2O2HA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis complexed with 1,2-dichloroethane
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of haloalkane dehalogenase Rv2579 from Mycobacterium tuberculosis complexed with 1,2-dichloroethane
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase 3
total genus 112
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o2hA00
1CUYA 1NU6A 1XQVA 1XRQA 3H04A 2ZSHA 1DINA 4ZI5A 2WG0A 3HLKA 3DKKA 3BF7A 3IUQA 4KAFA 2HM7A 4GLBA 1QIEA 2I78A 1N5MA 3VJMA 4FLFA 1XRMA 1UOPA 1GGVA 5A7GA 2XI4A 4GWLA 5T4FA 3FLEA 4BRZA 3D59A 1AQLA 5ALWA 1Q0RA 1MT3A 2ZJ7A 4M0MA 2OCIA 3WKCA 5EHZA 3QVMA 2XQGA 4QA9A 5AI9A 3C6ZA 1WB4A 4QDTA 4LXGA 4AN1A 5IH7A 2WJ4A 3FYUA 1MNAA 5IVHA 5T4EA 5FV4A 3NOXA 5F4ZA 2XLCA 1CUGA 1ZGCA 1UK6A 3G8YA 2C5FA 4J03A 4U2CA 2FUKA 2HA3A 2R11A 5IVDA 5BV7A 4AO6A 4W1RA 3I1YA 1YS2X 5DTIA 2PUJA 1Y7HA 1YS1X 4U2EA 1CQZA 1UKCA 3G0DA 2QMQA 2RGUA 3BJRA 3B3QA 5JIBA 2ECFA 4X94A 3C6BA 1XZBA 2XQIA 2VQ6A 5DYWA 4HXEB 1EA5A 2RI6A 2O7VA 4H7DA 3ZLVA 2CMFA 1LLFA 1ZI9A 2FJ0A 1JKMA 3O4GA 5AIAA 1OILA 1MX5A 1UZAA 4OD0A 1A8QA 2OXEA 1W6RA 3VJLA 3QPAA 3D2BA 1XZMA 4P08A 5AH0A 1P0MA 4BCBA 4LYEA 3D2AA 4UHCA 3QH4A 3T52A 3BF8A 4Q1VA 2DQYA 2G5TA 3Q0TA 5AICA 3KDAA 1YA8A 4KE8A 4KRXA 5CURA 5CH3A 3M83A 4X93A 5SYMA 2OLEA 3GELA 5HKBA 3V1NA 1YA4A 4BC1A 4CIBA 1Q0ZA 1DQYA 3H2GA 5H3HA 1H2ZA 3OC0A 1R1DA 4F0JA 4MWTA 3I2GA 3CCCA 3KWFA 1E8DA 1LBTA 2WSLA 1HDEA 5SYNA 4EHBA 4E14A 5ALIA 4KJXA 4L9AA 1NU8A 2QTBA 4BDTA 1EK1A 3A2LA 4DSAA 1FFEA 5JZ9A 3D3NA 1C7JA 3H2HA 1EB8A 3C6YA 5ALUA 5LZ7A 1ZIYA 2J4FA 4GECA 5JAOA 4I4CA 2G5PA 1XLUA 2PUHA 1LZKA 5CW2A 3EQ8A 3O0DA 4NMWA 1B6GA 4HXGA 4ZRDA 1Q84A 3DNMA 4X85A 5CH8A 3LS2A 1J1IA 4H7IA 3AILA 5AOBA 3FOBA 2XQJA 1GQRA 5ALJA 1XRNA 2Z5GA 1L7RA 1QIGA 1AX9A 3FLAA 4BE4A 2X5XA 4B85A 3DYVA 5CT6A 5IKXA 1ACLA 2AJBA 2HA6A 1BRTA 4ZWNA 1LZLA 2IITA 2IX9A 3BIXA 4B81A 1BROA 2XT0A 1W4LA 5E4TA 3ESAA 3IVMA 5A2GA 1A7UA 3ZLUA 4W1PA 1CUCA 1LPNA 1BU8A 1THTA 5HQ3B 2RONA 1R3DA 4BYMA 1CVLA 1ORVA 4K2AA 4AQDA 1J07A 1Y37A 5EHXA 2DQZA 2BJHA 2HA7A 3PUHA 5DNVA 4FFVA 4HVTA 1XQXA 2NW6A 1HQDA 1DWOA 2ZVDA 3LIPA 1XRRA 2VF2A 1J06A 3STWA 1TCBA 2WLSA 3FNBA 4CIAA 2O2HA 3H1BA 1G66A 5JD4A 2XUFA 5AM2A 2LIPA 4UBJA 4EA6A 1LNSA 3FCYA 2V98A 1H22A 3L1IA 1E3QA 5D7BA 5AI5A 2XMDA 1GPNA 5AK5A 2WUEA 5FKJA 5JAUA 3QYJA 1QOZA 4O08A 1JMKC 4AB1A 1H2YA 1X70A 2ZYRA 5K3CA 1IMJA 4I19A 2WUGA 2QUAA 2PX6A 4RGYA 1U65A 1XZAA 3WI7A 5ALYA 4B0OA 3QMWA 3TGLA 3A2MA 3EF3A 2Y1KA 3IUJA 5EFZA 1ODTC 1ACJA 3STUA 1UK9A 3BXPA 3SK0A 3V1KA 1L7AA 3N0TA 4UHHA 3WK7A 3WWPA 1QIKA 4IQ4A 1ZJ4A 3B5EA 5FP0A 4TPKA 3VXKA 1XFDA 1AMNA 3BJMA 3F98A 2ZJFA 1SCQA 1MNQA 1TKRA 1VA4A 3JWEA 5YASA 1XZEA 2WUFA 1SOMA 4Y2VA 5HK8A 4X00A 5HZGA 5KWJA 4C88A 1FFCA 3OG9A 1ODSA 5I9IA 2QKYA 1YR2A 4H7FA 1L7QA 1GZ7A 2I03A 4G8BA 2OCKA 4AZ0A 3R0VA 3FSGA 3AZPA 4IHAA 3YASA 3F96A 1UFOA 1S8OA 3ICVA 1U2EA 1H2XA 5AKIA 3WJ1A 3G7NA 4DLNA 2GYVA 1K5PA 5A7HA 3M82A 4UBMA 1G42A 4MEAA 4QNNA 3PUIA 4G5XA 1XQWA 1GPKA 2ZJ6A 3RKSA 5ALQA 4DNPA 5CTAA 5AIBA 2PM8A 2WIJA 4GHWA 1WB5A 3FLBA 4RE5A 2O2GA 1AUOA 2JGKA 1MU0A 1MN6A 5LZ4A 1R4ZA 5CT8A 1EINA 5C7YA 4C6HA 4WJLA 3DDUA 1XRLA 4PF1A 4BVKA 2Y6VA 4EB0A 4FDMA 4QWMA 4ZXFA 1XZLA 4E15A 2I3DA 5FOQA 4KE9A 4Y2SA 3H2IA 3DEAA 3MUOA 2ONCA 1ZD2P 1ZD4A 2X8BA 5FPPA 4N8DA 5HKAA 5A71A 4WY8A 5AK3A 1GKKA 3WIOA 2W22A 3WWCA 1QLWA 2JGIA 2FJPA 3TRDA 5C8ZA 5E4JA 5ALNA 1PFQA 3WA7A 3ZI7A 1T4MA 4BTVA 1AURA 3SWWA 3BIWA 4EY4A 1BN7A 3OTQA 3GA7A 3W05A 1KU0A 4ZGBA 2VEOA 3WWDA 4B82A 1HBJA 1CUZA 1YB7A 4G4JA 4GXNA 5LKRA 1XZKA 2QUBA 4H7KA 1K4YA 4HS9A 4N5IX 4Y2QA 3WA6A 1XZCA 2Y2VA 1QFSA 2XUIA 5AI8A 3DD5A 1NX9A 3G02A 1UOQA 1CIJA 1BCSA 2EDAA 5AM4A 3D4LA 2B9VA 4QDOA 1FFDA 5LZ9A 3EIOA 2JGEA 1TCAA 3W9UA 2HA5A 4AMZA 4C89A 5LLSA 3WK5A 1X2EA 5AI6A 2DHCA 2XMBA 1IVYA 3PI6A 4BC0A 3PF8A 2QM0A 4B83A 1MX1A 2QT9A 2VJDA 3WL8A 1OCEA 2PKYX 2DCMA 4UHBA 5T4HA 2XDWA 1DQZA 5IVIA 4G8CA 4GDMA 3P2MA 4NZZA 4MWSA 4FLEA 4KYVA 2WFLA 1K63A 3DLTA 3I2JA 3FYTA 1ORWA 4S0XA 3IUMA 3G9UA 2WM2A 2XMSA 2GBGA 3ZV7A 1Y7IA 1ZD5A 2XUPA 1E8NA 4QEKA 3WJ2A 4INZA 4TGLA 4FTWA 3H0CA 3C5WP 4BAGA 1PJAA 2QXTA 4EY8A 3G9TA 3ED1A 5K3FA 3IBTA 1VA5A 3D5EA 3ANSA 1ZIXA 1I6WA 4EY7A 1SC9A 4DNQA 4EUSA 2EEPA 2HRQA 4AZ3A 4C01A 3WWOA 1EDBA 4BCDA 4HRYA 1E5TA 4BRSA 1ZI6A 3C45A 1CLEA 3UUEA 2V96A 4LHEA 1IZ7A 4K6GA 1VJ5A 1HKHA 4UBLA 1D07A 3V48A 3RM3A 1K6EA 5D6OA 2IIVA 2PSEA 3K6KA 3PF9A 4X6XA 2GZSA 4V2IA 4WFKA 4H0CA 2XUHA 2HU7A 3WIBA 3O4HA 3G0BA 3K2IA 5HF6A 3WKAA 5AM1A 3QPDA 2CB9A 1XZFA 4X6YA 1UT6A 1T2NA 1VKHA 5AM0A 1C4XA 4B7ZA 5ALMA 3WYDA 2I3ZA 1EB9A 2XE4A 3WK6A 5ALRA 5CT4A 4B6GA 4GEGA 3GUUA 3DQZA 3JW8A 5FLKA 1XZGA 2RIPA 4W1SA 3PFBA 4H77A 4CG1A 2PSFA 3UMJA 1GPLA 4B9AA 5DJ5A 4Y2YA 3WK9A 4BZWA 4KAAA 2WTNA 2AJDA 2WHQA 1HLGA 5BOVA 2XUKA 1LPPA 5EIHA 2WIKA 2ZYHA 4L72A 1X2BA 2XMCA 1M33A 3LP5A 3WKDA 5AKGA 1QGED 1F8UA 1E66A 1MAHA 4UHDA 4Y2UA 5LIPA 4KE6A 3Q8WA 4J0DA 2GBFA 2YXPX 3H1AA 4H35A 4DSZA 5ESRA 4J0JA 3CCBA 5HF5A 4EZIA 2Z3ZA 1EK2A 4C4ZA 4BVJA 1LPSA 1WCYA 3S8YA 4KACA 2ZSIA 4EBBA 1CUSA 