2O2HA

Crystal structure of haloalkane dehalogenase rv2579 from mycobacterium tuberculosis complexed with 1,2-dichloroethane
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
b'FGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase 3
publication title Crystal structure of haloalkane dehalogenase Rv2579 from Mycobacterium tuberculosis complexed with 1,2-dichloroethane
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 112
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o2hA00
3ICVA 5AKGA 1WB6A 2VSQA 1EX9A 4LXIA 4B0PA 2V97A 3KOOA 1MT3A 1QLWA 2WU3A 2PU7A 4BE9A 4OB7A 2V9ZA 1BS9A 1H2WA 1ZICA 3LCRA 4YX9A 1EVEA 1UKCA 3IUNA 5C7YA 2Z8ZA 2ORYA 5ALDA 5AKYA 3G9XA 1QIDA 3KXPA 1XZIA 5EFZA 4H35A 1JKMA 3WK9A 3PFBA 5FRDA 3PI6A 4AZ0A 5K3AA 3HEAA 4BDTA 2PSJA 5ALFA 4BP9A 4U2GA 1FSSA 1ODTC 3G0GA 4Y2PA 4EA6A 5KREA 1IZ8A 1YB7A 3EIOA 3H2KA 4RGYA 3YASA 1XROA 1HBJA 2B61A 3HXKA 1DQZA 2VATA 5DNWA 1A8UA 1SOMA 1W4LA 1LPPA 2HA4A 2C0PA 2HM7A 4UBIA 2RI6A 2GBCA 1Y7IA 4HRXA 4B82A 3CCBA 4F21A 2VF2A 1FFAA 4DGQA 5CURA 4DM7A 3QVMA 2ZSIA 3Q8WA 3E1GA 4TGLA 1R50A 1XRNA 3QH4A 1HLGA 1N8SA 1QIJA 4FDMA 1CUCA 3TRDA 2PSFA 4CFSA 1VA5A 2XMRA 2JEYA 1VA4A 4FFVA 5A71A 5AOCA 4UBLA 4H77A 3BJRA 3SC2A 2OAGA 4GHWA 3STXA 3O4GA 2GYWA 4CG3A 3G0CA 3MVEA 1TCCA 1VXOA 3UUFA 4Q3KA 1VZ3A 1WPRA 1SFRA 3H2IA 3FYUC 5AM1A 1E66A 5AP9A 5D6OA 4GXNA 3FSGD 5AKIA 2XQFA 1UKBA 1VLQA 3H2JA 4JNCA 5HK8A 2BCEA 3C45A 2WIKA 3W2TA 4N5HX 1HKHA 1LBSA 5JAHA 1LGYA 5HK9A 5AM4A 1ODCA 3BIXA 1ZD5A 3KDAA 3A70A 2H7YA 4N8DA 4C88A 1GZ7A 1KEZA 4IH1A 2GYVA 5T4BA 4QDXA 4WFIA 5AO9A 5EHNA 2DR0A 4ARBA 1YCDA 1CLEA 1ACLA 1CUIA 4PNZA 3PF8A 1UZAA 3FVRA 1VE7A 1H22A 1MN6A 5AI0A 2VT6A 4L9AA 1DINA 1JFRA 2QKYA 1XZLA 3BDVA 5EHQA 4X93A 3R40A 1R9NA 3IUQA 5DTIA 5CT5A 2CZQA 5AI8A 4EUSA 1CUSA 3OOSA 5ALQA 4HTAA 5AHXA 5HCUA 1GQSA 1CVLA 3GROA 4AZ3A 3E4DA 2BGRA 3M82A 1XQYA 1LPNA 2WJ3A 3WK4A 1GPKA 1GPLA 4A5SA 5ALRA 2VAXA 1C7JA 2BUCA 4PV7A 1J07A 5AI4A 1OILA 1MX1A 5AIAA 5EI5A 2WLSA 3X3HA 2GZSA 1UFOA 1LPSA 4QWMA 4L72A 2C5GA 4G4IA 2WHRA 2XUDA 2HRQA 1P0IA 3IBTA 3BF7A 2W22A 2CKMA 3C5VA 2DQYA 5JD5A 1ORWA 1ZGBA 1K8QA 1IMJA 4EY8A 1I6WA 1XZFA 3WIOA 3ICWA 5LZ9A 4GBGA 5FV4A 5HF9A 5BWCA 2XMDA 1SCQA 4AMYA 4W1SA 1R1DA 3DYVA 4OUKX 4MEBA 2J3QA 2D5LA 5ALJA 3FSGA 5I8PA 1WPXA 4UFPA 5DTJA 2AJCA 1ZIXA 1M33A 3OURA 3QMWA 3O4JA 1PJAA 4ZRDA 4MQMA 4W1QA 3C6BA 4N8SA 4XJVA 3I6MA 3I1IA 1FFBA 1NX9A 1E8DA 2PBLA 5JALA 3F98A 3S8YA 1MTZA 2YYSA 3ZLTA 2WFLA 3GZJA 3R3VA 3C87A 4FBMA 4DNFA 3WL8A 2AJLI 3HZOA 2ZJ6A 4AQDA 5ALNA 5JZSA 2WFMA 4OYLA 5AM5A 4B6GA 1Q83A 3NGMA 4LXGA 2WUDA 1MO2A 4HRYA 4UHBA 2HL6A 1FJ2A 2YH2A 2PM8A 3DOHA 4WDRA 4CCWA 4BCBA 2PUJA 4BRZA 4J0JA 2BAGA 1UOOA 4QZVA 1TK3A 5CT8A 4ZXFA 4S0XA 2D0DA 5ALHA 1EVQA 2XB6A 3V1NA 4FHZA 2W6CX 3N0TA 3FOBA 2J4FA 3EQ8A 1XZDA 3MUNA 3FCYA 2HHAA 3Q0TA 1NU8A 5HFAA 1CEXA 5DNVA 3DL4A 4ZV9A 5AM0A 2Y6UA 3HRHA 2PKYX 4H7JA 3C6YA 3A2MA 5AJHA 3L1JA 5A6VA 4RNCA 4G4GA 1CUEA 2QOEA 4OYYA 5FKJA 4X7BA 1LZKA 1EXWA 4WFKA 1QO9A 4H18A 3ZI7A 4JUIA 1ODSA 3FWHA 2WHQA 5C81A 1AMNA 3BWXA 1KU6A 2X76A 4FWBA 2Y2VA 4TVKA 3A2NA 3I2FA 4G5XA 2XUOA 2BUBA 3E3AA 3PF9A 3MGAA 4QLOA 5CXXA 2XQGA 4AXBA 3DYIA 1CQZA 4K2AA 1QONA 3FLAA 1G4HA 2HU7A 3WYDA 3SX4A 1H2ZA 3H2HA 4J03A 3D0KA 5CW2A 3IUJA 1K4YA 3ZLUA 4IH9A 4CCYA 2ZJ7A 5A7HA 1WB4A 1E3QA 5FP0A 5ALKA 4X6UA 3DEAA 3DNMA 1N1MA 5IVDA 4BB0A 4B9EA 2Z8XA 5AM3A 5K3FA 5AOBA 2WIGA 5AH0A 1X2BA 2GBIA 2RIPA 1AQLA 4BTVA 2QXTA 4GW3A 4BE4A 5FOQA 3FYUB 2O7VA 4DMHA 3AZQA 4FLMA 3AZOA 3MUOA 5ALIA 5CRIA 2I03A 4W1RA 4U2CA 3W06A 4FBLA 3AIKA 2Z3WA 5EIEA 1CUYA 1LZLA 4H0CA 1IUNA 2RAUA 