2O2HA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis complexed with 1,2-dichloroethane
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase 3
publication title Crystal structure of haloalkane dehalogenase Rv2579 from Mycobacterium tuberculosis complexed with 1,2-dichloroethane
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 112
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o2hA00
1CUAA 2ONCA 3DKRA 1WB4A 3QMVA 3S8YA 1I6WA 3VKFA 1YB6A 1VLQA 3W9BA 1QIMA 4EB0A 3O95A 3N2ZB 1QIGA 3QZUA 5I9IA 2WIKA 4UHHA 2OCLA 3MGAA 2RGUA 4FNMA 2QZPA 3BXPA 3CCCA 2WSLA 2WM2A 5CBKA 4Y2TA 3WK5A 4LXGA 4G1FA 1J07A 2OCKA 5LZ5A 3LIPA 2PSFA 4X91A 4DMHA 5ALTA 2B61A 3M81A 4M0EA 2CJPA 5JD6A 5FRDA 2XUKA 1ORVA 2Y6VA 3V1NA 5HF8A 2CKMA 5LLSA 3SK0A 3H1AA 1DT5A 5CH5A 4FLFA 3PF9A 1JKMA 2XQFA 3G9ZA 4BB0A 4WY8A 1FFCA 1UK7A 1L7AA 1LPAB 3DKKA 5H3HA 3L1IA 5AKIA 1WB5A 3FAKA 2PU5A 5K3FA 5AM3A 5CT9A 4G4JA 5LYYA 1GPLA 3OC0A 1IUPA 2RHWA 2JGEA 1NU6A 1LZKA 4AMYA 4BATA 3FWHA 1XROA 2ZYIA 2XMCA 4RGYA 2O2HA 4GW3A 3W04A 4LHEA 2X76A 1XZFA 3G9XA 4KYVA 2FUKA 3DCNA 3BDIA 4OB7A 4FNGA 4M0FA 5ALIA 3B3QA 2WILA 2XMBA 1GQSA 1UK9A 1Z68A 1LPSA 2XB6A 5HFAA 5JAPA 4B82A 1TCAA 1QZ3A 3IURA 3AIKA 2YH2A 1G5FA 1QO9A 4J0CA 4PNZA 2XMGA 5AI6A 5DYYA 5ALLA 3JYHA 3AIOA 4W1RA 4ITVA 5AKEA 4Y2SA 5AIAA 3IBTA 3AIMA 3N0TA 3O4JA 2I3DA 4IO0A 3UMJA 4EY4A 2JGJA 1R9MA 1LPPA 2RONA 5ALJA 3V9AA 4J0HA 4X7BA 4EZIA 4G9EA 4KE8A 5LZ2A 1GKLA 2D5LA 3WL6A 1QIKA 2K2QB 3WYDA 2G5PA 5AK3A 5BV7A 1VA5A 5CRIA 3MVEA 1FFEA 4F5ZA 4BVKA 2PSEA 1BCSA 3KOOA 3H19A 4Q05A 2E3JA 3PDCA 5LKAA 1AZWA 3PI6A 4M0MA 2HDWA 4KE9A 1ORWA 2ZYRA 1J2EA 4Y2PA 4H7DA 4AO7A 1ODCA 1CUIA 4MJ3A 3QH4A 3VXKA 5JAHA 3R3ZA 2OGSA 5K3CA 1QOZA 3OM8A 4AX4A 2QR5A 4ZV7A 5SYNA 4N8DA 4ETWA 2Z8XA 5LP1A 1AUOA 2YYSA 5ALZA 1GT6A 3G8YA 4MYSA 3R3YA 2C7BA 3M3DA 2C4HA 5FKJA 1GXSA 4B9AA 1U2EA 4TPKA 1JMKC 1GKKA 3GZJA 4UHDA 5BWBA 1LNSA 3H2HA 3BL8A 2WKWA 4CFSA 1GPKA 1QONA 3A2MA 3GA7A 1Q0RA 1KU0A 5AI9A 4PF1A 4IQ4A 3A70A 3X3HA 3FLEA 1CPYA 2XUGA 4FDMA 3CN9A 2HL6A 3SC2A 3AUKA 2HA3A 4Q3OA 1W4LA 3ANTA 4MEBA 2IIVA 3BF7A 4L9AA 2OCIA 3VDXA 2V97A 4FBLA 3DEAA 1K4YA 3O4HA 1J1IA 2CMFA 2VT7A 4K5QA 3A2LA 1YAJA 2GBFA 3D5EA 5C81A 1CUZA 1A8SA 3D2CA 3D7RA 4U2EA 4NVRA 1P0PA 3SX4A 1XLWA 4EUSA 1LPOA 1Q0ZA 1TRHA 1MPXA 1BEZA 3H2JA 4CG1A 2PKYX 2VATA 5E4YA 1ZI8A 3P2MA 1GQRA 3I2IA 3K2IA 3C6YA 5AP9A 5AKXA 4J3JA 4BCBA 2BUCA 2OQVA 5HKBA 4N8EA 4O08A 1IZ8A 2PUJA 5EIEA 3OG9A 4I19A 2AJDA 1R4ZA 4BTVA 2J3QA 1ZI6A 1ZIYA 2CEKA 2XUJA 4A23A 5T4EA 4GEGA 1QIFA 5AKKA 4B83A 1H2XA 4KRYA 2PPLA 3BIXA 4OB8A 2X5XA 1SOMA 3DL7A 2BFNA 4U2CA 5AKHA 1XZJA 2NW6A 1WCYA 5T4FA 1WPXA 4B81A 4HXFB 3QMMA 3H04A 1MU0A 4B0PA 5EIHA 2OCGA 2ZJ6A 1MO2A 3DYIA 5A62A 3WKEA 4AQDA 3IIIA 2JF0A 1YS2X 1X2BA 4QLAA 1AX9A 3WYNA 3I6ZA 2H7YA 4QZVA 4DNFA 1UXOA 2WUGA 5K3AA 5LZ4A 4UBJA 5D6OA 4K6GA 1Y7HA 4ARBA 3AZQA 1RP1A 1CUSA 1QIEA 4LIPD 5KWIA 1TCCA 2BCEA 3WWPA 3PFCA 2HRRA 1A8QA 3FOBA 5A7GA 3BF8A 2WUDA 3R3VA 3WK9A 3I6YA 1WHTA 1EXWA 2JGKA 3WK7A 4W63A 1EK2A 2XUIA 1D07A 2XDWA 3ZLVA 4UBKA 5AOCA 1O6GA 1U65A 4WJLA 1OILA 4LKOA 3MUNA 5K3FB 4C4XA 4XX1A 4X94A 2VAXA 1EH5A 4J0IA 4X95A 4DNPA 3JWEA 4BP8A 1G4HA 2BJHA 3AZPA 2HFKA 5C8XA 3H2GA 2WUEA 3BE8A 3HACA 4QDTA 4NZZA 1ZJ5A 2GBCA 5I7UA 2WQZA 3F8SA 4G8BA 3BJRA 1CLEA 3DOHA 1UFOA 1Y7IA 3R0VA 1RYYA 5I8PA 1XZBA 2C0PA 3E4DA 5ALMA 2Z8ZA 2OLEA 1XQVA 1LBSA 4QWWA 2QM0A 3TJMA 3WJ2A 1FJ2A 4ZI5A 4XVCA 1E8DA 1VXOA 3FVTA 5D3ZA 2Z5GA 1P0MA 2OXEA 2JBWA 1PV1A 2J3DA 1UOOA 4J7AA 3FSGD 5A71A 4C01A 4XWGA 1W1IA 5CH3A 4FFWA 2DHCA 2ZJ7A 4KE6A 3TRDA 1PFQA 5DNUA 4WDQA 3UUEA 1UZAA 1DT3A 5LKRA 5AI5A 2ZSIA 3M83A 2JGIA 2WTNA 1J06A 1ISPA 5DTIA 1JJBA 3VJLA 5KREA 1N8SA 1W76A 2PUHA 4OD0A 1WM1A 2BKLA 1DWOA 1MJ5A 5JASA 3F98A 1XRQA 2VQ6A 3STVA 3F9CA 5J3JA 1IZ7A 4EY6A 2PM8A 1XZHA 1JU4A 5ALKA 1KU6A 4B84A 1GGVA 1CUWA 3I2FA 1CQWA 2ACKA 1C4XA 2WIDA 5AOAA 4B9EA 3O9MA 3WK8A 4IH4A 3H18A 1U4NA 2FJ0A 5K3DA 4BVJA 4RPCA 4GWLA 2WIFA 1IUOA 3I28A 2QT9A 3DNMA 5HKAA 3I2GA 4PSCA 1QLWA 4CIAA 4MYDA 3WIOA 3QITA 4X3CA 1MNAA 3V1MA 5JD5A 5C8VA 4Y2QA 5BOVA 5IKXA 3D59A 4H77A 1L7RA 4MQMA 4IH9A 5AKLA 2D0DA 3G0BA 3L1JA 4HXGA 2UZ0A 4MEAA 1HL7A 2WHRA 1T2NA 4Y2JA 1XZDA 5A7FA 4NMWA 4QDZA 4A5SA 4GDMA 2VJAA 4X93A 2XMDA 4JYPA 4L72A 5K3BA 5ESRA 2AXEA 2EEPA 3H0CA 1A8UA 3O0DA 5D7BA 2XLBA 4JYMA 5AI8A 3C6BA 4PQEA 4V2IA 1TKRA 5A2GA 5DNWA 2XT0A 3M82A 4BAUA 2ZVDA 2XQIA 1XZIA 4HZGA 4BE4A 4RNCA 4UBIA 2O7RA 1UKCA 4Q82A 1MNQA 2Z3ZA 1Q84A 3FLAA 3E0XA 1W6RA 1W52X 1FFDA 5CXUA 4J0JA 1MAAA 1CV2A 2JGFA 5A6VA 3FNBA 2OQIA 1HDEA 2DQZA 1TAHA 2DSNA 3WA7A 2WFZA 4KAJA 2OPHA 4Y9SA 1NX9A 3E1GA 3BIWA 1DTEA 1R3DA 1UT6A 1E3QA 2DQYA 4H7KA 3G0GA 4FMPA 3WL7A 3FYUA 1HBJA 2YASA 4HRXA 1BRTA 3PUIA 4X6YA 2EDCA 2WFLB 3HC7A 4HRYA 5CTAA 2QRUA 1F0PA 2IX9A 5CT8A 3H2IA 2PU7A 1IMJA 1YR2A 5JARA 3ANSA 5DYTA 4EHBA 3WK6A 4GECA 3HEAA 1QO7A 5AO9A 1XRLA 2HA0A 3STYA 3QPAA 5FLKA 4CCWA 5JZ9A 1G42A 2J4FA 3WWEA 5ALQA 1F8UA 2VJBA 1EX9A 1AURA 3SWWA 4MXDA 4ZXFA 4BDSA 4U2DA 4Y2XA 2QJRA 4Q1VA 1UK6A 4BAZA 1E89A 1A88A 1VOTA 3DD5A 2HU8A 5HF5A 