4MYSA 4ZV7A 3DYIA 2JGLA 2O7RA 5KWIA 1QIFA 2XUQA 2XMGA 5ALOA 1EVEA 4N8EA 2JIDA 1CUVA 1CUEA 4NVRA 5D3KA 1YB6A 1FFBA 5ALFA 2XLBA 5C81A 2ROQA 2WIGA 4M0FA 1QE3A 3F97A 4EY6A 2UZ0A 1JJFA 2OCGA 5JAHA 5ALVA 5CT9A 1QONA 4PSUA 4UFNA 1BCRA 3PE6A 1XRPA 1BN6A 3ESBA 1IUPA 5FXMA 2J3DA 3IA2A 3GFFA 4OB7A 5AK6A 5HK9A 3C6XA 3WZLA 2BGNA 1TAHA 3BL8A 5CH5A 2RHWA 4DMKA 3WKBA 4QLAA 2CZQA 4QWWA 4UPDA 5C8XA 2XMRA 4PW0A 4G8DA 4DMFA 4NS4A 3ESDA 3O4IA 1QTIA 4UBKA 3HXKA 1CPYA 2D0DA 4QDZA 2C5GA 4DMCA 3D2CA 3FBWA 3LIIA 5KBYA 5EHNA 5K3DA 2YH2A 1WPXA 3WL5A 2W6CX 4XJVA 3ESCA 5AKYA 1XROA 4BP9A 3IB3A 4HXFB 5CT5A 2XQKA 3V9AA 3X3HA 2PU5A 3R3VA 2HHAA 1AKNA 1U8EA 2YASA 2Z8XA 3N2ZB 1O6FA 5AHXA 4BATA 2OPHA 4AXBA 2PBLA 4G4GA 1MTZA 1SFRA 4IO0A 1ZI8A 4Y9SA 1SCIA 2BFNA 4Q82A 5JAPA 3QMVA 2BUBA 3D7RA 3HZOA 3LCRA 1TK3A 1VOTA 4JEIA 3DCNA 5K5EA 2ACKA 2BUAA 3R3YA 5AKHA 2WHPA 2VAXA 3TEJA 1THGA 3I6MA 1WB6A 4K6KA 3H17A 2VATA 3OM8A 4Q05A 2Z8ZA 3AINA 2ES4A 1UWCA 3HRHA 5FUMA 2AJLI 3GBSA 3L1HA 3WKEA 2HDWA 3AIKA 2WFMA 4F60A 4KRYA 1SCKA 4K5QA 3FYUB 2GZRA 3DL7A 1YCDA 1QZ3A 2CEKA 5AI4A 2HA2A 1A8UA 3WMRA 4J0GA 5AI0A 1MPXA 3I6ZA 3VVLA 4FWBA 1VE6A 3STTA 5AOCA 2H7CA 4U2GA 2OGTA 2Y2UA 2XUGA 1ZJ5A 5BWBA 5ALDA 1AC5A 1J2EA 1UXOA 1N8SA 4FHZA 4X91A 1XLVA 3LLCA 1K8QA 1Z68A 2BCEA 5BWCA 1QIMA 5LZ8A 1F6WA 5DYYA 3U0VA 6YASA 5EIAA 3R3XA 5ALHA 1W75A 3E0XA 3DJYA 3WZMA 4FMPA 3NGMA 2EDCA 5FPQA 3E3AA 2BGRA 1EDDA 4ETWA 1IUNA 5JANA 1DTEA 3F67A 2G63A 3IIIA 4JH0A 5AKZA 3AZQA 3NWOA 1WHSA 3KWJA 3HACA 4IH4A 3R3WA 3O95A 1DX6A 4DIUA 3ILSA 4EY5A 2HU5A 2WU4A 1YASA 4GI1A 1XLWA 1XZDA 3I2KA 3A6ZA 5AKKA 3UUFA 2V9ZA 4MXDA 1TQHA 1FFAA 4CFSA 4Y2PA 2ACEA 4G9GA 4UUQA 5ALKA 4UHEA 2QRUA 1USWA 5ALXA 2XUAA 3U1TA 4WY5A 4WFJA 3NUZA 1LBSA 5FDFA 2AJ8A 1AZWA 1CUFA 2C0PA 1C7IA 3L1JA 1JU4A 1P0QA 4C4YA 4RNCA 5K3AA 3R40A 5DLPA 3M3DA 2OAEA 2PSJA 5AP9A 4PV7A 2DR0A 4LIPD 5DWDA 4PO3X 3G0CA 2PPLA 3EBLA 3I1IA 3H2JA 3W06A 1JJIA 4J7AA 2XMQA 1XZHA 2JF0A 1GT6A 1XQYA 3IURA 4Q3OA 2QOEA 4W63A 1RYYA 3I28A 3BE8A 4XVCA 1P0PA 5DNUA 3R41A 4K6HA 1OXMA 1W76A 1RWQA 2VSQA 3IUNA 4ARBA 2H7YA 4KE7A 4WDQA 4MYDA 3FAKA 4X71A 3I2HA 1TIBA 4IH1A 1AGYA 4Q3KA 2X76A 2GYWA 5I7UA 2JGFA 3V1LA 5DTJA 1TCCA 4HRXA 3DOHA 4U2BA 3G0GA 5LZ2A 3O9VA 4B9EA 2WQZA 3IULA 1CUXA 3T4UA 3AZOA 2H9YA 1VXOA 4UBNA 1O6GA 4BAUA 4N8SA 3E1GA 1JU3A 2VT6A 2DHEA 1R50A 3C43A 4HTAA 4LXHA 3R3ZA 1R9MA 1XKTA 4H7EA 4N5HX 2HA4A 2D5LA 4J0HA 3HYSA 1Q83A 2WFLB 1ISPA 2JEZA 1F0NA 3VVMA 3KOOA 5DNWA 5ISMA 2HU8A 1GQSA 4RE6A 3QMMA 4ZV9A 4Y7DA 4Z49A 2WU3A 3KSRA 3STVA 2WFZA 4L0CA 4D9JA 2OG1A 3HJUA 4JUIA 1DWQA 3C8HA 1ZOIA 5FRDA 2QZPA 4JNCA 2WG2A 5HF9A 1VE7A 4JYMA 2XUDA 4PQEA 2K2QB 3FCXA 2WUDA 3DKRA 2CKMA 1QO7A 4BP8A 5K3EA 5JZBA 3RK4A 3FVTA 1G4HA 2CJPA 2BUCA 4UHFA 4DYHA 2CUTA 4OUKX 4X7BA 3WLAA 4BB0A 4BDSA 3FWHA 3M81A 3B12A 4Q34A 5LP1A 5JZSA 1PV1A 1U4NA 3WYNA 5AM3A 5LKAA 2Q0XA 3SX4A 2GBIA 1DX4A 2WILA 2WG1A 4FBMA 4MQLA 4UFPA 3A2NA 4OB6A 1DWPA 4X90A 2Y6UA 4W9RA 5AM5A 2C7BA 2XUOA 2PVSA 4OYYA 4FKBA 1CUBA 3I2FA 3FVRA 3G9XA 2DSNA 4HZGA 3BDVA 1XKLA 1QIIA 3ANTA 1CUDA 1B41A 5EIEA 4PSCA 1ETHA 4MQMA 5CRIA 3PDCA 3WK4A 1HL7A 1IUOA 3DS8A 3R3UA 1YSCA 2B20A 5ALSA 2QJRA 5ALGA 3STYA 5ALZA 4A5SA 2FX5A 1WM1A 3DOIA 4P9NA 5ALPA 4AMYA 5K3FB 3FSGD 5DYTA 4BCCA 1QIJA 1R9NA 2WIFA 1BEEA 1CRLA 7YASA 4XIIA 4OCZA 1YAJA 5AKLA 3PFCA 4BAZA 4AO8A 1DU4A 3ZLTA 3WL6A 2H7XA 3QM1A 3ZWQA 4P92A 3DL4A 1JFRA 3KXPA 4GBGA 3AFIA 4UBIA 5EI5A 1WOMA 1LGYA 4DNOA 2CBGA 2VAVA 2OGZA 4YPVA 4XX1A 2BKLA 2ORYA 1UK8A 4RPCA 4E11A 4WCVA 3JYHA 5C8VA 4ROTA 1ZICA 2WKWA 4M0EA 3VJKA 2WJ3A 4LYDA 3MUNA 4OB8A 1LPMA 3CXUA 2BAGA 2AJCA 4PSDA 4AN0A 4X3CA 5JATA 1QO9A 2O2IA 3GZJA 4A16A 1MX9A 4CI9A 4UBOA 2WHRA 4X97A 2P8SA 2WTMA 1CQWA 4CCWA 1QFMA 1WHTA 5HFNA 2ZYSA 3WWEA 5JADA 4QLOA 5E2IA 1A8SA 2DFPA 3W04A 4DTCA 1EHYA 1EXWA 2PU7A 4C87A 1ZD3A 3QZUA 4OU5A 1HPLA 4F21A 2GYUA 4A23A 2OAGA 2VT7A 2JGMA 1F0PA 4W1QA 1TRHA 3H2KA 5HFAA 4YASA 5AOAA 4TVKA 2VJBA 3A70A 4UFOA 5HCUA 3RARA 1CUIA 3I6YA 3S2ZA 1CUAA 4FBLA 1KEZA 3G0IA 1UK7A 1MJ5A 2PL5A 2OQVA 5AJHA 3AJAA 4U2DA 5LYYA 1BS9A 4CG3A 2B4KA 4L3WA 3O9MA 3CN7A 4FLMA 3HEAA 1G5FA 2QR5A 5CXXA 4DNFA 1BEZA 1LPOA 4B0PA 3GROA 1EDEA 1YAHA 2JBWA 1DT5A 4G9EA 5JD5A 5J3JA 3D0KA 5K3BA 1VLQA 2QXUA 4PNZA 5HF8A 1A88A 3G9ZA 3STXA 5AKJA 2VJAA 3BWXA 3QBJA 1QIHA 4MJ3A 4AX4A 2HIHA 3AIOA 4OSEA 2OGSA 2OCLA 5T4BA 1H23A 1W52X 4J3JA 4U2FA 4H7HA 2RAUA 4CCYA 2J4CA 1IZ8A 1UKBA 4FFWA 4J0KA 2AXEA 2HA0A 4E46A 2PSDA 3W2TA 4FNMA 1UOOA 1QTRA 2J3QA 3V1MA 1CFJA 1UKAA 2Z3WA 1QIDA 4G4IA 5ALEA 1GXSA 3QPCA 5CBKA 1XZJA 4QDXA 4DGQA 1BE0A 4X95A 3RLIA 3VKFA 2WIDA 3BDIA 2XB6A 4KAJA 4B80A 3ICWA 5JYCA 4J0CA 2HRRA 1GKLA 2QS9A 1DT3A 2VTVA 4Y2TA 4JYPA 3C87A 1XZIA 5CMLA 4Y2RA 5JALA 4Y2JA 5A6VA 1EH5A 3MVEA 5LZ5A 5JD6A 5A62A 5I8PA 2XMZA 4CCYB 2WJ6A 3F8SA 1KU6A 2JGJA 4G1FA 5EHQA 3VISA 4FOLA 5JASA 3TJMA 5D3ZA 3OURA 4C4XA 4BVLA 4BZZA 3H19A 1EI9A 1CEXA 4QZVA 4I3FA 4DMHA 3E4DA 2JEYA 4AO7A 5EGNA 1CUUA 3AUKA 4KR0A 2B61A 2E3JA 2VJCA 1EVQA 4CG2A 1QJ4A 3ZPXA 2C58A 3HI4A 5E4YA 1MAAA 4BTLA 1W1IA 2VA9A 3HABA 4GW3A 3WQHA 