSA 621PA 5C9ZA 3W2TA 4RTRA 2ZAMA 3ANNA 3CUUA 3DFUA 4GOOD 4M4SA 5C53B 3AHCA 2P7IA 3F49S 3L84A 4FCWA 3SC2A 1JF8A 2WU4A 3BX1A 1TKCA 2F62A 3HQ4O 3IVCA 4KQCA 4X97A 2JD0A 4OI4A 2BHTA 1SC3A 3ONNA 4I19A 3DZFA 3CVOA 2ZJOA 3MUNA 4OX9B 1I36A 3SC2B 2FNAA 4KUGA 4WAUA 3RM3A 3A1WA 2W5UA 4DMGA 3RKSA 3D6AA 3JQGB 3KKNA 5JECA 5KVQA 2PL1A 3B9QA 2ORWA 1X39A 1R64A 2QU8A 2WJ4A 1FY2A 2FMKA 2YC2C 4OEHA 5HDQA 1GCAA 5HE9A 4CM7A 3WRXC 4OAOA 3IAHA 1XOIA 2ZU0C 4KYUA 3SHTA 1SUPA 2ZRGA 4F0JA 3GVPA 2AX3A 3X2EA 4QA9A 5A2QA 3ETLA 4RKRA 1V5EA 3DKRA 1UDRA 1P1CA 2QTTA 1BWRA 1CIJA 1L1EA 3DLIA 4P6VF 2OCXA 1Y4DE 1YDEA 2JLVA 5KJ6A 1SC1A 3TOVA 5J47A 3OH8A 3UUGA 3B6ZA 2Z9DA 3JCZA 1AK1A 2QD4A 2ZJAA 2AMYA 5CNIA 5THQA 4Z9BA 2R6GA 2PWZA 1GRNA 1FNMA 2FXVA 5F5LA 3D8NA 1PT8A 3ZK8A 2IHYA 1WLSA 3LC7O 2IIPA 2RB4A 1ZZGA 3AFMA 3DDHA 4A1FA 2VI5A 4OB6A 4WT7A 3P27A 1YIAA 2WF6A 3ZJ4A 3DM9B 2XTNA 2BFMA 2V9PA 3DOUA 2XCTB 1DG1G 3HUTA 2PZGA 4PZAA 4TS9A 1BO6A 3FTDA 5EMHA 3S2YA 4HAOA 4FKZA 3O94A 5TR9A 5FXMA 3GDOA 1NIPA 3RTGA 3D4IA 5KQLA 2OV8A 1JVSA 3KV1A 4W8HA 4NG4A 4LGCA 4MDHA 3QMMA 4YJFA 4ZT7A 2XA2A 4X6YA 3WLTA 5JRDS 1DJMA 2P3OA 5CEJA 2W71A 1K0FA 2P65A 3OMLA 3OZGA 3D81A 3O21A 2I2AA 5H3CA 4R6WA 3RTDA 3MFQA 4YJFB 1T1IA 4C0AC 3HDVA 3A9RA 4JBIA 4Q4CA 3L4BC 4L22A 1A71A 2ENUA 5D7NA 3EHDA 3RROA 1M7HA 3KQQA 1E32A 5HKAA 1IB0A 5JAZA 1O94A 3LLMA 2I4RA 3HZRA 3JV7A 4GE0A 4OXRA 1D1PA 4PLZA 1RU3A 3LUHA 1P8AA 4EKIA 1A2KC 1TF2A 2PUTA 3FW1A 3GLUA 5A1TA 2JEYA 3D3WA 3IV9A 4I4TA 1MZPA 5AW2A 3B60A 2F48A 5K8UA 3EODA 2IDMA 5CDUA 4YXWA 1SC4A 5C0OE 2PX2A 1A9QA 1KC3A 1NBOA 4FS3A 4Q4LA 3SZGA 1EFAA 3D3WB 4I4TB 2D2FA 2J7PD 3G0DA 3Q7RA 4BLWA 3FZGA 2COUA 2A4KA 1VMEA 4HDMA 4WASA 2XXJA 2AN5A 5LQUA 3U09A 3Q3GE 3WAGA 3WB9A 3ZXUB 4D9HA 2IHZA 3MGAA 1T4DA 1SXJE 4KOAA 3L4JA 1CS0A 1QGUA 1IWOA 4HDMB 3ROMA 3TTWA 2PKQO 3QYPA 4HLDA 3WRXA 3WNQA 4CODB 4LXGA 2WABA 3M3HA 1J2UA 2O8FA 3I37X 3Q0TA 3F1LA 1CS0B 1QGUB 1TIBA 3CF4G 3PDJA 3TIXB 4X62B 1KO5A 1M6WA 4Z3DA 3X1ZA 1FFYA 3UWPA 4D3DA 3C7TA 1EP2B 4Q9DA 1N5RA 2UUCB 1ZD8A 2O8FB 3PI6A 2Y4NA 3H4MA 3IH5A 4LIPD 1RHUA 3QITA 1ZD9A 4UMFA 3OX1A 3BXFA 2G7MC 3AP3A 2QV7A 2WILA 3EIXA 3MTQA 3T5GA 3R9IA 4JBHA 4KR6A 1F20A 4KGZA 1LWOA 3GA5A 4P36A 5FI1B 4BV2A 4EHBA 1W87A 3PUHA 5C1BA 2UYHA 2XGGA 3IELA 3FDIA 5FJJA 4DV1B 4NE9A 2PJDA 2IYSA 4IH1A 1FXWF 1LF0A 4I1IA 3FPGA 2GZSA 5D2CA 1EBBA 5D51S 5JH7F 4LRWA 2OHHA 3L7DA 1N57A 2O0JA 3QLEA 2EU8A 2N75A 2NMVA 5B37A 2OPHA 3H8VA 5FX2A 4EHFA 1Z6TA 1HH4A 4KIUA 1AHHA 2V03A 1G21A 4MUXA 2O54A 3CLRD 4AULA 3EWAA 3GZTB 1N5IA 1ZQ9A 3KXPA 1P2VA 3BHMA 2HD4A 3AHGA 4ALIA 2DHEA 2DPMA 3L04A 2ZJYA 4F56A 3GLHA 3L4BA 4ZO6A 3F6EX 2WYVA 1CR0A 1G21B 1Q7GA 4MRMA 2C5SA 4FR0A 3FVQA 5E7QA 2ZYWX 4H1UA 4OP3A 1SK8A 3NWPA 5J4VA 1QCCA 1WL8A 2BY4A 4IZ6A 1XEFA 4LV8B 4X8OA 4TKVA 1JA9A 3KQKA 3GLHB 1BHJA 1C9MA 2XMDA 2AR7A 4MRMB 5PNTA 2DM6A 1J20A 1OUMA 3GJXC 4JEUA 4IHKA 5FTJA 1T9GR 1JFTA 4AY4A 4TKVB 1ZBDA 2QI9C 3LUKA 1J0EA 3JPYA 1AC5A 4RFVA 5KMGA 2RHBA 4O8ZA 1Z73A 2Q5IA 2H4ZA 3D54D 1ZMXA 3R3YA 2R96A 3MRTA 3N8DA 4FKBA 4KXNA 2HF7A 4EF5A 4DIFA 2UZAA 4FWBA 5KMGB 2J8ZA 1DRJA 3IKTA 2YWRA 1W4AA 1QIDA 4NR0A 4JYAB 1N0VC 5AKEA 3T5MA 3DHWC 1MW8X 4W9MC 4RK7A 1LA2A 3KDPA 2XYRA 3O2NA 3UUFA 1SOWA 3NUZA 4N5IX 2LCQA 5I7EA 4QRIA 1Q6YA 1PWXA 2OBYA 1O3YA 2UYOA 1VKZA 2ZTUA 1Y5LA 3JYOA 4FDTA 2PS0A 4WZZA 4ARAA 3HBMA 3L49A 1ZD4A 3VOSA 1EGVB 5FA8A 5AI4A 4RMJA 2QLBA 