2O2HA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis complexed with 1,2-dichloroethane
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of haloalkane dehalogenase Rv2579 from Mycobacterium tuberculosis complexed with 1,2-dichloroethane
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase 3
total genus 112
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o2hA00
3S8YA 4ZV7A 3O9MA 3WZMA 1ORVA 3IUMA 3ED1A 1XZJA 3G8YA 2WUEA 4BZZA 3IIIA 1XZCA 3LP5A 1PJAA 4Q3KA 3QPAA 3QBJA 3I2FA 1SOMA 1AURA 1FFCA 3R3ZA 2YXPX 3EIOA 1XZAA 1I6WA 4ARAA 1XKLA 1H2YA 3K2IA 3NWOA 1QIDA 1QONA 3P2MA 2HU5A 2WHQA 4M0FA 4CCYB 5AM5A 2QXUA 4H7EA 4QWMA 2ROQA 5HF6A 3I1YA 1BU8A 1W75A 1R1DA 2JBWA 3V1NA 2WKWA 2XMRA 3A70A 3B3QA 1LPNA 1ZD3A 2RHTA 3STVA 1Q83A 2PVSA 4ZRDA 3PFBA 3WJ2A 1WPXA 1MX1A 3WA6A 2PSJA 2XQKA 1OCEA 3RM3A 4Q05A 4L3WA 4GW3A 1CUVA 5CH3A 1J07A 1CFJA 3F98A 4BAUA 2WUDA 4X90A 3D2AA 4BCBA 3WWEA 1CUZA 5DNWA 1GQRA 4Q34A 1GZ7A 2V98A 2XUJA 2WUGA 3PUHA 5AKKA 1EB8A 2B9VA 4OCZA 5FPPA 5ALXA 4FNGA 4FKBA 5ALYA 1U2EA 4X97A 4Y2SA 1EH5A 2H7XA 3ANTA 2ONCA 1EK1A 2QTBA 1LPSA 1XZDA 3H1BA 4TVKA 4G8DA 5AI0A 1NU6A 4LIPD 4QDZA 5AJHA 4L72A 3VVLA 1XZLA 1QLWA 4XJVA 3RLIA 3WK4A 1G42A 4DMCA 5JD6A 3GA7A 3ZI7A 4YPVA 2PU7A 3I2HA 1WM1A 2XE4A 4KAJA 5FV4A 5IVKA 3A2NA 3NGMA 4TGLA 3N2ZB 1PFQA 4H7DA 3WLAA 4LXGA 3DS8A 4B9AA 5T4HA 4UBNA 3DYIA 4OYLA 3FYTA 1VXRA 2OGSA 2WIDA 5YASA 1FFAA 4HXEB 5C8VA 3AUKA 2JGIA 1H22A 1OILA 5LZ8A 5I8PA 4CIBA 4MYDA 4DNFA 4Q3OA 4GHWA 4ARBA 4PO3X 1CUGA 1UZAA 1XQWA 1XZGA 3BF8A 4I19A 4EHBA 5K5EA 4EB0A 1QE3A 2VJAA 2RONA 1MAAA 5JALA 2XMZA 5DNUA 1CLEA 5JIBA 2ES4A 4KAFA 4BE9A 4Y2YA 4FMPA 1BEZA 1Q0RA 1E3QA 5AI5A 4LHEA 3KDAA 5AKZA 1UT6A 1N5MA 4XIIA 1HBJA 3I6ZA 2WFLB 4P08A 1EVQA 1H2XA 4MWTA 3HEAA 1XZEA 5FDFA 4O08A 1WB6A 2DHCA 1ODCA 2V96A 3WYDA 4Z49A 1PV1A 2VQ6A 4J0KA 4C4YA 3GBSA 4BDTA 1ZI8A 2GBFA 3AZPA 1UK9A 4H7IA 3AZOA 5T4EA 4IHAA 1IUPA 2WFLA 3G0CA 3W9UA 3WL6A 2W22A 2HADA 1QIHA 3HXKA 5JZ9A 1SCKA 3I2GA 1YASA 1EHYA 2DSNA 5K3AA 5AIAA 4WCVA 2JGLA 4KRYA 1AKNA 4EA6A 4F60A 2H7YA 3I6YA 3SWWA 3STTA 5AOCA 1XLWA 4J0GA 2Y6UA 1JU4A 1VA5A 3H2KA 3O95A 4B84A 3O4GA 4G9GA 1QFMA 3FBWA 1BROA 3W05A 4IO0A 2ZSIA 1UKBA 5AH0A 1QJ4A 4L0CA 4DMHA 4DIUA 1LPOA 1E5TA 3OC0A 3H17A 5KWJA 4KACA 2JEYA 4QZVA 5HKAA 3RARA 4P92A 4JNCA 2PBLA 3M81A 2GYVA 1W76A 1J1IA 1QZ3A 5AM0A 4QLAA 3EF3A 4X94A 5BV7A 1X2BA 4B82A 4FNMA 5HFNA 4EY4A 3M82A 1CPYA 3PF9A 1GPKA 3MUNA 3ZLVA 1EVEA 3WWCA 1RYYA 2QKYA 2WTNA 3O4JA 5DLPA 2XMCA 3G0DA 2PSDA 3JYHA 5F4ZA 4Q3LA 1XLUA 1X70A 1TK3A 4QE3A 5IVIA 3IUNA 1CUEA 4X00A 3VDXA 3LS2A 4BAZA 4NZZA 2CZQA 2WUFA 1YR2A 5IVHA 1DWOA 4BVLA 4BDSA 4H7JA 1EDDA 4FOLA 5K3FA 5DWDA 5K3BA 5ISMA 4JEIA 2ZJ6A 5JANA 5JZSA 4JYPA 1D07A 3V1LA 4J03A 2RHWA 3W2TA 4Y7DA 3WK8A 3K9BA 4U2CA 3WJ1A 2QXTA 5C81A 2XUKA 4CG2A 4KEAA 5EIEA 5EHXA 3X3HA 1MU0A 3AJAA 5JYCA 2C0QA 5ALHA 4B0OA 4EZIA 1QO7A 2GYUA 2O2GA 3EQ7A 4D9JA 3C8DA 4PF1A 2WLSA 3C6BA 3ESDA 1HKHA 1XKTA 4G4IA 4Y2TA 4CI9A 3HJUA 1UK6A 1Z68A 5K3DA 2BUAA 5LZ7A 2RAUA 3FYUA 3R3XA 1TCBA 4CG1A 4B81A 1LZLA 4B9EA 1KEZA 3TJMA 1OXMA 2XUIA 1R4ZA 2WFMA 1ISPA 1MX9A 4JH0A 4LKOA 2BCEA 4G8BA 3IUJA 2DHDA 2O7VA 5JD4A 1DWPA 2WIKA 5CT5A 4EUSA 3VVMA 3FYUB 3M83A 1VOTA 4BRSA 1LZKA 4MWSA 1FSSA 3LIPA 3BIXA 4H77A 2OCGA 4FFVA 5I9IA 4H7FA 2D0DA 2C58A 1G5FA 2D5LA 4OB7A 3B5EA 3IVMA 3AFIA 2HA2A 4Y2PA 1K6EA 4E14A 3QPCA 2G4LA 4GWLA 4M0MA 1XRMA 1UKAA 5ALWA 2OAGA 4EY5A 3QPDA 5D7BA 4AZ0A 5IH7A 1K63A 1MNAA 2Z8XA 3ESBA 4C89A 1F0PA 3FYUC 3D5EA 3FLBA 1VXOA 2JGJA 1ORWA 4JUIA 2IX9A 1RP1A 1QIKA 3D7RA 3ICVA 5I7UA 4HXFB 1NX9A 2HFJA 3G7NA 1VJ5A 2XUPA 3FNBA 5SYNA 1CUYA 3G9ZA 3I1IA 3IB3A 1ZD2P 2VA9A 4KRXA 4XVCA 3HSSA 5LP1A 4PSUA 1BN6A 1TKRA 1WCYA 4BE4A 4AZ3A 3E4DA 2CBGA 3JW8A 5ALOA 3U0VA 5AKYA 2PUHA 1O6GA 4OU5A 4N5IX 1W4LA 2I3ZA 4OSEA 1BCRA 1IUNA 3C5VA 4UPDA 5LZ5A 1VA4A 1YAHA 3S2ZA 3IUQA 5ALJA 3O4HA 2VATA 4UHHA 1N5RA 3WWPA 2XMQA 1W52X 4AX4A 3DKRA 4EBBA 3O4IA 3I2IA 3ZV7A 3GZJA 5LLSA 4DNOA 2ZYSA 1CUWA 3LLCA 4X85A 2PUJA 1FFEA 1ZGBA 1H2WA 4AO7A 3D4LA 4PW0A 1THTA 1ZIYA 1JMYA 2B61A 3I2KA 1N1MA 5KBYA 5CT8A 5LZ9A 4HS9A 5JAUA 2PKYX 2OGTA 3I2JA 4OU4A 3DD5A 3FOBA 3D59A 1VE6A 3WA7A 5FUMA 5E2IA 3AIOA 4UHDA 4C6HA 5K3FB 4QDXA 4CG3A 4WDQA 1A88A 1QIMA 1CUHA 3B12A 5SYMA 1WOMA 1EK2A 4BVKA 3LCRA 4XX1A 5EIHA 2PX6A 4U2DA 3G9XA 3F67A 1O6FA 1G4HA 4UUQA 1T2NA 1JJBA 4Y2VA 5JAOA 2RIPA 1A8UA 5D3ZA 1E66A 3UUEA 4UHEA 1XFDA 5CTAA 3BF7A 2VAXA 5CT4A 1UOQA 1FFDA 4DGQA 1CRLA 3MUOA 2WG0A 2C5FA 2PPLA 1WHTA 3KWJA 1E8MA 4FWBA 5T4BA 4NS4A 3FLAA 3F97A 4GEGA 2XQJA 3WKEA 1CEXA 3V1MA 5HZGA 3TRDA 3MGAA 3AILA 2CMFA 4BB0A 5ALZA 2GBCA 5FOQA 2H9YA 4K6GA 4INZA 1IMJA 3WWDA 2Z8ZA 4KE7A 5C8XA 3TGLA 4A23A 3R3VA 2JGEA 3G9UA 5JZBA 2GZRA 2WG2A 3KD2A 1ZOIA 5AM3A 3V1KA 3PE6A 1J06A 4BP9A 1QO9A 4IH4A 5HF8A 2HU8A 4EY7A 1XROA 5AI6A 4OYYA 1DT5A 2XUAA 4K5QA 3CCBA 1XZKA 3OTQA 1M33A 2XT0A 5ALNA 4QA9A 5EFZA 4C4ZA 5K3EA 1ZICA 3WL7A 4C4XA 2XUFA 4H35A 5ALUA 3C6ZA 1K8QA 2C7BA 2JF0A 4G8CA 1UOPA 2W6CX 4J0HA 4N8DA 1VE7A 5FXMA 1UWCA 1E89A 1ZJ4A 1LPMA 1F0NA 4WFJA 3ICWA 