1BU8A 4CG2A 2GYVA 2HIHA 3FLBA 2H1IA 1YA4A 2G63A 3GFFA 2GZSA 1XZEA 1BN7A 2VJCA 4DSZA 3RK4A 2W6CX 3VISA 2DHEA 5EIAA 5HF6A 5CH8A 3ZPXA 3VJKA 1F0NA 2XE4A 3QPDA 1QGED 1YCDA 3HXKA 4UPDA 4AO8A 2ECFA 3T52A 1K8QA 4K6KA 2C5FA 4CI9A 2WG1A 5CXXA 4DMFA 1BN6A 5CT5A 4GLBA 2Y1KA 1HQDA 3KWJA 3UUFA 1BCRA 5DNVA 2ROQA 1JJFA 2ZJFA 2VJDA 2QVBA 2JEZA 5HF9A 1SCKA 4X97A 4W1QA 1P0IA 1VZ3A 1MT3A 4B85A 4A16A 3RARA 4G4GA 2WHPA 4UHEA 5HK9A 4OUKX 4H0CA 2CB9A 4X6UA 5JAUA 5ALVA 3C45A 4Y2VA 1LLFA 5LZ7A 2ZYSA 2WTMA 2HA7A 3HYSA 1Y37A 5IVHA 2CZQA 1CUYA 3IUJA 4IH1A 1UWCA 5AKZA 3WK4A 2VA9A 1FSSA 4HVTA 4B6GA 1C7IA 2HA6A 3G0IA 4Q3LA 2XMQA 1E5TA 1QTRA 4UBLA 1DINA 1B6GA 4UHBA 4ZWNA 2BUBA 5HQ3A 2JIDA 3ESAA 2PBLA 4OSEA 5AK6A 2VAVA 3G02A 4QNNA 2X8BA 3GBSA 2AJ8A 5ALDA 3IB3A 4L0CA 4AN1A 3EIOA 2Y6UA 2H7XA 1W75A 2AJCA 4H7EA 2HA5A 3ILSA 5JANA 3F96A 3WWCA 1XZAA 1XRRA 4Y2RA 5AI4A 2PSHA 2I03A 2VF2A 3Q0TA 4HAIA 4X71A 5CURA 2VEOA 3WL8A 1DX6A 2WG2A 2WIJA 5AI0A 2ES4A 5AM5A 4OYLA 1CUXA 5C7YA 4OYYA 4CCYA 3IA2A 1EA5A 5E2IA 5SYMA 3TGLA 1ZI9A 3B12A 3FCYA 2O2IA 4UFNA 2YXPX 1ZIXA 2C0QA 2P8SA 1JT2A 1EVEA 3NWOA 1TIBA 4B0OA 1E8MA 1TQHA 2OAEA 1AC5A 3DLTA 3LS2A 4G9GA 2XQKA 3AZOA 3E3AA 2ACEA 3WKBA 4J03A 1ZD3A 4F0JA 3K9BA 1ACJA 1DWQA 5AICA 2ORYA 1YASA 2QOEA 3OPMA 1E8NA 3U0VA 3DL4A 1JFRA 3S2ZA 3ESDA 5DLPA 4GBGA 2QUBA 1TCBA 3WKAA 1QIDA 3HLKA 3LLCA 4ROTA 3OOSA 1OCEA 4BRZA 3EQ7A 3QVMA 1L7QA 4GXNA 2JEYA 2QUAA 3DS8A 3BWXA 5AKYA 3WKDA 1TK3A 4I4CA 5ALEA 3ED1A 3V1LA 4C89A 3U1TA 1XZGA 4DLNA 2QS9A 1YS1X 1THTA 5HK8A 4BC0A 5AM1A 4LXIA 2V9ZA 3KDAA 5ALYA 2WJ4A 2Z3WA 1CEXA 3OTQA 4L3WA 5YASA 4UBOA 4FOLA 4W9RA 3WJ1A 5FUMA 3WLAA 4IHAA 3I1YA 2WJ6A 3CN7A 4FBMA 4QDUA 5JALA 3CXUA 1WB6A 3ICVA 1CUUA 1XLVA 4BZWA 1AMNA 2DCMA 2RHTA 3RM3A 1LPNA 5EHZA 1PJAA 1ZGBA 1EB8A 1JU3A 4U2FA 1R9NA 3A6ZA 4AMZA 1CUVA 4G8CA 3ZLUA 1CUGA 5IH7A 2G5TA 1YA8A 2OGTA 1DX4A 3FYUB 1VKHA 2OAGA 1P0QA 1CFJA 1FFAA 2PL5A 4MWTA 4AO6A 3AFIA 4LYDA 4X00A 2PVSA 4QWMA 2B20A 4AXBA 5C8ZA 3FVRA 4KR0A 1T4MA 2QXUA 4P9NA 5AOBA 3TEJA 1AQLA 2G4LA 2IITA 2VTVA 4F60A 2XI4A 4N8SA 4JEIA 2XMSA 3DDUA 3C8DA 4AN0A 1EDBA 3C5VA 4G8DA 2WIGA 2RIPA 4GHWA 4P92A 4OU5A 3IUQA 4DTCA 4U2GA 1IVYA 1UKAA 4DMCA 4OB6A 5HZGA 3KD2A 4Y2UA 1MN6A 1XRMA 1VZ2A 2HM7A 3BDVA 4AZ0A 3C6ZA 4WY5A 1SC9A 4KJXA 3W05A 4PSDA 2QTBA 3DOIA 5FXMA 2HRQA 4JH0A 4YASA 3WWDA 3IDAA 1QFMA 1BE0A 1ZJ4A 4QDXA 3F67A 1YSCA 1XQXA 4DNOA 1SCIA 5FV4A 3O4GA 1BS9A 2QKYA 4AZ3A 3VVLA 3FSGA 3HJUA 3IUNA 4LYEA 4JNCA 2GYWA 4E11A 1X70A 4BC1A 1UOQA 1EVQA 3ESBA 5EFZA 4RE5A 3C6XA 1OXMA 1QFSA 1CVLA 4KE7A 5BWCA 1CUHA 1QE3A 3LIIA 4BYMA 1N5MA 1N5RA 7YASA 5EHQA 3FCXA 2BGNA 5AK5A 1H2WA 3WKCA 1XKTA 5DTJA 1CUDA 2XUAA 5KBYA 4TVKA 3EQ8A 1VA4A 4E14A 1DU4A 1ZOIA 5CT6A 3I2KA 2J4CA 3V1KA 3ESCA 1M33A 3ZV7A 4CG3A 4YX9A 5AH0A 4X92A 2XUQA 3LCRA 4DYHA 2WHPB 3GROA 3ZLTA 3EQ9A 3QMWA 1EHYA 1ACLA 1MX5A 3NOXA 2R8BA 1CRLA 2ZYHA 2GYUA 5JZSA 4QLOA 4YPVA 4KRXA 3EBLA 2OGZA 1CUCA 2DFPA 1WHSA 3O4IA 5AM4A 1UKBA 2BAGA 5CT4A 1QTIA 3DJYA 4BCDA 1O6FA 1CUJA 5DWDA 4BAGA 4UUQA 4MQLA 2C58A 5JZBA 1DQZA 4UFOA 5HQ3B 4HXEB 4KAFA 1R1DA 4FTWA 1K5PA 4WDRA 1RWQA 1THGA 5ALGA 2ZSHA 4J0GA 2XUFA 2XUHA 3WA6A 4BTLA 5ALPA 1B41A 3C70A 1Q83A 4WCVA 1XKLA 1EB9A 3ICWA 5E4JA 5FPPA 5LZ8A 1ZGCA 4BCCA 2B4KA 4HS9A 1ZD2P 2O2GA 4X90A 2V96A 4C88A 4N5HX 2WU3A 4I3FA 5JADA 4CCYB 3K6KA 1NU8A 2GZRA 2HU5A 3F97A 4X6XA 5CMLA 1C7JA 3CCBA 3PFBA 2QJWA 4DM7A 1SFRA 1MTZA 1XLUA 1A7UA 4FWBA 5AM2A 3WMRA 3D0KA 3I1IA 5ALNA 4XIIA 1VE7A 1CR6A 2B9VA 2HADA 4KACA 2VT6A 3VVMA 1ODTC 4UFPA 3V48A 1R88A 5FPQA 4BBZA 5LIPA 2CBGA 3G0CA 3Q8WA 1FFBA 1XZMA 1XZLA 1LBTA 4BE9A 1VXRA 3QPCA 1H2YA 4XJVA 4W1SA 3T4UA 1BEEA 2I3ZA 4W1PA 4Y2YA 4AB1A 2HA2A 2Q0XA 3AILA 4J0DA 3PUHA 1DWPA 3MUOA 2WG0A 1CUFA 4FLEA 3EF3A 2PX6A 5IVIA 3FYTA 3NUZA 1VE6A 1F6WA 1XFDA 4BZZA 3FBWA 4JUIA 4LXHA 2RI6A 4FHZA 4HTAA 4E15A 3DQZA 1QIIA 4DMKA 2XQJA 4PW0A 4ZREA 1VJ5A 2XUOA 5KWJA 4DSAA 1HPLA 3G9UA 4BRSA 2BGRA 2CUTA 4UBMA 4H7HA 2DHDA 5AJHA 4INZA 3JW8A 3NGMA 2HA4A 5JAOA 3I2JA 4MWSA 1XZCA 4BVLA 4PV7A 5LZ9A 2PSJA 2JGMA 2AJLI 5IVDA 2Y2VA 1XRPA 2C5GA 1ZD5A 1IUNA 1LGYA 2DR0A 4EY5A 5ALXA 1HLGA 2Y2UA 4C4ZA 3HSSA 4FFVA 2H9YA 3B5EA 2WFMA 3C5WP 3QYJA 3FYUC 4BP9A 3H17A 1ODSA 4Z49A 3STUA 3PICA 5JYCA 4YK7A 3WWOA 4P93A 1EDDA 3WZLA 1CQZA 4KAAA 1H2ZA 3WQHA 2WHQA 2XUDA 4D9JA 3OURA 2V98A 5K5EA 4FKBA 3STTA 3R3WA 4E46A 1ETHA 3C87A 3RKSA 5IVKA 3H1BA 4PO3X 1SCQA 4OU4A 1G66A 1YAHA 3QM1A 4QE3A 5ALSA 1JI3A 1WPRA 4CIBA 1LZLA 2QXTA 5FP0A 3C8HA 4GI1A 4B80A 3STXA 3KSRA 3HZOA 6YASA 3YASA 3PF8A 2VSQA 1ZICA 2I78A 2XLCA 2QMQA 5EI5A 2XMRA 2XMZA 2FJPA 1MX9A 1XZKA 4Q34A 2O7VA 5T4BA 3ZI7A 4EA6A 5JATA 2WFLA 3VJMA 3STWA 1LPBB 3GELA 3AINA 4C6HA 5HFNA 5DYWA 5D3KA 1HKHA 1AGYA 4ZRDA 4EY8A 5AIBA 3W9UA 2EDAA 1QIHA 5CW2A 2AJBA 4P08A 1XRNA 5ALFA 3L1HA 3WL5A 4WFJA 3D2BA 1JJIA 4UHFA 4ZGBA 1EK1A 1GPNA 1USWA 5ALWA 5FDFA 1ZD4A 3D2AA 1LPMA 1EDEA 4S0XA 2HU7A 2GBIA 1U8EA 4K2AA 5EHXA 1XQYA 4H18A 4WFIA 4NS4A 2WLSA 5FOQA 3A2NA 4DNQA 3R41A 4H35A 2FX5A 3D3NA 1H23A 3HI4A 1MX1A 2PSDA 1X2EA 4H7FA 5HCUA 1BROA 4DGQA 4F21A 5E4TA 