4FHGA 4HX5A 1NG9A 3HGTA 1I3NA 1LPMA 5CYFA 2VHWA 2HMVA 3FCYA 1CSEE 1EFDN 4N3AA 2DFLA 2F8MA 1YS2X 4MV3A 3EIWA 3DM5A 3H0CA 3D2CA 4DTIA 1NX9A 4BVLA 2IZOA 1KC1A 1GUZA 4MYSA 1WDKA 4ZI7F 1ICIA 2E37A 3LUBA 1VKRA 4RVNA 5HM6A 1QTQA 2BMJA 3VNBA 2J33A 2XTMA 3G9QA 2QPAA 1XZAA 1ZESA 1Y6GA 1KPHA 1W5FA 3PNPA 5FPTA 1XPOA 1SUSA 4FILA 4ND7A 3ZCXA 5JHHB 2D5CA 4E21A 3ZEIA 1T25A 3Q7QA 4GUDA 4LRQA 4FYPA 3UENA 2IYTA 1M3SA 2AYZA 2EZ4A 1EUDA 4FFOA 2HBRA 3DKPA 3OI7A 3CEAA 4HH4A 5AI6A 3WXMA 2Y1WA 5I7UA 3TINA 3DKVA 4KR9A 1E2BA 4UBJA 2VG8A 1IN4A 3ESXA 1Z7WA 4BOYA 1EUDB 1VYVA 1MJFA 1LZKA 2HXGA 2NUPA 3ASZA 2QAIA 3NT5A 4Y3UA 4PG7A 3SXUA 3K2EA 1JPNA 3FCSB 3OMWA 4O4JA 2CDRA 3EMDA 3TQTA 1IBCA 3G82C 5CD1A 4AG3A 2JG3A 1YRLA 2F67A 3AU9A 3NHSA 3OJXA 1RFGE 2NUPB 2OK7A 1DEKA 2A5GA 3SXUB 4AQ7A 2Z58A 3ELDA 1RHQA 2ARKA 4JN6B 3LX8A 3QNUA 4DSOA 5FWYA 5IJ0A 2WZCA 1NW6A 5B2ZA 1M1ZA 5AKIA 1CY1A 1OQAA 2HF2A 3H1GA 4RM2A 3LXMA 4CM3A 1PR2A 1ZK3A 5BNIA 1W4LA 4BFVA 3Q5GA 3N6VA 2G04A 4RESA 3KJEA 5FWYB 3VZCA 3LRXA 3F6CA 3JQAA 3UA3A 4D96A 4AECA 4PCVA 5IJ0B 4IICA 1DFGA 3SHWA 1NV8A 1NWCA 3CVYA 4BE7B 1OB5A 4JUCA 1MO6A 4L0QA 3R8XA 4A5OA 2YZKA 3O47A 3V3TA 1Q0TA 2V3WA 2VCHA 1RM3A 1UIRA 3JQAB 4EEXA 1UFOA 4JOSA 1V9LA 3QUAA 5IC6A 1L5GB 4D8YA 4JXXA 1C4WA 3PR2B 5A1JA 1WXDA 5KYTA 4X64B 3HDJA 3QU4A 3KFVA 5EINA 3VBEA 1TFUA 4ZGWA 5TMBA 5B1EA 4N0PA 1VZ2A 3SQNA 4RH1A 4UTRA 1IYZA 3SX2A 1Y8AA 3BB1A 4DQUA 4KN5A 3CT6A 3NBMA 4R05A 3ZCPA 1DRKA 5GV8A 4IZIA 3DVRX 2GI4A 4E7OA 3CT4A 2BH9A 4RYDA 1NJ8A 4IJWA 1ODLA 2QXTA 1NJ2A 2CMGA 2EGHA 3DVAA 1DKOA 3F5QA 3WNZA 3K2BA 1NWHA 3BGDA 2ANCA 3L6EA 2A86A 1EUQA 3OLZA 5GZ1A 3DVAB 3K6JA 5KTNA 2X9QA 3L40A 5LP6C 3HWRA 4C07A 3FF4A 2W6CX 2H3EA 2CBXA 1EDOA 1QR2A 1UKYA 1K97A 2B2CA 1WR8A 4L9RA 4PSKA 5ALXA 4OQDA 3RK0A 9LDBA 1E9DA 2CLFB 1E1YA 3K32A 5FAXA 2TS1A 1QNFA 2B5WA 2Q1TA 2Z2KA 2Z56A 3E03A 2V6BA 1W1IA 4JBNA 4UDXX 3A6FA 1GXSB 5FL7D 1GPBA 1E98A 1Y82A 3UOGA 3WLAA 3LYUA 1Y9DA 3N7AA 6LDHA 9ATCA 2AFHE 4R7ZA 5P21A 3TDNA 4QNNA 1U9IC 3G88A 3R5SA 3URMA 4YAUA 2A9VA 1T3HA 2QVGA 2VPZA 2ZSKA 4GH5A 1N5OX 3WIEA 2Z1NA 4L5JA 3FI9A 3HP4A 5LB2A 4P7KA 1QHFA 4EPRA 4ZYYA 3TUZC 1CF4A 2ON6A 4DDTA 4Y2YA 4RKWA 3NRJA 3R3VA 2FE1A 3DL7A 3KC2A 1JTFA 2HSJA 3OHMA 2LUOA 2GR9A 3EVCA 4OVKA 2IXBA 5G2OA 1K8XB 4ZO8A 4RULA 4CMGA 4QFDA 3UXHA 1EFHA 3LY9A 3N7TA 3WIBA 4RBNA 4DDVA 5T4EA 5C2JB 4FP9A 4QYTA 4YRZA 5SY9A 1UZNA 1K66A 2JAHA 2OR3A 1DQPA 4R8MA 4GWKA 3MJSA 5ERXA 4ETNA 1S4QA 5TDHA 3PGMA 4QBHA 2W6IA 1ODTC 3K70D 2ZS9A 3BXHA 4XWAA 2R6FA 2P5TB 4HY3A 4L72A 2J9RA 3A28A 3QM1A 2O2HA 2PMCA 3R7DA 1OXXK 2EATA 3A6JA 1NVWQ 2OK8A 1DKLA 3NGLA 4W1PA 1O97D 1I01A 2XNDD 5K0SA 1JG7A 2GYWA 1WUIS 5DW0A 3REQA 3UTDA 1SH7A 4KIGA 3V34A 1QHEA 4DHWA 5FYQA 1NL3A 4QQFA 1SKMA 3AVQA 4R9UC 2ZSIA 4WADA 4XLZA 5ESDA 3TKYA 5BYAA 3LUJA 3OTHA 3RS0A 1QGZA 1E7QA 4RIEA 3T1OA 3REQB 2HRCA 3NVDA 3PPVA 1DIHA 3DUFB 4GZLA 2GPSA 2D13A 3K9HA 1QUEA 4OHYA 1ZN8A 2DGDA 3ENWA 2WBLC 2B5VA 4FN5A 1Q0RA 1W5TA 2LW7A 1MCZA 2JI8A 3JTEA 1KO7A 4NENA 3HRKA 3STXA 2DQZA 2HL6A 4OB8A 3VR5A 3DHNA 4UAUA 2OL4A 3UEOA 3DYVA 3GFRA 4LZJA 1I5RA 1T0JB 2R68A 4Q47A 1UBRS 2KE5A 2ZE7A 1GY8A 4N7JA 3WQSB 2AFIA 4A2CA 5K0TA 4JWTA 3UJ8A 1G8YA 1JNXX 2OHFA 3DBIA 3V7UA 3CRQA 3NRCA 2OO5C 4NYMQ 1D4AA 1TZCA 3PUZA 5EESA 5AIBA 1NBIA 1PR0A 4TM8A 1COWD 4JP8A 3U3DA 1XZIA 2AFIB 4BQEA 1F6BA 4NAVA 3C41J 4JY7A 4DS3A 4CV1A 1IRXA 3ABRB 3AY7A 4XLLA 