1E8DA 2YYSA 1A8QA 2OG1A 4H18A 4ETWA 1BE0A 1ODTC 2BUCA 3FSGA 4FTWA 4AMZA 2J4CA 4GXNA 2PU5A 1R50A 1LBTA 5KWIA 1HQDA 4GECA 3AIKA 3SX4A 1LPAB 1CUXA 1AUOA 2WIGA 4U2BA 1CQWA 3OG9A 5DTJA 4AN0A 5HQ3A 2EDAA 2XUQA 4FFWA 1MTZA 4P9NA 5A6VA 1N8SA 4I3FA 1JJFA 4BC1A 4AB1A 2ZYRA 3C5WP 4BAGA 2JGKA 2WHRA 1CQZA 4UBKA 1ETHA 5DJ5A 5ALTA 1EB9A 5A7FA 1HL7A 2UZ0A 2WTMA 2HHAA 2WU3A 2VF2A 3ESCA 5AK5A 4A5SA 4H7HA 1P0QA 1YA8A 3H19A 2V97A 4IH9A 3WL8A 4G5XA 5EHNA 4UHFA 3WI7A 1YB7A 3PDCA 1MPXA 1YCDA 3SC2A 1IZ7A 4F21A 1XRPA 3NOXA 5J3JA 4XWGA 1VLQA 2R8BA 4UBMA 3YASA 3GELA 4RE5A 1SC9A 5ALIA 3H04A 5ALKA 2FX5A 2XLBA 2X5XA 1CR6A 2BUBA 3AIMA 5ALDA 4FBMA 3W04A 5AK6A 2Y2VA 2GZSA 4LYDA 3BIWA 4FBLA 3KWFA 1SCIA 5AKHA 5FLKA 4JYMA 3AINA 5AO9A 1DQZA 1XRLA 4C88A 4BBZA 4Y2JA 3F9CA 2GBIA 3R3YA 4I4CA 5AP9A 5AOAA 1U8EA 3FAKA 4EY6A 3D2BA 3RKSA 1P0PA 5AICA 5EGNA 4DMFA 1GT6A 5JD5A 4DSZA 4N8EA 2BKLA 3Q0TA 2BFNA 3RK4A 5KREA 1TAHA 4LXHA 5CH5A 2WHPB 3F96A 5CT6A 2J4FA 5EI5A 3QM1A 3FWHA 1L7QA 2Y1KA 1XQXA 3STWA 3ESAA 5H3HA 2IITA 4X95A 2HA5A 2OCLA 2WG1A 1MT3A 2I78A 2ZJFA 3C6YA 3G0GA 4V2IA 3H0CA 1B41A 3WK6A 2XUDA 4GI1A 4C01A 3BJRA 5AHXA 2JEZA 4B80A 2EEPA 4AN1A 1UFOA 3CN7A 5JATA 4WFIA 2Z3ZA 2X76A 2V9ZA 4N8SA 4UFPA 3BL8A 2QM0A 4KR0A 2VT7A 1L7AA 4B85A 2GBGA 2PSEA 3ZPXA 3HABA 1MJ5A 1Y7IA 2K2QB 3PF8A 3QMVA 1TCAA 3VKFA 1VZ2A 4X7BA 5FKJA 1GKKA 1DWQA 2C5GA 3VJLA 2QJWA 4MYSA 2XMSA 2AJBA 4AO6A 2WSLA 1W1IA 4E46A 4BC0A 1KU0A 1EINA 5FP0A 1XRNA 3G02A 5CBKA 1EDBA 2I03A 2H7CA 5D3KA 1K4YA 4MQLA 5LZ4A 1ZD5A 1JMKC 4MJ3A 2PSFA 1SCQA 3H18A 1B6GA 2JGFA 3VISA 5HFAA 4L9AA 1P0IA 4M0EA 5BWCA 4U2EA 2HFKA 3ILSA 1SFRA 1YA4A 5ALEA 3E0XA 4HTAA 3KSRA 4DNQA 4UHBA 2O2HA 2XUOA 2WHPA 5CXXA 3PI6A 1AZWA 3E3AA 1BCSA 5AM1A 1XZFA 4Q1VA 5LIPA 1JKMA 3PUIA 4UBLA 2HA6A 4B83A 3BXPA 3H1AA 2CJPA 5AM4A 3G0IA 1WHSA 4B6GA 1X2EA 1XZBA 1DQYA 2VJDA 3FCYA 3G0BA 5JADA 3D0KA 5E4TA 3WIBA 4PNZA 2RGUA 4QDUA 1MNQA 4J3JA 3WKCA 3O9VA 5CURA 2YH2A 2R11A 4J0CA 1U65A 3STUA 5HKBA 3C45A 3WWOA 4EY8A 1THGA 2QMQA 3L1HA 4ZV9A 1FJ2A 2VAVA 1R9NA 5AIBA 4X92A 5AKLA 3BDVA 1R9MA 1XQYA 4OUKX 3GUUA 3WKBA 5A7GA 5AOBA 4HAIA 1DT3A 2HL6A 2Y2UA 4BCDA 3DKKA 4HXGA 5CH8A 1A8SA 5JAPA 1ACLA 2AJ8A 1IZ8A 4OB6A 4X93A 1QIIA 3FVRA 4PQEA 1CUDA 3D3NA 3IDAA 5T4FA 1ZD4A 5HF5A 2QUAA 1Y7HA 4HRXA 1CUIA 7YASA 4WJLA 3KOOA 1BN7A 4OPMA 3PFCA 4MEBA 1ZIXA 3VXKA 2VJBA 3HZOA 1HPLA 1GPNA 4QEKA 2FUKA 3D2CA 5A71A 4CFSA 4FHZA 4MXDA 3VJMA 4Y2XA 3V48A 1CVLA 4G1FA 3HYSA 3DYVA 5AK4A 3IBTA 3WK5A 2CEKA 1LPPA 4E15A 2J3QA 3H2JA 1LLFA 4AMYA 5E4JA 2VTVA 2WJ6A 3QH4A 4ZGBA 3R3UA 1AMNA 3H2GA 2B4KA 2BJHA 1AX9A 2Z3WA 5A2GA 1J2EA 2Q0XA 1K5PA 4A16A 2XQFA 1EDEA 1U4NA 4BCCA 4OB8A 1H2ZA 1BRTA 1IUOA 4KJXA 2ECFA 2GYWA 2WFZA 3MVEA 2ACKA 2QJRA 1MN6A 2CB9A 4C87A 1Q84A 1HLGA 2VSQA 1Q0ZA 2WIFA 1C7JA 4FLEA 2QRUA 3M3DA 2QR5A 3EQ8A 1EI9A 3C87A 4IH1A 4ZWNA 2XUGA 3BDIA 2ORYA 5DNVA 3WKAA 3T52A 5LKAA 4AQDA 2OQIA 4FLFA 2JIDA 2WIJA 3DCNA 4KE8A 4LYEA 5IVDA 4PSCA 1CIJA 3EBLA 2FJPA 2FJ0A 2DCMA 5FRDA 3N0TA 1QIFA 1UK7A 1JFRA 2BAGA 3QMMA 4QDOA 3VJKA 2VEOA 3TEJA 2XB6A 4CCWA 5K3CA 3V9AA 1CUJA 3FVTA 5ESRA 3FCXA 3C43A 2ACEA 5AI4A 4BRZA 5ALVA 3PICA 5EIAA 5AI9A 4J0IA 3ZLUA 3WMRA 2NW6A 1W6RA 3DJYA 3IA2A 4DTCA 2HIHA 4HRYA 1VKHA 2HRRA 4QWWA 1UXOA 4BP8A 2J3DA 3JWEA 1EA5A 1AGYA 1XZHA 4KYVA 4BTLA 1CV2A 1R88A 3IULA 1YS2X 5A62A 5AKEA 2P8SA 3WKDA 4AXBA 3R3WA 3CN9A 2DQYA 1H23A 3R0VA 3C6XA 1XLVA 2DR0A 2HA3A 1WPRA 4J7AA 4HZGA 4UFNA 2QUBA 4CIAA 4WFKA 3DQZA 4YX9A 1VZ3A 5ALFA 1GXSA 3SK0A 4FLMA 3DNMA 1LBSA 2C4HA 2WU4A 3BE8A 5AI8A 4F5ZA 4U2GA 2IIVA 2HA4A 2OXEA 4X6YA 4CCYA 3GROA 4Q82A 1CUUA 2ZSHA 1USWA 3BWXA 1QTRA 1MX5A 4H0CA 3WIOA 3A2MA 4YASA 2QS9A 2QZPA 1BEEA 4ZI5A 5IKXA 3AZQA 2RI6A 1QFSA 5HCUA 3NUZA 3WK7A 4RPCA 2XMGA 3H2IA 5ALPA 5LYYA 4K6HA 4X91A 2VT6A 1XRRA 4G4JA 5CMLA 2XLCA 4QLOA 4IQ4A 2OPHA 3HRHA 3BJMA 2WQZA 1CUSA 5CRIA 3HLKA 3GFFA 3I28A 1EXWA 1ZI9A 2AJCA 3R40A 3UUFA 2LIPA 5E4YA 1YSCA 4G4GA 1TIBA 2O7RA 5C7YA 3KXPA 1ZJ5A 1S8OA 1MO2A 4NMWA 4UFOA 1YB6A 3G9TA 3R41A 2WM2A 5FPQA 2XI4A 2BGNA 3QYJA 5EHQA 2BGRA 5BOVA 4UBIA 1LGYA 2H1IA 1DU4A 5ALSA 3C8HA 4BVJA 1CUFA 4ZXFA 2AJLI 2ZYIA 2PM8A 4DYHA 5ALMA 4BATA 4ZREA 3QVMA 4H7KA 5AM2A 4GLBA 3A6ZA 1R3DA 4S0XA 4YK7A 3ZWQA 3Q8WA 1KU6A 1HDEA 3O0DA 4WY5A 3WYNA 5CW2A 5ALRA 2B20A 2CKMA 2ZYHA 2X8BA 4Y2RA 4UBOA 4X6XA 3E1GA 4RGYA 1T4MA 3T4UA 2G5PA 1Y37A 5AKGA 3A2LA 1MAHA 5AKXA 4DMKA 3ANSA 2PSHA 1GQSA 3F8SA 2DQZA 4DSAA 5AK3A 5HF9A 3DOHA 4BTVA 4TPKA 2OAEA 4P93A 1TRHA 3FSGD 1UKCA 3HC7A 5LKRA 4W1QA 5ALGA 4UBJA 4W1RA 4B7ZA 1NU8A 4GBGA 2XMDA 4X3CA 4K6KA 2QT9A 3W06A 1WB4A 2XDWA 3OOSA 2G5TA 1UK8A 1AQLA 3CCCA 2HDWA 2HU7A 2XQIA 4MEAA 2C0PA 2WILA 1IVYA 4AO8A 4F0JA 3H2HA 1DX4A 2XQGA 4G9EA 1F6WA 2JGMA 2XUHA 5DYWA 1QTIA 1QIGA 1CUBA 3U1TA 2QVBA 3STXA 2ZVDA 4LXIA 5JARA 1JU3A 3HACA 4GDMA 3L1JA 4Y2UA 4NVRA 3W9BA 1ACJA 1YS1X 2EDCA 2YASA 1EX9A 4QDTA 1XZMA 1L7RA 3DDUA 2OCIA 5AKJA 1YAJA 4Y2QA 1F8UA 4N5HX 4J0DA 1E8NA 5JASA 1JJIA 3QITA 4E11A 1TQHA 3OM8A 1QIJA 1XRQA 4PV7A 1GPLA 4WY8A 2OGZA 5ALQA 4W1PA 1CUCA 2E3JA 3WL5A 1C4XA 4HVTA 1C7IA 1GKLA 