3PICA 1ZGBA 2XUJA 1JMYA 3WL7A 1LPAB 4ITVA 2V97A 4LXIA 4OU4A 1VZ2A 4LKOA 3EQ9A 3HSSA 2XQFA 1CV2A 4H7JA 3FYUC 1N1MA 1ODCA 4DM7A 1MO2A 1CUJA 5KREA 5A7FA 4F5ZA 4QE3A 2HFKA 5AKXA 4P93A 3K9BA 2PSHA 2WHPB 4BBZA 4YX9A 2C4HA 3OPMA 3HC7A 1CUHA 3C70A 3I2IA 4X6UA 4Q3LA 1E8MA 1JI3A 4WFIA 2QJWA 4J0IA 2YYSA 4QDUA 5CXUA 1FJ2A 4BE9A 4ARAA 4B84A 4IH9A 1WPRA 2RHTA 1N5RA 4ZREA 2QVBA 3KD2A 2H1IA 3OOSA 4H18A 3AIMA 3C5VA 1CR6A 1RP1A 1EX9A 4YK7A 5AKEA 2HADA 3O4JA 2HFJA 5IVKA 3C8DA 3CN9A 3WK8A 5HQ3A 1JT2A 1H2WA 3H18A 2R8BA 2HL6A 1VZ3A 1VXRA 3EQ7A 1R88A 1JJBA 5ALTA 5AK4A 1FSSA 4XWGA 1LPBB 4FNGA 3W9BA 3F9CA 2C0QA 4KEAA 4OYLA 4X92A 4OPMA 4HAIA 4MEBA 1CUWA 5AO9A 3MGAA 5JARA 4WDRA 3QITA 1E89A 2OQIA 2DHDA 2ZYIA 4Y2XA 3SC2A 3VDXA 3IDAA 5ALLA 2G4LA 1P0IA 2GBCA
chains in the Genus database with same CATH superfamily
3VU9B 1CUYA 3ETHA 3T0FA 2RH9B 1VP3A 5LQAA 6ABPA 3H04A 4S04A 3SF0A 4H3KB 1DINA 2ZKIA 1REQB 2R0QC 1BZYA 4ZQCB 1QHXA 5DV9A 2I1WA 1NJSA 4LJLA 3TTUA 4B75A 3MUEA 1FRZA 4W8OA 4X20B 4OX9B 1B76A 1WABA 4J6FA 3IEKA 3FHCB 1QRDA 3U9LA 1PJQA 1Q14A 1Q17A 3MCZA 5HKLA 4TXJA 3UB2A 3QW2A 2HM7A 2K6GA 1YBMA 3SF8B 4GLBA 1VCNA 2P27A 4C22A 4M86A 3FGNA 4KN8A 4AJNA 3LBYA 3ENQA 4IGEA 1MVNA 3BA1A 1N78A 3KHKA 2E4AA 1JIXA 2FMHA 2IEGA 5DASA 1JJVA 4L95C 5IULC 5EWJA 2PXAA 3O3MB 3QUSA 3JQPA 3U3MA 1FUEA 5ALWA 3TR5A 2ZJ7A 5BORA 1V2HE 1YDFA 4YI3A 3RS4A 2C7QA 3DPIA 4GNRA 2OZVA 4HUTA 4F3CA 4ZCIA 3QEMB 1A1VA 2WWRA 2LTAA 2YJ5A 1G19A 4RF2A 3A6DA 5AI9A 3F5FA 1GL7A 3C6ZA 3T0IA 1LV8A 3I23A 3T3IA 4FK8A 2JHPA 1CTQA 2VYCA 2WJ4A 4EUKA 4MQEA 1A04A 1RLTA 1UBSB 5TS2A 4ASUD 3OCXA 3HXPA 3Q7PA 4RF5A 5IVHA 5T4EA 3U3JA 3E5NA 1UC5B 1KJYA 3H6GA 4H16A 4MV8A 3RT1A 1C0KA 3TRJA 3UC5A 1MVLA 3L6DA 2FSPA 1NQTA 2AF4C 3EXHC 3N2KA 5EL0A 2RB4A 1QQ7A 3OCJA 3UB4A 4R1OA 4V1CA 1L5ZA 2R4TA 3IQGX 5E3JA 1JG4A 1X19A 2XNHA 2ID9A 3AUJB 1ISRA 3G8YA 2PQMA 4MS1A 3W5VA 2PCLA 3H1TA 1V95A 4PG4A 2FK7A 4G36A 1FQOA 1SH7A 1AQ6A 3UK1A 1QV9A 1KPGA 5BN4A 4J03A 3E7FA 2BRUC 2D5CA 1KNXA 4IOMA 4TS1A 4KR9A 3T1NA 4E94A 1P33A 3S7ZA 3A14A 4KDRA 4JX9A 3RC1A 3GK3A 3IAFA 1ZNXA 3KU1A 3O92A 4IDFA 1AN0A 4OJYA 4Z99A 3O9ZA 5IANA 5C5IA 3T94A 3BTSA 3LX4A 1EE2A 2DEUA 3B1WA 4RA6B 4DDWA 1V43A 4HEA1 5DTIA 3SBOA 2G1JA 4D7AA 2OK8A 2Q5CA 3IAUA 4TLBA 4FDVA 3V5NA 3ZCQA 2QTRA 4LXYA 5K8VA 1UKCA 3UJNA 3VSBA 2C3PA 1L5GB 5DZSA 1QGUB 2CXXA 2F3UA 2RGUA 2ZIVB 4BQQA 4L0MA 1RWPA 1CYEA 5A3RA 4GC5A 4FQ7A 4P83A 2OSBA 3NPAA 4JC0A 5F9MA 3UXYA 5JIBA 1XDDA 3HWWA 1TT5B 2ECFA 3NTVA 2X0JA 3O82A 2EFHB 4X94A 3CLUC 5T8KC 2HNKA 2NZJA 3IBCA 3O47A 1QBKC 4XDZA 2P7IA 5IN5A 4HXEB 4QPNA 1Y0BA 1N25A 5BR4A 1P2FA 4RUKA 1H8HD 2RI6A 2ZRCA 5EWMA 3V1TC 1A7AA 3N8NA 1PQWA 1XCPA 4RELA 1Z4LA 2IYOA 2CMFA 4MGKR 2HWXA 1HDGO 1Z5WA 3GAAA 4F71A 2UUAB 4DLVA 3LUKA 1VHWA 3DMTC 1D04A 3U7RA 4E5PA 5K4HA 4Q3NA 5AIAA 3I4CA 1FX1A 1ITZA 2P0EA 5HUHA 2ZSAA 4A1FA 3HCDA 3MAGA 2CJYA 2JAOA 4OO3A 1Q7EA 2ZRDA 1A8QA 3W6OA 2D0OB 5HKKA 1KOGA 3CB4A 4GF5A 3KE9A 4Q4DA 4WEQA 5A4AA 3R8FA 1W6RA 1GZ4A 2IGTA 4C14A 1UP4A 2WJIA 1T2DA 3AB8A 4N54A 4G85A 2FPPB 3GIDA 4P3NA 1Z4IA 4A36A 2A9FA 4ZOEA 2QD4A 4CJXA 1TC2A 5G41A 2YW9A 4ESHA 4OX9Y 3ELUA 4M2LA 4CN9A 4EKEA 3HB0A 2QRNA 5EPOA 3DHWC 5EJ6A 4CMAA 2PGLA 1L6IA 4Q1VA 2EATA 5CFPA 5AICA 2BKXA 2CVFA 2AOTA 2PD4A 3GJTA 3KDAA 3TLMA 2CWWA 2QIOA 2R7AA 1V8DA 4PYQA 2EKPA 4B43A 2VQEB 1UBFA 4DM4A 2YMQA 4HFNA 4P8RA 1CY4A 4EJSA 1LA2A 3M83A 3KJZA 2POQX 2CLLB 5ETJA 1U2GC 5FAXA 5HKBA 1W581 1W96A 2IS6A 4OMDA 2ERYA 1JHQA 2R6DA 3A4YA 1RPNA 1PG2A 2VOEA 4OJMX 5DMHA 3PPIA 1BA3A 2I6SA 4TQAA 3I0ZA 2JB9A 1JHUA 1B1CA 4BVHA 3JV7A 1Z08A 3ZLBA 3ZDYB 1H1TA 1AIPA 3MT8A 2XITA 4MUMA 2HBYA 2ISCA 2ZB8A 1SXIA 3CCCA 1A82A 4UCXA 3V8MA 2ZIFA 2C5EA 2IRWA 4DC0A 3DBVO 2BGJA 2C4KA 1VMDA 5F64A 3VPSA 4N82A 1NVAA 1LDYA 1LBTA 4E09A 4REMA 2WSLA 4IWNA 5ILQA 4OJKA 1IIRA 1HXHA 1HDEA 1E2EA 2ZSEA 3CX4A 3DL0A 4PAWA 1U8XX 3PPYA 1D8TA 4M1SA 2WIAA 5THQA 3WMFA 4WNYA 4B6QA 3QFSA 4XPIA 4JXKA 4L9AA 4L2IA 1NU8A 1KI6B 2QTBA 4CIXA 1MRSA 3S2FA 1EK1A 1IWBB 3KKNA 5DK4A 4F72A 4KR7A 1V1JA 4MR9B 3DVQX 4QUBA 5FBWB 3GDWA 1E79D 2UUCB 3FROA 4ZVUA 1AA6A 1C7JA 2C29D 3K72B 1EB8A 1KPIA 2DX7A 2QSUA 2VDMB 3A1UA 1WULS 1FY2A 3C6YA 3DEYX 3LY9A 4MKFA 4BV9A 1SCUB 4ED9A 3B70A 4QSHA 1E7YA 1IBSA 1YJQA 3AX6A 1BJRE 2F48A 4ZK6A 7MHTA 1ZIYA 2DY0A 3HBNA 3CH7A 4BFXA 1E2KA 3M7IA 4XYBA 2J4FA 1NMXA 1NW5A 1DSSG 3NHKA 4KYUA 2V6JA 1U9IA 5DGHA 3LLVA 5ARBA 5C37A 1MMFB 1TTQB 4HDSA 3ZIAD 3AOEC 3TMAA 3PC2A 1LZKA 2CF6A 2GF9A 4KUGA 1T8YA 3O8OB 5KOJB 1I3CA 3DWEX 3EXIA 2IHNA 3O7WA 3LKDA 2PKRA 1B6GA 5GGYA 4N39A 1PJ3A 4P4SB 1V9LA 2O2CA 3OCUA 3KPYA 4HNQA 4N65A 4X66B 4JYCA 5AHRA 3N07A 4KVFA 3T3DA 3U4MA 4NJMA 3ZK7A 3ZW9A 5AUOB 5DLEA 1N7IA 1E1CB 2BT4A 2O5RA 3EAFA 1T9BA 5AOBA 2HN9A 1QX3A 3BX1A 4M0KA 4EMSA 2D1SA 4YYZA 2EWVA 2I91A 2XQJA 3PNOA 1GQRA 4CNQA 2A33A 1RWBA 4UDXX 1EJ0A 1HTBA 2BI7A 1QIGA 3G23A 3JZDA 4I5GA 2V7GA 1YD7A 4QPZA 4BE4A 1L4YA 2CHGA 2CKDA 3FFBA 2Q6TA 3Q7SA 1P2GA 3BWCA 1ACLA 2RGWA 4BWGA 4D0RA 1BDHA 4I1SA 4ZWNA 1Z33A 1UL1X 4QRDA 4R05A 3ZIAA 2NVOA 4N3AA 4JCCA 4LYHA 1VDZA 3FZEA 3DFMA 4CR7A 