1FW6A 2G9RA 5IZCA 3LBYA 4BQQA 1B0ZA 1YAJA 4OU5A 5J4LA 1MOZA 2B8WA 3IT0A 2ECOA 2W6NA 4HEHA 4V1CA 3TLYA 5IVDA 1DB3A 2ZUEA 2N9UA 4ZFNA 4U8GA 1HV8A 1THZA 4G36A 3ZWMA 1SVMA 1K4MA 4DIOA 2C2HA 2PUDA 4S1TA 1UANA 3GLKA 4V1CB 3L7AA 2F6RA 1T6YA 4HAWA 4MGKR 5TPZA 2GHRA 1UMCA 2IYXA 2Q46A 4CIBA 1SBIA 4IKEA 4S1WA 3THWA 1GGKA 3BIJA 5AW8A 1SC9A 2D59A 4IWYA 2R4TA 4KYVA 1UMCB 3U7HB 4B5LA 3B9BA 3ER9A 1W5AA 1NLUA 4ZT2A 1TM7E 3RC7A 3THWB 1EUYA 2QG6A 2DF8A 1P5HA 4ESOA 1YRQA 3K20A 3ZI4A 2BKVA 4HUTA 4YV0A 1H8HA 3LBAA 4EA6A 4WKGA 5JAQA 2AXNA 4IDCA 1C81A 3FMPB 4AZTA 2WU1A 2XDAA 1ENYA 4GP7A 2X0NA 3TCXB 3VU3A 1ZJ6A 5CIYA 4H6PA 5EHXA 3L0OA 2OG1A 5KNCA 5DNYB 1Q5PA 4TRMA 1HZJA 3RC1A 3KKKA 4JLMA 3RO7A 2RIPA 2WUEA 1TM3E 4UBNA 1LK5A 1GUDA 3QKTA 1ND6A 2RJOA 5JPIA 3WAKA 3IJPA 3GDWA 5CFQA 1WAMA 4EJMA 4D46A 2ADFA 2D7CA 1XZLA 5E8JA 1D3AA 4JJZA 1I5EA 4LUCA 3V4FA 5BR4A 1VXRA 5H82A 3AO0B 3TRKA 2X41A 1NYLA 1QLWA 2FSSA 3UHPA 4EFDA 3KOWA 4MKZA 3P4XA 1L9XA 3VAZA 2VP6A 1W19A 4TTPA 1TJYA 3CF0A 4ZJPA 2FSIA 4RABA 1FDSA 2ZYSA 1SU4A 1Q91A 1UXJA 3CUVA 3SQXA 4XTRA 2CFCA 5E7MA 2VXYA 5KTMA 3WK7A 4X65B 5IDWA 4GIBA 1OTYA 3N8GA 2E49A 2GLXA 2OO5A 4JBYA 4LS3A 1RRGA 4MEAA 3WKBA 4HEA1 4II7A 5BRNA 3O5AA 2J5RA 2PCJA 3IUNA 3H18A 4K46A 4ZICA 1L2TA 2H4WA 1H69A 3ZD8A 1JPJA 1NU8A 3HKDA 3B1ZA 1ILEA 1X8LA 4DMFA 3VJRA 5A9TA 4B34A 1RXYA 5A4MS 1ISFA 1P62B 3K1ZA 4AJEA 1JEYB 4M9RA 2YMQA 2GM5A 3IQDB 1U2PA 3OJOA 1UJNA 3HKDB 4HB2A 5DGDA 3BCRA 2WFLA 3CWCA 2HEGA 4K9MA 2B6HA 1E2NA 1Z7EA 4ZCQA 1AU9A 1O96B 5C5DA 1P1RA 3I9KA 3P97A 1O87A 2HNAA 1VPTA 2EWWA 2WFLB 2CLSA 3DLPX 1FRZA 1X19A 3F9CA 4K8RB 5BYBA 2AD1A 2NTEA 3GEPA 4AP5A 2V6IA 1JZSA 3QVJA 1TJ5A 2FLWA 3HJAA 4EY7A 2DFDA 3EPPA 3I2FA 4JLPA 5ED0A 5HHTA 3X2SA 4I3GA 1DWQA 3C3YA 1I6LA 1A98A 4MCIA 5GV7A 5NULA 1L5KA 4XEHA 4P4LA 3S2IA 2IP1A 3JQ7A 1QYVA 3I83A 1Q1NA 4LOJA 3E9MA 4PSAA 2ENWA 2Q0QA 1AURA 2VJQA 3ZDQA 1B8NA 2MSDB 3PVCA 3KOZA 3A0UA 2VYFA 4HN2A 1GOTA 3KQYA 3EZGA 1AKMA 4YO8A 3IT3A 3JQ7B 5DI3A 3HJBA 1ZR2A 3MLBA 4M1SA 2XLBA 2COKA 1NMEA 1GRRA 3W8EA 4GXTA 4JT9A 5JPDA 2PX8A 1GTJ1 3O91A 7GPBA 1XZGA 4CGYA 1SKYB 4OHOA 1EK5A 3OMXA 5DI3B 5JW6A 1Z6QA 1USUA 2Q4EA 4M88A 5G0SA 5EJ6A 1UKBA 3GAFA 4I55A 2O2DA 2QVYX 1VLMA 4IJ5A 1BD3A 1NMSA 5AK3A 4CM8A 4BEWA 2JVJA 3IUYA 3LTEA 2PGOA 4GLFA 4TKZA 4NJEA 4M0LA 4EB8A 3LO5A 3ZTWA 2O8VA 5JZBA 2VSOA 2YS6A 3CSDA 3WLHA 4CM8B 4C4TA 4JI8B 1BCSA 4G2NA 4E09A 3G7UA 3Q7TA 4RTLA 1CD5A 4NJEB 1EX7A 1THMA 3AESA 3P2IA 3GPBA 1R18A 1E77A 2OOKA 4MI6A 5IASA 1BCSB 3CISA 5AM3A 3WYGA 5JNSA 1N1EA 3T7KA 1M6EX 1P73A 3VPFA 3UC9A 3WRYC 5BUZA 2UZ3A 3AESB 3K2IA 3N0RA 5AVXA 2CV2A 3T4PA 4WD3A 5AW9A 4C21A 3UMCA 1THGA 2P9ZA 3I6MA 3QMPA 1SG0A 1Z07A 2G07A 1M0SA 1AZWA 1RZRD 4LJRA 2VTBA 1R0WA 1YJ8A 3ZQKA 1YF3A 2M2IA 2IYOA 121PA 4JFAA 4C22A 1SULA 2ST1A 3ORYA 4M1EA 4N6NA 3BTVA 5TT0A 4DOMA 1C0EA 5EG5A 2VTBB 1ZBQA 2FVXA 5HG0A 1OILA 1AKNA 3B82A 3P19A 3AF1A 3NJ4A 3UWSA 2O1SA 4RWEA 4DAOA 1GFWA 2GA8A 1EWKA 4K9RA 1Z2PX 2HFKA 2Q3MA 2VQ3A 1E2MA 1JH9A 2VHVA 1E1LA 3WTBA 2XE8A 3AI3A 3UGQA 1DT3A 3L7JA 1DGQA 2FRVA 3PJRA 5FDFA 1Q0UA 3MERA 1E9FA 3S44A 3KYDA 2EDAA 1ESNA 3VSAA 5K99A 5KQSA 4EARA 4DEYA 3EXAA 3I64A 2D0DA 3KYDB 1ABBA 1AKWA 2Z5GA 3D6JA 4GUAA 1M72A 4NFSA 4BVJA 2JGJA 1AK2A 2SICE 3B5JA 3ZDEA 3VO2A 1OLXA 4EYOA 3TLZA 4YCDA 1KZ4A 1JIQA 3QHAA 4OQZA 5HKLA 2G5PA 2G17A 5C1DA 1YK0A 2ZJ0A 1L5FA 3AZPA 1N3LA 5H16A 3IQZA 1OLXB 