4HXEB 4J0CA 1CFJA 3FVTA 4RPCA 2UZ0A 1WOMA 5IVIA 4G9GA 1AX9A 3M3DA 1C7IA 4XWGA 2WTNA 4DSZA 1FFCA 4UBOA 2RHTA 4ZI5A 3GA7A 1EI9A 2XMGA 1XFDA 4BATA 2NW6A 1WM1A 4G8DA 5FXMA 2I78A 4DNOA 2C58A 4H7HA 1TIBA 1S8OA 5DNUA 1XRLA 4KR0A 4H7IA 1XLVA 1XRMA 4CG1A 1SCKA 2FJ0A 3DDUA 4PW0A 1XRPA 2BKLA 3KSRA 1DX6A 2XDWA 4Y2TA 2FX5A 3F9CA 4UFNA 4QEKA 3FYUA 2O7RA 2JBWA 3IA2A 4E46A 3H17A 2AJDA 1WHSA 4OB6A 3STWA 1MJ5A 3F8SA 2WIJA 4BYMA 2ACKA 3WL5A 3AZPA 2JGIA 2QS9A 5HKAA 3WZLA 1XZGA 1CUZA 3HLKA 2ECFA 3QM1A 2CB9A 5CH8A 5E2IA 1N5RA 4DSAA 4WY5A 4ZGBA 1GKKA 1MNQA 1EB8A 5T4FA 2OCKA 1BRTA 5AKHA 3OG9A 4HXGA 3FLBA 4QDUA 2HU8A 3D4LA 5D3KA 1BE0A 4W1PA 2WG1A 2GBGA 2H7CA 1ZD2P 2GZRA 2O2IA 5AKLA 3N2ZB 1XRRA 2Y6VA 3QMVA 4UBJA 3WIBA 2GBFA 1L7AA 2DQZA 4LIPD 1JJBA 3I2HA 1ORVA 4A16A 4MEAA 5DYYA 2XUQA 4HAIA 4J3JA 5JANA 1G42A 4PSUA 2BFNA 4LKOA 5HQ3B 2VAVA 5ALZA 1ZI9A 2IX9A 3R3UA 4KE9A 5ALSA 4F60A 3UMJA 4UBKA 4GLBA 4X85A 4DNQA 1JMKC 4H7EA 2QUBA 2HA7A 3AUKA 4IHAA 1GT6A 4F0JA 1J1IA 2XUHA 3DKRA 3HACA 2WU4A 4X95A 4E11A 2H9YA 2HRRA 2I3ZA 4W9RA 4BBZA 3FCXA 2PSDA 4JYPA 1ACJA 2OGTA 1IUPA 1LPMA 5FDFA 5YASA 3OC0A 5ALYA 3KWJA 3WK6A 3TGLA 4U2BA 1CRLA 4EY6A 4X94A 1JI3A 3BXPA 2XQJA 1TCBA 2HDWA 5K3DA 1C4XA 1P0MA 1TRHA 5HF5A 2VTVA 5SYNA 4FLFA 1F0PA 4N8EA 2Y2UA 2HA3A 3GELA 4LYEA 5C8ZA 1G66A 1UK9A 4X6XA 1BCSA 4Q3OA 3WK5A 1CV2A 4C01A 1P0PA 1EDBA 3O4HA 3D2CA 1Y7HA 4OSEA 3K9BA 4Q1VA 5ALLA 4KRYA 5HQ3A 4GEGA 4U2FA 2OCIA 4ZV7A 3TJMA 1IVYA 4G9EA 4KRXA 4O08A 4Q82A 5DYTA 4DIUA 3GFFA 1RYYA 4JH0A 1LPOA 4LYDA 1U2EA 4AN0A 1UT6A 3KWFA 2O2GA 3PICA 2WFZA 4ITVA 1WB5A 4Y7DA 1AURA 1W6RA 3QZUA 1B6GA 2PSHA 1IZ7A 3I2GA 1PFQA 1YSCA 5EHXA 3W04A 1GGVA 1U4NA 2WQZA 3A6ZA 1ZD4A 2HA2A 1EK2A 3C8HA 5C8XA 4B80A 4BZZA 2AXEA 3A2LA 2C0QA 1AC5A 1QE3A 2G63A 4BVLA 4GDMA 1VZ2A 3CN9A 2QRUA 2CEKA 3G8YA 3BIWA 4Q3LA 2OAEA 3K6KA 3DQZA 1QJ4A 4U2EA 3IUMA 3WJ1A 1THGA 3D2AA 4PSDA 3WLAA 1F8UA 5CXUA 3RM3A 4Y2XA 1YB6A 2ES4A 3R0VA 1YAJA 1E5TA 1CUVA 3AILA 1AUOA 5CT4A 2HU5A 3BF8A 1BROA 3I6ZA 4Y2UA 3AINA 1EHYA 1LLFA 2PX6A 4X91A 4Y2YA 3PUIA 4HXFB 1H2YA 3STYA 5K3BA 4BCDA 2WSLA 2ZYIA 3DCNA 4Y2VA 2DHDA 3WWPA 4BVJA 5KWJA 4J0DA 2WIDA 4F5ZA 2WHPB 2VJAA 1F6WA 2P8SA 5LYYA 4AO7A 2XI4A 2OCGA 4UHEA 5AK6A 4FLEA 4BC0A 2WUEA 3PUHA 2QT9A 4EZIA 2V96A 3R3WA 4KE7A 1HQDA 2XLBA 2Y1KA 1E8NA 4GWLA 3BJMA 4FNMA 4TPKA 2WIFA 1QIKA 2J3DA 3ANTA 5JD4A 2CMFA 4XIIA 3OPMA 4X6YA 4BAGA 4QDOA 4P92A 1IUOA 4WY8A 5HF6A 3PFCA 4B84A 1B41A 3JYHA 1U8EA 5AKXA 2ZVDA 3I2IA 4DLNA 2BUAA 1QTRA 4KE8A 4WJLA 4PSCA 1SCIA 2R8BA 5LZ5A 5HF8A 4FTWA 2OPHA 3I2JA 1EDDA 4P93A 3DLTA 3ESAA 3VDXA 2XLCA 5FLKA 3WL7A 2WG0A 4KAFA 5BWBA 4OU5A 2C5FA 1CUGA 4H7KA 1UOQA 5CT6A 1CUXA 4GECA 4DMCA 2QTBA 2HFKA 5ALGA 2DSNA 2XMZA 4KAAA 3ZPXA 4BTLA 1UK6A 1ZI8A 2H1IA 5AICA 2V98A 5LZ7A 4L3WA 2JGEA 3AJAA 3QBJA 5T4HA 1VE6A 5I9IA 4MQLA 3EF3A 3JWEA 4FMPA 1CUJA 1L7RA 3QITA 3HSSA 2JEZA 1QFSA 4RE5A 2XMSA 1MAHA 5JIBA 1TKRA 4ETWA 5K3CA 4UFOA 3D5EA 1YA4A 2AJ8A 4NZZA 4KE6A 1XRQA 3PE6A 5E4TA 3JW8A 3S2ZA 1YR2A 3IVMA 3FBWA 2RONA 3C43A 1MNAA 2IITA 5AK4A 3BDIA 5LKAA 4QWWA 3SWWA 3CXUA 3O0DA 1VJ5A 4CI9A 1J2EA 3FNBA 1CUWA 3G0DA 3VVLA 1QIMA 2YASA 3G0BA 1ZD3A 2C7BA 1BN6A 1N5MA 2HA0A 1RP1A 5KBYA 1HDEA 4AMZA 5JZ9A 1K6EA 1QGED 3W05A 4AO6A 3D59A 4G4JA 5IKXA 4CIAA 1CUFA 3C70A 5AM2A 1MAAA 5DYWA 3VJKA 1XKTA 3T52A 4E15A 1DQYA 2VJCA 3NOXA 2H7XA 3WA6A 2QR5A 1FFEA 5LZ2A 5K3EA 2WUFA 4DYHA 3O9VA 3C5WP 2G4LA 3HI4A 1TQHA 5CMLA 4H7FA 3RLIA 2RGUA 2VJDA 4CG2A 1XZBA 5AIBA 5AK5A 4AN1A 4IQ4A 3V1MA 5LKRA 5AKJA 1U65A 5H3HA 3LLCA 4JEIA 4ZREA 3G9ZA 1LPBB 3WWOA 2Z3ZA 4X71A 3DKKA 3I2KA 4ARAA 5I7UA 2CUTA 2QZPA 4M0MA 