5DYTA 5ALLA 1BS9A 3OPMA 4ROTA 2I3DA 1UOOA 2WJ4A 4X6UA 3L1IA 2G63A 4K2AA 4WDRA 4W1SA 4W9RA 1DINA 1ODSA 3WQHA 1FFBA 3DLTA 1A7UA 4FDMA 4KE6A 4MQMA 1DTEA 1XQVA 3K6KA 4PSDA 3WZLA 4QNNA 4KAAA 2QOEA 5LZ2A 4DLNA 4UHCA 1DX6A 5HQ3B 3FLEA 6YASA 5HK8A 2HA0A 2HRQA 1P0MA 2AJDA 5A7HA 3HI4A 1G66A 3DEAA 4B0PA 5AKIA 3WK9A 3QZUA 5EHZA 1LNSA 2Y6VA 3EQ9A 2OQVA 4DM7A 2VJCA 4DNPA 5D6OA 3LIIA 3DL4A 2O2IA 5JAHA 3OURA 1GGVA 2AXEA 1JT2A 1ZI6A 5C8ZA 2DFPA 3CXUA 1ZGCA 4KE9A 5DYYA 5BWBA 3IURA 1WB5A 3DL7A 1CUAA 4BZWA 4BYMA 2OLEA 2DHEA 1QGED 1QIEA 2Z5GA 3QMWA 5HK9A 2CUTA 3I6MA 5DTIA 3UMJA 3DOIA 4RNCA 1RWQA 2ZJ7A 4J0JA 2HA7A 4RE6A 4Y9SA 3STYA 1XZIA 2HM7A 1QOZA 1AC5A 1LPBB 2PL5A 4ITVA 4U2FA 5CXUA 4X71A 3C70A 2XMBA 1JI3A 4W63A 3ZLTA 4OD0A 5CT9A 1TCCA 2WJ3A 2OCKA
chains in the Genus database with same CATH superfamily
4BLSA 2XRZA 3FMFA 1K89A 3V7UA 3F6PA 3K1TA 2FQYA 3QTBA 4OSPA 3T38A 3I9V6 3U4MA 2EKBA 3MG9A 2KX7A 3EWAA 3O9MA 4A2WA 1JAHA 3FPBA 4A1OA 4UTNA 4PZAA 3HWWA 3IUMA 5PGMA 4Y6PA 1KGSA 3WOVA 2FCAA 2NXJA 821PA 4C20A 4UARA 3AEZA 4BZZA 3IIIA 1P6XA 2GVZC 3GNTA 1XZCA 3HO8A 3TOXA 1NW5A 4P83A 2W98A 3JQDA 3LP5A 4BU1A 2XTAA 4FE3A 1PK9A 4Q3KA 2H1FA 1XX6A 3QBJA 1BO6A 1II9A 4DDWA 6REQB 2GEDA 2JIRA 2VFAA 4FOPA 1SOMA 2F7SA 2XCLA 1DDGA 3BUSA 2ZAYA 3CWCA 3FA2A 4FN5A 2VXCA 4KU4A 4O29A 1I6LA 1KWGA 3QEBZ 3DM5A 3D02A 2G4CA 4LCEA 3RHSA 4CLEA 1NI3A 1V8FA 4J4TA 1GUFA 5ADUS 1KXJA 4ARAA 3TLAA 1X7GA 3H2YA 5C46F 1IZZA 4HDAA 2DUUA 4R0MA 1RRKA 4GP7A 1QIDA 1QQBA 2DBRA 2XXAB 5AW3A 3V7FA 3OT5A 2WWGA 3NBKA 4MQ4A 4F9FA 1Q5PA 2WDPA 1QCZA 5ECDA 1V8DA 3WGMA 2IHYA 4M0FA 3W5UA 1CZUA 3B7PA 1CY1A 1TM3E 1E2HA 3MTAA 4CCYB 1DX9A 4CL0A 1VLMA 4KPUA 2JCXA 2ZIXA 4ZVSA 4GL4A 1M54A 1HFJA 1YCGA 3OX4A 1Q0QA 3KJXA 4HFNA 2H06A 5HF6A 3I1YA 1O7JA 1BU8A 4LEIA 3O2QB 3GRRA 3PFWO 1W75A 1O95A 3DFFA 5BRAA 1PT8A 2WJHA 4WGGA 3QWHA 1NJSA 1ISRA 1DEOA 1H8ED 4GBMA 4O4HF 4Q9LA 5DNEA 3V33A 5BSTA 4CF4A 1DXOA 4F5EA 4Z6KA 4FB5A 3A70A 4GSLA 1NKSA 1GTMA 1LPNA 3KPUA 1OX6A 3W9YA 2ZI3A 4WX2B 5B6JA 2H0AA 3QHQA 3EG5A 1I51A 2Y76A 1W25A 5TQJA 2P6UA 3BK2A 1L4BA 1T4CA 3FSJX 3U26A 4F91B 1G291 1OFHA 2VSOA 4JN6B 4XD2A 4JLUA 2ERXA 3QBVA 2VYVD 1Q20A 1C3XA 3FY4A 3WA6A 1D9ZA 1FQJA 5FADA 3TNLA 3CCFA 4I1VA 4ZN6A 3Q9SA 1FFHA 3ZXSA 4OXXA 2OV6A 4FZJA 2CLHB 4PYJA 5IZ4A 1VCNA 3OFSA 1E4VA 1M2EA 4Q05A 3AW8A 1V47A 4GW3A 4YRQA 2WSYB 4LV6A 3PRYA 1J07A 3ZQJA 4BAUA 1EQ2A 1U2GC 2ZQYA 1JE1A 2FFHA 4NSNA 2YRXA 4WXMA 3QWAA 4X90A 3NYRA 4G1BA 4L0DA 5GM2A 4BCBA 4GQBA 5KVQA 4AZSA 1CUZA 1GRRA 1GQRA 3M0EA 3GQVA 5DNWA 3JQFC 3UUWA 4ZI7A 4BKMA 1SUEA 4ZT6A 4ZDKA 3QVKA 1G20A 5B12A 5CLQA 4RJLA 3O2SB 5EKSA 1US8A 5AKKA 3O47A 3KR1A 1HE2A 2GRUA 4NDAA 3I1JA 1CETA 1TKCA 2ZI5A 5FPPA 3GGSA 2IYUA 3L4KA 4JEMA 3WHPA 1MW9X 3OM9A 1U1FA 2QDKA 2JCYA 2ZYVX 1DC3A 1AUQA 3I01A 3REFA 1MO6A 5IXSA 5E2BA 3LPAA 4PNHA 3EDQA 4Y2SA 1N32B 1XV5A 3MJEA 5KSYA 4YI3A 3EUWA 5C34B 3ANTA 4EY3A 1LDNA 3VYVA 5J5VA 1YTLA 1KFCB 3TXXA 4BFZA 4L4ZA 4JWTA 4LZAA 4TVKA 4UOQA 5C1BA 1TVKB 1GWNA 1L5FA 2YV5A 2GUGA 3AESB 4L4XA 4LIPD 5EEGA 4AS3A 5TEVA 4QDZA 4MOWA 4DZTA 4ZCMA 4Q1CA 2J3JA 3GMTA 4B6OA 1EWKA 4GPEA 3WK4A 2P1ZA 1OU0A 2UYQA 1ES9A 4JT4A 4XASA 5FPYA 4A03A 1LTHR 3TQFA 4MV1A 4AJPA 3WMXA 4ZIRB 3R6GA 4MI1A 1DC6A 4BMYA 5FYQA 5JXHA 2YMQA 3IMKA 3UCXA 3K4PA 5IVKA 3NGMA 1K6JA 4TGLA 2NYRA 1WZIA 5KNBA 2HHHB 3N2ZB 3GFQA 3LQ4A 1PSWA 1SO8A 4H7DA 2ZB2A 1U0JA 3CLTC 4LXGA 1GL7A 3A9SA 1GNLA 1Y8QB 1H4TA 3NHRA 1UMBB 1KO1A 2G36A 4C7XA 5CAEA 3DS8A 2Q41A 1L7MA 3GEMA 4QFDA 1Z2EA 1IWBB 5TX7A 1EFVB 4RPGA 3IO3A 4X9XA 3GDFA 5AOVA 1CY6A 2HMUA 3A9CA 3FYTA 3H5AA 1T0UA 4TS9A 4TT3D 4S05A 1FFXB 4OHWA 1RLJA 1ZCZA 2NUTA 1YBAA 3D4NA 3X2SA 1GQ2A 1T5OA 3EXHA 4GUAA 5F51A 4B6QA 4F3CA 5I8PA 4X1IB 4R7GA 2FE1A 4GHWA 1N33B 2VHZA 4ARBA 4KXMA 4PO3X 1UZAA 3OCZA 1CHNA 4AJOA 4EHKA 4PO1A 5EJ4A 2A3NA 1CDOA 1REQA 1SC4A 4L51A 4I19A 2P8JA 1A2QA 3OU2A 1GGKA 1Z2NX 4O4JF 3W2EA 4EHBA 2R0QC 1YS4A 1XWFA 1L1QA 4EB0A 3R5TA 1KXZA 1RQXA 2QBYB 1RVDA 1OV6A 4QJ4A 3FOCA 3QU9A 2YVUA 5CIWA 2VJAA 3ONFA 4MLCA 4F2GA 2YYYA 4ZI3A 1IN5A 3KYDA 1SVMA 2VYCA 3WWYA 5JIBA 2ES4A 3HXOA 2R7AA 5GJBA 7GPBA 1CJTC 1OYVA 1HDGO 4FMPA 5TRTA 5JFTA 5IAJA 1JNYA 3AUFA 2X4IA 5EEHA 5T3UA 1HTBA 3FVVA 3PK0A 4WESA 3PJFA 4NU8X 2IEYA 4J94A 5AKZA 1MB9A 1NYLA 3AG6A 5J2UB 3N2IA 1R15A 1X8LA 2M9MA 2V7WA 1HBJA 5LYJB 1GAXA 1SCDA 3OMWA 4ECEA 3ESQA 4X84A 4DXHA 4EAAA 2IXEA 3CQ9A 1AT1A 4EP1A 2VP5A 2GKSA 1ZYUA 3KKEA 4BQOA 3NHPA 1YC2A 3A36A 1U8XX 3T5CA 4DJAA 5BV0A 3WLQA 4HUTA 1N6NA 1RLOA 3GRZA 3U44B 3TVTA 3JQGB 3TSZA 4BY9E 1PR3A 4CMIB 1ELOA 2IPLA 4Z49A 3BHMA 5D3QA 5F23A 3GP8A 2X0FA 4J0KA 4L6CA 4FUQA 1MJGA 1F14A 5G0SA 1V7PC 3IQGX 3EZFA 3PQFA 3S2GA 1GTVA 2GWRA 4UM9D 1ZI8A 4X61A 4BN4A 4QBIA 2O8EB 2PZJA 4ENVA 2ZE7A 1VP3A 1YQWA 4H7IA 1F1BA 2LP4Y 3PGA1 3V42A 1HG1A 3CKYA 2EIXA 4GE0A 4QBHA 3IPYA 1S89A 3UK2A 4JBHA 3L8HA 5F1KA 1IUPA 2AEMA 3I3OA 4RY9A 4D25A 1AN0A 2GX6A 4E32A 3GJ0A 5BPHA 1I2BA 3OO1A 3DDNA 5F5XA 1CD5A 3T4PA 5EHGA 3ZE8A 3TQTA 1MOQA 1F60A 4QOEA 4K6CA 4RV5A 4AY3A 2HT6A 5LQAA 1NLUA 4URFA 2AN1A 2Q5QA 1M2WA 1U0HC 2GEJA 1ADBA 