1W4LA 4LQCA 4Z8XA 3ESAA 4UQPA 3PX2A 2IV3A 1Y6RA 1DIBA 1US8B 3SSMA 5LMCA 1T6BY 3QWAA 5J23A 4MQ4A 1LTKA 2J6CA 3AJEA 1RHRA 2ORIA 2QL7A 4I2NA 2W6JA 2I2DA 1EFRD 4W1PA 1Y4ZA 1TYDE 5T67A 3ZLUA 3E3OA 5K0GA 4CR6A 2IW1A 1LPNA 4YUXA 1YI1A 1S01A 3BQNB 1GCUA 2V3WA 4OHXA 1P4RA 1Z0JA 4RY9A 5AVWA 3DVAA 1VB5A 2ZVPX 1SKQA 1S0UA 1BVRA 4K2AA 1I4OA 1X8KA 1R9GA 1VSVA 1Y37A 1KZ7B 2VWQA 1JQ3A 5A4DA 5EHXA 1ONSA 2QMZA 4E5MA 1FLVA 1EQUA 4FCWA 2WZBA 2QTNA 3DGFC 3OPQA 4EW6A 6CHYA 4FFVA 3GDOA 4ECAA 2YR0A 2ZUTA 1QDUA 2Z1DA 4HL6A 1ZO8A 5TC4A 1OZGA 1VL6A 2VBCA 4EGCB 4MQEB 4BBPA 4D6PA 3C3KA 1ZBQA 2Q28A 4RW0A 1NLMA 4F6RB 1CF9A 1BCRB 3NNSA 1XRRA 3GCGA 4CMGA 2QEQA 3CO0S 2XBUA 3UXHA 5JS6A 1ABBA 4AKTA 1IEQA 2IHBA 5DRTA 1KDTA 2M1XA 4XEUA 3EYWA 1GVNB 3WRWA 3ZGXA 1QU2A 2WLSA 2Y92A 4YJGA 3ZJ4A 3ZCUA 1IL0A 5B37A 1G60A 1HLPA 1HZZA 1OF1A 2PRIA 2A30A 3A4VA 1A9OA 2W2KA 1G66A 5ESXA 3UPUA 1B7GO 4JU9A 2Z6AA 1F6DA 4R1PA 5H9WA 1XCJA 4GICA 5K0SA 5F9HA 2I8CA 4TS9A 2VDJA 1DC8A 2EX1A 3RLFA 3FHJA 3E61A 4IMIB 2NQ2C 3RS5A 2LIPA 4UBJA 2OCDA 4UTNA 5CB4B 1LNSA 2C2BA 4Z2AA 3J7TA 2OP0A 3FTPA 4UOEA 5L4SA 1DKRA 1VP9A 1UDRA 1TTTA 3DZ8A 3NWBA 4MUAA 3EIEA 1B23P 2B0CA 3N5KA 1MQ9A 2WKQA 4WK0B 3UJBA 3LKVA 5KSZA 2XMDA 3ECAA 5FNZA 4F3YA 5KQMA 4DZTA 2JI8A 4B3SB 1EEXB 4ZKEA 2YUTA 1I7LA 3AHGA 1REQA 4WBSA 5FUVA 3I45A 3U3ZA 4M1KA 4E2FA 3ZD7A 5C8YB 1NOKA 3TGWA 1T15A 3ZHUA 3ZBPA 3L0DA 3WY9A 2F8SA 1EG7A 5FKJA 4LF9B 1QOZA 2GJ9A 3Q0IA 3A4MA 4NJMB 4XE5A 2LCIA 1OSNA 4HUJA 3DHVA 3FNRA 4MKZA 3CRW1 1L2TA 2CUZA 2ZYRA 3FPEA 4OREX 1QTNA 1EXDA 2C92A 2QUAA 2PX6A 1KZ1A 5F51A 5JDIA 4RGYA 1RDFA 1NFRA 4RTRA 2NZUG 3FVVA 4GPEA 5JZMA 3SDZA 4ETMA 4L5BA 4POAA 2AX4A 1Y3BE 2NAFA 5F78A 4H59A 5IARA 4BN4A 3PNVA 2OFFA 5L3VA 4INOA 3WFZA 2ZIZA 3MWEB 4JLWA 3T5PA 1L5OA 2CGEA 3EF3A 3I61A 3IUJA 2V6BA 5T3YA 2ZPUA 2Q5HA 2MSWA 4HB0A 1K98A 1T2UA 1ACJA 2WHXA 2Z2JA 1MRNA 3V1KA 5KDDA 1L7AA 3SJCA 3PEEA 3SPXA 3K70C 4YHBA 2KWIA 2NU6A 1H0RA 2HO5A 2GVNA 2AB0A 3N2GB 4OXQA 1YR8A 3AHCA 5JBQA 2CXQA 1Z74A 5TPZD 2WAMA 3T3EA 2XODA 5LUAA 1WVIA 3TZQA 1T0PA 2D2VA 2LWIA 3PDHA 4TPKA 3JQ9A 4Q1BA 3IE1A 3AU8A 3VXKA 1MH1A 1AO0A 1WP9A 3PEUA 1YZGA 4TZTA 2HTEA 1GWNA 1FNDA 5H59A 3FDJA 4HI0E 4BRUA 3C85A 1AMNA 3G89A 3F98A 4YONB 2P6NA 2GCNA 1H5QA 4HNSA 1MNQA 1TKRA 4GX5A 3JWEA 1J9GA 2ECOA 3DDOA 5CLLA 2B2XA 3HHPA 1WETA 3BEDA 3ETEA 1U3WA 4LCBA 4RCVA 1OH8A 1GT91 1L5QA 1PJBA 5KVQA 4A8JB 1SOMA 1ADCA 5JWOA 1FBTA 2WU1A 2AFIE 4ZVTA 2DB3A 3MLAA 4Y2VA 3MLBA 4DVGA 5BNTA 1N7HA 4GYJA 4E5YA 2YY6A 3DV2A 2XZLA 3MRTA 4FGLA 5AVYA 5KWJA 4JZYA 3HYRA 5I9IA 4YAFA 2X9QA 1S8NA 2QKYA 3IDZA 1R0LA 1YR2A 3FM9A 3MM4A 1L7QA 1YTLA 2I03A 2OCKA 4JEMA 5BN3B 1VSTA 1EVZA 1Y3DE 3JASA 5DXAA 3RS8A 1V3QE 3UMBA 8AT1A 3KVOA 5BRJA 4MNTA 2P5TB 2UVPA 1H2FA 1P44A 2EZ4A 3K05A 4BEJA 3ZKAA 4IHAA 4ROSA 4GLFA 2CDAA 5EQDA 3M1YA 5KYXB 1AT1A 1QR6A 1Q1BA 1YI8A 1SY7A 2ZAYA 3L84A 1IM2A 3W6NA 1V1MA 3QX3A 5BP7A 4CXMA 1U2EA 2FOIA 4DLSA 5AKIA 3DBLA 4INPA 5FOWA 3WJ1A 3E23A 3TTVA 3M6AA 2XOEA 3FH0A 4PIVA 3RSZA 3R8CA 3M33A 1OWPA 3M82A 4WESA 4PQFA 1EFVA 4JI0B 2ADFA 4IJWA 4YIKA 1NLYA 4G5XA 2VYFA 4D4KA 2PJRA 1KY4A 3K1YA 2ZJ6A 1R37A 2H5IA 1JNYA 4KMMA 1KS2A 1P1IA 2GARA 2XRFA 4UE2A 4V0LA 5AJYA 4FMDB 4DNPA 1N1GA 1Z38A 4MMXB 2R1UA 1VLHA 1E61A 3W8RA 5BN5B 5KTKA 4TN1A 3G9QA 1FP6A 3NJ8A 3PIIA 2C9YA 3T7EA 2ORVA 4CM7A 4N7BA 1GRCA 1TK2A 2F1RA 4GVPA 2XRZA 5EZSA 3ZVMA 3DTYA 2QLNA 3DUWA 3KEOA 4ESOA 1WB5A 2P1ZA 5SV2A 3O93A 1CR2A 5K0NA 1SZJG 3WNDA 2JGDA 1CB7A 3R0QA 4P33A 2X9LA 5CNIA 2Z56A 1Y8QA 2ID8A 4IUCS 3IIEA 2RJNA 3S7TA 4A5OA 4L4SA 3TXYA 4A0GA 3PENA 4D0NA 3LVFO 1G63A 3LZDA 1E9SA 1N34B 1P29A 3OJLA 1Z5GA 4E32A 2GILA 1SHJA 2CYBA 1VFPA 1UZLA 2QAGC 1QFXA 4LG1A 4FFBB 3O8LA 3SYKA 1CG6A 3B52X 4HWOA 5EP4A 3PIDA 3ROXA 5C7YA 5JBIA 3LG2A 1U7WA 1N5JA 3DDUA 2EKBA 1BFUA 3GAMA 4WZ6A 1SVMA 5I47A 2V4UA 5CB8A 4GKKB 4AKIA 2HDHA 1KMCA 1M7GA 4ZODA 3UK0A 4BLWA 1YUBA 1JU9A 3TL3A 4CLHA 1W5FA 1XELA 3ISVA 3KR2A 3NBMA 4IMPA 2XIQA 2HPVA 4OM8A 4D80A 2POCA 4KQWA 5EKSA 3FFWA 3TM4A 4EO9A 5IX8A 3BBLA 4DABA 4YRGA 1GPJA 4GS5A 1U0BB 1JRLA 2QD1A 1ZD2P 4X7PA 5EMLA 1ZESA 5CDHA 1ZM3A 4IIBA 1G8PA 1ZD4A 4L3VA 4E4TA 1TU0A 1QF9A 3ELWA 4PX3A 1P7PA 1PT9A 3WXBA 5HKAA 3W5CA 4WY8A 2AFHB 5AW5A 2L82A 1YQUA 4DKJA 3FPBA 2PY6A 3H8SA 4PLPA 5KJCA 1LDNA 4ZC1A 1PZFA 2V7XA 3HJHA 3WWCA 4OQMA 1QK4A 3GUZA 3RAFC 3IGFA 1O8CA 2HRCA 3SQOA 2CSUA 3V6LA 1AQJA 4CM9D 1H4QA 4LDZA 4FR5A 4IY1A 4OXIA 4ENRA 5LYJB 5E4JA 2JH3A 3PJFA 1FIUA 1WXQA 1PFQA 2B9EA 3WA7A 2ABWA 1D6SA 1IWOA 4IFIA 4C2TA 2WA1A 1J8VA 5D87A 1P1JA 2FUG6 4NESA 3BIWA 3WNCA 4BTVA 5P8WA 4DC9A 4QHTA 3GRPA 4RM2A 5FOVA 1DBWA 2J07A 1PVOA 2WNSA 1UMDA 1AK1A 4D9GA 2RARA 3AI7A 4DIKA 3EG5A 4ZGBA 1A4IA 3TVYA 4ZFNA 5EWJB 4QECA 4UOQA 7ABPA 1Z7BA 1HBJA 1IY9A 2NX2A 4LE0A 4RS3A 1NR1A 2IEZA 2CWDA 4D3ZA 1S2LA 3W5HA 1KO7A 3FTEA 1E2MA 1L9KA 1Z18A 5KVVA 2R8PA 1B73A 1YB7A 3DE7X 1Q0TA 4G4JA 4JJGA 4GXNA 1T9GS 3GA5A 3HSYA 1XZKA 2QUBA 2IS2A 4FYMA 4LJYA 2LZ0A 1K4YA 2VLIA 4JI3B 3ILXA 1X7HA 3K31A 1DKPA 3NDJA 3QI7A 2IYUA 4FNAA 4MQFB 4UNPA 2GXUA 1UMKA 4NF2A 4HC4A 4ID3A 5EZYF 4BNKA 