2G5PA 2OGZA 4QLAA 3WKDA 4KAJA 2DHCA 3EQ9A 1CUBA 2ZYHA 1CUHA 4YPVA 5JZBA 1UOPA 3WWEA 1YA8A 1DWPA 3CCCA 1GKLA 5CTAA 1Z68A 4G8CA 2BJHA 3ZLVA 5ALEA 4B85A 2WM2A 5HFNA 4X90A 1R4ZA 1XZEA 2K2QB 4CIBA 3O9MA 1W1IA 1H23A 2QVBA 5CT9A 4HZGA 1MX9A 3QPCA 3SK0A 3WKCA 4ZWNA 4I3FA 1Y37A 5EIAA 2WJ6A 1E89A 3BE8A 3D2BA 4MYSA 3NUZA 1EDEA 4K5QA 1ZJ5A 1JU3A 2B9VA 3R41A 2XUFA 1J06A 2OQVA 1RWQA 2O2HA 4PQEA 2XQIA 3E0XA 2QUAA 2WKWA 3C6ZA 4P08A 2WG2A 5ALPA 2G5TA 4OCZA 3WKEA 4J7AA 2VJBA 4X97A 1QO7A 4P9NA 1UK8A 2I3DA 3VVMA 5IVHA 4EHBA 1DU4A 5E4YA 3F97A 1XQVA 5E4JA 2PL5A 4AO8A 2JGLA 2XT0A 1ZI6A 1HL7A 4ROTA 3VJLA 4FOLA 3HJUA 1XZKA 1NU6A 3IDAA 4M0FA 5AKKA 3O95A 3G9TA 5ISMA 1YS2X 2EDCA 3L1IA 3WJ2A 1UWCA 4PO3X 1DX4A 4I19A 4XX1A 4J0GA 2OQIA 1Q0RA 3WKBA 1W75A 3BL8A 5D3ZA 1DT3A 1GQRA 5ALOA 1G5FA 3QYJA 4NVRA 3WZMA 4X92A 2XMQA 1VXRA 2FUKA 2XMCA 3HABA 3FLEA 1DWQA 4I4CA 2QJRA 5F4ZA 3M83A 3T4UA 3M81A 3V1LA 5DLPA 3VKFA 1EB9A 3DL7A 1XZCA 3DOIA 4DMKA 4YASA 3STVA 1BEEA 4EY4A 3U0VA 3WKAA 1LPAB 4B81A 4HS9A 3W9BA 1EINA 2PU5A 4EY7A 2ZSHA 3QPAA 3V1KA 5A62A 1BU8A 3WI7A 2X5XA 1QIHA 1ZGCA 4QA9A 4UHHA 2WUGA 2PUHA 4C4XA 2CBGA 3H18A 3K2IA 2PVSA 4NS4A 2EDAA 1D07A 1A8QA 4C89A 1TCAA 1LBTA 1QIGA 2JGMA 4UHDA 3C8DA 1MU0A 4INZA 4AB1A 5JADA 4V2IA 4YK7A 1LNSA 2OXEA 2LIPA 1JMYA 5ALTA 2VEOA 4MWTA 3ZV7A 3F96A 3VXKA 2Q0XA 1UK7A 4KJXA 1DTEA 1TAHA 3WK8A 1ZJ4A 5DWDA 3H2GA 5EGNA 4E14A 1XZMA 4LHEA 1JT2A 2OCLA 4QE3A 4Z49A 3LIIA 1BEZA 4UBMA 1XKLA 4OB8A 3RKSA 3DS8A 4QDZA 4H7DA 3H0CA 3QPDA 3U1TA 1E8MA 3AIOA 4BCCA 4BAUA 5CH3A 3RARA 3O4IA 2XUJA 4QDTA 3P2MA 3IB3A 4UUQA 1A7UA 2CJPA 4OPMA 2XUGA 3CN7A 4C87A 4X00A 5BOVA 3WL6A 4UBNA 3ESDA 3UUEA 4UPDA 5BV7A 3L1HA 5FPPA 3DD5A 4Q34A 3F67A 2BGNA 3R3ZA 1QIFA 2WFLB 3IULA 2XUIA 2HFJA 1EK1A 1XQXA 3TEJA 2ROQA 1QOZA 3GUUA 5EIHA 5A7GA 5AKEA 1SC9A 5JATA 4MYDA 3I28A 5JYCA 2HADA 5FPQA 4LXHA 1Q0ZA 1QZ3A 3B5EA 1FFDA 2B4KA 4UHFA 2XQKA 4DMFA 3WWDA 4FNGA 2B20A 3HYSA 3PDCA 1L7QA 4BAZA 1AKNA 5ALUA 5SYMA 3ILSA 3VJMA 1ZIYA 4N5IX 4FKBA 1XZHA 1PV1A 1CUUA 1K5PA 3ANSA 2HA5A 1QFMA 1P0QA 3G7NA 5J3JA 4X3CA 4BC1A 3C6XA 4Y9SA 2YXPX 3D3NA 1OXMA 3LP5A 4J0HA 1BCRA 3STTA 1YS1X 3GBSA 4Y2SA 4K6KA 5CBKA 3V48A 4WCVA 2WJ4A 5JD6A 4KYVA 4PF1A 1EH5A 5EHZA 1CUDA 3R3XA 4DNPA 1R88A 1A88A 2VA9A 1VKHA 5CH5A 4A23A 3VISA 4KACA 1XZAA 1R9MA 2XUPA 3H19A 3NWOA 1CR6A 2HIHA 1THTA 5JAPA 4OD0A 1GXSA 3QMMA 4K6GA 4JYMA 4RE6A 1WCYA 1HPLA 5IH7A 4GI1A 3I1YA 4DTCA 3IURA 1O6FA 4D9JA 5JARA 4L0CA 2EEPA 4WDQA 4B7ZA 3EBLA 2VQ6A 3ED1A 1ISPA 2WHPA 1W76A 4U2DA 4BVKA 2ACEA 3G02A 2GYUA 4G8BA 3WA7A 3WQHA 1VOTA 4CCYB 3H1BA 3D7RA 1Q84A 2QMQA 4C6HA 2R11A 2DCMA 5ALWA 1DWOA 5A7FA 4G1FA 2IIVA 5ESRA 2ZYRA 1ETHA 1H2XA 4B0OA 3OM8A 4C4ZA 4BDSA 4B83A 4BZWA 1CQWA 5K3FB 3KD2A 4BP8A 1YAHA 4W63A 5C8VA 1WHTA 2DFPA 2ONCA 3HC7A 1BN7A 1GPNA 3LIPA 1W52X 2ZYSA 2OLEA 4J0IA 3WYNA 5AKZA 4MXDA 1AGYA 2QXUA 2DHEA 2RHWA 3OTQA 3DJYA 2XUKA 4M0EA 4MWSA 4Y2JA 2Z5GA 1F0NA 2JF0A 2JGFA 1MPXA 4QNNA 3B12A 1T2NA 1OCEA 3B3QA 6YASA 3G0IA 4J0KA 1XQWA 5ALMA 1XLUA 5LZ4A 4IO0A 2X8BA 5AI5A 1X2EA 5AOAA 3H1AA 2XE4A 2FJPA 1CIJA 5JAOA 2QM0A 1QIIA 3H04A 2QJWA 1CPYA 5FUMA 5D7BA 4C4YA 2ZJFA 1JJFA 5KWIA 1X70A 4Y2QA 1AZWA 1K63A 4MJ3A 1JU4A 1QTIA 1USWA 4Q05A 3WMRA 1JJIA 4K6HA 1CUAA 3FAKA 4BRSA 2J4CA 3R3YA 4EB0A 4EY5A 5HKBA 5JASA 3FYTA 2VT7A 3AFIA 2AJBA 3V9AA 4OU4A 2XUAA 4UHCA 4B9AA 2C4HA 3ESCA 2HA6A 2PPLA 3RK4A 5JAUA 3W9UA 1DT5A 1YASA 4AX4A 3LS2A 5HZGA 1UKAA 5LZ8A 3IIIA 1QIEA 1MX5A 4XVCA 5AK3A 5DJ5A 5AI6A 5K5EA 4HVTA 7YASA 4Y2RA 3ESBA 3STUA 5ALXA 5LIPA 2JGKA 2E3JA 4IH4A 1UXOA 4EBBA 5LLSA 1XLWA 1XZJA 4KEAA 3WK7A 1EA5A 5AI9A 2XMBA 3EQ7A 1O6GA 1KU0A 5LP1A 1T4MA 4FFWA 2JIDA 3AIMA 1A8SA 1R3DA 5ALVA 2OGSA 1ZOIA 5IVKA 2OG1A 3WWCA 5A2GA 3G9UA 3ZWQA 2JGJA 2WTMA 2PSEA 2WILA 5T4EA 4WFJA 4NMWA 3I6YA