1EHYA 1RYEA 1YRAA 2DSNA 4IJ5A 4NFSA 5BYJA 1PDOA 3GBVA 3CMCO 1E64A 4JJ4A 5CLIA 2CB0A 3FDXA 3MWJA 4WCVA 1WNFA 4H3VA 3L8EA 1YU9A 4QUAA 3FGPA 1WVGA 1JR3E 3PXGA 4JQYA 3RFUA 2H4JA 3I6YA 3UTDA 4EKEA 3MHTA 3IJRA 3STTA 1M2HA 1Q57A 4PEVA 3IQDB 4TXLA 5F1YA 4JNKA 1B93A 4QYWA 1BXRA 1JV2B 3LT4A 4Q9IA 3PIRA 3QXHA 5HIIA 3KBBA 4YCLA 1B0AA 3JQ8A 1JU4A 1J00A 4I4LA 1G20E 1HE3A 2Z9DA 1Y8CA 3CW8X 3H2KA 3LBYA 3LRXA 1W2HA 8OHMA 4AQYB 3RSQA 1XZPA 2HMTA 2D54A 1QFMA 2P9ZA 4US0R 4Y2HA 2QLLA 2YWHA 3AL3A 3KT6A 4G5QA 4NAVA 5DISB 5DM1A 1KK0A 4ZT2A 5CNMA 3BD9A 4GOLD 1HEYA 1OF1A 2PYIA 2NACA 1G4AE 2XX3A 2GPAA 3G2QA 2EF1A 4LX0A 2RFLA 2F48A 3IP3A 3KLOA 3OLCX 4UDOA 4YIHA 1THZA 4I55F 2AK3A 1C2TA 2H1CA 2X2FA 1OW3B 3OFNA 2RGDA 2IYFA 1E2EA 2XW6A 5CFMA 1L6RA 4ND7A 1P2GA 4JYZA 2C83A 5FHRA 4BKUA 2E4WA 2YNMD 2FLKA 4GO1A 1LKZA 4FK8A 1NPYA 1GV1A 5CLLA 4UMDA 3U3DA 1XA4A 1U94A 2H6EA 3NV9A 4L0CA 4R2KA 4DDTA 1ZM2A 5CDSA 5EYPA 2JLBA 2O2XA 3HJTA 2EWWA 3KYCA 1TZBA 1Y5IA 3L18A 4MAAA 2JK0A 5KX5B 4I1IA 3V4PB 5FEUA 2A9FA 3USES 2AXPA 2DY1A 2LGJA 4YFVA 2R8OA 2CHVA 4LN1A 5KWJA 4JHLA 3V4SA 1N2EA 1BMQA 3HM9A 3VVCA 5HKAA 3FR7A 4MGEA 4ZOLF 2GYVA 3OZIA 3OLZA 4LBWA 4V24A 4RFVA 4ZYUA 1J1IA 4D9NA 1QZ3A 1JYSA 1XYVA 2RGYA 5AM0A 2B2NA 3U49A 1VE9A 3MFYA 3QBDA 1O58A 5BV7A 5L40A 3D3JA 5ERXA 4CMAA 5M34A 5JNWA 2XIQA 1N2XA 1WUJS 4OQDA 1VPEA 2R8EA 3LVBA 5AHOA 3UJHA 5B1EA 1P5FA 4FNMA 3HKDB 3SLGA 3NYQA 3RU2A 2OL4A 3ZDXB 3OEYA 4HVLA 3PF9A 2JLXA 3TLBA 1CE8A 2H31A 3F9RA 1E3LA 5ARDA 4OMUA 4N76A 4AJLA 5AQ1A 2H4FA 4HGQA 1B0ZA 1JQJC 1EVEA 3HGTA 5M2QA 3WWCA 1D7OA 2I3BA 1M6VA 1EJ0A 3OSUA 4WLEA 1XRJA 3UJPA 4TUYA 2QKYA 1NOIA 2WTNA 1YDGA 2QMYA 1TZKA 1O3YA 2J46A 3CR3C 1LBHA 4LRTB 4KH0A 4AG5A 1JZTA 2D5BA 4K3VA 2YJ6A 1CKEA 5TQ2B 2IBMA 4R83A 5HG0A 5A3SA 5HQTA 5JU6A 4YI5A 4JLSA 2CFRA 1JIIA 3FWNA 1LBQA 1THMA 2CZQA 2WUFA 2VZ9A 1TA0A 3O7WA 4GZMA 5CLHA 1EUCA 2FRXA 1OYWA 5HIMA 1DWOA 2Z8YM 2CJFA 1UT5A 3L82B 4HQ0A 2RB4A 4I5GA 4LECA 5AJXA 1IH8A 2YOGA 4ZO4A 1G8AA 3SS8A 3W8RA 3HL4A 3DP7A 3N05A 3GRCA 5AJTA 4IFTA 4QC2A 1M2VA 1QAOA 1S5PA 3NPMA 2YOHA 3RF7A 4C5CA 3PEEA 2X19A 3NETA 4JBYA 5KYWA 3VNSA 5JANA 2VT2A 3IBGA 3ZCPA 2C7QA 2GBLA 1D07A 1Z15A 3V1LA 1X7XA 4L22A 2AN5A 4JSTA 1NR5A 1PW7A 2FTKE 3JZAA 3GN1A 4OXKA 4H4EA 4W7IA 3RYHA 2IH5A 1H2HA 1TAQA 3JYLA 3BHJA 4FMBB 2RHWA 3R9XB 4BECA 2W7TA 1DWUA 3QKSA 3O0TA 4QFCA 4U2CA 4ZRMA 2QXTA 5BYBA 5ITZB 3HNOA 3WYBA 1VIVA 1G21B 1U4SA 3QKRB 4KEAA 4ZVLA 1HH4A 3HB5X 3I8SA 2QX8A 3JD2A 1NM5C 1JG1A 3OUTA 3HU2A 4PN7A 1GZ6A 2H63A 4B8WA 1C8VB 1HT2E 2BSXA 1U9JA 2NN3C 1R4MA 3AEQA 4HKTA 3PL1A 5A3JA 2R1ZA 3RAEC 1LW7A 1Z6PA 5CVJA 1PQ4A 1N92A 4FFLA 4BLUA 1MU0A 4D41A 5BT8A 3HPQA 4Z4GA 5DU2A 4B35A 5LJLA 2C0QA 2GERA 1RC1A 3IAUA 4UAUA 2Q2WA 3UVEA 5BUCA 2Z4RA 4KSCA 1SXJB 1YE8A 4LC1A 1NYRA 5FAKA 2G9VA 4KQJA 1Y80A 4QTZA 4O4JA 4EZIA 4FX2A 1YZGA 5DE3A 1BHO1 2BFDB 2DM6A 2WKRA 3SQXA 5EVCA 2MR5A 3EQ7A 1CIPA 5FWAA 5TPZD 3THSA 1TPZA 1VYHA 3C8DA 4FT4A 4PF1A 5T8KC 3VSDA 3V4ZA 5LDDC 4PG8A 2ASEA 2I7VA 1NVMB 1YIDA 1NMYA 1Z4NA 2EW1A 3F4BA 3MRVA 2COEA 3D0QA 3LUKA 4J1SA 1N9KA 4LVNA 4OXYA 1V1MB 1BC5A 1KBQA 3AU8A 3RHTA 1HKHA 4G4IA 1V8PA 3AM5A 1V35A 1K68A 1JF8A 5FTWA 3HPRA 1XXHE 5KJEA 5GAJA 2J32A 4Y2TA 5M5BA 2Y9PB 1A7AA 2INGX 4F2WA 2C2YA 4JLPA 3O8OA 5K20A 5K3DA 1NJ1A 4IZOA 4MV0A 1M0TA 3SHQA 5EZQA 4JP1A 5GJWC 4REOA 5E7QA 4IHJA 1K3TA 5KQGA 1KZ1A 5ADVA 1JEEA 3GB9A 4J6EA 4P4GA 4RK1A 4CM8B 3LHDA 3R3XA 1RC0A 1TLFA 5CPBA 4EJSC 1NUTA 3ROFA 4OMFG 4DLPA 2XNCA 2FMHA 1LZLA 1WD5A 1ZUD1 3EVFA 1NT2A 2QUIA 1VPLA 5KTMA 1K0UA 2NUAA 1OXMA 2FUG1 3WGVA 4ZMBA 2ENWA 2XUIA 2UYYA 3SQLA 1IHDA 1LY1A 3FCUB 4IXWA 2VA8A 4KI7A 2ZUBA 3WSWA 1TT5A 2G88A 4O63O 4OLAA 4N39A 1L4GA 5FFMA 1HMPA 1JAIA 2V4ZA 5A4JA 1D1TA 1IB0A 3Q15C 4ON9A 3SJCA 1Y89A 4JH0A 4LKOA 4MR8B 1Z26A 4FUTA 4OF4A 3QOWA 3V4OA 2I6FA 2JAWA 2X0NA 1JDUA 2D0OB 4D9BA 4FYVA 4PPQA 4WVFA 3G0HA 3RFTA 1IHUA 2NM0A 4Q4CA 3B3GA 1M8JA 3L6UA 5DNDA 2I66A 4HB2A 1C81A 2OCBA 2WIKA 3M6IA 2VG8A 4NBVA 1RADA 5AVUA 2C03A 5A6SB 3FPFA 5L7WA 4QOHA 4Z2AA 1CYDA 2DAPA 1TNDA 4ZJYA 3RADC 3HMQA 2MMGA 3C3BA 1VOTA 1H6BA 1XTUA 1XVVA 3SIXA 1JYEA 3PL5A 3LF1A 4OIFA 8ABPA 3CNQS 3RYCB 5HW0A 3EXEA 3KUCA 1GPAA 4R1MA 3VZQA 3D6AA 1BA2A 2RSLA 4Q66C 2XNDA 4N18A 1Q6ZA 4E5UA 3S2YA 5JNTA 3RASA 2OCGA 3HA3A 5I9IA 4N5LA 5BO5A 3KS9A 4CCAA 2FB9A 1AH2A 3K16A 1OY1A 2D0DA 3DDOA 1VJTA 3DQQA 4RDXA 1C9JA 5ITSA 2Y93A 4LF6B 2D5LA 4OB7A 3IVMA 2E87A 2HA2A 3IIKA 4Z86A 4EHIA 6CHYA 1OT5A 3HCPA 1N2CE 1QGZA 2VJNA 3AEYA 4GYJA 1HFEL 1MV8A 3RJ5A 2IGBA 1Q74A 2LZ0A 1SVIA 1QYWA 1CB0A 1BIFA 3LUBA 1NBAA 4IDHA 1H05A 1VMAA 3QY0A 1U3DA 1WF3A 3QPDA 4RA9A 4X0EA 1HOXA 3H97A 2I2WA 2J0EA 2VAWA 2VOJA 5LM3A 3DEYX 1CZLA 2IQ5A 1K63A 5IH7A 1KPHA 4OLHA 2JLYA 3ZKAA 1GAQA 1T6XA 2Z8XA 2H52A 3D9QX 3P0EA 3Q3IA 4FFSA 1M5UA 4QBGB 1P5JA 1RXSA 4W5RA 4D56A 3D5EA 3TMAA 4PQFA 4TV9B 2F1HA 1VXOA 3R8XA 1ZOPA 3TLCA 3T9FA 3U2QA 3B36A 1RYFA 4DRXA 3TTSA 2RHHA 2PT5A 1QGAA 4O2RA 2Z98A 4B6RA 1XAGA 4MSUA 4ACAA 3C3CA 1T5DX 3D7RA 3ICVA 5D8DA 3LLMA 2GAOA 1VQ1A 4XFDA 3KTFA 5L4NA 2VNSA 4HVAA 1TUEA 1WMBA 3D6UA 4HXFB 