1I8TA 4LHYA 4RVOA 1W1UA 4KC0A 2GHTA 4RPIA 2J6IA 2A7QA 1Z75A 3WADA 4EPYA 1ISGA 3GLIB 2YFYA 1JAXA 5AVVA 5IP5A 2AYZA 3EZYA 1J97A 1FP4B 1NX9A 2PZJA 2UV8A 1EE9A 4MVJP 3G02A 3WGUA 3JQ7B 1M6VA 3CB2A 4FYXA 1UOQA 1CIJA 4ZAWA 4RJKA 1U02A 2RKOA 4B3DA 3UW3A 3L18A 3VKHA 2A0YA 3D4LA 4N48A 5TEVA 3ZKWB 3OQHA 1SPBS 4PYJA 5F1PA 2B9VA 5TPWB 3TW0A 3SMVA 5IRCD 1FSPA 2C2KA 1H2BA 1B0UA 2LVBA 3DONA 3WIUA 1GA1A 3B60A 2GDZA 1FFDA 3HN6A 4DR1B 1CQIA 2VK4A 3ACDA 3CJQA 4AF6A 4YJ2A 3QENA 3EIOA 4YJ3F 4IIFA 3IT0A 3CSSA 2FRVA 3A9SA 4MIEA 4W6QA 5TGDA 4QYSA 3A1EA 4X1IB 1C8KA 1N1DA 1QG6A 5G02A 4OJNA 2GAAA 4GZMA 4AMZA 4C89A 4GMKA 4MGEA 4X7MA 3WK5A 3V3TA 3ZHRA 4D9FA 5A4MS 2DHCA 2XMBA 4KITB 3G2KA 3PUYA 1L4EA 3TZKA 4FDLA 5JDIC 1W36D 1QO0A 1W34A 2OO3A 3EZGA 4P7KA 1ICEA 4WQMA 3S1SA 3FMFA 2Q1XA 3TZBA 3THXB 1U2DA 4BHTA 1PHRA 2F43A 3ACBA 2XY4A 1OTXA 4L57A 2X3UA 4GYWA 3WL8A 3EC2A 1NXPA 2PZ8A 5HBRA 1ZNQO 5TQJA 1ZAYA 3P2OA 3UF0A 4TMZA 4C0WA 5HCIA 3PFHA 3RVLA 3TSCA 2QGFA 3HNOA 1YQDA 2XDWA 2AA3A 4C7BA 1Q22A 4M9XA 1DQZA 5IVIA 4G8CA 1K3UB 1W36B 4HQOA 5HA5A 2IY9A 3P2MA 4DWWA 4EB6B 4AKGA 3KZVA 1EK5A 3IALA 4NV0A 3PYXA 5HOEA 2WFLA 3HB9A 1ZXLA 2IH2A 2QUIA 4Z4FA 3EJWA 3I2JA 5DRYA 5GJCA 1SRQA 2QRQA 3FYTA 4TWBA 3SIPA 4FGZA 2IODA 5CNMA 3IUMA 5DX0A 1OXTA 1CDDA 2WM2A 5B4UA 1VIMA 3VHXA 2HMYB 3ILYA 4MDYA 4HF7A 4R2WA 1RRMA 2GM4A 2GCEA 9MHTA 1P60A 3EVBA 1V5FA 3LT5A 4KQGA 3RDPA 4YJ2F 3I5XA 3GU3A 5CFOA 4QGAA 4TGLA 1YRAA 4A6DA 4OBBA 4BJ6A 4C08A 1LJLA 5GZ6A 2GNPA 4DANA 5LDHA 3FYDA 4KWHA 3ZNNA 4TKVA 1ZCFA 1LW6E 1FVFA 2PFGA 1M1YE 2ZGVA 1M0WA 3A10A 2WAAA 3B1XA 5FT9A 4U1RA 5DI9A 1IJFA 2V7TA 4J07A 4JBWA 4IDQA 1G1AA 3ISJA 1F06A 3D5EA 4Y67A 1ZMBA 2DPLA 3B2QA 4D6YA 4HVCA 4LV8B 1KTVA 4NENB 4R51A 1TZCA 4RQUA 2B2CA 3F5DA 2E4WA 5IAOA 4EUSA 1KZ9A 1RT9A 2PT7A 3FZNA 4C01A 5I7HA 4RQBA 3RU2A 1EDBA 3QA3E 3D1JA 4TTTS 4HRYA 1XTRA 4X8HA 4E5NA 1N2BA 2EC5A 2W2QA 4HLCA 4O4HB 3COPA 3R5TA 5AXBA 3S4YA 1RM0A 4YJKA 2XNKA 4CKWB 4F4DA 4V0ME 4G2NA 4MUFA 3F0TA 5KIAA 3I32A 1J2YA 3DZDA 3ESZA 3UUEA 5I01A 2OC9A 3UHFA 2O5CA 4IKEA 3VYRB 1P1RA 2VJPA 4KMRA 2A5JA 1YMUA 3A1CA 3ZE1B 2EJVA 2AD1A 3P96A 2OV3A 2VPIA 4YJ2B 1BOFA 3EHEA 1O4WA 5CX1A 3RANA 3RM3A 1KWKA 4WI1A 2J7PD 3RC7A 3UWPA 3ZWOA 4F04A 3I52A 1N92A 1T8PA 4HAOA 2JLQA 1FVOA 2QUKA 3L43A 2K2WA 2FFQA 2TMGA 4WV3A 4CT4B 2GZSA 2RI1A 2QLBA 1QQ6A 5JNTA 1B42A 5JQWA 5LQNA 1Y5IA 3PYLA 4WFKA 4QT4A 5HIKA 3TVTA 4JP5A 4DJDC 3WIBA 1GGJA 4NBNA 3KL4A 4YO7A 4CTNA 1GCGA 2BSAA 1X3LA 4LGYA 2PGAA 1WIWA 2A0UA 4BLTA 3EFBA 1SQSA 2HLPA 1UKZA 5I7SA 1XZFA 4BO8A 2EZ8A 3MC1A 2LXNA 3OPNA 4XUGB 5AM0A 4QFBA 4UJ5A 1E9VA 5ALMA 4XUCA 4C0BA 4NG5A 5EYPA 4EA9A 3C15C 1W49A 1UJ6A 3LCJA 2I3ZA 1KYZA 3OO0A 3C3PA 3A3OA 3WRXC 2XE4A 2GZHA 1V6SA 4DIMA 3ENVA 2X3YA 2AX3A 5CLIA 3R5HA 1I6MA 5ALRA 1XHLA 2WUWE 3P9SA 3OTIA 4Q16A 5BW5A 3GO4A 4F91B 1K2VN 1SUSA 4GEGA 3I3OA 1SUEA 2G77B 5LA6B 4YCJA 4LZJA 2OCAA 4V0RA 3ZDBA 3JW8A 3KP1A 5BR8B 4WBNA 2ST1A 4HGZA 3K2BA 3VHXB 4ZICA 5FLKA 4GZ3A 3ZTTA 4EJMA 4KMOA 1XZGA 2P1DA 2W6ZA 3AF2A 2YX1A 2ODQA 5I9SA 1OFUX 1H2RS 5TV2A 1GRVA 4NHEA 1DGQA 3K6SB 4H77A 4ZQGA 4EG3A 3NORA 1KFCB 4B5LA 3UATA 2NO5A 3EIXA 4K8OA 4LDRA 3T5TA 2BKUA 2VR1A 2J31A 4F3NA 4B9AA 3A11A 5E7JA 3R9IA 4D4IA 1UBMS 3R44A 1D4AA 1FDIA 1U7UA 4LDQA 3HBJA 3NHWA 4H0NA 2OHFA 1TT7A 3E8MA 2VZEA 4B73A 4PGAA 2DWOA 1XF9A 2CC2A 1BA2A 4IHJF 2R6FA 4AJLA 4LQ4A 1DRVA 3AW8A 3FTNA 1MB0A 3THYA 4JLMA 3QF7A 4DOMA 3I37X 1U4OA 4XJXA 3X1XA 2EERA 5EIHA 4B7AA 2BFDB 4YCBA 1VIVA 1OFTA 2WIKA 4XRRA 1KE1A 1QGOA 2ZYHA 3ZV4A 2AE2A 1PR6A 3AEQB 3LMKA 3U0BA 2IUYA 3THXA 5ARCA 1I4WA 1NNUA 4WN3A 1E4EA 3DB2A 2XMCA 3LC2O 1IY2A 4J6EA 1NN5A 1M33A 2I3AA 2XF8A 3TNLA 1ZINA 2Y1LA 4JEUA 5LNK6 1WQ3A 2RFLA 2O0JA 3L06A 1ZJZA 4W7SA 1TA4A 5KNLA 1Q77A 1H6DA 3L0CA 4OGKA 4WASA 5C4MA 1RR6A 1C30A 3VR6H 2IP2A 3IUBA 1KI2A 3AGPA 3HUUA 4NU5A 1XTQA 2VYVA 3CW8X 1M5TA 4KE6A 3S2SA 3UVEA 2GBFA 1OE0A 3ZZ0A 5KKAA 2YXPX 2PUVA 2PZEA 1G17A 3QBEA 4BASA 1GQYA 2GN4A 1M6WA 2DTEA 2BEWA 4PC1A 3VZQA 5JR3A 2NV2B 5M34A 2H4JA 3CCBA 3CYFA 3MB5A 1K6XA 2HF2A 3OUTA 3VNUA 1RRKA 4UNQA 4PZ0A 4C4ZA 2VWPA 5LYYA 2OVBA 4BVJA 3UAYA 1R2QA 2XYVA 3OPVA 4Y2HA 4KACA 4V0NA 5CUQA 3S2IA 5LQRA 4UPVA 5IT0A 1X7YA 1U2RA 1JPJA 5EQTA 5B58T 3S8EA 2ZUVA 1CUSA 2C96A 2O0HA 3CF0A 2A9QA 1XC7A 1PNVA 4MYSA 1J5EB 1J0BA 3OF3A 4KQ2A 4EPRA 3TO5A 2JGLA 1QYWA 5CHYA 2I9KA 3D6VA 3GZ4A 4BNWA 4LSZA 3S5UA 2O7RA 1BX3A 2NO4A 1UBLS 1XPJA 4KV9A 5KTRA 3MD9A 1YK1A 1AUPA 2XUQA 1DG9A 2B8EA 2I71A 5ALOA 4IS2A 1OLSB 5IH3A 3NDIA 4CL3A 3S29A 4PX9A 2BCGY 1JECA 1JDUA 2FMIA 2I7CA 4M9ZA 4FB4A 2QY9A 1HEUA 3H8JA 4WN9A 4ZI2A 1FFBA 2XEXA 2X0IA 5LDDC 3ONFA 3EIQA 1M2OA 2PX2A 3B13B 3EXIB 4O2LA 1XCOA 4O2BB 2O14A 2QD3A 1PEAA 1I3NA 4MRPA 3WNBA 1M2VB 3DAOA 1UPUA 1V1MB 1N2CA 1RRFA 4KVGA 4WOPA 3ZQ6A 1I7PA 3CUEF 3HWX1 3QVGB 1T3ZA 1UANA 1IEVA 4LVOA 1Y1KE 4FPXA 4E22A 2BVNA 2QQEA 3GLFE 1D5WA 2V4ZA 4YP1A 2JCXA 5KNBA 4KQ1A 1BW9A 1RI1A 2FEAA 3H42B 2H92A 3GXOA 5ALVA 1UBHS 2FWIA 4V0OA 5BSUA 3NHMA 4UFNA 1E2IA 2OC4A 1BCRA 2OWEA 4YRRA 3RAGA 3WSVA 1I7DA 3ESBA 3B1ZA 3LCMA 2C9OA 3E22A 5C8DA 3K0AB 