5BN5A 1XTIA 4B71A 5HM8A 2P6RA 3EIEA 4BO6A 1D5WA 3TYXA 3AI2A 5AFSA 2M1XA 2GZ3A 1DOAA 2P2CA 3HSSA 3EGCA 5BN5B 4L75A 2EF0A 3RS3A 3RD5A 1NW4A 3LFUA 2ZDGA 1W6RA 2CZGA 4MWBA 4QEDA 2FDCA 2XUAA 5SZHB 1T5BA 4Z9AA 5HF9A 4ED9A 4D56A 3UMRA 2NSLA 1H85A 3O6VA 2JAXA 2R65A 3FYTA 4GI3A 5SV2A 4FE3A 3Q3IA 4LK3A 1HETA 4FOSA 4BBPA 4C0QC 2CMFA 4J0QA 3WRYA 4PC1A 2HCJB 3G2JA 1S2LA 2C77A 5T57A 3V33A 2ZWVA 3N2NA 1E0SA 2Z8YM 2LGJA 3AM4A 5LMNB 1P7ZA 3GD7A 1CLUA 2JZOA 1QK4A 4BFTA 4KDEA 2ZUFA 3HI4A 4BO8A 4PC2A 1U94A 3E27A 1H66A 3W78A 4LK2A 1L4MA 3IP5A 1PGQA 3EDMA 4GLLA 1WU8A 2V8BA 5COBA 3LC1O 2YWGA 4GKJB 2NW6A 3L8HA 2VDKB 4XGQA 3IPCA 4BYMA 5KSYA 4QULA 2Y1LA 1UADA 2AFVA 3CF6R 4HQFA 4KQIA 1W0JD 4OQNA 2FXIA 2CF6A 4KO4S 3FY4A 4RIHA 1CYEA 1YL7A 2JHFA 4H7KA 4BBAA 2V0NA 1VSVA 1ZO8A 1JT9A 2AT1A 2CBGA 2HA7A 1D2HA 1ZSYA 2Q62A 2QROA 5G4KA 1DAFA 2RJ3A 1DZ3A 1H3FA 3WISA 1G7SA 3H6HA 3KYCA 3WK5A 4ARIA 4G1BA 2BR5A 3KR1A 3K71B 5G4KB 2O5CA 2IBSA 1DHTA 3DFZA 1KH3A 4MKGA 1T3SA 1KQNA 2XB2A 1BRMA 2GPBA 3PWKA 1CZUA 3P2MA 2YVAA 1XFDA 3KYCB 1ZDMA 2F1JA 3MMSA 3IUBA 4DQ0A 1JFSA 1F3OA 4YXWD 1NLFA 1WMDA 2PG3A 1VSTA 3C48A 3CEMA 3LE8A 3P71T 1G17A 1FSGA 4CDRA 5JZSA 3SQWA 3A9SA 2QY6A 2FWPA 4HH3C 4PZZA 4BU0A 1PK8A 2GAFA 3O82A 3WMWA 1DC6A 2NQTA 2IELA 3JVVA 3KT6A 2BI4A 1E0DA 1XJCA 3VPCA 3K92A 1O6ZA 4JSTA 4ENUA 4M8LA 1NONA 4YV1A 4C7OA 1SHLA 1KA9H 4OHWA 3SR4A 2P9JA 1K8ZB 2DT5A 1PKXA 2WJIA 4CN9A 4KO8A 1JQ5A 3EWIA 2IUYA 3AF4A 4LYGA 5AHKA 4EA9A 2PMKA 2ZQZA 4YRIA 2EBHX 3O90A 3T6KA 4C7OB 4Y8VA 3MBIA 3A1DA 2J3HA 1U7XA 3DE0X 5EZYA 3ZWVA 4ZYXA 1JEEA 2NSJA 3HY4A 1YR7A 5EKDA 2QMZA 1FLVA 2OFOA 4ABTA 4G41A 4ZANA 1U2TA 1OHHA 2GT1A 4N41A 1MC4A 1P1IA 1K3FA 3LPLA 1K98A 3JYHA 1OC2A 2GTPA 2HMUA 3QJ5A 1A9PA 4QO7A 5EZYB 4IVQA 3MYYA 1DRWA 4J03A 1FOEB 2LV8A 3DJFA 5FUQA 3O8CA 1JLRA 1O5OA 3SI7A 4I08A 3CA8A 4JBXA 4ND8A 3GFGA 3ZZ1A 2HBZA 2Z3VA 5D3KA 4KHZA 5IH3A 2ZUTA 5IUNC 5G0TA 2VQEB 1TM1E 2IEYA 3QFSA 4CR6A 1TKAA 1YHZA 2C3UA 4NV0A 4J16C 4UUBA 1KRWA 3D31A 4EPYA 5EPUA 1JMYA 4ND8B 1U8AA 4CM1A 2OYCA 4CUKA 1ZU5A 4U5QA 1ISSA 3KKPA 4JOCA 3A6DA 4XQEA 2YXEA 3OQNA 4CN8A 3AOGA 3V8VA 2NV2B 4XR9A 2C0QA 3INYA 4EVRA 3NNDA 3MS4A 4RLFA 3KVOA 1JHPA 1GZ5A 2D00A 3LCCA 1E3SA 3NYWA 3PTZA 4ZVLA 4OLFA 4TMXA 3OBIA 3VBCA 5DM60 3O84A 2QMEA 3R24A 1QE3A 2HSEA 5TQ0A 3UAXA 4BQPA 1MXFA 3BA1A 2H11A 4RD3A 1GCUA 1AT1A 3NANA 1DAMA 2PYIA 4GWGA 4HNHA 3TNLA 4G07A 3NPAA 5TQ0B 3LDFA 4YASA 5EAIA 3R4VA 3S8MA 4ENSA 4OREX 1A5BB 2I78A 1W4ZA 5GVSA 2WUVA 3WICA 3C8HA 1GQSA 1PNOA 1SUDA 1K2WA 4JLAA 4LMAA 1B42A 4PYNA 1N6PA 1EQ2A 2PR7A 3FNRA 4JBWA 4YJHA 1KYZA 2Q2WA 4DNFA 4XE5A 5ERGB 3F4KA 3UXEA 4EI9A 3CW8X 1Z36A 1U5BA 1T8TA 3KWJA 4Z4FA 4ZQBA 3ZZTA 2NXJA 1KEWA 4XQGA 5IJ9A 1GRCA 2JGKA 3VYSB 3IEIA 4YJHB 3EF3A 4UW9A 3SHQA 2OCLA 2V58A 1DLIA 1ZI9A 4KUHA 2YYZA 2JH8A 4Q3OA 1U5BB 2CXSA 4JYMA 2EZTA 1FU7A 4DEVA 3ZOKA 3BMNA 5I01A 2J9XB 4DV7B 1FDOA 3ICEA 4FMDF 5IJ9B 5CNKA 4J0JA 3UB4A 3W6PA 1EJBA 2GJ9A 1XZEA 4E7PA 5AD1A 3F3YA 3PKJA 2JLRA 3S5UA 1G9TA 4L8FA 5F3WB 3BMNB 5AOVA 2UKDA 1RT9A 1NP7A 1DBIA 2JNWA 2R1ZA 3ZTYA 4R2KA 4QG3A 2O5VA 5BW8A 4KQEA 3G17A 1QU3A 3BDIA 1J90A 2C83A 3LYHA 3I4FA 3BPSA 1PG2A 3R5HA 1MP0A 4PQEA 2DQ4A 2ZGVA 1G8GA 1TDJA 1N2BA 4ZYZA 2Y2VA 3A2NA 1GKYA 2Y2UA 2AZTA 1PFWA 4Q12A 3OLXA 2N1MA 3EEIA 1VSUA 1XBTA 2XEXA 5HIMA 2PE5A 5JC1A 3MOGA 4J16A 2JJ2A 5ERYA 4YCNA 3MOIA 3SYNA 2BGLA 1QX3A 2UDPA 4NBWA 1GHTA 