2O06A 1NX9A 2JJQA 3GYBA 3I04A 3VSAA 4AD8A 4DLZA 4EEKA 2G1JA 3Q5DA 4QBTA 3IMCA 1KE2A 1WW3A 4EIWA 1D4FA 1E0JA 5FHQA 2QD2A 5HJ7A 1J09A 2EJUA 3QFRA 2W2NA 1NSTA 4IHKA 1KFBB 4ILEA 4JVLA 5JNUA 4XWOA 3KKZA 3ROXA 3PEFA 5KAMA 2P2SA 3KOUA 4KRXA 1AU9A 4UULA 3KKLA 4I1PA 1TCVA 1II0A 4M1WA 2CXNA 2ESRA 2IS4A 4R3WA 3ZCQA 4DZZA 3PGVA 2H59A 2P4SA 5SYAA 3TTYA 1KI7A 4B45A 4UTPA 4AZ3A 1Q15A 1YQXA 4PXAA 1EGQA 3U0VA 1TC2A 5EIBC 2PUHA 1X7ZB 3W77A 5IABA 3SHTA 3DVRX 4GYWA 4N5IX 4LK2A 1W4LA 3TTVA 1T8YA 2X0IA 1U3VA 2VDUE 3BICA 4LRSB 3RVPA 3N86A 1ZVKA 3RRJA 3C5VA 4BO3A 3TG8A 2JANA 4PZDA 2XR1A 1E98A 5JS6A 5K0JA 2CT8A 3FYHA 1ZWKA 2GVDC 3CSDA 1G8YA 3KTAB 1MR3F 2C5BA 5DB4A 5K0CA 3A1UA 3OIDA 2GZ1A 1ZL0A 1CJCA 1OTHA 2I2DA 3FMIA 3S2ZA 4QRIA 3IUQA 1JHMA 4KQCA 4EOGA 3O4HA 3CRMA 1U1CA 2N9UA 2O8CB 4HDNB 3WWPA 3ITDA 2NMVA 1FRVA 4PHCA 4DW8A 5JY6A 1DOAA 4AX4A 1TD1A 5LB4A 2GPSA 1UBUS 1GYPA 1ZRMA 4CQMB 1DKLA 4EBBA 2NSHA 4GLJA 1HRDA 5KOHA 4A36A 4XIJA 3DLBA 4RZQA 4IMIB 1JHPA 5LLSA 5F77A 2C7VA 2XEXA 4LJ5A 4X85A 3JAKB 5FBLB 4KI0A 3EXG1 4YWJA 3EW9A 4M37A 4DJEC 4MR7A 3K05A 3D4LA 2WSBA 4CKYA 2CXOA 2J85A 1WPGA 4K28A 3R5HA 5BWMA 2FG7C 2O8FA 2B61A 2VBGA 4G67A 3GGCA 3TKLA 5KBYA 1POWA 3AKCA 3Q10A 2MSLA 4JUCA 5E1DA 3NTUA 3RSLA 3H9UA 1CK4A 5JCOC 1V5WA 1MC1A 2O7SA 2R4UA 4ND2A 3ZH2A 3ZJ4A 1C80A 3E2PA 4RHFA 2NVWA 4ZJUA 1CR4A 3Q4GA 4JOSA 3DBHB 4D9CA 4ZKDA 1VE6A 3MRTA 3WA7A 3DBRA 1SZCA 4BB6A 3T5PA 1GKIA 2HSDA 4QOGA 1NBMA 2JG3A 1UBNA 3OT4A 2VNJA 1O94D 2XCOA 1NASA 4FNAA 1EFVA 2IHNA 3P9NA 3LC1O 3ZX4A 2VBIA 3IQEA 4CG3A 1DRVA 2CEAA 1OXUA 1H2FA 1QIMA 5LL6P 3FNEA 2B8EA 4RZSA 4XCVA 2JA2A 3DMFA 2RE8A 2WF7A 3CUEF 3HJGA 4OYHA 5DHRA 3H8WA 3A32A 4YN3A 3WIVA 1LK5A 1EK2A 1HUQA 2J6IA 2X13A 5FWYB 3ZYCA 5EIHA 4B3CA 4BVKA 5I3ZA 2PX6A 4IGAA 1G3MA 1IN1A 1REQB 5DI9A 4UUQA 1YOVB 1T2NA 2OBMA 4BO8A 1LI5A 4YMUA 3PNOA 4K03A 4TN5A 2F00A 3RVSA 2FZKA 2Z95A 4GD3Q 3I45A 3VR4A 4G07A 1TW3A 2D7JA 1E59A 1UPBA 2NG1A 3PC2A 1F9AA 2VHQA 5FI1B 1VYTA 1UBKS 5D3ZA 1E66A 2B0CA 4E4YA 2QX7A 1GGEA 1GILA 3FDFA 3REOA 2WYUA 4WOKA 4YH1A 4DWOA 3QPVA 2FW7A 4BNJA 1ZL2A 2A1UB 5IXYA 2NXWA 2IPAB 4PFJA 1UOQA 4KPFC 3V8BA 1GNTA 3UJCA 1KFKB 3AJEA 3Q3VA 4TKMA 2BDTA 1PT6A 4MUXA 1IB6A 2O8NA 4JODA 4XYEA 2ST1A 3I6BA 3HYLA 4DRZA 3JPYA 4NG4A 3OQVA 4DV3B 2DT8A 1V9CA 1E18A 2AOUB 1V11A 4CVNA 4U6QA 2W43A 4LI3X 3NM5A 3E05A 3Q5EA 3V9PA 1J7KA 2PRSA 2I6SA 5T4BA 1SB9A 1TAGA 5JMTA 1D5CA 3FLAA 4GX5A 4ZEOA 5DTRA 5FPKA 2DPHA 1A3CA 3MJFA 3WKEA 1Y48E 5LSAA 4GMHA 2I22A 2GSWA 1ISFA 5HZGA 3MGAA 4R1OA 3RSOA 1L7BA 2Q3DA 2RC6A 2CMFA 4QYSA 3C7TA 3RHZA 3T9CA 2HUNA 1WMEA 1DAEA 5BMVF 5ALZA 3AKYA 5CFOA 4QSMA 2HWYA 2R8RA 4X54A 1NDQA 3TGLA 5C8XA 2G6TA 3Q8MA 1IM8A 3T9BA 1AV7A 4YMTA 4UZSA 1N4DA 1RYZA 1X87A 5CK5A 2JGEA 4GOMD 3PQ3A 3URMA 5ICGA 1H9AA 2GZRA 1LS6A 2WG2A 4D26A 3LXUX 1EGAA 3JARA 1Y8RB 3QYAA 3R5SA 5MFZA 2O8EA 4P86A 2BD0A 4PPFA 4WK0B 1HSOA 3T7RA 5THXA 3UB3A 1TUBB 3ETDA 2JHCA 5DK4A 4M9CA 4B4VA 3DO8A 2QLMA 5KMGB 2PUWA 4G0UA 1EWYA 3HSKA 5AUQA 5AHRA 1Z7YA 3G59A 2M1XA 3UN1A 2KMLA 2ZM5A 5LP6C 2OESA 1JJAA 2HU8A 4Q6WA 3CT6A 1JILA 2BGJA 2O1SA 4RLQA 4EY7A 5CCBA 3B13B 1UPXA 1E9AA 1W0KD 3FVQA 1U0LA 3E22A 4K5QA 4LDPA 4QU5A 4C0JA 3EEOA 1X7HA 1XZKA 1CFZA 3KLPX 4FE7A 1L9XA 2II6A 3HA2A 3HL0A 4RZ2A 4BS9A 2W6JA 4WWHA 5GGXA 5FUQA 4MUGA 1C8LA 1ZVJA 2QRVB 3OQJA 4K9MA 4RXMA 4QNRA 3ZU3A 3N0WA 2DJIA 4WADA 1R6UA 3LUGA 4C4XA 3KVOA 1Q7TA 2Q3JA 3LWDA 1E96A 3MM4A 4H35A 4R16A 4TWRA 2C7BA 1FXUA 4C7JA 4UEQA 1T3GA 4G8CA 1ECLA 3DBVO 5T64A 4OHXA 4ZALA 5HE9A 1I14A 5DSZA 1YRWA 2C77A 1PIWA 3W8EA 1VE7A 2B4RO 3OTWA 2TMDA 3DR5A 3PUYA 4YLEA 2ZTVA 2PS3A 3ICWA 3NZEA 3RUAA 4AJHA 4D4LA 1E8DA 2EARA 2O0LA 3JATB 3PTZA 5CEEA 1FDRA 3D4PA 4X7RA 5JBIA 4G0VA 5A9SA 5IJAA 1X7WA 2CL0X 2DWQA 2Y1FA 2DQSA 3A05A 3JVVA 5K2MA 1QF6A 4EFKA 2FGKA 3PT9A 4Y1RA 4TTQA 1UJMA 2VDJA 3MCAA 3L02A 5FIUA 5HUHA 1NSFA 1FU7A 5IM4A 5C37A 3GLGE 4ND1A 3ZY4A 3KAJA 1T4BA 4TMFA 5DN6A 4ZTBA 1KZ7B 2EKLA 4AMZA 1JKJB 3VNBA 4HEA6 4RJTA 2A94A 1MO4A 2GEUA 3P2JA 4EW2A 4CTKA 4ZOEA 1LBTA 1Y9EA 3Q1LA 1M1ZA 1GQOA 2HSWA 3QV2A 3HDHA 3IT0A 4BO5A 5FLXA 3EVTA 4ZVRA 4P32A 3RAGA 3SX4A 1CUXA 4CM4A 4Q3DA 2QRHA 1HNNA 3KQVA 1QGDA 3QK7A 4D9HA 1AUOA 1Y5NA 2YS7A 4E09A 4IDGA 5JCJD 2UYOA 5EYPB 1CQWA 4GMFA 1YL6A 4WCDA 3UV3A 1CZRA 2PUVA 2MT9A 1O5OA 3OG9A 1FP4A 1MFZA 2MR6A 1D2HA 1AXGA 1N3IA 2OILA 1QMGA 1SPBS 1W85B 5HQ3A 1PSDA 4C0HA 4WPGA 3R3SA 1W35A 4Z0PA 5C8DA 2EDAA 4F3TA 3OOHA 3INTA 2GSDA 1V96A 4HH3C 4ZMRA 1NULA 2XUQA 2VEDA 3I64A 2JD1A 3R5FA 5LWQA 5TIIA 4FFWA 1V8BA 4MIKA 5AD1A 3JD1A 5BSEA 1WLSA 1KEVA 3EDMA 3LCVB 3QU2A 4FM9A 4Y8VA 2ZB4A 1G8SA 1T3LA 4YUYA 5EJ8A 3CZMA 4PNEA 1Y81A 5LBTA 1SKUA 4QUDA 1CQZA 5F2EA 1N0UA 4RFSB 5F2OA 4W5QA 1JLKA 5KB3A 1RPAA 1G3UA 3LP6A 4PBRA 1SQGA 1R18A 6NULA 3K0HA 4WD3A 3QEOA 4JY7A 1EB9A 1RXWA 4NDNE 3RS7A 3UC9A 2VPQA 4IKEA 1SC1A 4BQQA 4WN3A 1M67A 1SG6A 1X1EA 2AYZA 2LD4A 2VF2A 1D2NA 4RIIA 5K0ZA 1IOLA 3F5DA 3BRWA 4QYTA 1YHZA 4KLRA 1YDMA 4A5SA 2GYYA 1XO1A 2QN6A 3QX7A 4G1CA 1JVBA 2Z1MA 5JISA 5I7OA 3SM9A 1I7LA 4G5XA 2SHKA 3V32A 2ERYA 4UE3S 4MP3A 4UHFA 2F3PA 