4U2BA 2GBGA 3O9VA 4UHCA 2BUAA 3I2HA 3ZWQA 1EINA 4DIUA 5K3EA 3R40A 5AK4A 2WU4A 4EBBA 5EGNA 3G9TA 4ZV9A 4X85A 1E66A 2JGLA 4H7JA 4Q3KA 5F4ZA 4ARAA 4OCZA 5DJ5A 3C43A 1S8OA 4C4YA 1QJ4A 3HABA 3G0DA 2W22A 4J0KA 3R3UA 3DYVA 3D4LA 1N1MA 4Y7DA 1DQYA 3GUUA 1XQWA 2HHAA 4B7ZA 1WOMA 1CIJA 2LIPA 3LP5A 3KWFA 4KEAA 4WFKA 5AKGA 4TGLA 1MAHA 1KEZA 1QIJA 5ALRA 3QBJA 4QDOA 4EY7A 4PSUA 1UK8A 1UOPA 1H22A 3R3XA 3BJMA 4QEKA 3HRHA 4UBNA 3H2KA 3G7NA 4QA9A 3IVMA 5AHXA 5ALHA 3WI7A 1AKNA 2WJ3A 4G4IA 1R50A 1K63A 3KXPA 1CUBA 4K6HA 5AM0A 3WIBA 5JIBA 3RLIA 4FLMA 4BDTA 1K6EA 1JMYA 4OPMA 4G5XA 5EHNA 3WZMA 2OG1A 3PE6A 5A7HA 2HFJA 3AJAA 5T4HA 1YB7A 1EI9A 1GZ7A 2XQGA 5ALUA 5JD4A 4N5IX 5ALOA 3I6MA 2RAUA 3IUMA 5AKJA 4C87A 4RE6A 4H7IA 3W06A 1CUEA 3W2TA 2XUPA 2WUFA 2H7CA 5ISMA 3IULA 2R11A
chains in the Genus database with same CATH superfamily
1H65A 3CLKA 3QW2A 3ZVMA 3SR4A 4YBRA 2ONZA 1ONNA 2QEQA 3JY6A 2XR1A 2JH9A 4TN5A 4UNPA 4D41A 4GR9A 4AZVA 1WB4A 1DV1A 1Z3IX 2XRFA 3Q85A 2AOTA 4YMGA 3VKFA 2GCNA 3DE6X 4FQ8A 4TMTA 1U98A 1IMOA 1I30A 1Q0SA 1VPLA 1TGVA 4GP7A 1FJHA 1DKMA 4ARCA 1OXTA 5ERYA 1I3CA 5BW4A 4FFBA 1R6VA 1WW2A 4P7JA 2FQ1A 1OB5A 3AJEA 2EWVA 3AX6A 1TGYA 1RYEA 3FF4A 3GV0A 1M1UA 1YHYA 1BYUA 1M54A 2C3PA 2V7UA 4G0XA 4LBYA 1X1DA 4XB6B 2R65A 4Y2GA 5GJWC 3QE9Y 4ZT3A 4M9UA 5CB6A 2OCLA 1ZJYA 3G5LA 1W36B 3COPA 2L17A 2FZLA 4FI3C 1KWGA 3OIUA 2FPLA 4F2GA 3ZDQA 2O2CA 4ALNA 3LUFA 3CCCA 3E9MA 4HNAA 3DOEA 4TRNA 4I9FA 2FOIA 1M5TA 2O4UX 3KLPX 3JAKA 4XSVA 4YALA 1SG0A 3DAYA 4QPJC 3I05A 2QTRA 4XEUA 4EOGA 4XUCA 4R71A 1E9RA 2CNLA 4YH1A 1EA7A 1I4DD 1QQ7A 1C0EA 3PQ3A 2X8WA 4I99A 4WL0A 3KQQA 4DA0A 3FR8A 5M04A 2G3YA 4YFYA 1NYRA 2PSFA 4R2LA 3NKFA 1NLUA 4BMVA 5AUQA 4CVNA 4DMHA 2VQEB 2CNWA 2R6FA 4OOFA 2O6HA 5C18A 4WLEA 3WLIA 1ZGJA 5ALTA 3OUUA 2WYUA 4QOSA 4UREA 3K0SA 4FCWA 3L84A 1ZOOA 3O3NB 3ZQ4A 4A0GA 4I3GA 2CYBA 3DMRA 2H1HA 2ZDHA 1YE8A 4IVNA 2IXDA 2XUKA 1V26A 3IQHX 1PW5A 4IZOA 4H1HA 4BJ3A 5AVUA 3U31A 5KVAA 1PI3A 4HAUA 3V1NA 3PNKA 2R7AA 1CY1A 5CGQB 4JI7B 3UVEA 2ST1A 3H1AA 1P1KA 2RHOA 1O9BA 1DT5A 2XYGA 2ZBUA 4HWRA 1OYOA 3NFRA 3TLCA 2RHLA 4E4TA 5A5EA 1D2GA 2CN1A 1SKQA 1IIBA 2EC5A 4FLFA 3PF9A 4MJ7A 4TV8A 4CR6A 5CB8A 1I14A 4F4UA 4WY8A 2W2TA 2ZU6A 1UK7A 4IJUA 2LTAA 4TWAA 4MQBA 2W90A 1NGSA 5CLIA 3EDQA 1ZM3A 4PO8A 2NUTA 3DTVB 2D2VA 4ZTBA 4N7RA 2QMHA 1N9KA 1LDMA 2PU5A 1B26A 1W73A 2P69A 3FAKA 2EFGA 2GD0A 4FZ5A 4G4JA 5HE8A 4ANFA 4LJ8A 4GNKA 5LYYA 3MJEA 4NEHB 3SJCA 1GPLA 1OV6A 4HAVA 1GZ5A 2RHWA 4TT3A 3WVNA 3REFA 3I58A 1CZUA 1NU6A 3SKXA 4E22A 3I39X 2NZ2A 2QSZA 1FTNA 1BW9A 3V2IA 2DFLA 1PJTA 4YRQA 3VAZA 4R6XA 2G4CA 3EOZA 4LHEA 4EJ2A 3UH1A 3G9XA 2CFTA 1JJAA 1PQ4A 5DH9A 3CT6A 2BZ1A 2H2FA 3TTSA 2XMPA 4FIZA 2FSVA 2GOYA 3H6GA 4PFKA 1Z0ZA 2C99A 4AF8A 2B99A 1P31A 5KI6A 2JIRA 5IULC 2N0SA 5EN4A 1KI1A 4YT4A 1C9KA 4CMGA 1BDIA 4W82A 4HDSA 1IPEA 1Z68A 5JNRA 3BWMA 3MMNA 2FXIA 3ZNQA 2G71A 4OY3A 1GQOA 3LF2A 5JAPA 4B82A 3LY8A 4Y1GA 2QYSA 3QU4A 3V2UA 2YHUA 5HUJA 4PS1A 1A69A 3FTNA 4NARA 4KSBA 5H7XA 3A32A 1LLQA 2B94A 2ORVA 1U7OA 2VNKA 2PXHA 3FI9A 2XMGA 4PNHA 2J32A 1TT5B 3BQNB 3WLPA 3F8TA 3VV3A 1RFGE 3FLMA 4OQXA 4C21A 4XFKA 1ZNZA 4CFZA 5LYJF 2F8MA 3KYDB 1H4TA 1CYDA 2A9QA 2ZAGA 3KQUA 4J1TA 5KOJA 1OBHA 2XTZA 2XEXA 1GL3A 3JYHA 3OHMA 2BH2A 3SEAA 3JD3A 5F4BA 2AE2A 3PUJA 5DX1A 4XR4A 3WAKA 4Z2AA 5AKEA 2X0RA 4Y2SA 3V2HA 5LFAA 5DN6D 2YDXA 3PDHA 1AKYA 1TLTA 2HI0A 1J2JA 2RGAA 2UVPA 2W2LD 3GEIA 1H0SA 1VMEA 1YL7A 2P8JA 3OCZA 2I3DA 2VWHA 4IJ6A 4R83A 4PN3A 3C3CA 3DZCA 5EWMA 5GMOA 4L9SA 3EXEB 3FTQA 3N7AA 2DFDA 3LBNA 5LP6A 4RKRA 3UC5A 4EY4A 4HEHA 2XYPA 1KVRA 4L8GA 4XX0A 2OHGA 1G20B 3DUWA 4X7BA 3M3PA 3L7LA 1T34A 4KE8A 3T3OA 1VJCA 4EG7A 1IONA 2DPLA 2PFKA 1QIKA 3OIGA 7REQA 4Y98A 2VG8A 2IIPA 5ENVA 3OCVA 5AK3A 4BNJA 1WABA 1ADYA 2G80A 1MC8A 3NWJA 3EBOA 1WY5A 4RX1A 2PL3A 1JEOA 1ZZGA 1VA5A 4XEHA 3KZXA 1SVIA 4F5ZA 2PMEA 4NBUA 3ND6A 2OK7A 3CR3C 5TPWA 3ZU5A 4CTNA 1M7GA 4LHXA 2D7CA 4BVKA 4Q3AA 3H2BA 3KOOA 5L4LA 3CEPB 1OV4A 2GSWA 2HLDD 3IKMB 5CB4F 3HL0A 2AX4A 3FMIA 3GNSA 2BHTA 3IT1A 3L7NA 3KJHA 4GVXA 2ZVQX 4OKNA 3SOZA 3TLZA 1HORA 1NQWA 1UEXC 2F1IA 1OXSC 1UFVA 2Q5HA 3BXXA 3FZQA 3GQVA 3H8JA 5GJCA 4ENRA 3CH4B 4LRYA 5C2JB 5LKAA 2ZBQA 1EFCA 1EVLA 1HNNA 3B89A 3U1VA 4EJSA 1K86A 1MQ9A 5ALQA 2YKGA 2NU8A 4U9IS 3TI9A 3PFIA 2FSHA 4KE9A 1BS2A 1I4OA 3P2JA 4UUMA 1BVYF 1ORWA 2ZJZA 4JA2A 2C98A 2WIAA 1NUPA 1QXSA 4KQ6A 4XGNA 4O33A 1ODCA 1CUIA 3OF5A 4PRKA 3GUYA 3OE5A 4ZC1A 3VXKA 2Z2YA 4PONA 3TAUA 2OB2A 3RLFA 2ZTMA 3MN1A 1W2HA 1E1MA 1U7DA 4LPKA 3ESQA 5ERXA 4WUTA 3GH3A 4FNOA 4NJEB 1E2BA 1ZLXA 2YJ6A 3R3ZA 3AP1A 4JK3A 4BMOB 1ZN8A 1U7ZA 3FVQA 4N9QA 5K3CA 1AH2A 5DGXA 1VL1A 5IDWA 1E6CA 3OM8A 2BIFA 3P9YA 3AY3A 4JSRA 3QWHA 3B36A 2PMKA 4EYSA 2MT9A 5LP1A 2DJ5A 1AUOA 3AR6A 5JISA 1WXHA 2VYNA 4PYRA 5ALZA 5KYWB 4DVJA 3S7ZA 1KWKA 3AVWA 2C7BA 4F6RA 4C06A 2X4GA 4D9EA 1WNTA 4QT0A 5AUPB 4ZQFA 4PIPA 3K70C 4Y2HA 3FNEA 1GXSA 3FW1A 2X9VA 4B9AA 4TPKA 1FNBA 1X1AA 1Z7WA 2Q41A 1GKKA 1JQ3A 1KBOA 1NN5A 3KVRA 4CT4B 3UK7A 3GZJA 5G4KB 2PUCA 1YI1A 4AJ1A 1T4GA 2QN2A 3PHHA 2EBHX 1GP2A 3KCQA 4OXYA 2MYTA 