2C4VA 3CVJA 3P4YA 4RPIA 1PJLA 4H6WA 2IIBA 1XMVA 4XWGA 4ZP1A 2W98A 4LWPA 4XDHA 4FUQA 1DWOA 5C3MA 5CM2Z 2HWWA 1Y1LA 2AKEA 1N0IA 2QG4A 2NTVA 2DC1A 4U2BA 3LLSA 2CHGA 4L15A 1X86B 3WYBA 2HK9A 4M60A 3WWEA 3ZDZB 1WDMA 2PL5A 3RSSA 5BN1A 1F4VA 2PJUA 3ZD7A 5BSUA 2AOWA 5ALOA 1E2FA 2W2XA 4YB8A 4F85A 3UK0A 1ODFA 3GLRA 1H6AA 1GA1A 2WIDA 3ZKAA 1PHPA 1ZH2A 4ZYTA 3EISA 3KEQA 3GL9A 4QXOA 3OFJA 3FWZA 1EUCA 2ZB3A 3C6BA 3HB4X 3WIVA 3ZU3A 2NT4A 1E96A 3RRXA 1NPTO 3ZR4B 1RQ7A 3DBVO 5BW6B 2ZYDA 4GI2A 1EUCB 5KC8A 3GZNA 3AKZA 2GZMA 3LVQE 3FMIA 1NMZA 2D2IA 3LX5A 4NZZA 4O4LF 3IFSA 4BASA 4BFCA 5C5IA 2O3TA 4ND5A 1IHUA 1Q92A 1H5QA 3FTFA 3GZNB 5CT4A 2LNDA 4MV0A 3O0DA 3P0RA 5MFPA 3E2PA 4FT2A 2ODPA 3RKUA 1XU4A 1B4DA 3DL4A 5CB0A 1SU8A 2IOQA 2FSGA 2L19A 2IP4A 2V74B 3O4JA 1SG9A 5ABPA 4FGUA 3U6KA 1PL0A 3PDHA 1QCDA 4JC8A 4WJZA 4UBIA 4UU8A 3RGWS 2CMDA 3HLTA 4QWWA 2JZNA 3TSOA 3VTAA 1RC8A 4UFOA 4O4HA 3EPJA 1D2MA 3GROA 5IPFA 1CUXA 3KDAA 2WDPA 3KD2A 4LY6A 1L4LA 3EBLA 4ZVSA 1ZGCA 3V4LA 3K35A 4H7EA 3KX2A 3MRXA 4F93B 1ZN7A 2ZROA 3QYJA 3RU3A 4O4HB 4P98A 5F2OA 2H31A 5M29A 3G9TA 4C05A 4V0ME 4JLBA 4ZTZB 5AICA 3HUEA 5COAA 2R5WA 1UPAA 1A82A 1KYWA 1LV7A 5CMLA 5F7XA 2YWBA 3H0KA 4LQ4A 5F77A 3IHLA 4E15A 1Y5RA 1QDLB 1X1QA 1ZEMA 3A14A 4PYIA 4X60A 2BGGA 3C3JA 2VDLB 3U4IA 4GRDA 1CETA 4CG3A 4RJKA 2DR2A 2VPXA 4MV8A 3EA4A 4D0GA 3OQPA 1PJSA 4GC9A 4UVDA 3UUEA 1CY0A 4B73A 2QN3A 2VDNB 3OCXA 3QVOA 4DR5B 2OVBA 3WX0A 4CF5A 5FBVB 2QUJA 4AN1A 1IQRA 1WKVA 4XIGS 3MWLA 2ZYTX 5EJ7A 3OX4A 3A3OA 2ZBQA 4R0NA 1DX4A 1FUKA 1IM8A 2ZYAA 1LI4A 3ILSA 3HM2A 2QL6A 4KLZA 2GNPA 1E1MA 4NU5A 4TV9A 3TKLA 4EHJA 3L0CA 1TYEB 2WTMA 4NZNA 1U7HA 1TK2A 4WBNA 2G9VA 3GHYA 4U7PB 2JGEA 3CG0A 4D3YA 1XLVA 2NPFA 5KSZA 2IZ5A 1DC3A 1DUVG 2EZ9A 1ECCA 2GN6A 2XQFA 4TV9B 4RY2A 2GJ4A 2P9BA 4URVR 2FPXA 2FJUA 3RUPA 4WBNB 3JZMA 4KSYA 2Q9BA 3V2IA 1XDBA 2C7GA 1RHMA 4P1ZA 3QI7A 3UGJA 5CVEA 3I4LA 1M2JA 4YP5A 4TRRA 5FUXA 5KKAA 3T9EA 3UXYA 4MJ3A 4N3GA 1MV8A 1UBJS 2HSGA 4KEAA 5LNK6 4MGYR 2DVMA 5JJIA 2F1IA 4MB6A 3R23A 3W77A 1PZGA 3EIQA 3O9MA 4MYRA 5JEDA 1BMTA 4NV1A 3FOEC 1ACLA 1M0WA 2GZDA 4QJBA 5C8DA 5C35A 4CMEC 3G7NA 1Q2XA 5LJIA 1SUAA 2GO1A 1U6JA 4EJSB 3DBLA 3MM4A 4UNSA 4EAAA 4UTVA 2ISQA 1Z38A 4AY2A 4AKEA 1FDRA 1LB1B 3FTQA 3AR4A 1CRZA 3L7YA 2Q3FA 3OZVA 1PK7A 4H7JA 5IT9A 2VZ9A 1VBFA 3NKVA 3C97A 3DBLB 3E3OA 4BGVA 5F2NA 5LYJF 2CXHA 4UPDA 5L8VA 2YUTA 1P2FA 5F5NA 3TZEA 3HU2A 2FPSA 1JSXA 2AB0A 2CNOA 4AS1A 4GMDA 1L4GA 5EIBD 4EG4A 5EHNA 4GX5A 3RJ9A 2Q5OA 3LCVB 3N0VA 4W9RA 1Z5ZA 1XLTA 4K2AA 3H3JA 3ESAA 1YUNA 1J99A 2QP3A 3OZBA 2WT4A 3BK1A 5EKTA 5ALLA 2GJ8A 3QHPA 3VR5D 1KRHA 3WIUA 1VIYA 3FDJA 4A03A 1AGYA 4EUNA 3V1MA 2OFPA 2ZQ5A 1OJLA 2P9FA 4EDHA 1R1DA 1UBCA 1FBTA 3LLVA 4H18A 3WGZA 3ISVA 4E6PA 1DAGA 3O1IC 3HDTA 4MMYB 4XFJA 4DBLE 4N0EA 2GWRA 1QOZA 2E4YA 1OW3B 3DPIA 1G38A 5EI5A 3RJZA 2FB9A 1E3QA 1E9BA 4NIMA 5AVUA 5AP9A 1GUAA 2ZS7A 2C31A 2FQQA 1BW9A 1O89A 2BFDA 3AFOA 3HCCA 4II3A 1GPLA 1NXPA 2GUGA 4C7MA 3R6GA 2O9JA 4NU8X 5EKUA 4CLEA 4YECA 1BH2A 3KVVA 5JE8A 2HJHA 3KTFA 1D0VA 4RHFA 4XD2A 1MB0A 1V2GA 4XAQA 5LP6F 1TT7A 1BW9B 5L9AA 2BFDB 2E87A 2XWPA 1K06A 3TQSA 3CONA 5JCXA 2W42A 2HIAA 1SIOA 5GM2A 2A0KA 2H1IA 5HRAA 1DBQA 1V37A 4L3OA 1JEQB 4OHFA 4R1OA 4DC0A 1ESZA 3SC6A 1RWVA 1TIKA 2ZWPA 4CM5A 1TEZA 5TPZD 3KYBA 3BCUA 2JGNA 4G0WA 2UYQA 2QR5A 4TN1A 4KK4A 2E85A 2A9QA 4A0QA 4ZZIA 1WMBA 3A9WA 3AM5A 1NVKA 3TRIA 