5DBOA 1C9NA 4X60A 1YFJA 4YCDA 1Z5UA 1T9DA 3GRKA 2DFTA 2FKNA 3FKSA 4TRMA 2P9TA 3ETEA 2P2DA 1IZ7A 3NIFB 3ZKWB 4YJ3B 1EJ2A 1MVLA 2Q49A 3NOXA 5FBKA 4FW9A 5MN4A 1VLQA 2XGGA 1OI4A 2CDAA 2VVTA 4IDQA 1QF9A 3OFND 3WBBA 4MW6A 4EX7A 4HYYA 4HAOA 4E0BA 1BQ4A 1L4KA 3ORYA 5KCMA 1J9EA 2VO1A 4BMSA 5KWVA 2FOIA 1E6WA 1ODFA 5FTKA 1SC9A 1TVCA 3M6MD 1YD7A 3EPRA 1MA3A 1WA5A 1MOSA 3WMGA 1J0EA 1E9SA 3EH1A 4NK4A 1OT3A 4O4HA 1X7DA 3IVAA 2X5XA 3TDNA 3S2SA 1O0CA 2X1LA 3NHZA 3ZDEA 1VKZA 3SJAA 2UZ3A 4ZT7A 1WXEA 2WJWA 3BCHA 5DYGA 3RIGA 4CLDA 4DSNA 1F38A 1QG0A 4FS8A 4K05A 5CFLA 3QKSB 4G41A 3C3KA 4AY5A 1CS4C 1IVSA 4FBLA 1SC6A 3LWBA 2Q2QA 4WLVA 4A0QA 1N0VC 4P5EA 4IWYA 4CEIA 1H4VB 4KQ9A 1IBSA 1U63A 1A77A 3M5DA 1UDRA 3MWDB 4H6PA 1SM4A 5AO9A 3TX2A 3T94A 1IBLB 2HNAA 4MDEA 4KUGA 5LXTF 4B3FX 4FD2A 2OEPA 1M1NB 3BIOA 4Y2JA 4RXUA 4N54A 1Y4DE 4ODIA 3SBXA 3GDHA 4W5TA 5IKMA 4WCFA 2Q7DA 5IFLA 2B4AA 3WB1A 2ZIZA 1PEDA 2GBIA 3BKXA 1HSZA 3R3YA 4UNSA 4ZCRA 5LMCA 4NHEA 1ENYA 4X66B 4PC2A 3M6FA 1JXQA 4B33A 1U8EA 4MQ6A 1KY4A 1CNMA 5DYNA 3WYCA 4HNAA 1A50B 1VIAA 2R79A 1PZGA 1IDOA 4MZXA 2H4YA 3TCXB 4BEVA 4EY6A 2LIVA 1ZW6A 1P0PA 2WUWE 3W90A 4AKIA 4MQUA 4TZKA 2YICA 3M3HA 4U3JB 5AICA 3DAYA 3KVNA 2QTAA 4DMFA 3KQYA 1A27A 2GRAA 4N8EA 4PR0A 4RPKA 1I0LA 1PJSA 4FHCA 1G5HA 1ZMRA 2BFNA 3R2JA 3VAZA 1BDBA 1IXSB 4OA8A 4NAHA 3UK6A 1Z2PX 2G0AA 1VSQA 2ATVA 2FF7A 4Y0AA 1KZHA 2GF2A 5LQSA 3F96A 2JKZA 2OLJA 4WK2B 4FYXA 4M6WB 3QM1A 4RVNA 5CT6A 3DR3A 1KO5A 1L7QA 2RGNC 4UREA 4B43A 5LMUB 1SHTX 2Z6QA 4O2BA 2B94A 1Y4UA 3UWDA 2AG6A 2OGWA 3FJYA 4K9LA 3AC0A 4Z7QB 4D9MA 1ODJA 1PFGA 2IITA 4DHEA 4P80A 3GVHA 2G17A 3WYFA 2FW6A 1HLPA 2NAPA 3ZDQA 3HCRA 4NXMB 3RJ9A 3BGVA 3A6HA 3ANYB 2I78A 4M76B 3ICPA 2FWRA 3G8CA 4C1NA 2IW1A 5DLDA 2SCUB 4V2IA 3L6DA 4IHQA 4XWYA 4HZUB 3LD9A 1A9ZA 3QFTA 1B8OA 4H6VA 1AKUA 1M8KA 5KYUA 1A4RA 1RJGA 1XN1A 2P91A 3CWQA 2XUDA 4JGGA 2W2XA 2IDZA 3MD0A 4OAPA 3RUEA 3WK6A 3ER9A 3CE6A 3OESA 3IUYA 1NY5A 3BRQA 1DRKA 2A14A 1KMQA 4TYYA 1BXGA 2CE7A 3HVKA 5BN4B 1H3EA 1ZG3A 2JEZA 2C00A 4D6YA 2DBVO 1A5TA 2LUOA 3WWZA 2F1JA 3V1UA 1IQUA 4WBNA 2PXAA 3OTIA 1IM5A 2P1DA 4HS4A 5AW5A 1GG2A 4FJ0A 2VWHA 1T8TA 2OV4A 5IJ9B 4DCSA 4TWZA 2NP7A 2HQ1A 4N0QA 2Z3ZA 1L7PA 2P41A 4WFIA 4NONA 4B31A 3K70D 2CWDA 3BL8A 2A59A 4I8IA 1V7ZA 2C1ZA 4YS6A 2QM0A 5TPZA 2NOAA 3TXYA 1LJ8A 4YACA 1XD8A 3C1TA 3NWEA 1HDRA 1KI2A 2GZAA 4IIGA 1TO6A 5J2TF 2FPIB 2GBGA 5JRJA 1ZH0A 1UMKA 4JDUA 2V8OA 2QLJA 2FUCA 4L28A 2YMLA 5DGIA 1OZFA 2H2DA 4F4CA 1HNWB 1K86A 1GYQA 5JS7A 5DV9A 5TVGA 3QY9A 5IK2A 1JS1X 1UDCA 4K8RB 2BJWA 1Q1QA 1TCAA 4PC3A 2E4XA 3WJ7A 1MIHA 1GRQA 3VKFA 1RBYA 1K27A 5HRAA 5FKJA 4XWTA 2PBFA 4V1CB 4GVPA 4WBNF 3RK1A 3S6JA 1DWQA 1VI6A 5JTUA 4UVHA 4XUCA 2JFOA 3L9WA 1V8OA 2WF8A 1I5OA 4XM0A 4F1JA 1LDBA 3I61A 5FBVB 3B38A 2B92A 2HHJA 2PKCA 4AO6A 2WSLA 4IDPA 2PWAA 4QU0A 4RJKA 3ST7A 1Q1AA 5DBFA 3F78A 3PXEA 1EINA 3W2FA 1K6MA 1XRNA 1D7AA 5K9ZA 1PU2A 2OY0A 1GTL1 1K5DA 3W5IA 5IM4F 1MQ8B 4PRZA 2YJ4A 4K6MA 4XDHA 1RRPA 5DX1A 1EDBA 2EKZA 1CDEA 1R6TA 1NURA 3FPJA 3G5LA 4GL2A 1GADO 4M7WA 1DAMA 4PGFA 4Q18A 4OOFA 4L4SA 3C74A 4UEKA 2Y27A 5TE9A 1M6NA 3Q2OA 1HA3A 4FGLA 1VE1A 5EL0A 2RKBA 4GXTA 4KVFA 4NENB 4PINA 1YJ5A 4MQLA 5EE5B 1JBQA 1LSJA 1RM0A 1U3TA 1ZY2A 3G17A 5KU1A 1G7CA 2PSFA 3HYCA 1GGNA 2IUSA 3E9YA 1VCOA 3GPDG 3PPXA 4JX8A 3U17A 3ZGXA 1DB3A 2PRYA 4J2HA 4QTTB 5FOSA 4FGKA 1ZPDA 1P0IA 4M0EA 4IX1A 1VYUA 3FRJA 3KLNA 5G0TA 4EF4A 5I7FA 1ZCAA 4ND8A 3L4JA 3DBLA 5H82A 5IAGA 3AW9A 1QZUA 2GM5A 1SFRA 4FGUA 1YA4A 5ALEA 5BW4A 2PXCA 1GITA 3D6NB 3E0XA 3IVRA 4HDQB 4ZC1A 2BM9A 1EK6A 1JA9A 2E1PA 2WHPA 2WPDA 3UXYA 3GQBB 3JQAD 1T8UA 2QSYA 2ZRAA 4H1UA 4N6GA 5DK6A 3HP4A 3PI6A 2DQ4A 1AZWA 4YAIA 3WNQA 1BCSA 1TQ4A 1MLDA 2EZ8A 1KOJA 4HNRA 1JFVA 5DBHX 5FT9A 2LCFA 4IIJA 4MWEA 3EPKA 3GRVA 4GGOA 4BVGA 4OX9B 2DF8A 1ORHA 1LNQA 3RUHA 3ASVA 2V03A 4LKRA 4DZRA 2HO5A 4PHHA 3ILHA 4G1MB 5B6PA 1S1CA 4BASA 1I3MA 3FCCA 1QNFA 1FW8A 4YROA 1NAIA 3U6BA 1W5AA 4J1QA 1GLVA 2ZAOA 1VJRA 3F5QA 2HLPA 1JFFB 4C22A 4CIDA 1KBOA 1YVEI 1XVIA 4QU9A 2ZRGA 3ER6A 4B6GA 5EE1A 4DS3A 1P18A 1JG3A 2NU9A 9MHTA 4QAJA 3IO5A 5IAOA 2WP0A 3GLKA 2GZHA 4C7KA 3FCYA 3T3NA 4GLFA 3MN1A 4GXQA 4A0RA 2JCBA 2BLLA 3TD9A 2W6NA 3FI9A 3AR2A 2J33A 4ER5A 1Z0SA 4RJJA 4PYQA 4YQZA 1BX3A 4K87A 1LWNA 2RGUA 4X20A 1QBGA 1D2EA 4J3JA 4A8HA 4R2HA 2RHCA 2Y92A 2JH9A 3B82A 4AULA 5HM8A 2FEWB 3OQPA 2E5LB 2IYAA 1T10A 5JWOA 2R11A 1L5OA 3JD3A 2YQ5A 2HK8A 2QLBA 1YS7A 3STUA 1Y1RA 2XB4A 2UU9B 1QYVA 4RKEA 4R01A 3BB3A 4OATA 2QYSA 1BGVA 1T3HA 3CRNA 4L74A 4NS1A 3SXUA 3ZY3A 2XRMA 1E3JA 3PQ7A 4D6PA 4ZZ1A 4XQCA 5HJEA 4CU2A 5FR2A 5JPCA 2JIBA 1N2CB 2JAUA 5D3MB 4CKCA 2YCBA 4BRUA 4HGZA 4B3RB 2A0YA 3D3QA 1Z6XA 2HYDA 3MIZA 2X42A 4QARA 2WJIA 3EXIB 4JBIA 4ZV9A 1W36B 3ZUGA 3ZC3A 3AT1A 4BEBA 3DBHA 3IEUA 1GOTA 2G76A 2VNKA 3A04A 4KQWA 4C03A 3K6SB 2CXRA 1SUFA 1JIVA 3UJAA 2JHGA 4G5YA 4LNHA 4RLHA 1NW8A 3KO8A 4XPZA 1OBOA 1QE0A 3WZ2A 3KZNA 1JAZA 2LCIA 1MABA 1V3UA 2OBFA 1N5OX 5FB3A 3WKBA 1JEYA 1LDEA 2BTOA 1G5PA 1USVA 1Q7RA 4WKBA 1QOQB 1RWMA 3O8QB 1MGOA 2JRLA 2IDMA 3GNLA 3K30A 2WWWA 4F96A 5MGNA 