2W2KB 5I9SA 1T8TA 4UW9A 2HO5A 4YP0A 3OMWA 1AZLA 4LNUB 1QGAA 2D5BA 3K96A 1U5AA 1BSVA 3A4LA 3TNFA 3URKA 2CLMB 2FPPB 3BL8A 4S0ZA 3VZPA 4DR7B 3PXEA 1E2IA 1XEWX 2WAAA 3A6JA 4TQAA 3ZBPA 1W47A 1PFVA 3IE1A 1SQSA 4EVRA 3GA7A 1XWIA 3MGCA 1Q0RA 1OAAA 1UPXA 4XUEA 3T6KA 4E21A 2J5RA 4ND8A 1ZBQA 4JQCA 4PF1A 5EKXA 1UPFA 3HEBA 5E7MA 1DIAA 4Z7NB 3FLEA 2P90A 3P9PA 4E08A 1I2ZA 2Q6VA 3OPXA 3MIIA 1W0JD 2XUGA 3UAWA 3D3QA 4YAJA 1IWOA 1M1NA 4FDMA 1NQVA 3Q1LA 4C0JA 3CFYA 5B2FA 1G7TA 5L7WA 1SCBA 4XM0A 3AVQA 1E9AA 1NATA 3K9LA 1N2GA 2IE8A 1B93A 1ZNQO 5BVHB 1YXMA 2OC9A 3DCJA 4Q3OA 1IIRA 5INTA 1W4LA 3G89A 3NEJA 2XV1A 4DDVA 1G2QA 1KK2A 5BN1A 3OIWA 2O14A 3OX1A 4OAPA 4FBLA 2PMWB 1VHQA 3FYHA 4QU9A 2AG1A 1ETUA 1JHVA 2YYZA 1RXEA 3T9CA 1B74A 5B4UA 4MWZA 1IFXA 5ICFA 3O4HA 3ZDEA 1QAMA 2Q6LA 3D3WA 1DB3A 4R1OA 3RYTC 2W42A 4C3ZA 1QYCA 1W4BA 3NWBA 2BEJA 2V6IA 4ASUA 1EJBA 1V2HE 2P91A 3FHOA 3OWOA 4QREA 2DULA 3BICA 3OESA 1AQUA 1OFVA 3PWKA 1ZQ1A 3AC0A 4MJLA 3U16A 1LX6A 3K92A 1Z35A 2ZIZA 3L82B 3BWYA 4I8DA 2HBZA 3AB3A 4MR9A 4NX2A 3OJEA 4Q48A 3LBFA 1BKYA 4RL6A 3RBVA 3SICE 4EPYA 5A06A 1R0XA 4AL4A 1VPEA 1A8SA 1UM9A 4H0NA 3RU7A 2BI4A 2V6JA 1ZMTA 1A4UA 4BWVA 1NBHA 3SX4A 3PL1A 1XTKA 2ZYVX 1J20A 4MKFA 5I9MA 1JEYA 1BEZA 5K3SA 2WAXA 3N2KB 3AVPA 1GJRA 3NORA 2FRDA 3TVYA 1QU3A 1BOFA 2Q1UA 2VATA 3E18A 4HYQA 4D56A 1E9EA 5A3RA 5LJIA 2PQMA 2QD4A 4B2YA 1DC8A 2B0JA 3T1TA 4HMOA 5E4YA 5I4IA 2PSSA 2ZT7A 1OA0A 1QVRA 1FDWA 4OHOA 3M0EA 4QEDA 1X1QA 2CEAA 1BGVA 4WZBB 2GEJA 4Z9AA 2BFEA 3E9QA 5DXAA 1A98A 2MIIA 3GDHA 4URZR 3PXUA 4KXMA 1W5FA 5EESA 5AKXA 3QXJA 4J3JA 3RSFA 4DE5A 3LT4A 4E5NA 1F1BA 2QYOA 1KH2A 2LIVA 4LZLA 2D5AA 3TX2A 5FOUA 4BO4A 4GFDA 3LCVB 1ACMA 2ZUBA 2DWOA 2BJVA 1ZRSA 1G63A 3HCPA 1GYPA 1PNQA 2WVAA 1QK4A 3WADA 4KKXB 5ICGA 1OI4A 1B7GO 2AQIA 2J3QA 4ZANA 2NO1A 4YQZA 3U5TA 1GILA 2J5QA 4IPTA 4XVUA 3WGYA 2XZTA 2X23A 3JVUA 1TTTA 3A9VA 2RB4A 1AGRA 5BVGB 1JSLA 1NQ5A 1L3CA 4ZEWA 3B9RA 5AKKA 4IMJB 1QHYA 3WGLA 1KIMA 4CIWA 4EX7A 3KM0A 4KRYA 5HIAA 3DB2A 3HB5X 1H05A 1Q21A 3BIXA 1GPWB 2YXDA 3HVKA 4KBFA 2J46A 3SYMA 4BFVA 3AJ9A 1E3WA 4BMPB 1SOMA 3DL7A 4Z4CA 2BFNA 4YLGA 4EW1A 1TOAA 4KN8A 2HXSA 2WLTA 1WPXA 3HDJA 3A3OA 2J9XB 1KDOA 4TXNA 2JFFA 1II8A 1RAEA 4HXFB 5EVJA 5I45A 3W3AH 2HJRA 3QMMA 1ZNXA 1MU0A 1LQTA 4LWQA 3UB4A 1EVZA 5CFPA 1KBQA 3T06B 2ID9A 1GAEO 3U4IA 3UK1A 2CVFA 1XEFA 4LGMA 3EASA 3ZV4A 3OEWA 4HGRA 1RPNA 4FFBB 4MVJM 3V00A 3A4YA 2V7GA 5L8VA 2GEFA 3C98A 1UH5A 4HDMB 3EEYA 3BBLA 3P0IA 4FYWA 1J22A 3T99A 1IN5A 2OHJA 1R0RE 1V8OA 9ATCA 4AM8A 3UKDA 5BUCA 1NDUA 5BR4A 4OOEA 3WOVA 3OZWA 2GTHA 1MV8A 2B3DA 1Z7GA 2WVGA 1X80A 2E82A 3HEMA 3WYNA 5FO1A 4OFBA 3U7IA 5IKPA 4EG4A 4RQUA 3I01A 4QZVA 5TE9A 2IYVA 2JH3A 2AZDA 2Y0CA 4HNAB 4KXLA 1C1DB 1G5PA 2EZ4A 3KT6A 4NENA 5CPBA 3HXOA 1REQA 3JAKB 3OY7A 5LB2A 2FKNA 2WUGA 3NV7A 1YV9A 4W4TA 4DCUA 1R9JA 1SBTA 4UBJA 2ZBPA 1TYBE 2BOVA 5I4KA 5D6OA 1Q0UA 3K0HA 4Q5IA 2MMGA 1E1RA 3AGPA 3AJRA 2QM3A 4NZYA 2V4ZA 2CDRA 2ZR0A 2QPTA 2H2AA 2B1QA 2JLBA 5H80A 3ZWKA 3NVAA 4MGYR 1ONPA 5DTEA 5JQGB 1AHHA 3LC0A 3HUUA 4ZD6A 4Z2YA 3ZX4A 4LIPD 1FZQA 5FI1B 1J2YA 1F8YA 2JJQA 3LC7O 4BKQA 1YJ8A 4A36A 3LT0A 3UJ6A 2VHWA 1G0OA 2ZQ5A 2Z9DA 4EVQA 5KSWB 2YXLA 3GOHA 1XI2A 3Q8MA 3FOBA 5A7GA 2P3OA 4RH0A 1GV0A 3JD1A 3DVRX 1EXWA 2NLOA 3P26A 4TTVA 4LXUA 1ZGGA 1WCXA 1L5QA 2PY6A 3OIFA 3OAAD 1EK2A 3WK7A 3NHKA 5B6IA 5FR2A 4B8WA 3E7DA 5HIMA 3EEFA 2DBZA 1VIDA 3N8KA 3ZWWA 2XUIA 3TNLA 5CA0B 3TCXB 1HEUA 1RXUA 2XDWA 3NHZA 5H70A 3W5HA 3PPXA 4FYKA 2VZ9A 1UMDA 4LWOA 1FE8A 1KARA 5AOCA 4AJIA 3JASB 4FB5A 1Y1TA 2HNKA 2POQX 3HFJA 1UPTA 2EBWA 5CLHA 2Z2KA 4CLRA 3VKUA 1KY3A 3M6WA 3BGOS 3GFQA 4C4XA 3R8XA 1X9IA 1N0IA 3QP9A 5T7BA 3DVAA 1B8PA 1LBIA 2XODA 2J0UA 1DZ3A 4MGEA 1DC4A 2NXCA 2VAXA 4WEQA 2VPTA 1S8NA 1ZN7A 1BW9B 2C84A 5CD9A 2VPIA 3EF1A 3A8TA 4XVHA 1MOPA 3L5OA 1Q2XA 3NIFB 4EI2A 4BP8A 1G4HA 3TW0A 4EI7A 2BJHA 4OJQA 2HFKA 2ZE5A 2I4IA 4GYYA 3W6PA 2ZW9A 4WGFA 4DIKA 2ZM5A 2OV2A 1Q77A 1OH7A 4PZPA 4RXUA 4QDTA 4URXR 3ICQB 1OXVA 2GI4A 2FA9A 2XB8A 1X3SA 3WDSA 3G5AA 2QTWB 5L40A 2WQZA 4TV9F 3QU5A 4YDHB 4G8BA 3BJRA 5I7RA 2HO4A 4F04A 1F2TA 3DOHA 2XB4A 2ZUDA 5I7FA 3X1YA 4E3WA 1Y7IA 2IGBA 4PLZA 2H2GA 2JLAA 4R8RA 3T61A 3O1IC 2LCQA 2A5JA 3OQPA 1KDPA 1S2NA 3LKVA 3LTNC 4PC3A 1ATZA 5DLEA 2MHCA 4NI5A 3IPYA 1WSDA 1A9XA 2RHMA 4DBZA 3DL0A 4KUHA 1XTZA 4LF7B 2FPIB 3UEOA 2OPBA 2QNRA 2WRZA 3DBOB 4ALKA 3B1XA 1XQVA 1D6MA 4NESA 5TGZA 4E13A 2Q2NA 3KCNA 4PLYA 3TNDA 1ILWA 1ZAYA 5CDGA 4M9RA 4RD6A 4R8MA 4D3ZA 3M33A 1TUGA 3O92A 4BO5A 4PCUA 5L3RA 3B6KA 4B45A 4I9HA 5EE3A 2GEUA 5I6DA 2O3TA 1KFCB 4L07A 1VXOA 3HN6A 3FVTA 2QYTA 3UTCA 3QIAA 4BQRA 1ZKMA 5D3ZA 3RFUA 4YRBA 5JO0A 2CFIA 2XZPA 1QRDA 2I3BA 3LDFA 4G5FA 2OXTA 1ES9A 3GEHA 1V8PA 3QF4A 3MJFA 4P4LA 3T3MB 1S2MA 2VCHA 5LP6B 3EIEA 3WGUA 1F4VA 2OXEA 2A9VA 2JBWA 4HLUC 4XX0B 4DKXA 2APJA 1PV1A 1TU0A 2EJTA 4M8IA 1CW2B 3CX7A 2WA2A 2IXEA 2QQ5A 4XWGA 5C3MA 3T3PB 5JLJA 2PWBA 5GP1A 2DHCA 4BLTA 3WZ2A 7REQB 2XCIA 2DC1A 2EZTA 2OK8A 1RTTA 1THZA 4KE6A 4ZOAA 4GYJA 4IJVA 4JJKA 4YMSA 1Y6RA 3GAFA 2GPAA 3C6QA 3SJBA 1YK0A 3LLVA 3N9IA 4IP0A 5TRTA 