3M4ZA 3U60B 3VR0A 4MWOA 4ZV9A 4JCCA 1ADYA 1YR3A 2GCPA 1BGWA 1G19A 1SB8A 3TLAA 1GT91 2DETA 2RCNA 4G5HA 5CX4A 5IWAB 3PZBA 3T1NA 2REXB 2AL7A 1NOIA 1BVYF 1H8HD 5K09A 4W5TA 4ND4A 3AEXA 5LQKA 4MYCA 1P17A 4M54A 3LX4A 1YCDA 2JA1A 3S2GA 1Z5PA 1YCFA 3ZCVA 2OE2A 1MG0A 5J3JA 1E0KA 1FQJA 1IPHA 4NCJA 5KNCD 1F8XA 1B0PA 4G65A 1JJIA 3CXRA 3TGLA 2GM4A 2AF4C 1RZUA 3IMKA 4A3SA 3EMVA 3CSSA 4C2BA 4TKUA 3SQOA 4EHLA 1AKRA 5H1YA 2KX7A 1PUIA 2IZ6A 2YCLA 3LDUA 3MJCA 4EIWA 1JLKA 2QW8A 3PCTA 3ZLVA 4D02A 3ADBA 3DMGA 1UEIA 2OCIA 2OILA 4TKUB 5CG1A 3BSFA 4ZVNA 4MJXA 1FXSA 1I2ZA 4CQMA 2ZRCA 4CTOA 4O4IF 1ISIA 3NBQA 3EE6A 3WYAA 4C14A 3O8OA 1KJ8A 2FW9A 1JXMA 4PM4A 1XHFA 1BCRA 4CQMB 4BEJA 5A5DA 4I5GA 3NTOA 1G4AE 1VQ1A 3O8OB 2MWMA 4ZN6A 2I29A 4RGVA 1QS0B 4BVGA 4MA5A 3PIIA 1BCRB 4TS4A 2BM0A 4PPNA 1I7DA 1D7OA 2H9IA 1QBGA 5DM1A 5M04A 5A5GA 5I5GA 3T7JA 4NOMA 2G0AA 2D0IA 1E2DA 3TFWA 4DR6B 4EMBA 2FQYA 4KSCA 2IYAA 3ZBQA 3PBKA 2WFZA 3ROXA 4AFNA 3TLBA 2R8EA 4JI1B 3RG8A 4FOLA 1P6QA 3HCDA 5BSVA 1QG4A 4EQ6A 3H5NA 4EHAA 1ABEA 4CL3A 3GGCA 3C14C 3OZFA 5CDFA 3UMSA 3MELA 1MNQA 1OXMA 3ISTA 3CLSD 1UEXC 4HWGA 4IEIA 4KP7A 3AHEA 4FW8A 4L4YA 5CR9A 1BJTA 2NZYA 3BRWA 4IQ0A 4EQ6B 1YVPA 4KC0A 4V2UA 4D92A 1YZFA 5SYAA 4DLKA 1YZTA 1U7DA 3HXOA 3R7NA 2J6BA 3I2YX 3CS3A 1Q7RA 3CKLA 4DT1A 4B7AA 5JFTA 5JROA 2P9EA 3R9WA 5MN6A 1QU2A 2PUHA 1QGAA 2DPXA 2NZ8A 4F3CA 2XKJE 1IVNA 1YIOA 3PUYA 1Z45A 3GRYA 2E1PA 4MIOA 1KWKA 1KEEA 4DT1B 4GM0A 5H4GA 4X1KA 4C2UA 3SGLA 1G4HA 3PGA1 5A04A 5DBIA 3C3PA 3DP7A 4R6XA 1AXEA 3AUAA 1KEEB 1XCGB 5AKYA 1Q19A 2XI4A 4PNEA 5EEGA 4X1KB 5ALYA 1S2MA 2R1UA 3E5MA 2G70A 3Q88A 5FKJA 4J3NA 2FF5A 3MW8A 2XEDA 2VT6A 4JUAA 1KRXA 1VG8A 4ZMBA 2GPAA 5CEEA 3I61A 2VP4A 5I4KA 2Q6VA 4PXAA 2H7YA 1CT9A 2WP8J 4JQYA 2J46A 3OZCA 1SUFA 3SC3A 5FJIA 1NF2A 3X1WA 4YCBA 2O14A 2J48A 4L50A 1UAGA 2FN7A 3BSSA 5FOXA 4DE5A 1XZBA 3PQ2A 5EQFA 1PEDA 4QG7A 2P40A 3LP6A 4P3NA 3L07A 4EGJA 2GK6A 2H2DA 3P26A 3PB3A 4B47A 4DIBA 1A8QA 3P9IA 2WF8A 4WJLA 1E9SA 4GR4A 1GIAA 2WUWE 3OP4A 4EB0A 1S9HA 4MWEA 2RHMA 2P4HX 3GGPA 3MG9A 5G1PA 4AJ4A 4QGBA 5BVHA 2AJCA 2ZT6A 3EN0A 3M6FA 1O2DA 9GPBA 1VPWA 5ADVA 2YBEA 1V3TA 1JDVA 4HI0E 4YALA 3U7GA 3C87A 3NCHA 1G3RA 2W2MA 3MAAC 1W75A 4GU5A 5BVHB 1B76A 1AD2A 1DAHA 4R7TA 5EIEA 2QUAA 4PAMA 4AVYA 1D4ZA 1Z6AA 2HJVA 1OZFA 1Y6JA 1GPKA 3JQBA 3KSZO 1JE0A 1XTUA 3CB2A 4P83A 2RE8A 5CG2A 1W59A 3PG5A 1MAWA 4NC9A 3GH3A 3H42B 3QVSA 3EVDA 2DULA 2Z2YA 1FYWA 1R0ZA 3HNRA 4KN6A 2VA9A 4MJ7A 2IV7A 1OBFO 3C6ZA 5A3RA 2YOHA 3CLTC 1Y3HA 4HNRA 5IZ4A 1N6NA 3VMFA 2PQMA 2H16A 1J2TA 4BVEA 1KU6A 4MUMA 4EG3A 2GEUA 3VH1A 3L79A 3S8YA 1JGTA 4ND6A 3U19A 2H2AA 2QQEA 3DFFA 3O3CA 1CHNA 2HMYB 2H85A 1Q77A 3A4NA 4AG5A 3PNBA 1B2RA 2NG1A 4YI3A 3EEYA 3KTDA 2PXCA 4X7PA 5LLTA 1PEAA 1OH8A 4PHCA 4GMGA 4PLGA 2PT5A 5ITSA 2DLCX 2VHQA 3EZ9A 3C8ZA 1GPWB 1XYVA 3IMFA 1L7VC 3SKVA 1YU9A 1ZXLA 2BM1A 2P27A 2V7VA 1OASA 5ESRA 2X8JA 3ZNNA 5JOQA 3MMXA 2CL0X 5MDHA 1RTTA 3IRVA 4JZKA 3SXPA 3DAFA 1KH2A 4G4SO 3O2QB 3WA6A 3MCTA 3H7AA 4TT8A 1QAMA 2JF0A 4FUTA 1LBQA 4U2KA 5JISA 2WFMA 4BFZA 3J81A 4W6QA 2M6KA 3EZNA 2X8JB 5LQCA 3DFKA 1A7KA 1FJGB 4RMGA 5IXSA 3E53A 2Y27A 3GEMA 3KHKA 3NETA 4LOHA 1N5LA 4PXSA 3IUJA 4UEJA 2CVQA 3ISJA 3K96A 3EGEA 4ROSA 3TUIC 3I2HA 4NTZA 1X87A 4OJQA 3V48A 3WGNA 4BMOB 4BNGA 1M8KA 2G06A 3KUCA 1EVJA 1SKQA 5HRCA 1ULZA 2MOKA 1FA9A 1W29A 3IQFA 4XJXA 4Z8XA 5DZSA 4RVOA 2Y77A 1V8PA 1U9YA 