chains in the Genus database with same CATH superfamily
3LX6A 2YV1A 1WB6A 2C61A 2ZBEA 4U0KA 5FL3A 4EG0A 4LXIA 4B0PA 1QHGA 4DA0A 1VRCA 1C4KA 2P6UA 4C05A 2SKDA 4LMAA 3KOOA 1CETA 1MOQA 1SQFA 1KEEB 1MT3A 2IA5A 3JATA 4KTVE 5IN5A 4TMVA 3WG9A 2WU3A 1XXHB 3HYCA 5JNUA 4WZBA 4OB7A 4Q16A 4V1CB 1PWYE 2IU4A 4Q6WA 4KGXA 4LGMA 3VOSA 4YPFA 1BS9A 1XBTA 4BNZA 3HE3A 3IKLA 4ID9A 4GLFA 5MHTA 1URPA 4UMVA 1T3SA 5E1OA 3LFHA 4JASB 3SC4A 1R6VA 4TKMA 4WPGA 1L4GA 1E7SA 1WR8A 1JLSA 1D4FA 1IEWA 4U9IS 1G2PA 1MB0A 1B3RA 1MA0A 2BM0A 2ORYA 3KAKA 5EZYF 3WYEA 3KXPA 4F38A 2CFTA 1DOAA 1JKMA 2Q7XA 4L2IA 3BD7A 1ML3A 3VHLB 5K0NA 5K3AA 1T2AA 3D7LA 4LAFA 5L3QB 1H2RS 1T2EA 5FBKA 3EAFA 3GUZA 4BP9A 1VCHA 4BMXA 4H3KB 1BXRA 2VYFA 3OKAA 3RSHA 1VHLA 4F5YA 1ODTC 2VF4X 4IKOA 3ZD7A 1MIHA 2H52A 2ZVJA 3JVVA 1GUDA 2XNKA 2VZ0A 3EEIA 1ATZA 3VPFA 2CLFB 1T9ZA 4K0RA 4EA6A 5JEEA 1RKVA 1F2TB 1K4MA 4LZWA 4X8OA 5A4DA 1QRUA 1YB7A 4J49A 4QOFA 5ADUS 2NYAA 1SCUB 3EVFA 4OFWA 1EFKA 4BGIA 5K2MA 1NVVR 3F5FA 3DB1A 4FOOA 3LKVA 2GCGA 3ILHA 2HDHA 3QVLA 4O6VA 3HXKA 1U2ZA 4CMAA 1WMEA 2O23A 4GPBA 3PVSA 5LQMA 1U11A 2IYTA 4IRXA 2O0JA 3A6KA 3EA4A 3KOYA 3OE7D 2C5BA 1XD8A 3DVAB 4ZO6A 3PC6A 1A8UA 2UU9B 4NE2A 2EF1A 4L28A 5F2KA 3LG2A 5LXTB 2NYVA 1E5LA 2E48A 4OQDA 2XKKA 1U2QA 1EUCA 1QQTA 2X0IA 1W4LA 1Z35A 1RWXA 5IJAA 1FK8A 1GTVA 5KU7A 3AOEC 3N87A 2PGXA 1QF6A 4ABYA 2D1FA 4F97A 1B2RA 1CJCA 1Q22A 4A0HA 5J4HA 1VL5A 2GRUA 1J49A 1P5FA 2ZT7A 3D1VA 4MI1A 1PV2A 4RZ2A 3ZKAA 3ITNA 2H57A 2I6GA 4OTZA 1MENA 3LT5A 1J5PA 3MD0A 4HRXA 4B82A 2VWGA 4B4DA 4E5DA 2P9YA 3CCFA 1Z2DA 2C00A 3U44A 5DCYA 1RSZA 1PR6A 4E08A 3QVMA 5EJIA 1AGRA 3Q8WA 3VYTB 1Y82A 4WADA 2VXCA 2KS6A 4IHKA 5TMEA 1CVIA 2GTHA 1ECLA 2P4HX 4IWNA 4JLKA 4FYJA 4HH0A 3QTBA 2Q4BA 1G5TA 2QW0X 1M1YA 1SB8A 1QRSA 3TE6A 4G24A 4RDXA 2QWXA 2RHCA 1FC0A 4DANA 1BFDA 2VP5A 2ORIA 1DCFA 3HB4X 4RV4A 4YAGA 1EUYA 1NRXA 3OU2A 2JEYA 1VA4A 4FFVA 4DLUA 4PXSA 5A71A 2VZLA 3E4CA 5CLHA 5C4GB 5AOCA 4WA7A 2Z2IA 4B6PA 2NTEA 3BJRA 5K09A 2F2TA 3T9AA 4GHWA 3B51X 4BRWA 3UMYA 1V1MA 4M88A 4P5DA 2CWWA 2R8ZA 1W9HA 4B5LA 1I24A 2J9YB 2JKYA 2RSLA 2OP1A 2BGKA 3JASA 1AUVA 1ZCBA 1ODLA 3B6KA 2FXIA 2V8OA 3ODPA 1AA9A 4YJGB 4Q3KA 3IGFA 3RSGA 3T9EA 5C34B 3UUFA 3ZTWA 5FFNA 3FNGA 4LECA 1RXSA 2ZT5A 2AEJA 3A1DA 3KJZA 1WG8A 3FYUC 1CQJB 4RX1A 1ML4A 3F78A 4Y1FA 2RFLA 3EGCA 4MNTA 1HG0A 4J94A 4AZ3B 4M21A 2RBKA 3E1SA 3OJXA 3W2EA 2RJNA 3FHLA 3UJ3X 1GYRA 1N4AA 2WMDA 3SN6A 4BNWA 3C1UA 3BUSA 5DLDA 5LQCA 3DVAA 4ENWA 3IFSA 3VU3A 5LXTA 1WCXA 1I2BA 1W59A 3I45A 2YVUA 1UKBA 1E3LA 1QBGA 1D1PA 1VLQA 2JFYA 2OHXA 3UJCA 3DDCA 3PD1A 4MVJI 4Q9NA 1GL7A 1XWFA 2BCEA 3FCEA 3DLAA 3F9RA 3FYCA 3LPAA 2YL2A 2QSUA 3IYLW 3ZDFA 2WIKA 2PPVA 2BHTA 1XEWY 3L05A 4JS0A 1CD5A 1G0OA 2YW2A 1RQXA 2FE1A 3CZ9A 4J8PA 4ERNA 1KR5A 2GJSA 4R71A 2BZ0A 4OOFA 2CF5A 5E6SB 1WS6A 1OROA 3V4SA 1Q7CA 4CNQA 1DC4A 5JAHA 3GL9A 4P4TA 3NIBA 4GICA 3RKRA 1ODCA 3PRJA 1TB4A 2G67A 4HFRA 1LDYA 2QP9X 2V3VA 4EW6A 1T10A 4AKHA 4AL4A 2QUIA 3PIRA 3SKVA 4HC4A 1S6YA 2G8NA 2GX6A 4MRSA 4BKQA 3AH8A 5JNRA 2YXNA 5AJWA 2H7YA 4D92A 4CKEB 3AW9A 1KZ6A 2CL0X 3SSMA 3ZCUA 5F76A 4FN4A 4BZXA 1CCWA 2COEA 5C3MA 1XIVA 3LF2A 4C0HA 1EXVA 4I55A 1N0UA 3K72B 5KSWB 1ACLA 2AX4A 2C9MA 2OHGA 2H8GA 3PX2A 4PC3A 1TA9A 1YKSA 2OHVA 1VE7A 4JC4A 2YINC 4GPD1 4X44A 4CR7A 4CUKA 2Y9MB 5KTMA 2VT6A 3JQFC 2IFTA 3I9MA 5IC4A 1XJCA 2L0XA 3K2BA 2FSFA 4JAVC 1X8LA 4P86A 3K15A 3MRVA 5J43A 2DLNA 1JIUA 1W0JA 1NSFA 2PK3A 3SFTA 1X7HA 1MT0A 