2YDYA 5AOBA 3U3XA 4F8JA 1EG7A 3FFWA 1JWLA 1NMEA 2QP3A 3AUUA 4KH1A 4TT8A 5DNCA 1RSZA 3AHFA 3EVAA 1PRYA 3F5SA 5FV7A 4OHZA 4BCDA 4DAEA 5AWFC 3DKKA 4AIRA 2VDRB 1ZZEA 2ATEA 2KYRA 2ODAA 5L4LA 4AJ1A 2O50A 4JI8B 5CVCA 2XZOA 4GPD1 2BFBB 3OQ1A 1IZ8A 4OB6A 4KIJA 4C6TB 2QD5A 3GMSA 5BXYA 2GR9A 1L1RA 3EZLA 4AF8A 3FVRA 3MBOA 3ZHRA 3AR8A 1XYYA 4PQEA 1CUDA 3OZGA 2VKQA 4QIHA 5ER9A 5T4FA 2I91A 4Q1EA 3WMEA 3BWYA 1CY8A 2ZROA 1KARA 1T1GA 4R6XA 1RJWA 4YLGA 1PFKA 3L4BA 5TJHA 1FXWF 2QD3A 1PN3A 2HJRA 4II2A 5FO0A 1B6TA 3Q3JB 1HDXA 1K92A 2A6PA 5DXAA 5ARCA 7REQB 2QRNA 2C96A 3KOOA 2YHSA 1XZ8A 1DZ3A 2OHJA 3C39A 4OPMA 1U8CB 5I9BA 4MEBA 4CZ2A 2H2GA 4ZYXA 4YRRA 1ZAYA 4M1QA 4HYTA 2AZ4A 4YP0A 3G2NA 2JFNA 1SQFA 3UJ6A 1Y9DA 4OQLA 5KNCH 5C7IO 4OK5A 2AN9A 1HQKA 1DFHA 1NBMD 5FXMA 4GPBA 2YWBA 3ISVA 3PX7A 3LFHA 1QPBA 3BE4A 3K15A 4WOJA 1F6BA 4ENSA 2DWOA 4RD0A 1EFLA 3UAOA 1PYDA 4CFSA 1VJCA 2BVNA 4BL5A 5C7OO 5DO9A 2Y1DA 2O8BA 1E4EA 3QA9A 5NLLA 1M3SA 3VJMA 2I62A 2QP9X 3IDOA 2ZB7A 3V48A 2W90A 4M38A 4EJ6A 1E9CA 1U3GA 1WNTA 2XXJA 4GSKA 3RAPR 3DO6A 3I5YA 1CVLA 1DJMA 2RB5A 2JAXA 1INLA 1T26A 1UJ4A 2JEOA 3EEQA 2XWPA 3HYSA 1YBHA 4YVFA 5BV2P 1XHFA 1CQIA 3GGPA 5AK4A 1DCTA 3S28A 4R1UA 3PD0A 3IBTA 3PHJA 4YRAA 3W8NA 1LPPA 2QNRA 3T54A 4E15A 2B8WA 3NWJA 2J3QA 2G1AA 2H85A 3OIFA 1T8PA 2Q9BA 1ZOOA 3N2KA 5H9VA 2JAQA 3RVNA 4BE7B 1ZONA 2OKCA 3DE4X 4DLRA 1Z12A 2WJ6A 4JI7B 2A1TS 2Q8QA 4FYMA 2QMEA 2ZWVA 4ZGBA 3KOMA 3SZUA 2IYTA 3H2GA 4NH0A 2REQA 4RD3A 4KYUA 1AVTA 5T5QA 4ZHQA 1ODIA 4NYIR 3ZU5A 2GRJA 4KNVA 1BE1A 3GI1A 4UEWA 1RRGA 4AS2A 1UAGA 2VR1A 2XQFA 2ZYGA 4JENA 4JL8A 4YAWA 3NWBA 3UJ3X 1U4NA 1QDUA 4EUHA 3Q9NA 5ERGB 5L3SB 1GEEA 1UUFA 2J9ZB 4YMVA 2P0EA 3KL2A 2FP3A 1FTYA 3NHMA 3QNMA 1RNLA 4JFAA 1L5LA 3DZHA 4DLUA 3SLKA 3U0BA 5BQXA 3O74A 2JC3A 1OFUA 3S68A 5BW8A 1Y1QA 2GPNA 2RBKA 3ROZA 2BGTA 1QBKC 1SKYB 2X9GA 3K0CC 3SYKA 4QXMA 3VTFA 4N3GA 4MW0A 3CEMA 1U7HA 3H4VA 2ACKA 1J8FA 1XHLA 4HWOA 2H51A 4MYCA 3W7AA 5J4VA 3DT6A 1MC5A 3RC1A 7ADHA 2Y1XA 2PWZA 1UM8A 3JASA 4KIGA 3S99A 1ESMA 1IN7A 1T25A 4C87A 5D01A 3UGKA 5G4KA 3EPPA 4TQGA 4LRXA 1C4KA 3K20A 3PITA 3GLFA 1C7JA 4FLEA 4PTYA 4KR3A 3SKVA 3DZBA 2WM3A 2VSNA 1YMVA 3JQPA 4EW1A 1TM7E 2IOHA 4F38A 1MD9A 1XDBA 2J67A 1E1QD 2QQFA 5BN5A 3OWOA 4OP1A 4A10A 3K1YA 4YV7A 3C87A 2A9OA 2EOAA 4G97A 9ATCA 5KJ6A 4I1SA 2JPDA 3IX7A 4L5JA 2CHFA 4U1RA 2IVZA 5FCDA 2OHFA 3WADA 1PE0A 3AI3A 2PKXA 2ORYA 2F3QA 1H42A 4NICA 4NF2A 5DNVA 1B2RA 1T2UA 4DCUA 5IT0A 4OAOA 5LKAA 4IX9A 4AQDA 5GIOE 4M7RA 4CN8A 1Z17A 5A5GA 4POOA 2PZLA 1P2TA 3I53A 3OZXA 5T67A 4E22A 5DN6D 2E18A 1JN0A 5L4SA 3NEJA 3KV3O 5E3JA 4I5EA 5GONF 3ZJTA 4BMCA 4CF6A 3NEYA 2AF4C 2FJPA 1R27A 4JJIA 2D7DA 2FJ0A 1ECPA 2OOSA 3MRXA 3W4KA 1SIOA 1XF1A 3OZUA 4EDHA 1U1IA 3OZAA 5FRDA 5KJFA 3RUFA 1LA2A 1QOPB 5B4UA 4G56A 4BNIA 2DSTA 3JZFA 2EQAA 3AF1A 1JFRA 3OZSA 5JOQA 1K7XB 3QMMA 4KUEA 1ID8A 4CV2A 2ZRIA 3HCBA 1N6LA 4Q4LA 2UV8A 4EG5A 3ZTTA 9LDTA 3AVYA 3KKNA 2YZ7A 5A02A 4MWZA 4N0MA 5BWLA 1XXHA 2F8MA 5HGXA 4WEQA 2ZDGA 1E1RA 4UD6A 2QTGA 2C5EA 2ZE5A 4HWGA 4MUMA 4JB0A 5P21A 3V9AA 1CUJA 2G28A 1GFIA 1GKUB 5CYPA 3FVTA 3OFJA 3J81A 4NATA 2QRGA 2CLCX 3FCXA 4TVBA 1EXNA 2JFVA 1Z0AA 3D54D 4GC9A 3EDYA 1EVYA 4ONEA 4EPRA 5I9SA 3S40A 1OGIA 2D7CA 3G2KA 1JR3A 4N6OA 5ILQA 3GF4A 2FUEA 3TR5A 3V4FA 1KJYA 3IBCA 1XMIA 5EPEA 3PICA 1UKYA 3A7DA 1V6CA 5EIAA 2X4GA 5FNVB 2HLDD 4IKPA 3SJBA 5AI9A 2RJOA 3KFVA 3VZSA 2PXXA 5DHQA 1Z7WA 2EQBA 4YQEA 3P0IA 5JBNA 1BAPA 4M7OA 1PGQA 3GHHA 4L76A 3IPRA 1EP9A 1JLMA 4WZ6A 1L6IA 2RHJA 3IA2A 4G0ZA 2J5XA 4DV2B 1Q44A 4HRYA 4LWQA 1SUBA 1RWPA 1ZCJA 3D8HA 3HVJA 4QEZA 1FIUA 2HRRA 2OUKA 4BV2A 4ZC8A 4QWWA 4IRMA 4OX9Y 1FTSA 1PL6A 3K9HA 4KXVA 1ZJYA 2X1VA 4MJLA 3LPDA 1LXCA 4HN2A 1DBIA 5CA0A 3BORA 1Z37A 4DE5A 3DULA 1EAYA 3HJBA 4G65A 2A86A 3AHCA 1XP8A 5EY5B 2J3MA 4EY4A 3SFTA 4AG6A 4G5OA 4FCTA 1HT0A 3GARA 1XZHA 4OHFA 4B3TB 1KOGA 4UJ5A 1Z4MA 1SVLA 2VJMA 4HAUA 1IK4A 2WMOB 2Z8YA 3FZEA 3EWNA 5AKEA 1DJNA 2A78A 2C3MA 2JLUA 3Q7QA 1FPQA 1UJ5A 2DMRA 1O6ZA 4NPAA 3N1UA 2EL7A 4AXBA 3GLGB 5LQCA 2ZLBA 4ZYLA 5D6NA 2NPFA 2IIPA 3ULKA 3R0VA 1OC2A 2WU0A 4LXTA 5D5QA 2OCDA 1RIFA 3RD5A 1WXDA 2DR0A 1M8FA 3RRZA 1AS3A 1WPRA 3L8CA 1DIOB 3KAQA 1CQJB 3TSYA 4D3DA 4BB9A 4EGCB 4HL6A 5CA0F 5TQ0B 2OV3A 1Z7BA 1Z5WA 3F71A 4R2LA 4RS3A 5F12A 1SBIA 4NNOA 1N3BA 4BYGA 1FQKA 1Z8DA 4HADA 2YXBA 2PIAA 3AR3A 5ALFA 3V46A 4YX9A 2XCTB 1CRPA 1NYQA 3LT5A 2QY6A 3SK0A 2UZAA 1KI6A 2UZ1A 1SELA 2OBLA 1LBSA 3EQZA 1EE2A 3KQMA 4O25A 4XYGA 1OFIA 2CHQA 3M70A 2BCGY 4EVSA 4I3GA 4FXPA 3L4BC 3LQKA 4LISA 3AEXA 2PDAA 4F5ZA 5JJIA 3H5NA 4KZPA 1PL7A 3EXHC 1KQFA 2IIVA 2HA4A 2Q21A 5DKFA 5F73A 1EQAA 3TW4A 2OXEA 1JTEA 1V5EA 2QVLA 2FXIA 2YXDA 3AEUA 3GCXA 4KQIA 4X6YA 5CFZA 1A9QA 2OXRA 3IQZA 5G0VA 1KC1A 4TZ6A 3AL0C 2EJBA 1NV9A 3E5MA 2WWHA 4JBNA 4I1YA 3MJTA 5IULC 3OTOB 1ZP6A 3HP1A 3MPUA 2F90A 3UZUA 4IXMA 1XQ1A 3AF3A 2QXYA 5EZSA 4D8WA 3PHLA 4I3HA 1BFKA 2WM8A 2YJNA 3DXZA 3QUCA 1SBCA 4XIGS 1CJSA 1PSZA 1ZFNA 5H59A 4L57A 2JJYA 2WWVD 4DY6A 1KIAA 1U7DA 2Y1WA 3F1LA 4Z9BA 3U9TA 3HKEA 3E5NA 1PYOA 1PNVA 3OCJA 4H08A 1WUHS 2GH1A 4D3FA 