4LOHA 2A9PA 3TSWA 4ZJZA 2X8JA 3M2PA 5AI5A 1Q0HA 1DXHA 1JHQA 4LNAA 2JGIA 2WTNA 1GNRA 1J06A 1EGQA 1ICIA 1TZBA 5TPWB 5LQUA 2H11A 2FWJA 1N2CE 5CFMA 3H1TA 2GRUA 2EJBA 5DBGA 3M5CA 2ZSBA 1Z2EA 4L02A 5DTIA 1A95A 5HOQA 1UODA 4ZEOA 1WB9A 3R20A 4D3FA 1R66A 4RDIA 4F1KA 2BCJQ 5JFOA 1IATA 1RRMA 1SUDA 3NKVA 5HGXA 2Q7DA 1W76A 4B3CA 2ZI7A 1NJ5A 3JQQA 1C3EA 3OJ0A 3ZR4B 4NH4A 2R0QC 1YJQA 2FQQA 3PQ6A 4EUNA 1Z29A 4ND2A 4EKGA 1M74A 2CWWA 2NU8B 4OFXA 3TVTA 4MRVA 5JASA 1E1KA 4RK5A 4N0EA 3ASYA 4F4IA 4JBGA 4ECAA 3GRRA 5FEUA 2IY9A 2VQ6A 4EA7A 3STVA 4BVFA 3LZDA 3QI2A 3MHPA 2LUOA 3BXHA 1X7DA 3CBGA 3WQBA 4UTPA 5LQRA 5E6RA 3E6AA 2PM8A 2A9KA 2XVMA 3A4NA 4RMJA 4UM9B 2BM0A 1DI0A 3QBDA 2GAFA 4B84A 1GEEA 2QMEA 1JQLB 2IUYA 2R00A 2GXAA 4MW0A 3E53A 3RWOA 4EMUA 4K9LA 5DBFA 4EKNB 3L05A 4JDPA 4WWHA 2UUOA 1H9BA 3V8PA 2BFFA 5EJ4A 2FMIA 3AUYA 3H87A 4MW1A 1I3MA 2ZUUA 3IOMA 1Z6XA 3ZWYA 2OSVA 4W6ZA 1SBYA 3MCAA 3MF4A 3DUFA 1CR1A 3I2YX 1NPDA 2BGWA 1NFQA 2XAAA 1EUCA 2V6GA 2IUSA 3LGAA 3EVDA 5FYDA 2EG9A 4NEQA 1PVOA 4XFDA 3WK8A 4HPJB 2AXQA 4MOWA 3CV3A 1U4NA 1SZPA 4IWYA 2FP4B 2MR5A 2Q1YA 3IE0A 3IDOA 4JOBA 4F6RB 3KX2A 2JHCA 4BN5A 2GTIA 4Y30A 3AF1A 3QUCA 2CLEB 3PENA 1TQ8A 5KOHA 1Y9JA 2BMWA 3HKCA 3LGXA 5DCUA 3DNMA 3I2GA 2O0HA 4ZI2A 1RQPA 2W6PA 1QLWA 4H3KB 1RC8A 3VNSA 3DZIA 2VSYA 3IIJA 4S12A 4TTTS 2QRKA 2J6IA 3PZRA 3R7WB 1MD9A 4UCFA 4DUYB 1FSZA 4X3CA 3TK1A 5JD5A 3ZQ6A 5T3UA 5C8VA 2C7PA 1Y5IA 1BTOA 2KQUA 2COKA 4LMPA 5BOVA 3E70C 2GN2A 3W79A 4BMDA 2RGXA 4I14A 1XE3A 3H4VA 3JRXA 4Z4HA 3DJFA 4H77A 8GPBA 5KZMB 1MAUA 3LJKA 4L0DA 3UGJA 4I50F 4ARSA 4C7JA 4EW3A 3BA6A 4B3HA 4G0VA 3PEUA 4FS3A 4MQMA 2XRZA 2IXAA 4CMJA 1I7DA 4XWYA 5G3ZA 3HADA 4FCVA 1S2OA 4JZYA 4LWPA 1L4KA 3C48A 3N2GA 3NBQA 3IKTA 3L1JA 5EXSA 2EKBA 3CLSD 3EHDA 2VDJA 2YZNA 5LB4A 3H97A 3OO1A 3QXGA 5KJFA 4MEAA 1RXIA 3RYFA 4P4GA 1PQPA 1U8UA 1U94A 5BW8A 5JJKA 1U8FO 4WBNF 2AG5A 3GZTB 1BJRE 3ZKWA 3PLRA 4Y2JA 2W6ZA 5J5AA 2GF9A 1ZMBA 1T5LA 2Q50A 1JH8A 3B8EA 4IWNA 5TVGA 3DWIA 4V1CI 3PEWA 1R37A 3K2BA 3SKVA 4NMWA 1IQPA 1Z7BA 2W83A 3BAZA 4DR2B 3TSAA 3A9WA 1H2FA 1XTSA 3R4CA 4ZDKA 5FR1A 4C2BA 1IAVA 1TJ5A 4GE3A 3A1NA 5BSGA 3KPWA 3OOEA 2VJAA 4OMUA 3UOGA 4X1IA 3LC2O 1L5NA 1LQUA 3NTOA 3RT1A 4HDOB 4ZCRA 3L6OO 2GEKA 2LD4A 3D3WB 4OA5A 4LVOA 4Q93A 2AXEA 1TJ4A 1NT2A 3HKEA 5K3BA 4R7ZA 4F4DA 4OBWA 5JC1A 5B3KA 5LNK6 3GL9A 2WWFA 1G60A 2OFOA 3BXEA 2XNDD 5FLEX 3O0DA 2YJ5A 1NI5A 1YI8A 3CKMA 4MR9B 3SIRA 4A1OA 2Y1OA 2YVAA 3CX6A 3IUEA 3C6BA 3K31A 3LY9A 4LSZA 5AI8A 4LZAA 5EJ2A 3V4ZA 5BSEA 3P5SA 5K2MA 3PFHA 4WLUA 2DTXA 5IDXA 1UM9B 4V2IA 2O8FA 1E3DA 3REGA 5JCOC 1S96A 2YXBA 3AUJB 2Z2JA 4LRUA 4F7DA 5KJ1A 4RS4A 3CM0A 1GGHA 3UJ3X 1JEYB 1L9KA 3VZSA 2A35A 1G5HA 4OTZA 5IFKA 1PYGA 1CG6A 2HR1A 3UUWA 2C04A 4FP9A 5TT1A 3I9V6 2FGKA 1VDMA 1DVRA 3OJOA 1DBPA 1KY2A 1XZNA 4AJNA 4ZOQI 2IV2X 1P0FA 1SURA 4BNXA 3VFDA 1KC1A 1H8EA 3REOA 5K8LA 2YHAA 3KTFA 4PG4A 2O5EA 3CUYA 1ZD8A 3I9MA 2JLVA 2QUZA 4UBIA 2BFEB 3RF6A 3URMA 6NULA 3P27A 4RCZA 1NF8A 1ZH0A 1E0JA 3FPGA 3WWZA 2Z3ZA 1MQ8B 4N3BA 4E1AA 3UJBA 3E0XA 4YYEA 1IPFA 2X9QA 4X8MA 2ZSUA 3RT7A 2V0CA 3AKEA 2M9MA 4PVDA 4WOJA 4CEJA 3P4YA 2PA0A 1W52X 3BAFA 3KPVA 1FFDA 3OF3A 1XEXA 1RBMA 1U3CA 2FN8A 1Q1QA 3O8DA 1Y4DE 4I6EA 5EQTA 5SZJA 1XP8A 4HN4B 1U1IA 1W36D 2GNPA 1XF9A 1X19A 1MB2A 5C4GB 3TB4A 5IABA 1PG5A 2E89A 4QU5A 4ZVRA 5FV7A 1IYZA 1LJUA 4JU8A 4NJMA 3SD7A 5LLDA 4LFBB 3UV3A 2HYIC 1GLVA 1WCV1 3F49S 2OLJA 1JTEA 2WICA 4X41A 1WP4A 4V0QA 3ZQKA 2M6RA 4B3FX 2O8DB 1NRIA 1WQ1R 4O8ZA 4CW7A 2A78A 1F0KA 1OPRA 3KLNA 3THRA 4EGQA 2IHUA 5FUQA 4ALMA 3FNFA 3IP9A 4YREA 1DKPA 5ADUS 3PC4A 1DTEA 1PWZA 1R3DA 3GEEA 3FWNA 3GZ4A 2I91A 3ZQUA 1II8B 4W5OA 2DQYA 2P40A 3LFHA 4E31A 1P2BA 3G0GA 2OM6A 4FMPA 3RUFA 1TD1A 3Q8KA 1W29A 3WL7A 2FFAA 4BNTA 4ZHQA 4WK0B 1P5HA 2CE2X 5F23A 4HRXA 5KTNA 1P9OA 3DEIA 1BRTA 4X6YA 3OLCX 1U28A 1F2DA 2WFLB 2WI8A 2YV2A 2B5OA 2R4UA 4V0LA 2CSUA 3HC7A 4X54A 4AD8A 5DT2A 3TMAA 4MP3A 1BXZA 1PX2A 1Q12A 1R6XA 2OCYC 3D6FA 3NDIA 3O74A 3Q7EA 4JVOA 3TX6A 4QOIA 4BFUA 4MVJF 5CT8A 1QTNA 1X80B 2HMYB 2ZUCA 4KO2S 1IMJA 5E7QA 2QV0A 2QPOA 4PRZA 1REQB 5DN9A 3ETGA 3PDIA 4MPJA 3TOSA 5EKDA 2D2XA 3T1VA 5CTJA 5B3LA 5BWMA 1JKIA 3VPCA 1O5IA 3HXMA 4KQIA 5DYTA 1F9AA 3S81A 4O1MA 4V0KA 3RVNA 3FN4A 1PHPA 1PJSA 3DTVD 3DC2A 5H3CA 2X1MA 3ANXA 3OT5A 5A6SA 2XIQA 3AU8A 1QO7A 3QLJA 4P86A 5HW0A 2VHEA 4JLOA 4AP5A 1ENOA 1AQIA 2PKQP 4DM4A 4PANA 4XLTA 1Q91A 3H84A 5FLKA 1V6AA 4DCOA 3H9QA 5JZ9A 4UZSA 2XCSB 1GTSA 3L6EA 2WWRA 4LPSA 1AXGA 1Z0IA 5F1PA 1EGAA 1FUYB 1N7HA 4D4GA 2H1SA 3FVVA 3G6KA 4X0EA 4OQ4A 5K03A 4PM4A 1NM5C 1WG8A 4E32A 1ZS9A 3LOQA 4PZCA 3KHKA 3W5JA 1B73A 2G40A 3EUFA 3P0JA 2ZAYA 1K9SA 3R44A 4ND7A 1D5CA 1JLRA 1NAIA 3EISA 5FWXB 4FYYA 4LV8B 4G0UA 1L5LA 3D81A 1IDN1 3BSSA 1PN3A 1VL5A 5D5PA 1QHGA 3VBEA 3ZS8A 2IUUA 2YIDA 1U0FA 2R96A 2WWGA 3I52A 3SYNA 2HSJA 3EEIA 3GDOA 2Q8NA 2ID7A 4GUAA 3R9KA 4B4DA 2YC2C 3CVUA 1UMDB 3A9TA 2WF5A 2G72A 2REQA 3DGEC 1CS0A 4TS9A 4UXJA 3OZDA 1JZQA 4D7AA 2OXFA 2Z95A 2AC7A 4HNVA 3OZUA 1A88A 4IFEA 1WCWA 4L4XA 4OHKA 4ALLA 4CLRB 1W4RA 2OO5C 5HF5A 3ZDRA 1BU8A 2CWDA 