3GH3A 4ZU3A 1RE0A 5K8VA 4X93A 5LDHA 5LNK1 2VWQA 4PIMA 4YJGA 2A2ZA 4JGIA 2R5NA 4GR4A 1Y6ZA 4Q4HB 4N48A 4I9HA 1JIKA 1CUSA 3OOSA 4JI1B 3IMCA 3N39C 4G1EB 4DRYA 4LZJA 4MZDA 1NBAA 3WO1A 2IY8A 3D31A 5DE3A 1CYDA 3C3EA 5AHXA 1O0CA 3GJYA 5AJUA 3T1OA 1CVLA 1Z33A 4F4JA 1LLDA 4AZ3A 5BVHB 1L4YA 2E4VA 5D5HA 3HB5X 3M82A 1J23A 1DEAA 1ORIA 1RRFA 1LPNA 2CV0A 3SOZA 5KVAA 2DR2A 1GPKA 1GPLA 1OX5A 3MG9A 3PWTA 2MSWA 1U28C 4XA8A 4RXUA 4DQDA 4EB6A 4PZ0A 2BGIA 4NEQA 3LYAA 3DCYA 1I6MA 4ZOAA 3UC9A 2WRZA 4LQCA 4TYMA 4PV7A 3TPCA 5EI5A 1MX1A 3P0EA 4WXHA 5GGXA 1O9HA 4CETA 5K8TA 3USCS 3X3HA 3H13A 1SXQA 4ABTA 2GZSA 2PXAA 4XCVA 4HDSB 1Y4AE 3OOJA 5IMSA 3GAMA 1VB5A 4UVIA 2XGJA 2Z9CA 5LMZA 3FPLA 4JA0A 4UOZA 4K86A 4O2AB 7MDHA 5TGZA 2WHRA 4OI0A 5KPJA 3HJTA 1P0IA 2C2HA 1VJRA 4XGQA 4B6FA 4RTNA 4I1PA 1D1SA 4B79A 1NJ1A 4X5OA 1I7LA 1K8QA 3AHJA 3CT4A 1PX2A 1IMJA 4PLHA 2J67A 1K7YA 3CNQS 1DDIA 1FXSA 2ONJA 1NWCA 4GPAA 5T41A 4YS6A 4JBWA 1VLHA 3KPYA 3TKYA 4ZAWA 4YO8A 4JLJA 2WAOA 4RJJA 2RKWA 3ICWA 1WU7A 2JI7A 5FV4A 3NYQA 3QPWA 1TZJA 3FMIA 5HZMA 2F9LA 4EFNA 4F3TA 2VDNB 3DQQA 3E9QA 3GLVA 1WXWA 4AMYA 4D80A 5C37A 3TXAA 3DYVA 3OQ6A 2FTKE 1X7DA 4OUKX 4OFXA 1E9RA 1FTGA 2PMEA 1JDJA 1I33A 4FGZA 3CLTC 2D5LA 3FSGA 1JUDA 3D81A 1ZGZA 2GPTA 1NATA 1COWD 1WPXA 3I8XA 3VNSA 3C7DB 4RTSA 3ES9A 4HZUB 2CHEA 3H7AA 5GMOA 4EX6A 2PL9A 3AHGA 3ZV5A 3T1TA 4RIFA 1VCMA 1UXGA 2XQVA 3CUSA 4ZCMA 1XALA 3PTLA 2HJHA 1PG0A 1Z6PA 1NURA 5ILOA 1AGPA 1O89A 2EJWA 3N74A 4ZRDA 4OGLA 5HDBB 4DF3A 3ITEA 1WJGA 3PHLA 2E4ZA 2HWXA 1IDN1 1SPXA 3WVNA 4BQFA 2H00A 1GILA 2WBLC 4XJVA 4RHCA 4Q4HA 4Q7KA 3I1IA 1XE3A 4NENA 4RFLA 3L0BA 4GI2A 4FOTA 4PAWA 1E8DA 4IZOA 3ZCTA 3KZVA 3W90A 1E7QA 1DC6A 2PBLA 2PJZA 1IHYA 3EA5A 1OBOA 1YR7A 2ADFA 2DTDA 3H8WA 1MTZA 2WDPA 3MILA 3HV2A 4EB3A 4MWCA 2I3BA 2LP4Y 4P6VF 4R2JA 4GZMA 3CTMA 1QYRA 2TECE 2X0RA 3HUTA 4BQPA 1PDWA 1WSAA 4QXMA 3IJPA 2DP4E 3HN2A 4A92A 1HE5A 3E9DA 4KPGA 4IFEA 4NMMA 3WL8A 3QFRA 3HZOA 4YRSA 1TECE 5DGCA 1EJ2A 2CXPA 2W6ZA 3NJRA 4UUAA 5BO5A 4LK2A 3VSEA 1W34A 2HNBA 2HIGA 4NWIA 4HB0A 4O4IA 2A7QA 3FAZA 1XVAA 2G1JA 2WUDA 2LXNA 3ZE2B 1M6YA 3HUUA 3R5KA 4KN5A 3SFZA 1TM3E 2AFRA 2ZG6A 3DMYA 1DAKA 2HL6A 1US8B 3Q3IA 4P98A 3W4JA 4E2ZA 2YH2A 3GLTA 3LCMA 3QQ5A 3WLJA 1IWBB 3L4BA 1DEHA 4REMA 4CCWA 2IH4A 1YI1A 1GV0A 2E0IA 2ZZMA 3Q7IA 1OV4A 1UFKA 2Y05A 2EX1A 3CPHA 3IOMA 4J0JA 4BNFA 4RJ2A 2C03A 1II9A 2Q45A 3GJ3A 1U3GA 2CF6A 3E2PA 1NBWB 4ZQGA 2D0DA 1G5QA 3DHNA 4GRDA 3Q40A 2XB6A 1VPVA 2X8JB 3MMNA 3OEHD 2NP6A 1FQOA 2BYTA 1LDBA 3N0TA 4LF4B 4GGMX 4KXMA 4G3XA 4CMEA 4ASUA 4DBLC 2Q2VA 3OT1B 3R7BA 3ZDEA 3EQ8A 1E2IA 4KQJA 2G25A 5IM4F 1A8PA 5GADl 1V3UA 1NULA 1I3NA 2J07A 2Z57A 3D1JA 1ZESA 1KH3A 3F5DA 2DC1A 4IQ8A 4P3OA 3LXMA 3OX2A 3Q0TA 1HGXA 2I55A 3ZCQA 3NOQA 3OF3A 5BYBA 4YGXB 4HT3B 4OHOA 2W2PA 4LOLA 1TVKB 2IIQA 5DNVA 4DM4A 2DFDA 1ZAYA 1H5QA 2QG6A 4G89A 1G8PA 5C32A 3COWA 4JI6B 2IHKA 2WP0A 3L0YA 5LQAA 1TT7A 3L7OA 3SGLA 5HILA 1HYQA 2PEZA 3NXKA 4UKDA 3M0EA 3O73A 4QC2A 1YS6A 5G02A 3UGTA 2YW9A 1C3JA 1YZLA 5CHYA 5HSGA 3T5TA 3NAGA 4P2GA 2JH8A 3GGOA 1GGFA 2BFCB 1V3QE 1IB0A 2FYTA 2GH1A 2XODA 4DA7A 3ROGA 3I9JA 2CY0A 4MV0A 3BAFA 5JAIA 1CUEA 2V3WA 3SAJA 1A7KA 4EG4A 5KSPA 3RIYA 5FKJA 4E2WA 3OQJA 4YJKA 1EXWA 3AYXB 3GCXA 3HVIA 2J3KA 5DXAA 4F2PA 1VE1A 2J4DA 1K5DA 3HCRA 4PX3A 3ULKA 3G1UA 2ZBRA 4X1YA 2C7QA 3LDUA 4H18A 4EARA 3UGQA 1ODSA 2OA0A 1I4DD 1Z28A 3D9QX 5DM60 4BN4A 2GCOB 2PUVA 1N1GA 5KTYA 1GADO 1V4VA 2PGOA 4NICA 3WLPA 4E5KA 3ZDXB 4BVGA 1KU6A 4UZEA 1I5RA 2CK3A 2HF2A 3VVBA 4JGGA 1NXVA 2MYPA 1BHJA 2XY4A 3E7XA 2XUOA 3BBLA 1ZQ9A 4WVFA 2WFAA 4MGZR 4M0PA 1A9YA 1P4GA 5HM6A 3EHDA 