1YB7A 4YJ3F 2QVXX 2AUTA 2DPYA 2CBZA 4IDFA 3UM9A 5KWEA 3HB9A 4D98A 2ZCVA 1ZH4A 2MSLA 4IOKA 4FHCA 3DBOB 3M5CA 2OAQ1 2P62A 1G8MA 1PG0A 2WV9A 2XCOA 1NVTA 1LPBB 3F3KA 4LZZA 1P33A 2CFRA 3IXMA 4F97A 1GITA 4GXNA 5DHRA 3ZHVA 1L7DA 2LE0A 2O7RA 3QE0A 4XYLA 1YJXA 3LHDA 1P60A 3HXLA 3SF0A 4HVLA 2V7XA 2JFFA 1MRNA 3EEBA 1ZN9A 2PX4A 4HMPA 5REQA 4NI5A 4GYYA 4LDPA 5I9BA 3RRZA 4Q24A 4NYJQ 2B2NA 5I9TA 3T7RA 3OQMA 2QYTA 4ZRDA 2ANBA 3LH5A 3LXXA 4ZWNA 2OYSA 5REQB 3VO9A 3WGVA 5KOIA 1Z83A 5KOJA 3KT8A 1H0RA 1B8UA 1RQ2A 2XOEA 1DU4A 3LQYA 2W2TA 3OUZA 3OZEA 5FR2A 3GU3A 3F6RA 2XJ9A 3R3XA 5IXJA 4FEYA 1U0JA 3VPHA 4DLWA 1PF7E 3GBSA 3QENA 4X7BA 5KOJB 3DTYA 2HY7A 1G1AA 3A1UA 3KUKA 4TV8A 5DCLA 1E2QA 1QFYA 3K0CC 2GBFA 2HIGA 3G2LA 4JP1A 3PNOA 5DWDA 5KNBD 4FMBB 3UK6A 2J3KA 2QNBA 4W5WA 3LGAA 4HB4A 1M34A 2HHCA 3EQZA 2ZE8A 4RENA 3F6YA 3OCUA 2DWCA 1NW5A 2VAWA 3WFZA 1AHPA 1U28C 2QP4A 2C2OA 4Y2XA 4B2IA 1WSWA 1ZGZA 4RVUA 5K0JA 1M34B 2QGFA 3KQSA 1H4TA 4IGKA 3W8DA 4BMYA 1P0QA 1NJGA 3CX3A 1LRKA 2ZRLA 5EHGA 2WIKA 4JJ7A 5D6NA 2PUEA 1A5ZA 1YDGA 4P3KA 4WOBA 5JUWA 1WZ2A 3UK2A 1YUBA 2LWIA 4F2WA 2WJZB 3RGGA 2DEUA 5HZHA 4CEIB 1QBKC 1UEJA 4B3HA 1D6SA 2VHCA 1R6VA 4BP9A 1JSCA 2W58A 2V7GA 4WLFA 3KRTA 1S1MA 3BJEA 4H4DA 1MAAA 2VVTA 4QTZA 5B36A 1NRIA 1VHWA 2I65A 1D4OA 2F4NA 3DDOA 2EKBA 2V5UA 3KS9A 2QTNA 3I1JA 3YASA 1VTKA 5EN4A 1JHVA 3VC2A 3WGQA 5EZ5A 1CVLA 4LOAA 3QPUA 3AUJB 2DQYA 5BV2P 1IK6A 4Y1RA 1G8KA 4AS2A 1N1GA 1H2FA 1OHHD 1QB7A 4LQDA 3EWSA 2Z30A 1YQUA 3Q85A 3O2SB 2VPPA 1W2HA 2IU4A 4Y1RB 3I2KA 1P3JA 1IEVA 5EIAA 3THYA 1Y1TA 4URHA 2LPMA 4IG9A 3A11A 1JR2A 1ZI6A 3TSCA 3A9TA 5AK5A 4LGMA 3LHFA 4AJJA 5EY5B 5FFNA 1ZOLA 1L8XA 2C88A 8LDHA 3THYB 2FN4A 1NQOA 3N8NA 4ZCRA 1PEKE 3A2LA 3AEYA 3D7LA 3GFQA 3EXIA 2GBGA 1N0WA 4GC5A 5TC4A 3B3FA 1NBME 3I9OA 4TQ9A 4OGFA 4XLTA 3SP1A 3MGBA 3R0ZA 1YI8A 3C7AA 2D0PB 5C4GB 4Z49A 1D8AA 4KXWA 3KB1A 4OBEA 5MGNA 4OI1A 4IDNA 1RJWA 1P7WA 4DV5B 3EXIB 3OHSX 3AR3A 2KBFA 4JLWA 1A9XA 4RV5A 1Y3FE 5KOYA 4LZLA 6PFKA 1QRTA 1XU9A 3QXGA 4UATA 4XB1A 2ZWOA 5AW4A 3K0CA 3RFTA 4XRGA 4K6GA 4EYKA 1A9XB 5EP3A 4ZEWA 1ZAKA 1HE4A 1WD7A 1JIXA 5KAPA 1N8NA 3NQ41 4EECA 4PN3A 3CZ4A 10MHA 2Q8QA 3QXJA 4K1LA 3C43A 1XZJA 4Q5IA 1J06A 2J31A 2V6JA 3D6FA 5IAEA 2J08A 2Y0PA 2MMCA 2BVNA 3NBZC 2ZIXB 4BKOA 4Z2AA 4OATA 4DRYA 4ZOLA 2JHPA 4PAOA 1GR1A 1GDHA 1BKDR 2I2CA 2ONKA 2QVBA 4JUDX 2G88A 1E6UA 3FPCA 3KZOA 4KKVA 3INGA 4RIFA 5CB8A 4WXEA 3P96A 5GIPE 4D99A 1OI2A 4YHBA 4ZOLB 4FOOA 2EBWA 3TBHA 3WL4A 4D8UA 3L1HA 3FVWA 3I62A 2P6MA 1IXZA 3A6HA 4YA6A 2X23A 2DKOA 1G2IA 3GFTA 4P4UA 3ZHUA 4WUVA 1ONSA 4Y2UA 1M5RA 3N0XA 4QQKA 3IR7A 1IL0A 4PZYA 2Z8YA 3G2HA 4K9SA 1V7QA 3VKWA 4WFJA 4RO0A 2XQIA 3IL2A 2F59A 5ALFA 3L1KA 4H08A 4FDAA 1X0VA 1R8YA 4Q9IA 2CXOA 3OFND 4IDDA 1LLCA 3SSNA 1NY6A 4WZ6A 5IDQA 4MV1A 2AZ4A 2PLRA 2ZITA 4J3JA 3GRCA 1ABFA 1BQ3A 1XAJA 3SEZA 4CLRA 4H6VA 2VJCA 3PUKA 4MW9A 1QP0A 2P6PA 3L9XA 3F4LA 1CY4A 1P4HA 2YZ2A 4FU0A 2B6NA 4KQKA 2WJ3A 3USCS 3HABA 4MGHA 3UXMA 3WL8A 4F9FA 1UBMS 5B6IA 1P3Y1 2P4UA 3Q40A 1DDIA 1WTAA 4LDAA 2AHOA 5DM4A 1IN5A 4RPLA 5HKBA 4GICA 5KNDA 1CG6A 4EZIA 3UAOA 5EQDA 1I51A 2G08A 3OCCA 3EJWA 4UM5A 3O74A 4CLXA 2NN3C 5FT9A 2Q1YA 3SE0A 4AWAA 2EJVA 4H6XA 3SOZA 4A16A 2FWRA 1DC4A 4F3KA 3CBGA 3SPXA 4P33A 4FHZA 3WKEA 2NAPA 4QASA 3CX4A 5JADA 5F9HA 2AW3A 3I6QA 2NO1A 1G66A 2R60A 3OWHA 3P94A 2E9SA 1VG9B 3KEFA 4IIHA 3QWIA 5KTRA 4AKIA 3P7MA 2QENA 2B8JA 