2OLKA 2O6LA 4RIFA 5FXMA 2OXFA 1GPBA 2B4TO 1EVKA 1DC6A 2XSZA 4YT2A 5LXTA 4E07A 1VL5A 4H4CA 5GINE 3I5UA 5UKDA 2DAPA 4Z4GA 1E1NA 1SXHA 2OM6A 4ENQA 3HUTA 3BL8A 3IIMA 1QCCA 3PKZA 5HCNA 1U0TA 1TQ6A 3JU3A 4FZ5A 2AFHA 2RHHA 3MGBA 1ZW1A 4GYKA 4QG7A 4WJZA 3WKBA 2ZJZA 2HNAA 2XTZA 2IDZA 3ROMA 4ZVQA 5C8XA 1WXHA 5KPDA 1AMUA 1E5XA 1BYUA 1Z0SA 3JD3A 3T9DA 1HTTA 4G8DA 4DCSA 2BDEA 2KM1A 4XTCS 4UULA 1U0OC 1XWIA 2IYNA 2OFPA 4GC9A 4F56A 5L53A 4UBKA 1NHGA 1LQUA 2ZT6A 1KZYC 3P27A 4NBKA 3JQBA 4BB6A 5BVGA 2PLAA 4J8PA 1YO6A 3FTFA 4AXXA 4X84A 3MNFA 4QDZA 4F1KA 3BJZA 5DBGA 3UC9A 2OHGA 4W5RA 1KDPA 4TV8A 1KQ3A 4MUGA 4WLUA 1I30A 5CDYA 3FBWA 3EPKA 1E3WB 1H4TA 5JSQA 3SYNA 2IYQA 4FFBA 2O07A 3QPUA 1MLDA 4KXUA 5DM4A 3HO6A 2YV1A 1DXYA 4OIFA 1NBEA 3F8TA 4O2AB 3WL5A 3ZE2B 4QXOA 4JI6B 3WLIA 3W8EA 2WKSA 4FNOA 1TEZA 4FYVA 3ZBUA 4UVIA 4MRNA 3HY4A 1APBA 2GERA 3SVTA 3ESCA 2FE4A 3OLQA 5DHFA 1EZ4A 1PGNA 1NZDA 2EOAA 1GSIA 1WP4A 2QMUA 3BWVA 4RKQA 3W79A 3IOMA 2RKWA 1KS9A 3ABOB 4JB8A 3IEVA 1RJ9A 1WBBA 3HRKA 2O7SA 1KSJA 2QP4A 1WWKA 2PRKA 4H4DA 1N2SA 3ABZA 3RIXA 4AF8A 3BJIC 1TMYA 3CX8A 3M8KA 3ZWMA 1WEKA 4HEHA 1SUFA 4DCGA 1XAIA 2RHCA 4FN5A 4QM7A 2R6JA 1X15A 1YC5A 4HAZA 4MHTA 4GQBA 5H02A 5C7OO 4ZVMA 5AHXA 2YIDA 1DWUA 4BATA 2G09A 2O20A 1KNQA 1P8JA 1NIPA 3CC8A 5IZCA 3DXXA 1ZK0A 2NXCA 3RBZA 2NACA 2YMLA 5CW1A 3WLMA 16PKA 1SCIA 4BE7B 3ICQB 1VJTA 4ZOCA 4DEVA 4Y30A 3I9LA 4D5GA 5I4BA 3D7RA 1MZPA 1ULBA 1G64A 5FFFA 1DFGA 3L82B 3W6UA 3MWFA 3WB9A 1ECBA 1FBNA 2QN8A 2ZCVA 3RS0A 5IAEA 2QVCA 5J4VA 4CHTA 1IPHA 1AQUA 2DJIA 3F7NA 2BI8A 2NU7A 3IOEA 2SBTA 1YMQA 1KOLA 1VOTA 1UP6A 4EGQA 5HWSA 5GIOE 4FFRA 3I9V1 1KQPA 4JEIA 3DCNA 2HUNA 2D2IA 3LFTA 4X3PA 1VI5A 3K53A 2EP5A 5A1JA 4D25A 3R3YA 2J46A 2QY6A 5LVAA 3JWHA 2Q2VA 2J6BA 4IDCA 2C31A 2IBSA 4IUYA 1QE0A 1CQJB 4NICA 1JQBA 3EULA 3QSYA 4X63A 1K4KA 3TEJA 1THGA 2FZKA 4AC9A 3U49A 4IZOA 4HDMB 1JFVA 5DIZA 5IAJA 3FUXA 3VHQA 4KAXA 1DARA 4D57A 3KB1A 3E2MA 3V8QA 2V7WA 2B3DA 3D6JA 1JVBA 4BV8A 4RLQA 3FNFA 4CG0A 1YH3A 2AS0A 3CX7A 3OLYA 4AS2A 4LYAA 5AHOA 1CBUA 3JWIA 5KMGA 5FUMA 4CGZA 2BFEB 3CH4B 1FZTA 1NVEA 3GUHA 1P9OA 3CZPA 3LF1A 2AN9A 1L5RA 1RI4A 3EODA 3JXEA 4F60A 4KRYA 3KQLA 1F4VA 1ADGA 1B1AA 1E6MA 5EC8A 2GZRA 3TSAA 5KOYA 2FSIA 1NWCA 4PG8A 1VJGA 4DV7B 3DV9A 3KAQA 4O59O 1KBQA 3KT8A 1NI4A 1BGVA 1QRUA 2HYIC 4H6VA 2HA2A 2QAJA 1L4NA 4DV4B 4BLSA 4M8IA 4QUGA 1OTHA 5DP1A 2QV0A 2GHRA 1G8HA 2ETXA 4TMTA 4E2ZA 5TQ2A 1YDMA 1B8UA 4LWZA 3L4KA 2VP9A 1USVA 2QSZA 3C74A 3RHFA 3VNQA 3WMRA 2RIRA 1V71A 3ROKA 3K4HA 5K8LA 4KBYA 2DBYA 1WCV1 2MIIA 1GSAA 3MMPA 2R47A 1GPDG 4MS3A 3LUJA 1SKYE 5EIFA 5MGNA 3I3SR 3M49A 1NHWA 4IJMA 4GGPA 3X2SA 1NM5C 4E3WA 3CF6R 4EG8A 1XEAA 4U2GA 3RIMA 1Q0HA 2XUGA 4KIUA 3H9UA 3DXYA 1YQXA 3VI4B 1MBZA 3LT2A 2PS1A 3SYLA 4F2HA 2GS9A 1K8RA 5F9FA 4HDOB 4RIHA 1L8OA 4R2XA 4NCAA 3FJ1A 3G8BA 2GZMA 2J48A 3I64A 2CSXA 5I9NA 3Q3JB 3WGQA 1K8QA 1GG2A 2BGIA 2XMPA 3BTUA 3U37A 1ID8A 4XQ0A 3KUXA 2WDPA 1Z26A 1HDOA 4OGLA 1QS0A 1OLSA 3V7NA 4ARUA 1F6WA 2E4ZA 4U63A 2OBNA 3PHGA 4UQOA 4HQLA 3U0VA 3VOBA 2V1XA 2V9PA 2Q49A 4GIBA 4C2BA 4F4FA 3ZLJA 1K2WA 1F4LA 3Q85A 6YASA 3JYLA 2GBLC 5JFGA 1P31A 4K9OA 1JSLA 3DJYA 3ZI0A 3B78A 3K35A 3NGMA 2V1UA 3KLOA 1Y42X 2C2WA 1ZUIA 1NC1A 2BGRA 2F00A 3OZWA 1NBAA 3TE7A 4A8HA 5E9WA 3HXMA 4IYJA 2I76A 4HFJA 2XJ4A 2YN0A 2CNWD 5JANA 3DTVA 1DTEA 5LQKA 1N57A 1JMVA 5B3KA 5M29A 4JT9A 1YUNA 4BMXA 1I2CA 4UUNA 2ZUBA 1A8HA 3L04A 4FQ8A 1CZHA 2OFXA 5BNFA 2BEJA 3WE7A 5FBZA 3C24A 4EHAA 2ADOA 1PFGA 3KAPA 1NNSA 3R3WA 4P3KA 1FTSA 2ZR8A 1OAOC 4GOXA 3T1OA 1PJ2A 1ZGZA 1P77A 3UWKA 5C9ZA 2ZBQA 4RY8A 1NBOA 3O95A 5TY0A 3V8RA 4BLUA 4F6RA 1XN1A 3JAKA 3ZGYA 1V7QA 4IF4A 3D0OA 1JKFA 1QG4A 1I24A 2ORED 2P3OA 4EHLA 4BX8A 3I05A 4IDOA 1PFKA 3ONDA 3RWMB 4OM7A 3FTQA 2PVCA 1JXQA 2WU4A 4GI1A 4I3GA 4RXUA 5BVHB 2G1PA 2P0AA 3B1KA 4QGHA 4E7OA 3UFBA 1RTTA 1S2IA 2WVJA 2OB2A 2JBAB 3VV3A 3A6ZA 2ZKLA 1MEEA 3M2PA 5DLQC 1JWLA 2V9ZA 4MXDA 1FYVA 3L3BA 3VZCA 3L4JA 3ZWPA 1RLOA 1K1EA 1E1QA 1PGJA 1T0JB 1P3DA 4FFLA 4WZAA 3ZDXB 1O6CA 5GZ1A 3PJEA 1WCWA 4DMLA 1I32A 1M34E 4Y2PA 2DUUA 5AUPB 5EUCA 2ACEA 5AW0A 3PGKA 1ZZGA 3BDAA 3KHTA 3MYYA 3PJDA 4QYTA 1DG3A 4LBYA 4BN5A 4UHEA 3ZY6A 1YBHA 2QRUA 1G8SA 4KDCA 5G3ZA 3SS8A 1ODFA 1USWA 1EGQA 3LCVB 3AUYA 1D9ZA 5LLDA 4UNNA 4MRSA 5BWNA 4WY5A 2IYXA 4LF7B 4WFJA 4M98A 4RO0A 3ZCRA 821PA 1TEXA 2V0NA 5C2JB 1LBSA 1B6RA 1A69A 5DGXA 1AZWA 4MJ7A 3KFXA 1QB8A 1C7IA 4R2IA 2CK3D 1Z56C 3KLMX 4P58A 5E1OA 1P0QA 1U04A 1IRIA 1BMTA 2DCUA 1D2AA 4HUQB 4BNMA 5K3AA 1PYGA 1KAGA 1ZR2A 5C32A 5GONA 2BHLA 1I33A 1DRKA 2HIGA 1IBMB 1J0DA 4UVDA 1UQUA 2Y3IA 2DR0A 3R6DA 4HD8A 3PZBA 2AG0A 2OXRA 3FRJA 3RBVA 1P2UA 5JFTA 1JDBC 5DWDA 5FO1A 3H2YA 2H1LA 5JO0A 1RHMA 1VCOA 2F4NA 2PPLA 3OZ7A 4KR6A 4EHFA 4HLUC 4Q00A 3H2JA 3ITDA 1M34B 2ZPTX 2H4ZA 4WKPA 5COAA 4XEHA 1JJIA 2XOKD 3A7EA 1VL1A 1U8CB 3GCXA 1JEQA 1V5GA 2A0XA 3BREA 2O3UA 3MK31 4O8ZA 5DHTA 3AI2A 1GARA 2VZ9A 1XMSA 2QTAA 2Q3HA 5EWLB 2X6RA 1ADYA 4JKOA 4BO0A 5KX5A 2FSSA 4OP2A 4R31A 1RYYA 2B4AA 5CNJA 4MRMB 1XTSA 3BE8A 5KYVA 2LW7A 1UC8A 2H5EA 4BC1A 5FAKA 3D8RA 4YNBA 3RIYA 