3FTPA 2V7WA 4PR3A 1UBGA 2HHJA 3EG5A 2C77A 3OA2A 3OFVA 4XQ9A 1W25A 3LHDA 1WZIA 2IXTA 3ADOA 1TKAA 5I01A 5D01A 4YXWD 3HGQA 4KFRA 1T2UA 1EEXB 3OPYI 4YJ2B 2SCUA 1KJ9A 4TLDA 1YH3A 4Y6OA 3S6JA 1UMBB 2R8YA 4BBPA 3RRMA 4B6JA 1SBCA 4N01A 1OXVA 3SX4A 5B58C 1E0SA 3HXLA 4RDIA 5IHXA 2RJOA 2SKEA 2X8JA 2FUCA 1JDSA 1L1QA 1U0JA 2ERXA 4J03A 4M89A 1ZVKA 4H4CA 5CW2A 2ST1A 4TWBA 3UJPA 5LP6B 4OJMX 4FE3A 1MX3A 3DT8A 1YKFA 2H29A 1R0BA 3OT1A 1A72A 4QGFA 4A2PA 1W8DA 4IH9A 4Q1DA 1MO3A 2P78A 2V9PA 4LMBA 5GZ1A 3EOAI 3HJGA 2ZJ7A 4GYYA 2QPAA 1FMFA 2PX2A 5TY0A 1DIHA 2GEJA 3II6X 3T7CA 3EQ2A 2AEEA 2TRSB 4URUR 1CBUA 1EWVA 5ALKA 2JDIA 4YFVA 1NJ2A 4X6UA 2QTGA 2OECA 3DNMA 3CLKA 4JLWA 3GFBA 4RKRA 4L4XA 3DPIA 3JQ9C 3R7NA 3BB4A 3RJ5A 3C3XA 4BB0A 3ZZ1A 4BPBA 4TSFA 5KS2A 5LQRA 2XBLA 2G77B 2WA2A 4LRQA 3SYRA 4US1R 1KQOA 1W0CA 3TGPA 4ZT6A 1P91A 4EFMA 2JJ2D 4D9IA 1M7GA 3EGVA 3GDFA 2WIGA 5MFZA 4X7MA 5AH0A 1B0ZA 3OZGA 4JNKA 4FGLA 4GOMD 1X2BA 1PD1A 4BFVA 4YEDA 3U4CA 1AQJA 5CK4A 4LWPA 2RK4A 5MN5A 4P3XA 3K35A 1M6VB 2O2ZA 1TXGA 4OYRA 2QXTA 4KXWA 5A0FA 4BE4A 4BTVA 1RAFA 2OHJA 3HADA 5K9ZA 2J5QA 4GFDA 1SK8A 3IVCA 1QFYA 4OBXA 3TQIA 1WDKA 2JCXA 3F4BA 2P3LA 2QROA 2WYHA 3E8XA 4OM7A 3G5UA 2FEXA 3AZQA 4CYMA 4DMHA 1F5SA 3AZOA 3NALA 1Q77A 1WHSB 2GCOA 3IQIX 5D5PA 1WCV1 2OEPA 4RZ3A 2CXTA 2O50A 4PN3A 3AR6A 1XMIA 5HRCA 4DC1A 3MT0A 2JCVA 2IOFK 3G59A 4LK3A 3O8QA 4O8CA 3TIIA 3WYBA 2O5CA 2Z3WA 3LECA 5ADWA 4QO7A 5EIEA 1G55A 1JA9A 1U7TA 1Y42X 3LA8A 3RFUA 4ALNA 3IS3A 3R0ZA 5JRDS 4R0VA 3G3EA 3TBFA 3RUPA 2W5UA 4DAOA 3R3JA 3EZLA 1Y7PA 4H0CA 1CEYA 2RAUA 4F2DA 4C4PA 1UQUA 3C3AA 4OMFG 4ILKA 3S1SA 4HXEB 4EDFA 1NQXA 1XRSB 1BOFA 1EFLA 2WB2A 1CFJA 3ILXA 2FMTA 4LEIA 3GRKA 1G2OA 2D0OB 3SYLA 4QGAA 2R1VA 4YJ2A 4TYWA 4OQPA 3UCXA 3PQ8A 1HDRA 3IAHA 5JVDA 5IVIA 1RJWA 1Q16A 1AKYA 2FF5A 1ZK0A 1K68A 2LV8A 4IZHA 4XWGA 1A97A 2WTNA 2CGEA 3NFRA 2Q07A 4F6RA 2RGEA 3KE9A 5I9TA 4ZI5A 1TJ3A 3PEVA 3MN1A 4FFSA 4L5YA 4Z9AA 3GA7A 5TLSA 1ITZA 2EYUA 2P2SA 3FBTA 3GMIA 1UFQA 5FA5A 2RGCA 1AKWA 4JJZA 1XFDA 3N0RA 1W93A 3NT5A 3UK0A 4BB9A 2XTAA 5DU2A 1D9ZA 4MKFA 3PC7A 1P3JA 1DJLA 3FPGA 3DEKA 4Q12A 3O8OA 1U6IA 1UH5A 5FXMA 5G4LA 3WY9A 4WBNF 5FADA 1XPRA 2Q3EA 2F1OA 2ZSAA 3V8BA 3CVVA 2RHMA 1QVAA 4BFYA 5TPWB 1GPYA 4BKMA 4TTJA 4HADA 3BYZA 4U9HS 4EY3A 1QWSA 3WC4A 1S8OA 4UATA 4MI3A 3M4ZA 3MJSA 4JYCA 1FTSA 1Y5NA 2XNJA 4ZVPA 4CG1A 3SFVA 3TNDA 2EKDA 2GLTA 2O1XA 4BJHB 3IPXA 2PJDA 2Y1FA 4U1RA 4B3JA 3DDUA 4US0R 2FPGA 2IOYA 1AQIA 1PJ4A 3KXDA 2JAHA 1PVDA 1E2BA 1JJ7A 5EZ6B 2FUG6 4OLBA 1LV8A 1JMVA 2XDWA 3U3XA 1DQRA 4PYIA 4DZRA 5JQGF 4RD2A 2FX5A 4FFBB 3F9CA 4RKWA 4RA9B 4UFNA 2ATCA 5EE1A 1KVTA 2AT1A 2PZEA 4F7DA 1GCIA 2BCGY 1RRMA 2CYBA 1DWUA 3NLLA 1WHSA 4OB6A 2WU0A 4HWPA 4JUDX 1TEVA 4YHBA 1ZRNA 1XELA 4DHWA 4YQFA 5JH7B 2VPZA 3RF7A 4BYMA 2VPPA 4QAJA 2IYUA 1LJ8A 2CLMB 3MGCA 3VR5H 1IG3A 2ONZA 1EX7A 2WD7B 4RL4A 3N5CA 3VPCA 8ABPA 2GUGA 2QS9A 2CLIB 1XXLA 3HNPA 5IC5A 1GYPA 1N6LA 1E2EA 1GZ3A 2HPHA 2IP2A 3AEKA 3SBEA 5CVTA 5JRZA 1CUZA 3KTAB 4HH3C 3ZI0A 3HLKA 3RRXA 4G07A 4TUYF 4YPOA 4DIBA 5MN4A 1PR1A 2EBHX 1J21A 4CODB 2CB9A 2HHCA 1SIUA 3TOVA 2CE7A 3EDCA 2B6NA 1FFHA 1OI4A 1UBEA 2FN8A 2YUTA 1NC1A 1GKKA 3IO5A 4MPDA 4DSAA 1G21E 3BIFA 3FPEA 3H9GA 3VSBA 3G7SA 5AKHA 3X1WA 5IVPA 3QWIA 4LW8A 5M29A 2XYPA 2A8YA 1T4CB 3D4LA 4P58A 3C3PA 4JY7A 3GXBA 4M9ZA 2AZXA 1DAIA 3P0RA 2CJXA 2PSSA 3TGWA 2GBGA 3SMVA 3NYWA 4QPZA 4I8DA 3FMFA 1O5OA 3NO4A 5E6RA 3BMOB 5KTNA 3R7WB 1SIOA 1ZH6A 2Y6VA 1Z75A 3WAKA 3QMVA 3FE2A 4TLCA 3WMGA 1XZQA 2HDNB 3PC8A 2JLWA 2PS9A 5FTKA 4FSDA 4H6VA 2GBFA 5HG0A 3W5AA 2AV6A 3BTVA 2VG8A 5TPWA 5WRFA 3IBCA 3N8NA 3WNQA 2Q3FA 