2DH5A 1ORTA 1TLLA 4OI1A 3ZN2A 4DCMA 5GADl 1T2DA 1GUAA 3OTOB 1TT7A 3DVAB 2JLRA 1UWKA 821PA 5IKMA 1PT9A 4OH1A 4Z9BA 1I9CA 4WOBA 2AMYA 2PLWA 1DADA 3NWPA 4RLFA 4JUCA 3AI7A 2B4QA 2OZPA 3FCCA 1CIPA 3QVGA 5DV9A 3RAPR 4U2KA 1WSAA 4G3XA 5E9JA 1JIXA 3AM1A 1UXKA 1E9BA 3NCHA 2FQYA 5F76A 1MAVA 4EO9A 1BN7A 4J2TA 4UAVA 5H4HA 4FZJA 1HOTA 2W6CX 2P2DA 1QYXA 1DKNA 1L5SA 2J6BA 2VJQA 1KZGB 3RK4A 3S8MA 1BDJA 3ZW9A 1A72A 4C3OB 4PNEA 3U17A 2VNHA 4MV8A 3B1YA 2TS1A 3HXKA 3P8ZA 4ZCPA 3SC6A 1M6HA 4JHLA 4NXNB 2A1IA 1Z73A 1AQYA 2C7QA 1F2TB 2WG1A 2ZULA 1TQ2A 4QO7A 2ZGVA 1B0ZA 2IHKA 1ZG3A 3BWCA 3MK31 1LSUA 3O8NA 4HWOA 5HQJA 4II7A 4EG6A 4NE2A 4JJZA 4TTPA 1GAQA 4GLBA 4TLDA 2XB9A 2CXSA 4DLYA 1PS9A 3C3EA 3KWJA 2VIIA 1UPAA 3ASZA 4D98A 4AMUA 1A9XB 1U5BA 5DNVA 2OHFA 4GXQA 1KO7A 3A26A 5MN5A 2AF4C 1JJFA 2J3KA 2D13A 2Y4NA 4YXWA 3QPBA 3RROA 3SYLA 3VR1A 2O57A 2YW9A 4DV6B 4OQLA 3GPLA 3K1YA 2WUVA 3KJZA 4ALIA 5ICCA 1GPJA 1SCKA 4X97A 3S68A 4XGRA 4W1QA 2Z6VA 3TM4A 3IHTA 1P3DA 2QPAA 4G09A 5H83A 3TTWA 2BW0A 2DOKA 3OICA 3LTEA 1GR0A 2G0TA 4GMDA 5IBRA 1K6MA 4BMNA 1MT3A 4B85A 3AM5A 3KV1A 4B48A 1N1GA 2ZIGA 2CY0A 3FM9A 3LXRA 4MCIA 3KE8A 4QTUB 4Z0TA 1T2CA 1QP8A 2C97A 3OX4A 1I51A 2EP7A 4DDKA 1ZHFA 1BJKA 5KC8A 4OUKX 4UEKA 3KR2A 2W2VA 4FONA 4X6UA 4DARA 2B1GA 2OO7A 4ZKEA 5ALVA 2IVZA 2YJNA 1HE1C 3C45A 3VA7A 1LLFA 3QVOA 4Q00A 1VMKA 5FQOA 2ZM6B 5LZ7A 2ZYSA 3HJAA 4JBLA 1IVSA 3JXEA 3HYSA 2AOXA 2JLSA 4BQFA 4YI5A 3OEEA 4NYMR 1CUYA 1V41E 2ZXFA 3R5FA 1KI2A 4FYXA 4MUAA 4KIUA 4W6QA 5AKZA 3WK4A 5JDIA 3OKCA 3O8OA 3T0GA 4AK9A 4JSYA 5CG2A 3IMGA 3CNBA 1ORIA 1YD7A 4NYMQ 3OZTA 2X8JB 1FSSA 3VTZA 3QYPA 4HVTA 2EW1A 2C03A 2INGX 2X7XA 4ONEA 4EA8A 3R6LA 3VGPA 3WRVA 2WZQA 2DG2A 4KI7A 2JCBA 3VKWA 3QNUA 3TIIA 2POCA 2UAGA 3KC2A 3PD0A 1DINA 4WNCA 4YMVA 4DV2B 4J07A 1Y6FA 4CMEA 1RKVA 2CNKA 3ESAA 1QYVA 3GFTA 3MUFA 3H8WA 2WPDA 3U7RA 4OI2A 1NUAA 1YZNA 3E9YA 5AK6A 2WYHA 2PXXA 2I65A 2XJ4A 3BRSA 1NY6A 2RG7A 4QSHA 4C05A 1LS1A 2PO7A 3MBIA 4Y3UA 4TRMA 1E1DA 3U4CA 5DMXA 3NHAA 2JA2A 2YOFA 4C7BA 2FI1A 3WLHA 4PRLA 4G5QA 1KDRA 3VSCA 1WMFA 2H7XA 4CE6A 1DIBA 2W4IA 4IXMA 4JJAA 4DSOA 4NHOA 3WYFA 1FXWF 2XGOA 1H6CA 3F96A 5EP4A 5BV1A 5E6RB 1QH1A 1XZAA 1YMQA 3DMHA 4NRDA 2BKAA 3A0RB 1M6EX 3EPJA 4Y2RA 3HJHA 3HP7A 4S1NA 1SPXA 1WU8A 4RVDA 5DTQA 5AI4A 3QOXA 3OY2A 5SICE 3HYCA 3A3KA 3ZNPA 4KLZA 2KSQA 4HAIA 3U4HA 4X71A 5CNKA 4MMXB 2BFFB 4L76A 1RZRD 1G8PA 2PRYA 1FS4A 2A6PA 2C8JA 2WG2A 5T64A 1KO5A 3ZWVA 3UJCA 1AKTA 4ADSG 1WDMA 2B1RA 3DUFB 2FFQA 2RC6A 3IODA 4PYMA 1EUCB 1EE1A 4OYLA 4Q9IA 2XD4A 3ENWA 3TFQA 1A2BA 2WTBA 2R8OA 5JCPA 2AA3A 2VNAA 4CCYA 1TPZA 1DEXA 4MS4A 1CSEE 1SRRA 3R23A 1RDFA 2IYAA 5HHTA 1VSTA 3IXQA 1PE0A 1OZFA 3HCFA 1AUVA 3E3OA 1NSYA 4J9UE 4UFNA 1H6DA 3KEQA 3GJRA 5C3UA 3V1UA 1DLJA 2ZR9A 3G2JA 3RYIA 3U09A 3LPLA 2FSPA 3IRVA 5D86A 2X2PA 1DC6A 2DRIA 2IUFA 1Q11A 1B16A 1EVEA 1RWWA 5LBIA 1N75A 4YJ2B 5JBIA 1ZNYA 2PBRA 2QY9A 1ZWLA 1O03A 4AUMA 4TSFA 4F5EA 1EFUA 1M2HA 1UC4B 1X8KA 2E4ZA 3CX8A 3E3LA 3T38A 5JZSA 3Q7IA 2WTAA 3LS2A 2GA9A 1RBZA 4IO1A 4Q7QA 2OORC 1I9GA 2B5WA 4G9GA 4I1IA 2AX3A 2DQKA 3BWBA 1SD2A 3AEZA 3AZOA 3CLRC 2A92A 2DJIA 4MEJA 3WP1B 2ACEA 4XPIA 2YJ4A 4V0ME 4FKZA 1J7KA 5JYBA 3QFRA 1JKJA 3N2GB 4J03A 1WKVA 2OCBA 2YIVX 4GG1A 2WNHA 4G4SO 1N5JA 4NU6A 2C5SA 2CVZA 3EOAI 3K9BA 1FTYA 4WXMA 5GONA 2P2LA 4QDKA 3RYFB 1GKYA 1RAFA 1ST2A 2A88A 2QRNA 2FMXA 2ADMA 1YASA 1G9TA 2QOEA 3BH7A 3VR6D 1VFNA 4LQDA 5ES3A 3AHHA 5A4IS 2XNHA 1GN8A 3PFKA 3U0VA 1JFRA 3IV7A 4RK1A 3S2ZA 4F12A 4G65A 2V65A 2RI1A 1A82A 1Q92A 3QVKA 2YXEA 4PAMA 2AVDA 3BK7A 3NMUF 1YKSA 1A4XA 1BMFA 3K0BA 2H48A 3U4QA 4G5HA 2SKEA 3BL5A 3DLBA 1VE5A 1XBTA 1Z0UA 2QUBA 3MUEA 4IHQA 4MIKA 1O4WA 2H4JA 3HUTA 4G4SP 1FU7A 1X1CA 2CNOA 3HKEB 4D9MA 2BYTA 1OCEA 1P6UA 2HKIA 1DRWA 2XRYA 4XR9A 1PT6A 1JAHA 3GT4A 4TUYA 1UWLA 3FRJA 1GRQA 2GJKA 1GV1A 2AUNA 3K6RA 2RH8A 4OBEA 4P34A 4PZDA 3UXEA 1Z6TA 4Q7MB 1TUBA 1NP6A 4EHLA 4YJ3F 4F92B 4UHJA 3BWVA 3UATA 3CHYA 2P41A 2Y0EA 3DEZA 2IZ1A 3HRKA 5TQ0A 2W8ZA 3FTDA 3GRKA 2REBA 4TSKA 2DUMA 3VZQA 2QTVA 2Q6OA 3K8ZA 4JP1A 3ED1A 1H94A 4P5DA 3GJ0A 4NL4H 4YRAA 4IHKA 4PTLA 4TKMA 4DBLE 2IP1A 2OSBA 2JCVA 2PGXA 1ICEA 3HMQA 4XB2A 1O6ZA 1GGJA 4U6SA 2H4FA 3F5MA 4Q3DA 1IU9A 5GQSA 1BA2A 3C3BA 2B6NA 1UANA 5HK8A 1OKKA 4JWTA 4W5HA 1A8PA 4R3NA 1X87A 2R1UA 1V5IA 2BE9A 2EHDA 1PGJA 2H9IA 4INPA 3K0CC 2VP6A 3OOHA 2WJ4A 4M1TA 4X84A 3LX6A 3V6MA 5L4NA 2AEEA 2L0XA 1LQ2A 3OZIA 4XA8A 4YCJA 4UBOA 1YGPA 4JLDA 4BRWA 4F3KA 1GTRA 3WJ1A 3ROGA 4HT3B 1C41A 2HEGA 4MAMA 3CN7A 1WXIA 3OTIA 4FGSA 4X7PA 4CEJB 2Q2QA 1XEXB 2R4QA 4V02A 1MABA 4BVGA 3PLNA 3G5UA 4D4HA 1RZ3A 2P3SA 4DT1A 3HJTA 3W90A 4CL0A 2GDJA 4DA8A 1AMNA 1ABFA 5C53B 2CLKB 3O93A 4W8HA 7GPBA 1LPNA 1U3FA 3B6ZA 2JFUA 1XDDA 1HNWB 2PKXA 1EB8A 1HDCA 2ZJ3A 1R9NA 4AX8A 2AZTA 4MRNA 4PPFA 4EJFA 3A6ZA 1DQRA 2AXNA 5I7AA 1JEDA 1O6CA 2YWRA 3AL3A 5BMVA 1PS8A 3DV0B 1VJ1A 5LWQA 5DCYA 2BLNA 4BO2A 3A14A 1Y9AA 5TJ9A 4AJOA 1GL7A 4BO1A 4C1NA 3VOBA 4MWOA 2AOUA 5J5CA 2EXXA 3PNOA 2VDRB 1WE2A 4MW4A 1DHRA 4G97A 5JCXA 4K03A 2CNWD 1LFDB 2W0SA 2WFAA 1O95C 3B53X 2Z30A 4G41A 5DW3A 4ZHQB 