1DO8A 3G5LA 1ND6A 2O1WA 1TA0A 1GCOA 1C4WA 2OV8A 3C3DA 2HSGA 4U3JB 3D0QA 421PA 1JBKA 1NF2A 3VSCA 3UMCA 1NDHA 4FC7A 1UAGA 5KX5F 3G0HA 1YQ9A 1EWYA 3FYSA 3R41A 5F5XA 4N4AA 4UNIA 2H7YA 4ZAFA 1DJOA 2A8YA 2Q1SA 2YZMA 2C5SA 4EVQA 3W8FA 5JROA 3KOWA 1DMSA 3FAKA 1F6BA 3QA9A 3I2HA 3QYPA 1YK0A 1U90A 3DZJA 3G2OA 2TMDA 4I55F 1GU0A 3LK6A 3A9VA 2YS6A 2XTJA 1KOJA 3H11B 4CHGA 1X8XA 2FWPA 2NWQA 1SXJE 1SWVA 3ZS9A 1AHPA 4M55A 3GJ4A 2HREA 2VTEA 5LZ2A 2V7BA 4B48A 1EWRA 1UWLA 4B9EA 1YA6A 4MRVA 5ITZA 5CB6A 1SBNE 3NKVA 2EXXA 4XB1A 4EFKA 3GRAA 3R7NA 2GA9A 3RSHA 1SIUA 4JUBA 4MULA 3W5AA 3PEYA 5FL7A 2JFXA 1Z45A 4KYIB 4LPKA 3AETA 4NQRA 5EJAA 2H9YA 4BP1A 6PFKA 4P1ZA 2K87A 1DRWA 2Q5FA 1GTL1 1PSDA 4ZZIA 4ZZ3A 3KOMA 2YJ3A 3AP1A 3OT1B 2DHEA 3JQAD 1DIOB 4RVCA 2QN7A 4EUHA 5FUQA 5LJIA 2DH6A 2Y4NA 1ZK4A 1FDSA 3HCEA 2HJ9A 1RWXA 4B44A 4HTAA 1E6WA 2CNOA 2FN3A 4IWXA 1JBQA 3VU0A 2ATXA 4C1BA 1RRGA 4HB4A 3BZBA 1P45A 4LXHA 4XCVA 3R3ZA 1MZVA 2ZP1A 1R9MA 2O2DA 2PS3A 1NE2A 4AX8A 4JLOA 1VE1A 4H7EA 5IG2A 1UPFA 2XECA 1KMIY 1RWNA 2OAP1 1NXWA 4IJVA 2HQ1A 4J0HA 3ZC3A 1SRRA 1Y3HA 3K9GA 2WFLB 2HJRA 1ISPA 1CDZA 5IZ4A 5ADUS 1QMPA 4PHFA 1JAZA 1F0NA 4KV7A 4NPCA 1OGIA 2SNIE 1FQJA 2H9IA 1MV5A 2HXSA 2RKBA 2GCIA 4IJ5A 3UHPA 1KAMA 5KC8A 5DNYB 1HSOA 1BKYA 1Q2UA 1YR3A 1P72A 3ECCA 1JSRA 3L6CA 3NAGA 4KG7A 4RPHA 4Z1MA 4ND1A 4EHJA 1N32B 3OX1A 1O89A 5CNKA 3QMMA 3KQKA 2FZCA 3CBQA 4WACA 1O3YA 4RH3A 5KOIA 4Y7DA 1HR0B 3L1VA 5JD3A 2B1QA 3C5CA 1LSOA 2VO1A 2NXNA 4LZNA 3KSRA 4OSOA 2P75A 1DMRA 4M7PA 2AZMA 5LIPA 1HK7A 1XVVA 1V7ZA 2G7MC 3MWJA 1MKYA 2AFIB 5K8JB 1OY1A 2IPXA 2J6HA 2LCFA 3JR7A 4C3OB 2JL1A 3O4VA 3U16A 2ESRA 4QBFA 2PDAA 4RK1A 2XGSA 3C8HA 2CL6X 2HSWA 3WNZA 4YAOA 2BEUB 3O90A 5JSUA 2ZTLA 2EFDB 3NBYC 4AMGA 2SKDA 1JKIA 3ET4A 4B3GA 1Z8DA 4GL2A 4EHNA 1J8YF 4ZI7F 5HF9A 1TUBA 1G20E 2B8TA 3VBEA 1N6NA 4JYMA 3QY0A 4L51A 4EW1A 5JT1A 2B78A 2GNAA 1N6IA 1TJNA 2XX3A 3FCXA 1ISFA 1X38A 3OAAD 4HEA6 4YB8A 3SFZA 1M6YA 2ZU0C 5ED0A 1GFSA 4L9RA 2JLCA 4GWKA 3DKRA 1PBTA 2XV1A 2GPTA 1IULA 2AQHA 3ZZUA 1QO7A 4Q3DA 5TF4A 3BKWA 1WO8A 1PAUA 5B55A 4PAMA 1TJ5A 1W1WA 3HJBA 2GASA 4A8PA 3IT2A 3ZHCA 3IEMA 1G6Q1 3RK4A 4AVYA 1SU6A 4GMDA 1G4HA 1RW4A 1U7PA 4NOJA 3GVIA 3FWNA 3OCCA 1DDOA 1G6HA 2L69A 4DJAA 2BBWA 5FLEX 2BY4A 3HKEB 4RNDB 3ND9A 4HPJB 3TD9A 4Z1MD 3VKVA 2PN1A 2GEBA 2C61A 5CDTA 1BU5A 1YJCA 5HSGA 5KNCH 2W43A 3QW4B 5KEIA 4OUKX 3TDNA 3K0HA 4X7BA 4PPYA 1Y6GA 1JDBB 3AW9A 1JXMA 1D2NA 3LVBA 2GVZC 1M2WA 2PWAA 3QXGA 4P7FA 3QLEA 3HSKA 4OQFA 5FR1A 4AP9A 4DG9A 4Y9TA 4YJHB 3L93A 1XNHA 4WUTA 2BFDA 4N0PA 3T9BA 2P9QA 3VV2A 4Q34A 3O3OB 2KBFA 5KTNA 5JZSA 3VR5H 2VSFA 4BUCA 1OX6A 4L3OA 1GPAA 5IBRA 5LXTB 4U6QA 3SQLA 3PTAA 2WG1A 4DSNA 2ZOSA 1MH9A 2XIJA 2NUAB 4D4MA 3PQ3A 4CM9A 1SEPA 4PXAA 2XGJA 1PR3A 3OH8A 2YHIB 2IHYA 1KQFA 2ZE7A 3KOXA 4IICA 4C0KA 3TI9A 5G1OA 5AM5A 1H0KA 1KHTA 2XCSB 3SYMA 2V4MA 3H8VA 2V5UA 1ESMA 4YA6A 4OYYA 4MV0A 5TMBA 4RTMA 2XADA 3FVRA 5KTTA 3A6EA 3DDZX 1Q7RA 3HO8A 2GJSA 4R1TA 2ZUWA 4ZU3A 3Q1LA 2MDTA 3M70A 3QUQA 4GOOD 3K0EA 1GTSA 1XKLA 1YB4A 4H1UA 2XKBA 3LRPA 3R6TA 5HE8A 4ABYA 2C9ZA 1QCDA 5CRIA 3GUVA 4CQLB 2NNWB 5KKNB 5JTUA 1C80A 4U7TB 3VGPA 3GLHE 4NSNA 1BSVA 2WM9B 1LTQA 4NOMA 3TSWA 4C6TA 5KS2A 3EQ6A 4UEQA 1DOHA 3D43A 4RMJA 2HHCA 1HT0A 2PLWA 4ZMBA 4MVXA 4OBEA 2EIHA 2ZVJA 4HNAA 3MAJA 4WNCA 2LR0A 4RSGA 4J4TA 4W9MC 3L7DA 1OLXA 1EGHA 4A5SA 4PSKA 1DNPA 5D85A 1WM1A 2VDOB 2FI1A 2HHLA 4GKJB 2H07A 3PE4A 2H57A 5KPJA 4CFZA 5EEHA 4C7OA 5K3FB 5HM6A 2UZ4A 4IL5A 1CK4A 4IILA 5AHKA 1SN7A 1XBTA 1IN7A 4ZYVA 2QL5A 1QIJA 4P7GA 5JLJA 3UHOA 5BRAA 5DFAA 3QU7A 1FC0A 4ANFA 4B4VA 2J33A 3I9JA 4LHVA 4XIIA 5AKLA 2CVOA 3MIIA 1EDZA 4LZLA 4G1BA 3W9SA 5TVGA 3WL6A 5L7TA 4AROA 4O3FA 4EABA 5JI2E 2CJWA 2ZSKA 1WD7A 2PZFA 5JDCC 4AZTA 5J4LA 5M3BA 3DL4A 2WFAA 2HF7A 1JFRA 3GVXA 4YJFA 4BWVA 3VA7A 2FKNA 5ENZA 3CG4A 3VPGA 3RSGA 4BGVA 4N0MA 1TA9A 4WE3A 1MOSA 5B2EA 3TOSA 2QZZA 2F3SA 2HMVA 4FUTA 4RHEA 1UFRA 2Q3CA 4D3FA 4ZVVA 3RSSA 1MVOA 1R15A 3WV4A 3USES 3EWSA 5ADHA 3GFPA 2OGZA 1DFIA 3FHOA 3IQHX 1TJ4A 3HNRA 5CR9A 2H0RA 4MW0A 3UH0A 1JFTA 4TV8B 3UMFA 1UK8A 4E11A 1P6XA 4Q93A 3RKUA 3L4BC 4V03A 4KN5A 2WE8A 4G3XA 2P77A 1E58A 3FFTA 3LO8A 1TMGE 1ZA1A 3GFSA 1J20A 1KGSA 1TF5A 1Y3CE 3R5KA 4JZKA 4BBAA 5LMNB 3CHYA 3K6JA 4RIEA 4ROTA 4C7MA 1JEYA 2QVLA 1F3OA 3KUDA 1Z0KA 3MUNA 3WIDA 2L0XA 3OJCA 4B3RB 1VGVA 4PAQA 2RDMA 3B6MA 4ZJZA 4WJKB 1N9GB 1W4RA 1LX7A 2PXCA 1Q3TA 1UCFA 5JATA 2CV1A 3FB4A 2SKEA 2O2IA 3A3KA 3EDRA 3LA8A 1MX9A 3GP3A 2JD2A 1KAHA 3F3MA 3QG5A 3O4FA 4Z9FA 5FA8A 5CA0A 5KVCA 1MC5A 3U26A 2B25A 1ZVQA 1KZGB 1KVRA 2X1HA 3CNLA 3RV3A 4O4IA 3R7WB 3LPNA 2P8SA 3TX2A 4BNJA 2WTMA 5GJVC 1T5LA 3DDCA 1DFHA 1SUAA 3HVUA 1QFMA 1WHTA 4Q66C 2RGRA 2NMVA 1AXGA 3HO1A 1E9FA 2PKQP 4I1VA 5ECWA 2OZLA 2I6QA 2VP5A 3CEPB 2QL6A 7ADHA 2JANA 2PQ0A 4BJ5A 1OASA 3ZW8A 3DAGA 1MJGM 2PU7A 3L92A 5M7EA 4C87A 3KT0A 3QZUA 1U9ZA 2P9JA 5DHAA 1QAOA 1PSZA 2EP8A 1W0CA 1H3EA 1T5OA 4Y6QA 3IHTA 1P91A 2WM3A 5JE8A 1O77A 2X41A 1T1SA 2G6BA 4MQUA 2KE5A 2QRMA 3H4VA 3VZDA 2F59A 4HBGA 2NOAA 3WOHA 2VTBA 1BXGB 3FI9A 4MUKA 3OX4A 1F0PA 3ZEIA 