1GCAA 5MF6A 2C57A 3FUWA 3J7AC 5DSTA 4ZI5A 3AZQA 1PVOA 5DBGA 3DVLA 1YI1A 4GPTA 2C9OA 1ZITA 2N75A 3DFMA 1EIZA 2J41A 3CNOA 2IXAA 1AZLA 3ZDDA 4WKPA 3OLWA 1HETA 1KO7A 4IS3A 4Z3KA 1RJEA 1XEWX 2PX5A 5EQFA 4BLVA 1QP7A 5EMHA 2NYUA 4CWAA 3O84A 2XUZA 4JVOA 5ALPA 2YZGA 4EUNA 2Y4NA 5DEIA 3GIWA 1Z5PA 2WJGA 4YRLA 1HE8B 1Y1PA 2ZAGA 3INRA 3FB4A 4JJ6A 3QPBA 5AUPB 4W82A 2Q5CA 2FK7A 1XRRA 1GQYA 4G4JA 3LQYA 2XKJE 1T0IA 3VC2A 2ZITA 4P33A 3VPCA 1ZM9A 3ZHCA 3TQOA 2EP7A 2E4VA 3VDMA 4ZCPA 1S01A 1POXA 2PZBA 1KJNA 4IOLA 2CV0A 2X9LA 1IFXA 2X22A 1R8XA 2G9ZA 3E9NA 4JOQA 1GSHA 1SHUX 4F2HA 4JJ8A 3ETCA 4MTLA 4R1TA 4MR9A 2FPRA 1EXWA 1QHHA 4MQEA 1OASA 1R4NB 4HGYA 4D9EA 1NATA 4GZ5A 1WULS 2BFMA 3S1SA 1KIMA 1YULA 4TLLB 3T7SA 4AFNA 4TYMA 4TS1A 2JIOA 2OYSA 4B1FA 1X86B 3OBBA 4IGKA 1R8SA 4QX6A 1KDYA 5C7YA 3UOAB 1USUA 2LWIA 4P54A 4EG0A 3NDPA 1QZTA 3E9ZA 3UTCA 1QVZA 3JQ9C 1BW9A 2F62A 1Z2OX 2XDYA 2L17A 5IT5A 3OA0A 4Y1GA 4KB5A 3V8PA 3U13A 4NMWA 3J81k 1YB6A 1IULA 2PGAA 3R41A 4BJ6A 2DERA 1RKXA 4J4HA 4WN9B 3N8GA 5KSZA 1U4OA 5IMSA 4XD7D 1PZHA 1GZUA 2NVUA 3KV1A 4XKJA 3DPSA 5BOVA 1H94A 1VL6A 4UBIA 1DS6A 1R6AA 2B34A 2TMGA 4Q03A 1JQDA 4TTIA 4US1R 1UZUA 1EP3B 3CMMA 2H1IA 4O4IF 3EEFA 4RULA 2ZVPX 2HNBA 2WICA 4NLLA 4OMDA 2BF7A 1Y5LA 2E82A 4CUJA 1S2OA 4TMXA 1YUBA 2BBSA 4BVJA 2Y1GA 3V97A 1G8MA 4GOOD 3ZHOA 3ER8A 1OI2A 4ZXFA 1T2FA 2O6LA 2M6KA 3OF2A 3DLCA 4BNDB 3TD6A 2QZZA 4HDRA 3OQ6A 2ZAMA 5ALMA 4DLAA 2A5LA 5CB4F 5I8WA 4PYMA 3QVSA 4KGZA 1NVEA 3QVMA 4K9NA 4MGZR 5IUKC 3WP1B 1AGNA 3MS2A 5KTRA 3RC9A 4B3SB 4GX2A 2H16A 1UBTS 3A6ZA 1R3DA 1UCFA 2WU8A 2BM1A 1X14A 3ENVA 4GR5A 2VHXA 1ZNXA 4S0XA 4YK7A 3ZGVA 3ZWQA 5GZ1A 2R8YA 4DN6A 1V9LA 3FTEA 2EC5A 1DGQA 4BNYA 1NHGA 1W8DA 1EFCA 3O0DA 1PVDA 4F6RA 4US2R 5CR9A 1OI3A 4EVIA 1D2CA 4WY5A 2D00A 1G0NA 4KK4A 3PEUA 3LGAA 1Z82A 2QZ4A 1MB3A 1E6EA 1AXRA 3L7LA 3NLLA 4NBLA 1WDLA 1N3LA 5TS3A 4KYTA 1HEUA 4ER3A 3GJ3A 3AFHA 4KO8A 2GCOB 3DOFA 1MO5A 2X8BA 1RQLA 5F1PA 4CLHA 2NU7A 1VBMA 2DLNA 4M9ZA 5BSFA 3IILA 3M89A 5HXAA 4LTMA 2N1MA 3E1GA 3PXUA 3RF6A 4CW7A 3KEQA 3T4UA 1E2KA 3EUAA 4UCFA 3LC2O 1IY9A 1VG0B 5CM9C 9ABPA 4PSAA 4NZMA 4CKXA 3GEIA 4BGIA 3GRAA 3FDZA 3A2LA 3B5IA 1KL7A 3QUQA 5AKXA 1AXEA 2I54A 3O8RA 1W0JD 1DG9A 2PSHA 1B0PA 1GQSA 2OORA 1Z63A 1QRDA 4BEWA 4DC0A 5BVHB 1T91A 1KAEA 1JFFA 1VG1A 3HCWA 1E7RA 2PTGA 4R9RA 2O4UX 3DE3X 4KL8S 3H4IA 3SDZA 3TUIC 5KVCA 5FL7D 2PYZA 3MGCA 4EABA 2FDXA 1T9BA 4DJDC 4YRFA 2O5RA 5IDYA 1AUXA 1MX3A 1TRHA 2DFKB 4OGFA 5LKRA 3HC7A 1D9XA 3QJGA 4KW7A 4L2IB 4UM9B 2Y0EA 1MJGM 3SAJA 4EO7A 8ADHA 3VR6D 1SG9A 3HBLA 4B7ZA 4KIFA 4B2YA 1G59A 5K6AC 1TYAE 3H75A 4LMAA 1VHJA 3ML1A 3QP9A 1QSGA 3EIXA 4X3CA 3A1SA 5AK0A 3T5BA 4IDCA 4E13A 3MWLA 3FYCA 4ISCA 1KMCA 3VR6A 5A5DA 1XCOA 2CMHA 1D0IA 2ISCA 2A8YA 3PDIB 3OOJA 3QOFA 3W06A 1DOZA 4HEJA 3ZCXA 4XOUA 1UXIA 3SHOA 4E5DA 3KSAC 1NNEA 1GZSA 2Q1TA 3GZNB 4MCHA 3EARA 1FSZA 1HT1E 4DPMA 1UF9A 5FLEX 5IM5A 3VR5A 5HOQA 3AHHA 2FN8A 2NSJA 3OUUA 5KHAA 4C14A 5JS8A 2HU7A 3AERB 3HFSA 1C50A 4MEAA 3DV0A 1MEOA 1QB8A 3LGSA 1F4PA 1U5AA 4PCLA 1NVFA 2WILA 4K6OA 4QQNA 1JMVA 5JVDB 4FX5A 2GTPA 1QDLB 1TFRA 3I5UA 4XFJA 5E95A 4DV0B 2AZDA 1FLDA 4RMGA 1J0CA 1M8PA 3HN7A 4MRNA 4F0JA 1M1YB 2CBZA 3ENQA 1N2ZA 4UU7A 2XQGA 1MRZA 3KU4A 3L04A 3R4CA 4HATA 1NGSA 4HX5A 1IY1A 1ATZA 3GEHA 4OH7A 4YAEA 1FSFA 1KTVA 3A10A 3HN6A 1MABB 4J29A 1W9MA 2O1XA 1O4WA 4BKRA 4QUKA 2VDVE 5BPFA 3PPWA 4UNNA 4EYKA 1JU3A 4GDMA 3RBXA 3C3YA 1KMHA 3ONVA 3L1JA 4X1YA 4Y2UA 5KQLA 3DMTA 3F4KA 3LPNA 4NVRA 5JI2E 2PD6A 3KR0A 4RF2A 1D09A 1H5QA 2IUUA 5JAMA 2EDCA 1G6KA 2LBPA 1HQCA 3CLSC 4NCXA 4HHEA 3FFAA 3ROPA 2HC9A 5JS2A 3DDUA 1NE7A 2CNKA 3MCUA 3HU1A 1YC5A 2GAIA 4O4IB 1UJ6A 2GO7A 1FJXA 3C6KA 3EGCA 5L51A 2JNWA 1TZCA 1TYEB 1MENA 4ZOLA 5CU7A 3Q8KA 2GFQA 4PGGA 4Q3EA 3HB7A 1E6LA 2XBUA 3EZXA 3IOEA 3U62A 4Z3OA 3FDIA 4RTRA 3V6LA 1JSZA 2K7ZA 3FKSD 1MORA 3ABQB 3AONB 1N3YA 3AOGA 4A8TA 3I9JA 2FUNB 2O3TA 3DHYA 3PDUA 2ALJA 3Q2IA 1G8JA 5BXQC 4C0BA 2H1RA 2DXIA 1GA4A 1RWVA 4HP8A 4PIVA 1D5WA 3VQTA 5EJ7A 4RQUA 3LUDA 4RELA 1C7IA 1XG5A 5JLJA 4G0QA 1WOYA 1CZNA 1KYXA 2NU8A 1ONSA 5ALLA 1BS9A 5IP5A 2P7HA 2GN9A 3OPMA 4ROTA 2TRSB 2QPOA 5B64A 4KWTA 3WGHA 2ZQ5A 2P0AA 3FKJA 4G0YA 4M54A 4W1SA 2A5GA 5CAEB 3QYFA 1AS0A 5F2KA 5SV2A 2ONJA 4B2IA 2PH5A 2O4CA 2BDEA 3NS7A 2N47A 1DPFA 3LSYA 2Q4RA 1W2GA 1XCBA 1DINA 5TF4A 3LMKA 4PONA 5IDVA 3SX0A 3TFQA 1A9RA 2XNSA 2C0CA 5HZKA 1A7UA 1GG8A 1TC1A 4FDMA 4XWKA 2R6DA 2VNAA 5JLAA 3ZOKA 4PG5A 1LSSA 3C4VA 3KJQA 5LXTA 4WJZA 3DTVA 3SXJA 4LYYA 4C29A 1ORDA 4PSDA 4TTSA 3NONA 4QNNA 4GLOA 1JIKA 1KO4A 3AY3A 3HB0A 1GUYA 2GJ8A 3BERA 2HCTA 4K81B 2X9QA 4WW0A 5A06A 3W2GA 4DLXA 5I7HA 5CIYA 5JG7A 3F9IA 5B7PA 4WZZA 2WJVA 5J2UF 1GARA 3EMVA 3O2NA 4P7BA 5LFAA 3O8NA 2ZPAA 2YWXA 2XDAA 3FRIA 3MUFA 3NWPA 3TRFA 1MUUA 1C7QA 1DEAA 1FNSA 4FDAA 5BYKA 5HIKA 1ST2A 1LV8A 1P0MA 1W4BA 2CSXA 4V03A 3T7DA 4DADA 3HI4A 3C4QA 1PS9A 3M9LA 4BO6A 2P7IA 2XNJA 4GZ6A 1OZGA 1SG0A 3ZQUA 4NCIA 3KQOA 4UM5A 4FGJA 4HQLA 4HLCA 4KR7A 1V3TA 5DTEA 1QG6A 4ZMSA 5JHHB 1B74A 4MRMA 2QN3A 2WOOA 3ZGOA 3HYTA 1GZDA 3ZIUA 3KQNA 4I99A 4IJMA 3VUFA <