5KNBA 4TZ6A 1NVVR 1POWA 1A1VA 1ADBA 3EZ2A 3N2NA 4RMGA 2EX1A 3N2EA 1FFAA 4IDOA 3LUJA 4AO6A 1XHEA 2H1WA 3AFIA 1BCSB 1FRNA 3HWRA 2VF8A 4G0YA 4LGYA 1V7ZA 1U31A 3EZ9A 4P5EA 4S1VA 2R25B 2FJUA 3U9SA 1XLTC 1P2SA 2JAQA 3E7FA 4X00A 4KTVE 4RJKA 2PVSA 3VVBA 4DZZA 3OEHA 2Z2IA 3SVTA 3A0UA 3L2OB 4KR0A 4HNSA 4QHSA 3ZQJA 2C4VA 5AOBA 4BVBA 1XD2B 2I3AA 4WNAA 4COKA 3ZI4A 2VP2A 3BXGA 4U7FA 1EYZA 2YWDA 1DAPA 2YMQA 1S8FA 3E1SA 3WR5A 5FTWA 2N75A 3PDIB 4K3UA 5JS2A 3E2MA 1Z5OA 3B1FA 1FW8A 1KFBB 2WE7A 2QLFA 2XI4A 3PZBA 5C1OA 2XEDA 3WC4A 1SD1A 2HT1A 4NATA 2WJPA 2BGLA 2NU9B 3PIRA 1KJYA 1OC4A 3BBPA 4L4YA 4WXEA 5JECA 1J0DA 1DJQA 1M6NA 1F5NA 2JLYA 4BXOB 2QIOA 3S29A 1P5FA 4P92A 4WKBA 5JU6A 1E4OA 4L74A 3THYB 4FMDF 2P5TB 2JK1A 1Q74A 1D7AA 3AH8A 4TT3D 4R16A 1NE2A 4KMOA 3G7UA 3IDQA 5FL7A 3NHYA 2G88A 3I04A 3W8FA 4C2AA 4L5BA 3KD2A 4UNNA 1EXMA 4Y2UA 1MN6A 4K9DA 2F4NA 1TEZA 4A6PA 2C2KA 2O1XA 3O91A 1D2AA 1KHTA 2HM7A 3L8YA 6ADHA 3EEQA 3DE2X 3ENNA 3HR8A 5SV2A 3M4XA 3P4XA 4KJXA 4ZOLA 5E1OA 1EUQA 2IHZA 3SMVA 3C1AA 1CKEA 2GKSA 1GN9A 2EQBA 4E3ZA 4UDNA 4DLTA 3CNQS 2EFCB 3EVZA 1HDYA 1Y6ZA 3ZEIA 2O3SA 1Z6GA 1KH3A 4EA9A 1ZISA 3B7WA 2VH2A 1G41A 4EEKA 1D6JA 1QFMA 2P7HA 3AEXA 3INNA 4BX8A 2FLKA 2ZB3A 4QDXA 2H0QA 1X1EA 3ODPA 4OHUA 4HCJA 2OHIA 1I5RA 3G2LA 4UUPA 1EGMB 1YSCA 1P44A 3BX1A 1VJTA 4FOTA 3N87A 4MJXA 1W94A 4F3NA 5FV4A 2ECKA 5L3QA 2ZCVA 3UT5A 3CH5A 2RGDA 3LUPA 2QKYA 4YAFA 3V8QA 4WHMA 1L4UA 3GFGA 4RTSA 1IK6A 4L8FA 4F9EA 4BBJA 1KY4A 3VVLA 3IUNA 3K0KA 3HJBA 2AFVA 1NX6A 3NV9A 4G0PA 4LYEA 4NONA 4V3CA 1Z06A 4JX9A 1QS0A 2GYWA 4R4JA 4KBGA 5JSKA 1Y3DE 3A1WA 4E70A 3FNGA 2HCFA 4JUAA 4BC1A 2IYTA 2AC2A 4Z8YA 3ACCA 5J63A 1SHJA 2QTZA 3DDSA 3IXMA 5EFZA 1X7WA 4IINA 1QZTA 2G9QA 4RVOA 3PDWA 2W0MA 4IGEA 1RADA 1XPOA 4PPNA 4BYMA 3JZIA 3LHFA 3SXJA 5ILGA 1E6LA 3PVZA 2G7ZA 3SC2B 4YP1A 4QUKA 5EHQA 3V8NA 1N9GA 1U0SY 2XPCA 3DTNA 4FEAA 3BHNA 2QUHA 3TLEA 4WQMA 2AG0A 5T5QA 2AR9A 5C80A 2J9FB 5JFTA 3ONVA 4G86A 1C8LA 4HG2A 4QOFA 2JJ1A 4JBWA 4EARA 3BS4A 3EFEA 4GM0A 1I7PA 4DJTA 3R7SA 4LJLA 1LNQA 2QL7A 4BLUA 1USIA 3HWX1 4NNOA 3D64A 5KCZA 1UXGA 4I0WB 4YMIA 1X42A 2JGNA 1DLIA 2KX7A 2O20A 2J4CA 3B6MA 2PH1A 4QEZA 5E2AA 5BSTA 1FUEA 2OM2A 3AW9A 3JWGA 4DF3A 1DWUA 3X1KA 1N2BA 3CNHA 4LHWA 4TKVA 3KT8A 5LPNA 3K6SA 3I01M 3B6IA 2YWFA 3N05A 1M33A 1Z0JA 2OHOA 5COBA 3HN7A 2CD9A 4YP5A 3CPEA 5BSRA 4ZJPA 2OP1A 5DGDA 4CG3A 3O6VA 1T5OA 3G8AA 4YX9A 8AT1A 3EPHA 1RXVA 2AEJA 4WSOA 1QF7A 4A8PA 3ADCA 2OE2A 3LCRA 2BF7A 3JQ8A 3DHYA 3NO4A 4FR2A 4FZRA 4OM7A 5ABPA 4CGYA 2FW6A 3QEAZ 3EQ9A 2YS7A 1XP5A 1AVTA 2HPVA 3DMDA 2F3SA 3NEAA 3QKIA 1MX5A 3ECSA 4M0DA 2XBUA 1Y48E 5JXJA 1M1XB 4HPWA 1NN1A 3BXFA 2FQWA 2XTNA 2PGOA 1W59A 3SHVA 3ZBQA 2FUG1 1M2JA 2IZ0A 1V6CA 1QNLA 3EXG2 3GLHA 1NE7A 4X9XA 4ZCTA 5C8DA 2IODA 3GFVA 4LQLA 3AKDA 1X6VA 2RI0A 2W6MA 1YQUA 5E8RA 1R9GA 4Q3NA 1T9ZA 3O8OB 4KO1S 4ND3A 3ROMA 4KPGA 4YPVA 1A1SA 1NR1A 2VTKA 1M75A 3DM9B 4OP1A 4UM9D 3PTAA 3K8QA 1AZTA 1O97C 3AHFA 1O96A 4FXOA 3WBFA 1EBUA 4BNVA 5EIBD 2MWMA 3DFMA 2M1ZA 4P81A 5AM4A 2R66A 4IM7A 3DV2A 3C2QA 1L1RA 3R5HA 1T1IA 3PXXA 5CT4A 1KQGA 3TS1A 4CIYA 4OI4A 1CUJA 4NCKA 4BAGA 1QUEA 2IKQA 4GGMX 4MQLA 3ZTWA 3GJSA 4P3XA 1C7EA 3TF5A 4TV8F 3VPHA 3PXGA 4KNWA 2V5UA 3LF1A 3TQQA 1PNRA 3B1WA 2RIRA 4KAFA 1E5XA 4Y1EA 3VU8A 1F48A 4DV1B 2JFPA 4RK7A 4NCIA 4PIMA 5KMGA 2FZWA 2VYND 3SBEA 3SEFA 4WDRA 2VJLA 2YMLA 1AO0A 2I6QA 1RAHA 5ALGA 1NF9A 1YU9A 2E7ZA 5H59A 4AIRA 2OBXA 1G17A 2XUFA 3G8BA 3KJGA 2W58A 4YRCA 1B8UA 1R0CA 3BMXA 3WA6A 4BTLA 5JMOA 4YDRA 3RG8A 1XPUA 4CL3A 2YNMC 5IT4A 2GERA 3RODA 1H0HA 1VGRA 4HL6A 1QNFA 1QTQA 3KXKA 2PX8A 3BQMB 3CB2A 3Q9SA 4L15A 1ULBA 2VUSA 5EY5B 4GKVA 1Q7EA 1YZGA 3ICWA 4Z0HO 5IP5A 2PWYA 4KXWA 4QBHA 4KXFB 2Y27A 4DA6A 2MOKA 3GR6A 3RS9A 3DLHA 3CWCA 3CZ4A 5D85A 1WMAA 3BTOA 1SG6A 4UARA 4KMMA 3PQ8A 1BA3A 1HA3A 1JPVA 2BN4A 1JEJA 3QLEA 4XQEA 4MVJI 2P6NA 4CIXA 2I2FA 1P7ZA 4L78A 1DBQA 1PVVA 1U2GA 1Q16A 3GHYA 3OZRA 1US8A 3D4IA 5HKLA 3MEQA 4N5HX 4MYCA 1ND6A 1FDTA 1L3IA 2IP2A 2C9OA 3PQEA 1X94A 3IUSA 1QYIA 3A9RA 3SP1A 4DMMA 4I3FA 4CCYB 1MH1A 2XDQA 2IUTA 3ND8A 5CVCA 4MS4B 1IB6A 4LXYA 4I4TA 3UJ7A 4QXRA 3VHLB 3IJEB 5DNYB 4WESA 1YDFA 4GZLA 5DEIA 4F97A 1VYVA 2HU5A 1MOQA 3E35A 2CUZA 2OBBA 2VVTA 3F97A 1DE0A 3RIEA 1Z6ZA 5F12A 1O08A 4G0MA 4Q21A 4XIYA 3RYIB 4KQGA 4NBNA 4Y6PA 1NNEA 2F9FA 2PHZA 1D7OA 3UANA 2R85A 3VR3A 2R5FA 1T5TA 2Y1LA 4QKQA 2BFCA 1GUBA 1MTZA 3K09A 4KDEA 1SA0A 1XLUA 1A7UA 3F1LA 3QY9A 5HUHA 3RF7A 4TT8A 1KR5A 1P7PA 2ZAMA 1KJZA 2PH7A 3BMQA 5ALNA 5LWHA 4XIIA 3WGNA 4ASUD 2EKZA 1E59A 1G8AA 3EGIA 4NWIA 2XXAA 3A10A 5ES4B 2RAVA 1D6SA 1CNMA 3GF4A 4G8JA 4KVAA 3AF2A 3IFSA 4B4VA 4PPYA 4UFPA 1DCTA 3AL0C 4QT4A 1XJ5A 2CBGA 3G0CA 3IDSA 2J6CA 1JKJB 2QSYA 1FDOA 5LIPA 3HDGA 4X65B 3T1QA 2NTEA 1XZPA 4FOPA 5LP6F 3RASA 2K4MA 2NAFA 1JLHA 1IHYA 3DP9A 4GT1A 5GONB 4BMXA 5IZCA 1GFIA 2PH5A 4Q0MA 4MR7A 1DXYA 1JIKA 2XVXA 1H2YA 2I8LA 2QN8A 2EKLA 3MJTA 4L4RA 1LI5A 2HIMA 4IV8A 2P0EA 3TD2A 2GILA 2ZRBA 1MFZA 4DV7B 3SJAA 3UGQA 2DBVO 2W2MA 1SHUX 1CK4A 1VJRA 1U2QA 2NXWA 3ASVA 3KWLA 4WY2A 4KU4A 4DABA 1JZTA 1KAEA 4KDCA 