3R3SA 5BNIA 1L7AA 2VP0A 4Y30A 1X7XA 2MMCA 2PMKA 1OXXK 4JBYA 3CGWA 2WF8A 1ORVA 4KLAA 3AVWA 4Z9XA 1LC3A 1I1NA 1P1FA 4Q3CA 2Q9UA 4MUJA 3TPZA 1GDHA 4P7KA 4ZVKA 9ABPA 2XOXA 3RQIA 5AW4A 5J1SB 4PSUA 1P2VA 3I92A 1C9DB 3GJ8A 2BFNA 4AZVA 2W6OA 4LKOA 5FPKA 1YV9A 1D0SA 4AJ2A 2FWJA 1J42A 2GN0A 1T24A 3MCAA 2GD1O 4N7RA 3TOSA 3TZLA 4KE9A 3JQQA 1W1WA 3SM9A 4OLFA 1KQPA 3MC1A 3P9SA 3ZXIA 2X8AA 3QW4B 3P94A 4RMNA 4X85A 2IYNA 3TB4A 2NU9B 3PL5A 2DBVO 4H7EA 1JGTA 1XCMA 4YBZA 4BWYA 2QUBA 2AC2A 4EX7A 5JI3E 5JH7A 3DLBA 1Q11A 2ZSUA 4Q37A 2FFJA 1RPTA 1STOA 4MGIR 4COKA 5KJCA 3I53A 2A0WA 4TZTA 2XNDD 4L6CA 5SY9A 3KKMA 5DXFA 4EPXA 1WPGA 3EHEA 1YC2A 1V2GA 3TJRA 4OSOA 3DTNA 4V0QA 3T3MB 2CLOB 3M70A 4GPIB 1EJ6A 1GU0A 1T35A 2TMGA 3JU3A 4O29A 1KE1A 2GCNA 3LQ4A 4MVCA 1D2HA 2GPNA 4X45A 1FS6A 3HR8A 4H6PA 3FCXA 4N0PA 4YAWA 4UPEA 2I6TA 3ZIUA 4JYPA 1KBQA 1TGVA 4YMHA 5G4KB 1DZIA 4K87A 4BU1A 4AY5A 5IJXA 1AUPA 4G0QA 3EUFA 4G0NA 4UXHA 1ZU5A 4CXMA 1UMCB 4I4LA 4OP1A 4RCVA 3K2QA 5AXDA 3TKAA 2JGDB 3KWJA 3VH2A 1LNZA 1EVZA 3B2QA 4LRYA 2J08A 1KH2A 2ZJ5A 3V2UA 1GKIA 1EFVB 3C14C 1JI3A 1T4CA 2YV3A 1XYGA 4X94A 4EY6A 1DXHA 3KV3O 2JAXA 3ESXA 4HK4A 4MA5A 5DFAA 3GFVA 1JFLA 1VBMA 4P82A 1C2TA 3BH7A 1HUQA 2P4EA 5K3DA 4IV0A 4KZPA 3BMOA 3EVDA 5DX0A 3ED5A 2EVWX 2N47A 1L5LA 3HUEA 3R5JA 3UG6A 5HF5A 1I7DA 2C4MA 1R0KA 4DXAA 4JJIA 3THRA 5JW6A 2D06A 1RADA 2ODNA 3RFFA 3DHYA 3T99A 5GONF 1A9QA 1F0PA 2P0AA 4LXUA 1DJPA 3OX1A 1U2GC 1W5SA 5DTRA 1YHYA 2Q8QA 3QWFA 1AB6A 3H5VA 3GELA 5EKUA 3ZCXA 4UM7A 2HBZA 5ED0A 5GV8A 1G66A 2PBFA 2XNCA 3DW3X 4FSHA 4Z5XA 1V39A 3GPBA 1PDVA 2GRAA 4ZVMA 3WK5A 1JILA 2ZB8A 2J3EA 4Y1EA 4C01A 4NR0A 1KARA 3I8SA 4L8GA 3I05A 1XNGA 3GARA 3GEPA 5IX8A 5BWMA 5JCZA 1GRCA 1GOTA 1EDBA 2LD4A 2ZYUX 3LC2O 5EEGA 3HKBB 5AW9A 3ZIAD 2CLSA 4OSEA 16PKA 3NTQA 4NYIQ 3K9BA 4RZQA 2ZJAA 1MH9A 3QU4A 1PCXA 4IAOA 3WWYA 4UCQA 1RRVA 4E0BA 3B7GA 3MCVA 3RVQA 1E59A 5I8WA 4EAQA 5K0EA 1K66A 1TMOA 2A9JA 3DE2X 3GEMA 3DE0X 5COQA 2JARA 1IBRA 3D2LA 3F6CA 2QLNA 4JBXA 1XL0A 3TJMA 2WDZA 4DR6B 1IVYA 1VKJA 4YLEA 4XWAA 1IMOA 2IZZA 4GKVA 5EG5A 1Z82A 1RYYA 2OC9A 1DDOA 3GFFA 5JS7A 5KHOC 1S4MA 3L82B 4FE7A 3F73A 4A15A 2FG7C 4H4EA 3D6FA 2YV5A 4XIYA 2J85A 4Y18A 3I32A 3K16A 4RDHA 1SKYE 5E3IA 2EZUA 4U9UA 2QV7A 1DJMA 1UJCA 2VQ3A 2C95A 4KL8S 2QTWB 5JBIA 2KB0A 1E3EA 3P9CA 3PICA 2HQSA 4MEJA 4AMVA 3ANYB 1K88A 1VIMA 4NK4A 1U9IC 5EC8A 4BEJA 1AURA 4CM4A 2DMRA 4L16A 4L5IA 4L4UA 2RE8A 1Z8FA 1B6GA 1RQNA 2H4ZA 2IHBA 2ZW9A 1DC7A 3I2GA 3AEXA 3EEQA 1YL7A 5C80A 3AXSA 1ZJ6A 3VQTA 3OFKA 1Y0BA 4NFHA 3VNUA 1GGVA 2WQZA 4FFDA 3FMGA 1TUBB 3WLQA 3O3NB 2GK6A 3QUSA 3ESQA 3BCRA 4WK4B 1A2QA 3CLUC 2V55B 2HA2A 4ZVSA 1YHZA 2XXAA 1LW7A 3GRUA 4KIGA 4DBVO 4BP1A 2BD0A 3O38A 4X9XA 2I1QA 5HFJA 2YYYA 4BFCA 4BZZA 4D3ZA 5KNDH 1BVYF 1EFVA 1JYFA 2FW7A 2V45A 3GT3A 3HP4A 4LWZA 4P3PA 4K05A 4W6QA 1AC5A 4BVLA 5DW3A 4MVJD 5JMPA 5FWXA 5IJWA 1YOVB 4GDMA 2UZAA 5FA6A 3VTKA 3BMCB 5ERGB 1XPJA 3CN9A 3QFFA 2JB9A 4FNAA 1V7CA 3UHOA 3IAS1 2B30A 5REQB 3ZWWA 3I3OA 2YOFA 1UODA 4BNMA 5CLFA 3NDPA 2FHPA 4Q3LA 4ZVRA 1L8LA 3EVAA 3PGVA 2GBLA 2XF8A 4XPIB 5J4LA 4LTNA 4I1UA 2DHRA 2H54A 4CEHA 1SUWA 3HCAA 2C4VA 1P61B 1VI5A 3IUMA 3FDJA 1PR2A 3UFXB 3FHTA 3CO0S 1YK1A 1E4EB 3FNIA 4XLLA 5CDSA 5ICEA 2HPZA 1AKRA 2VF8A 2PKEA 2IYLD 3KEGA 4EHFA 4F86A 1V6CA 1GZUA 1XD2B 4ESEA 3WLAA 4GMXA 3O93A 2IHNA 1Z39A 3EEBA 1SKMA 5CXUA 3RSCA 5EWMB 3SZ3A 2ES4A 2ZS7A 4AFNA 2VLBA 1R5JA 4A0GA 1APBA 3TW4A 5TIIA 1UZLA 3OSUA 1PYGA 4N3BA 1AUOA 5CT4A 5SZIA 4F3YA 3LL4A 1IY9A 2XGGA 3GUCA 2I87A 4C4TA 1PF7E 3THYB 2XDQB 3BF8A 3AP1A 1XPUA 4ZVVA 2O1SA 2WM9B 4YJHB 4OKNA 4Y2UA 2X2EA 3AINA 5KNBH 