3OIWA 1JTEA 4LYHA 1XZCA 5AOBA 16PKA 2ESRA 1NN5A 3VPGA 1T43A 1XJWA 4IIJF 4LHZA 2TMYA 2ZCJA 3ES9A 4DLZA 4GDFA 1R0LA 4OXYA 4CKEA 2JLBA 2WIBA 3LDHA 2X15A 3BL5A 3ANYB 3A3YA 1EVYA 2HI0A 3HO6A 3O0TA 4KXVA 1D7AA 2F3SA 3AGQA 2Q5HA 3ORHA 2ISSD 5D7BA 4CKEB 1HTBA 3BJZA 3H5IA 3K5IA 1VMDA 3ECAA 1H0KA 1PJTA 5AKLA 3RODA 3W05A 1OIXA 5JAPA 4YTEA 4KH1A 5J59A 1TK9A 4B6GA 1QNLA 2P6OA 4FMCB 4QT0A 3A6GA 3E15A 3G0OA 4QXRA 4QXPA 5BSMA 4RJLA 2INGX 4M99A 2IYVA 2H1HA 1K9VF 4RF2A 1E59A 4B3BA 4QDKA 2FUEA 1QIIA 1XIVA 1X1TA 4YRLA 1BX1A 4KVZA 5CU7A 4IDAA 3K1YA 2OZEA 1QAOA 3I1FA 3GCXA 1PLKA 3GDHA 3ZE9A 1AG9A 1NAIA 1DG9A 1Y1PA 2C9OA 2AE2A 3FDXA 2QK4A 4OKNA 5CGZA 3RASA 3VRHA 4KXXA 4UAJA 2J30A 2WSMA 1PUXA 2DY1A 4QEKA 1FLAA 1WQ4A 2A7XA 2AFRA 3DE4X 2O8CA 5T6MA 2VP5A 4MYDA 3ZLUA 3VISA 2G1PA 3AV0B 5C18A 1N78A 1I13A 1JKXA 3H9EO 4MW5A 2K7ZA 2ZJ5A 4H3KB 4Y2SA 5CXSA 2YFQA 4OLJA 1KZGB 4NP6A 4Y18A 3N2EA 3V8EA 1JI3A 1XN4A 4JJ6A 4UTNA 2EFJA 3EGWA 4V0NA 5B3JA 1MH9A 1ENPA 1Q20A 1SU7A 4N01A 5B12A 1GPH1 1T0PA 5J40A 1YOVA 1BTOA 1SBHA 3W4JA 1F6DA 1ZP6A 3WI7A 5LBTA 1WLYA 3C3EA 1LNSA 4RH3A 2BPOA 3FPBA 1EDZA 1KQFA 1Y34E 4NEHB 3NDRA 3MUOA 3L1IA 4JYPA 1GAEO 1YOVB 4KL8S 1XD9A 1WDLA 5DGTA 4P7FA 1YA8A 4KR0A 5LWQA 1YTUA 3AINA 1TCVA 3W2HA 2CXPA 1OFUX 4H77A 2K2WA 1K7SN 3D8HA 4UMEA 3W6OA 3W9BA 5BUQA 2YNMC 1V71A 5TMEA 7AT1A 4MROA 1S3FA 3URKA 3G2IA 2VAVA 3RS2A 1Y8RA 2X3FA 3ZNPA 4FZ5A 1IOVA 1VOTA 3RJTA 1KAEA 3N9IA 1AUOA 1OMOA 4QDXA 3WKAA 1ODJA 3RAPR 4RCVA 1QIFA 2R8XA 3K2QA 2FETA 3AUXA 4I4LA 1UMBA 1Y8RB 3K9CA 3ID6C 4RY0A 2IYNA 3UJ9A 5CJPA 1R6UA 2CB9A 3WJAA 3ZUGA 4RXTA 4DMKA 1KNXA 3LLUA 3W5JA 3OWOA 5JJ5A 1DAPA 3NUQA 2HBYA 3OT1A 1W96A 1D8TA 3WJ1A 2Q5LA 1TZ2A 1UMBB 4JR0A 1W85A 3ZJVA 1US8A 1NN1A 1P9RA 3ONVA 2PZBA 2V6MA 4O2BA 3WLFA 3OT1B 2YFKA 4OF4A 4YK7A 1BVUA 1DNPA 1XA4A 4XUEA 1OB2A 1MOQA 1W85B 4XGIA 4ENRA 1PZHA 1WO8A 1EI9A 1US8B 3CRRA 2B7LA 5DSZA 2JASA 4O2BB 3NPMA 4V2IA 1CUSA 2GPTA 1WHTA 2PZLA 3W9SA 1C4OA 4DY4A 4MDEA 4EM6A 4C88A 1XCPA 3VZDA 4R2LA 5AK4A 2BT4A 1R27A 4QUKA 4NZ9A 4OSPA 1WHTB 1PV4A 1FNNA 1I3LA 2DR0A 3HR7A 3JXEA 3ZZUA 4ESEA 2PN1A 3M8KA 5JNWA 1BQEA 1J2JA 5DXFA 1WJGA 3VU9A 4FJ2A 2JAUA 1Z0KA 3S8EA 4TL8A 4J1QA 3CKMA 1TUGA 4EFMA 4HWRA 4Q9AA 1DTEA 3EZYA 3VU9B 2XKAA 3PNLA 4A0FA 2Q9UA 4L0CA 4CVNA 1ZLXA 3I9MA 3HCPA 4IWNA 4ZCPA 3FETA 3T0GA 4DGQA 3JW8A 4BN4A 5FUYA 4CKXA 1B74A 1E69A 5ICSA 4B3RB 1NXOA 4II2A 3B3AA 2FMUA 3H2GA 2Q99A 3O9VA 3TSYA 1FFDA 3OY2A 5TNXA 2ATIA 5ICCA 1E89A 2DUWA 1FDUA 4W5HA 5CM9C 3CH7A 1P3DA 3ICVA 5MHTA 2H1VA 2E6KA 4B3JA 2Z6UA 2QLJA 4X92A 1YBHA 2YY7A 5KVVA 2BLNA 5JYEA 2YNMA 5DYNA 3LL4A 2FFHA 3HYNA 2DUNA 3A4MA 1MX3A 2MDTA 5H80A 4NCNA 2XNKA 1VHQA 4BIMA 2O1WA 3HDGA 4CI0B 4CFZA 4Y98A 1TU3A 4FGSA 2TMKA 5JWOA 4M7OA 3ZIDA 4E5UA 3CVVA 2Z1DA 4M6WA 4D57A 5CURA 4FYXA 3AY3A 4N1AA 5JO9A 3HB1A 3Q7EA 4AD8A 1H2AS 2JFBA 4BMZA 2QRGA 5K3EA 1GZ7A 5HTOA 4D6YA 3I4CA 4NYMR 1GL7A 3GA0A 3HXPA 4HFMA 4W6ZA 4Q9JA 5FWNA 2AI2A 4IIEA 1WB9A 4BV8A 2WWGA 3OM8A 1S9DA 1QIHA 1U90A 1V3VA 3A26A 3SYMA 5C80A 4IHJF 1XZFA 3HB7A 2UAGA 3QPCA 4O02B 4GECA 4F92B 4HBZA 2A9PA 3G9ZA 2V4MA 3MD9A 4IZOA 1SHZA 4BKMA 3G49A 4RETA 4YQZA 3DO8A 3NHMA 5LPNA 3K8ZA 1CJTC 4DUGA 1MFZA 1O5IA 4QUIA 3W2IA 3IP8A 1OA1A 3LX6A 1K89A 4M1WA 1R50A 3PWTA 2CJWA 4GM4A 3FOWA 2I8AA 5GWXA 2R7NA 1FYVA 1SVLA 1NVDA 4LRTB 2DWPA 2MINA 3BE5A 3F4BA 1T26A 2D5BA 2QX4A 1O7JA 2YUIA 4EGSA 1Z0ZA 2OV4A