3R6GA 4C0BA 1NW3A 8ADHA 9GPBA 4GSKA 4L08A 1GTL1 2NP7A 1Y5LA 1YUBA 3DT8A 3TVDA 1Z38A 5HCNA 1DZIA 1K8XB 1DAIA 2VRWA 1CUFA 1T1GA 3ULKA 3OPNA 1KEUA 1JSXA 1WXXA 3N70A 4QBIA 1E7SA 4CTKA 2PX6A 1N3LA 1FX1A 4RIGA 4TUYB 2X4IA 2E4YA 4F3YA 3NGLA 3S27A 4EG1A 3RC8A 1A4RA 5DO9A 1TUBB 2R60A 3HPQA 4F93B 1KGSA 1U9IA 2II6A 2VP3A 2XNCA 5KYXB 1DGQA 3E8XA 1DG9A 1YZHA 4P4SA 4WRRA 2J9YB 2A0UA 3P2OA 3IQGX 4AZSA 5TQ0B 2B82A 1CF9A 4RADA 4CEHA 1V4NA 5E1MA 3HRIA 1Y34E 2WHYA 2QTVB 3IOCA 1K5GA 3PSAA 4FHZA 2I99A 3BFJA 4A6EA 1DIHA 2D62A 4IV5A 1PZHA 4KQFA 1GG5A 2Q1TA 4P1ZA 3KAPA 5AW5A 4LJ6A 3ZCRA 1G6HA 2C00A 4XUDA 4E15A 2AI2A 1Y5MA 3ZUGA 1ZL0A 2NADA 1L4YA 2ZAIA 3ETLA 3H0KA 4HAOA 3E9NA 5KWJA 3EPPA 2CV2A 4HNTA 3NU1A 5KQPA 2PL9A 2W37A 4II2A 3TLJA 2P77A 3D54D 1XA4A 3WHPA 3K9FC 2IHYA 3IP3A 2CUTA 4J29A 2JCXA 2JFXA 1CY8A 2PTHA 3VI4B 1MW8X 3CZMA 3O8CA 1OTHA 4ZK2A 4BQNA 2HD4A 3EQ6A 4RA6A 3AVOA 4LOLA 1QZXA 3DZ8A 3U62A 1HQYE 3GA5A 1FFXA 1NOIA 3HCWA 3C4JA 3EFOA 2QRLA 2X5JO 2VPYA 4IL5A 3CKLA 4KO8A 4M99A 2WTUA 4PV7A 1OI2A 4A0HA 4DT1B 1EFAA 1Y63A 4EECA 3QIVA 5ECDA 4DC9A 2GDZA 2HWXA 4WECA 2V45A 4LJ9A 2I22A 2GZ1A 2IIBA 1VG9B 2F7SA 4IIDA 2C5GA 2EGHA 3DT6A 4IBOA 2VOEA 2O50A 1Y7LA 1LGYA 2COUA 3E58A 3G2PA 3N8DA 3O8BA 4EY5A 3HCEA 2QDKA 4NE9A 5EWJA 4KQ9A 4QX6A 4M7WA 3WLFA 5BMVB 4MPTA 5I01A 3U5ZB 2Y2UA 4KLNA 3IAM6 5KQSA 3HSSA 1E1RD 2X3FA 2H9YA 2AOUB 1H4VB 3GP3A 3ZWPA 3U7JA 1Q22A 1ZOLA 2CUKA 2G9VA 2AYYA 1CB0A 1MF7A 3PGLA 3U0BA 5BSWA 1UDCA 5JV5A 1OX5A 5HJ5A 1SHTX 1RQNA 3QKSA 4JT4A 4LSWA 1RWBA 2AE1A 2W4QA 1AM4D 3EVAA 3QENA 1DAKA 1P1FA 2OC4A 4IYJA 1YQTA 2CCGA 1NMEA 5B5SA 1JT9A 2I66A 3B13B 4TRRA 1J42A 2XTJA 4ZCMA 5DM60 1DO8A 1E0AA 2BBOA 5M29A 3A2KA 3Q3GE 5I9LA 1KC3A 2OD7A 2DHQA 4QJ5A 1TW3A 2VNJA 4FKBA 4RQTA 3STTA 1I0ZA 4HLDA 3TTXA 1SUPA 3EYWA 3NTXA 3VTFA 5SZHB 1UBJS 2Y9PB 2WZCA 4KXNA 1L4HA 1L4LA 1OHHA 2VUUA 2O7QA 4PLCA 4ZAZA 4DCJA 3ZDCA 1ETHA 2ZIWB 3C87A 3NRBA 4PPGA 4WNAB 1W93A 3OPVA 4IGKA 5EYPB 1L5KA 4N4AA 1BDBA 1J5PA 1X7HA 1K89A 4M60A 4QXPA 5JRJA 3ND9A 1QHIA 3VNVA 3IVRA 3QM1A 2H8KA 4LJAA 3ZXYA 1NP3A 5E8JA 2PZAA 2R62A 1LZLA 4R84A 3CZCA 1KP3A 3C8HA 1WF6A 3L7OA 4R05A 2FR8C 3SE0A 3STXA 4DAOA 4TQUS 3ZU6A 3BIFA 1W19A 2MSWA 3Q88A 4CN8A 4KZPA 4IDBA 1E0KA 2QRQA 2PD3A 3CZ5A 3I1JA 1LK5A 2BKVA 3E7XA 3EGXA 1ZHHA 2GTPA 2X1LA 2HSEA 3R3SA 3RRFA 3J7TA 1RWOA 3UK0A 1RRPA 3IUBA 1M34B 4O1IA 5DB4A 2CK3A 2ZJ2A 3L4JA 3OQJA 1T0JB 1Z33A 3DE3X 3A25A 1XHLA 5F98A 2VHQA 2I78A 2P2GA 4ZOLB 1FLAA 4FVTA 4ID3A 3ESZA 4DCGA 1XPRA 4C0SA 4P7BA 4MYUA 1LB1B 1MX9A 1XZKA 1GR1A 2JLQA 2O7VA 3M34A 2IEYA 4IWXA 3Q87B 1FYFA 3U3RA 5FUXA 4CBVA 3DD1A 4E5UA 2CDAA 4M1KA 2Q5LA 1NRXA 1ZHOA 1FU8A 2R8ZA 3ROPA 3VM6A 3IDFA 1Z82A 1CHNA 3G2OA 4KQXA 1NJGA 4D4IA 3AINA 4ER5A 2D6FA 1OLUB 1XTIA 3RRZA 3NT2A 3QHQA 4NPAA 4QG3A 4ZRDA 1JQEA 2NUPA 4EY8A 4P32A 3EXIB 3OLWA 3IVGA 4O59O 4FSHA 3OPQA 4E88A 2A0YA 3D7KA 5IBCA 2EDAA 1QIHA 2AJBA 3SBOA 2C96A 3OD1A 3THXB 4P08A 3ZK8A 2ZTSA 4F2DA 4MS3A 1K3FA 4AY3A 1MX3A 1VI6A 4U8GA 1M8KA 2QM7A 3SI7A 3OSUA 4F1WA 2ORIA 1QS0B 1EK1A 3NPMA 3L9XA 4RZSA 5FWAA 3UPUA 1MVNA 4Q4JA 1Y1QA 1USWA 5ALWA 1CT9A 1ZD4A 5DHTA 4AG5A 3GIDA 1PR1A 3P9SA 4G5YA 1EDEA 1NXVA 3GP5A 3ZI0A 4CUJA 1X7WB 3EZ7A 1M76A 4J91A 4AT1A 2HU7A 2JL1A 3R75A 5KYTA 3HJCA 1XEAA 1AA9A 2RGCA 3DLIA 2QQGA 5CA1B 3N8GA 4WFIA 3KEGA 3QFSA 2G1UA 3HU5A 4PBTA 5FOQA 3O7MA 2IXGA 4EG5A 2FX5A 4JZKA 1IHXA 3O26A 1JTFA 2TYSB 1AHPA 2P1ZA 2GJSA 5F1KA 4D9HA 4EO7A 1QMPA 4RIEA 1N9GB 1Y6JA 3P71T 4M37A 3H9UA 3TUZC 4LTDA 5K4GA 1RM5A 1RYMA 2VS1A 2IDMA 4S04A 1U7WA 1QSGA 4GIBA 2FOXA 2QPLA 1EK6A 3FNHA 4M0PA 3CPHA 5E9AA 4LKRA 4R68A 3W5VA 1H4SA 5KKNB 2QI9F 4PG6A 4UCXA 4F21A 1Z5VA 1R6UA 2O8CA 2C7RA 4DRZA 2WVJA 1P19A 3LC1O 4KR2A 4UMDA 2YBDA 4ZVOA 4BL5A 5AQ1A 2VDMB 4ID9A 4OGFA 1SUFA 3ONEA 4GDFA 2M98A 1H3NA 1EWTA 3CX4A 3L6BA 4DIEA 2NPOA 3VYWA 1P74A 5JRDS 5K8VA 2V74B 4V24A 1L4MA 1FFWA 2F67A 2BI8A 3FMPB 3KT3A 3CLUD 1PZMA 5IFLA 4I5DA 1LEHA 4MUYA 2E2WA 1CIVA 4ZN6A 1R6AA 2NQ2C 3QVJA 4O4HB 4RTLA 4MQFB 4X85A 3ZWOA 3CJTA 2I1VB 3FHJA 4DLBA 1TM3E 3JQ9A 1HTTA 5I51A 1ZWKA 2B7LA 2YWEA 3DBRA 2IIQA 5LXTA 2WKQA 4IRMA 2AOVA 3CTMA 3VMFA 3B5IA 1EEHA 1M2NA 3KOXA 2XKBA 3RTCA 4DA9A 3SIXA 4QBKA 2OV1A 3C43A 3TQRA 3JX9A 1RYBA 3GLHB 5IAJA 2HHHB 5C5DA 4OJNA 2EQAA 3IL2A 3NNNA 1JYFA 1N2IA 2OAQ1 5JSYA 2Y1GA 1D3AA 3FRHA 3R3UA 5KU7A 1SIBE 2VK2A 5IHPA 4EIWA 1I01A 1G98A 1KDTA 3NC4A 2FFBA 5JI2E 1R27A 2HHAA 1O96B 1USKA 3GT3A 3IR7A 4TL7A 4YAKA 3MPUA 3HCAA 4IFIA 4MUHA 3D6AA 4HVCA 4MI1A 4RIIA 4KEAA 3DEJA 4WFKA 5AKGA 4ZDIA 4RDCA 4AROA 1JFVA 4G0OA 1YONA 4K7JA 3KJNA 5D5QA 1BMQA 1MAHA 1P18A 4FFPA 4IDDA 3T4EA 2FN7A 3P45A 5B12A 1Y81A 4N9WA 1BWRA 2GZ3A 4WKOA 3GNLA 5DBEX 4JP8A 3SZRA 1AF4A 3PQCA 5FBRB 2DU8A 4YRFA 3TDMA 3KQTA 4CI9A 4PNPA 2CHEA 1BQ4A 4FN4A 3W5SA 1PSDA 1GTMA 1O3YA 5CM8B 5FBLB 1H22A 2HY7A 3EXFA 4C4AA 2OL4A 1IZYA 1U1CA 1UR5A 4QEKA 1WUTA 1JSRA 5KTPA 1YCFA 3H2KA 2EWWA 1NVAA 1E5VA 3AY6A 3G7NA 5B3AA 2N1BA 5C5CA 5CIQA 2R8RA 1X7XB 1Y8AA 3FKSA 4H4CA 1L8LA 4R8KA 3T1NA 4ENQA 5JXWA 3D8UA 4CM1A 2BPOA 4CMIA 4JQSA 2E18A 2YV3A 4H59A 1P3Y1 4L73A