1QRSA 4KR2A 3SC6A 5AQ1A 1C3EA 4JLVA 1IXSB 1GNPA 1T8RA 3T7RA 3AVTA 2J0QA 1B8NA 3Q6IA 5AMXA 4BKMA 2ZRQA 3O8DA 1E98A 3CLTD 4RD6A 2XXAA 1KQGA 4X54A 3B85A 3FTDA 2O7QA 5HCUA 5DSXA 5BPHA 1S2OA 2V6IA 3RARA 1URPA 1N3BA 3PVSA 3BRSA 3HLYA 1ZJ6A 2CZCA 1Y8RA 3EGEA 1ZXBA 3P2EA 1CF4A 2P6UA 4DQLA 2IZ5A 1AD2A 4TTAA 1YJAA 2OHHA 1L0BA 3CWQA 2NU6B 1I2DA 4Z0NA 4JBIA 2Q9CA 3VC7A 2J0EA 1G8JA 5A0FA 4TMVA 1MJ5A 2PL5A 2NO6A 2GN8A 2R65A 8ATCA 1IOZA 1LF0A 4I81A 2XD4A 1OBCA 4KP7A 5AJHA 2OQVA 5B57C 2AKAB 2UU9B 1UBOS 1E3JA 1C3OA 1GNRA 1LDBA 2B6HA 2PSSA 3CUTA 3KNZA 3HMQA 1M2GA 4G4SO 4OA8A 4JJFA 4PGGA 5REQB 3U1VA 1E0DA 1DUIA 3M89A 2PHZA 3D6FA 4ENWA 1H2AS 1G18A 2J3EA 2X22A 1QRRA 1G5FA 4U7WA 6REQB 2G0AA 2JHCA 5GZ3A 2IHKA 4ND7A 2NT4A 4LNUB 2M6RA 5E3IA 3UYLA 5K6RA 5EAIA 1A7JA 3FBGA 5AVXA 4PC6A 3OU6A 4B0PA 3I1FA 3ZHZA 2ZAIA 4ZT5A 4RZXA 3KXLA 1X1EA 1SBYA 3CLKA 3SHWA 4I1PA 2A9VA 1B4DA 2DULA 1A3CA 2B5VA 2WF9A 1SXQA 3HJCA 4BNDB 3MAAC 3P0JA 5E8RA 5F52A 3LQRA 2HF9A 3AEQA 1OKKD 3V4SA 5JCOA 2P35A 1T3HA 5BSMA 3TW8B 2DUMA 5CVTA 3NYQA 4HNAB 4IIDA 1I1NA 4CKBA 4XUDA 4L8YA 4TMXA 3AO0B 3SN6A 5IKPA 1X86B 3D6TB 3NTQA 2QG6A 4FEGA 1A2BA 3AR7A 4HAYA 1LVGA 2EG9A 2C8VA 3N0WA 2E1RA 4LBZA 1DOAA 4PM4A 4E5DA 3BWXA 2C7GA 3QBJA 4CEHA 2VUHB 1QG0A 5BN1A 1CEQA 2OXCA 1W73A 1F8XA 2GCGA 2QRVA 5GM1A 1UMDB 1VLJA 4D4LA 3UY4A 4P80A 3FZGA 1W52X 3BH0A 4U2FA 1U2GA 2XNCA 3DBRA 4HZUA 4IO1A 1TE2A 3F2IA 4FFWA 4YT8A 2R9VA 2W9XA 2AXEA 2EZTA 4QJ3A 2VBGA 4EWLA 3LY8A 5JI3E 3DA8A 1XTUA 4YAWA 4LJRA 2R1VB 1L5YA 2J3QA 5AVKA 3UMSA 2NYAA 3V1MA 4B8ZA 2PWBA 3IJPA 1UKAA 2Z3WA 1QIDA 2WAOA 1GXSA 1PR2A 3CTPA 3G5AA 5ALEA 1Z2NX 2PT5A 4W5HA 3V33A 1CY6A 3RI3A 3N8KA 4G5HA 3QVLA 1ABFA 1ISSA 2C9MA 5EXTA 4TRJA 3RPEA 4CV0A 4HQKA 2V0GA 3ID6C 1O0SA 5J1TB 1NKVA 3IV7A 1A27A 4HH1A 2YIVX 5IVPA 3EG9A 4DQKA 4DR7B 1FJXA 3TW8A 3VZPA 2IYSA 1A9QA 1N0UA 3IA7A 4L5CA 4JWTA 1VHDA 2FDCA 2VOJA 3ORHA 5BPFA 3PRKE 3RUCA 1ULZA 4DAOA 3M6IA 2HRRA 3T7DA 2ZZNA 3GFRA 3MSCA 1ZM9A 5GV7A 2ERCA 2HLDD 2VTVA 4U5XA 4Y2TA 5T6MA 1TYZA 4JNKA 4JYPA 4B4KA 1IXRC 5CMLA 3AEKA 4Y2RA 3U5TA 5EVJA 5JALA 3DUFB 4Q6BA 1EH5A 1GGNA 3DE5X 4B79A 3M34A 2WVGA 1C9NA 3MVEA 4GOLD 2HX1A 1P4HA 4AWXA 1YVDA 2LD4A 4AD8A 4WXRA 1MOQA 1T0HB 2VYVD 4LC1A 2ALJA 2BR3A 5JMTA 1B15A 4R2MA 1QC5A 2XMZA 4CCYB 4ZDKA 3FKJA 1HZJA 1Z6XA 2NQTA 3JQGB 4FCTA 3LUDA 1FYWA 3H4IA 4G1FA 2QRJA 2ZWAA 2WJYA 3HR7A 3NJ4A 4OSPA 3TJMA 1I2MA 5LPNA 5C3MA 1D0SA 1UJ4A 2ZSDA 3GCDA 1XRSB 4BZZA 1AS2A 1M0SA 3JQ7A 4OH7A 4DDUA 3IPCA 5BWMA 3GJXC 2UZ1A 4LXUA 4QZVA 1QV7A 2A1TR 1RZ3A 5JQGF 2O8DB 1VGQA 1PE0A 3DVSX 1NTOA 1K88A 3IDFA 4E3ZA 1NQXA 2DRIA 3EIUA 4HK4A 2FUCA 1FRQA 1Z15A 3KK0A 5KDOA 3HWRA 3OQOA 1JIVA 4KR0A 3EZ2A 2E0IA 3BGSA 5KYYA 1ZUWA 1M72A 1UDCA 4ACBA 1G9TA 1FFXB 4CNBA 1QJ4A 1UMBA 3DGEC 4FQ5A 3JQAB 4YJ3B 3HI4A 3D7MA 2VA9A 1JE0A 4QATA 3S2UA 5MFPA 3QEAZ 3HABA 3NLLA 1V9SA 1OB2A 4JX8A 1XRJA 5LU8A 4GKVA 5BV8A 3JALB 3PICA 3ER9A 1ZGBA 1I5OA 1ZAKA 3EC7A 3QKIA 3C6QA 2FE1A 1GAEO 4I1OA 1GCIA 1MAVA 3TAHA 4URXR 1EQ2A 4ITVA 3AF4A 3H9QA 3FFAA 3QUTA 2V97A 1RQRA 3AFNA 4OGFA 3BJEA 5DKFA 1VZ2A 4KVZA 5C0OE 1N0VC 3NKFA 4OQNA 5HKOA 1N2IA 1AKTA 2KB0A 3W1EA 1CXZA 1EX7A 2ISQA 3NQ41 4C2AA 1HKUA 5LYJA 4XI9A 4LWOA 1W48A 1ODCA 4PRKA 1Y6FA 3THOA 2BDTA 2BHTA 5ITWA 3P94A 2M9MA 4IIXA 4M60A 2EYQA 3K73O 1JLLA 2YZKA 2W2NA 2V7VA 5BXYA 4DVJA 2MMCA 1GDHA 1BMFA 1G59A 1UADA 3TNYA 4F5ZA 2PE5A 1XYYA 4QE3A 1H1DA 4QTUB 3OMLA 3VR2D 1VFNA 5GQSA 2G4CA 2NO7A 4LCJA 1I3OA 4K9PA 2R8RA 2ZBEA 3U3DA 1OYYA 5LP6B 1PDVA 3KDPA 2JIRA 4P93A 3BXFA 3TMKA 5L6LB 1T4CB 1TPYA 1FMCA 2PAAA 1SK8A 1U9IC 3NAQA 1IH8A 4POOA 4HJXA 2PSHA 5A3QA 1E62A 5HW0A 5I4IA 5NULA 4WKOA 2AG8A 1JHYA 3VHRA 5J2TF 2JIZD 3BK7A 3HHEA 1SGWA 1PGOA 2C4HA 3OPMA 4LRUA 2N9UA 4V02A 3SBEA 2CUKA 3V8PA 4DV1B 1CUHA 3C3XA 4RPJA 2AH5A 1SU7A 2PCJA 2WWYA 2R5NA 2ZJBA 1ADJA 4PLWA 1K3TA 1E8MA 2RHDA 4B74A 3P9KA 2M1ZA 3GRUA 4LK2A 1MIOA 3AKCA 5K4GA 4X1OA 4MUYA 1QFJA 3FIJA 2CBZA 3SY8A 1OH7A 1QGDA 2YYSA 4HLQB 4QDUA 4FMCB 2ET6A 5FHQA 3ZH9B 5CXUA 4ZT4A 1M0EA 1XU7A 5K8TA 1GDDA 5J63A 3ZDZB 4JLDA 2OG2A 5TQ0A 3KRTA 3ZGVA 4D81A 4ZGWA 3UMMA 4C4SA 2RHTA 3TQIA 1TZ2A 1CE8B 1X8LA 4JP3A 4ARCA 2RHLA 4MITA 3LT4A 3KD2A 4CW7A 4LV5B 2GUGA 4OQPA 4NI5A 2VPTA 2YIMA 4JBLA 1EWVA 2O0LA 2NZYA 1CR6A 2Q9BA 2ZJ0A 3LD9A 3O2JA 2ZRKA 5G53C 4R5MA 1Z0AA 2DWQA 3T7AA 3UKJA 3HKBB 5DW0A 1EX9A 1RJ9B 2ZI6A 4G2TA 5C8YA 3TPZA 2HT1A 4B7XA 2HADA 4B6SA 1G8GA 3I6QA 1NPTO 4BGUA 2HFJA 3MOGA 3RYCB 4O6VA 5IVKA 3CN9A 4LBVA 2PUEA 2QDXA 3R5SA 5H9VA 3W5DA 2LCQA 4IIUA 3IVGA 4XB2A 3A6LA 5M5BA 5EQJB 5JOQA 3IKMB 3I39X 3P5SA 2RSLA 3KJEA 4F38A 3BRWA 3OKFA 3EQ7A 1EHCA 1R88A 3RKSA 3VNSA 3PUZA 1DUVG 3OZIA 3F4KA 3LOPA 1JG2A 3M1AA 3RWBA 3TPFA 4R4JA 3WNVA 2CFTA 3RIEA 2VP6A 1FSSA 4YEDA 1D0IA 2GKOA 2PZLA 1F60A 1TQ4A 3NBKA 4IGIA 4XWGA 1UXGA 3H9JA 2OGWA 1M8KA 4C7XA 4M46A 1Q3KA 1CIVA 1AJEA 5HMMA 3F9CA 4TWRA 2C0QA 3RSLA 3TB6A 3TTWA 1FYDA 4OYLA 2AW3A 1M7BA 3SR0A 3OM0A 5EMKA 1YOBA 2AEEA 5K2MA 1LI5A 5E6SA 4YRPA 5LJLA 3RVBA 2CD9A 4FFNA 4RMIA 1HT3A 3KLPX 3WBFA 4EA7A 4F5EA 3K9FC 2WF8A 4DA6A 1H85A 3DLAA 3OESA <