2P7HA 1QV6A 1U2RA 5CCDA 1U7WA 1P1HA 5F78A 5LXTF 3WTCA 4ZC1A 4RQTA 1NDQA 1YTUA 4HXFB 2V59A 4I6EA 4XFDA 4EO7A 4DABA 1D2NA 4WGGA 2OGWA 1PZXA 4PG5A 5E4FA 1RWPA 2EG5A 2ZATA 4TVKA 4W7IA 3VHQA 4AXXA 4I50A 1C30A 2R79A 1VCOA 3DL2A 5BSVA 2BFAA 4MSUA 5NLLA 3LF1A 3Q87B 4EYOA 2AKAB 5AJTA 3W9SA 1BGWA 1KVUA 3B1VA 5CFMA 3DGEC 3KELA 1KS9A 1MO4A 2OBYA 3BB3A 4XM1A 3W5BA 1IZZA 1TYZA 4FILA 1GP2A 1YMVA 2R87A 3FH0A 3D5TA 1KFJB 3G5AA 3KDSE 5LYYA 3RKUA 1VSQA 4DREA 4XM0A 4K88A 1ESEA 2GPWA 3P8ZA 1MJNA 3RIGA 4AY2A 1DPGA 4UHEA 4QHTA 2YZ7A 4CFYA 4DIFA 3DBIA 4P8RA 2C2GA 2WWXA 4TYNA 1GPUA 4QBGB 4EZIA 1W4AA 3DOFA 3R3WA 1EFUA 5B1DA 5F5NA 2D2IA 4TTIA 4UQPA 4LZZA 3BMCA 5DHTA 2VDQB 5DVZA 5JWRA 1W4BA 4FNMA 3C39A 2ON6A 4TPKA 3EFBA 2Q3CA 4QTXA 2JIPA 4FU0A 1YQWA 2LKDA 3TOZA 5JJIA 1R0ZA 3G85A 1JHVA 1N75A 1BMTA 1OT3A 2I71A 2XYHA 3IESA 2JH9A 3K09A 5J58A 2UUOA 5DHAA 2Q8NA 3FGNA 1W4CA 4ZTBA 3KHKA 3U7FB 2BKUA 4ZVLA 3EJWA 3AVYA 2VO1A 3FIJA 1DVRA 1L7PA 3H7IA 4FR0A 2ZIVB 3A7EA 3I2IA 3OZUA 4DLNA 1G3RA 4M7OA 1SBQA 3LDHA 1EHIA 1Z2NX 4WJLA 1XTZA 3REGA 3X0DA 5EWMA 2R8BA 4C4AA 4DA4A 5LZ5A 4X63A 5IXYA 4FTWA 4ZVUA 5J2UB 2FLWA 1R66A 5BNTA 3L46A 3NDJA 4Z6KA 1NSTA 1Y1PA 2EKBA 3I2JA 3OY2A 4GAEA 1FBTA 4HJRA 4P93A 2BZSA 4CI0B 1VHDA 3ZWYA 4C22A 2WKPA 3O4RA 1H66A 2XLCA 2PLFA 3LNTA 4FC6A 4ONEA 4LCBA 4R3UC 4QBHA 3OJ0A 4R1PA 2XDQA 2R0QC 1PFYA 1RQRA 2PRJA 2Y8EA 3R7LA 2VDVE 4DLSA 1CEEA 4PLTA 4MUAA 1RKUA 5BWBA 2Z1DA 3TIGA 2VJKA 1MC4A 3BSYA 1R5NA 2XIJA 4QIHA 5FUWA 4EUHA 5KOJA 1UOQA 1PU2A 5DGDA 3RRZA 4QQ8A 2O8NA 4Q4LA 2PZJA 3SBDA 1TIKA 2C78A 3AF5A 4M8SA 4BLTA 1FOEB 5I4BA 4CEJB 3FTCA 2Q41A 3I73A 5EHGA 5H16A 1UBTS 1E2KA 2HPAA 2NX2A 2QTBA 4R81A 4AF8A 5J23A 1RZUA 4TT8A 3VR5A 2IY9A 3FVVA 5H4GA 1E3DA 2F67A 3DTVA 2NXJA 4G0PA 3COZA 1V26A 3F74A 4K9DA 4F2GA 4KAAA 4ND8B 5KYTA 1RIIA 1ZI8A 3NVMB 1BG6A 4CIXA 3JWPA 4H59A 4UXIA 2V98A 3MWFA 1LVUA 2SICE 3CB2A 5HDQA 4AJHA 1SRRA 1YJBA 2IPMA 4L3WA 3GW8A 1YFJA 3AJAA 2ZREA 3BSFA 5T4HA 4LX8A 4KX5A 3OQOA 3T0GA 3HB1A 5K20A 3ZBUA 2LBPA 1KQNA 4UNRA 5F2NA 1NPYA 3HY4A 1RQGA 4UUOA 5T8KA 3BWCA 3VKHA 1PLLA 1U5CA 4ADSG 1N6RA 3DAHA 4L7QA 3ETCA 2RGNC 3N8KA 4FCVA 1H6DA 2VDWB 4CN9A 4P3NA 1VG1A 3K92A 2PRZA 4C6TA 4E5UA 1QFSA 5E9AA 4PGFA 4YVFA 1HDZA 1KK1A 1J6UA 4XUEA 1Z0KA 4ZVOA 5JSZA 2XMSA 1QPZA 2BJVA 2HT1A 2QN7A 3CUWA 1I7SB 1QO0A 4LI3X 4OL0A 2PH7A 1GQOA 2HLHA 5CFQA 5JIBA 4WZAE 1AN9A 1TKRA 3AKZA 1RYZA 3FPBA 1CULC 1NVUQ 4OOEA 4EFLA 3HN7A 3ZEIA 1UEJA 5IKEA 1A0OA 4UFOA 3M5CA 1XDZA 1IRXA 3RS4A 2AJ8A 2GF9A 4RNDB 1PFWA 2CXUA 1UJBA 2IODA 1GZ6A 5EINA 3L7BA 4CR6A 1G20A 4KRFA 1BXGB 1XRQA 3N3AC 2WV9A 4P33A 3BDAA 4F3RA 2P2YA 1YMQA 5J2UA 5BORA 1E2JA 1MB4A 1XZ8A 1YR2A 3RTAA 3UWSA 5FJIA 4D56A 3WLOA 3F47A 4B4OA 2C2KA 1R4AA 2H4YA 2QSZA 3A6GA 3C43A 4JODA 1HSOA 2VHEA 4X41A 1MNAA 3VTZA 2DGDA 5DF1A 3E7FA 3JD1A 4ZXPA 3ZV6A 4EYQA 5LKAA 3LM8A 3SWWA 3CXUA 3UT5B 3U7GA 2C84A 2A9KA 3LOUA 1U31A 2CN1A 4IP0A 4IX9A 1IHXA 4CI9A 2INGX 4Y0NA 5CM2Z 4URFA 1RI1A 4ARSA 4BMOB 4OHCA 2IYPA 1YR6A 2R3SA 4A0RA 3G0DA 5CDUA 4BYGA 3DZFA 5FBVB 4S04A 4ZJPA 1FP6A 2A0YA 3IDZA 4DTIA 2NU6B 2ZKLA 3ZGVA 4CEJA 3KQOA 3ZGOA 4UZSA 5JYEA 1E1RD 4O2AF 2GZ3A 2PG3A 1HDEA 3WISA 3LAWA 3UNXA 2ZRDA 2PNJA 4OHVA 4AMZA 1K6EA 4DW8A 4JQOA 5JZ9A 3D59A 3ECAA 1WXQA 2C8LA 1CUFA 3FLMA 4ND8A 3V80A 5AM2A 3ORFA 3VJKA 2SKCA 2NO5A 1VHQA 1G5HA 2ZAYA 1B6TA 2ZE7A 3ISTA 3WOVA 2ZS8A 4FX2A 3ICPA 4BLPA 4CKXA 4YRBA 2DERA 3CO5A 3DP9A 4AN4A 3OQHA 3HM9A 3D7SA 2AXPA 2BMEA 1CY0A 2VJCA 3NOXA 3OT5A 3W2IA 1K6MA 2BW0A 4EECA 2WSMA 1WKVA 3G2LA 3ON5A 4QPCA 3K8OE 5CGZA 5C8YB 5LZ2A 1OWPA 3HCWA 3K9GA 4C5BA 1CE8B 2G1AA 3JQPA 3OHPA 1GFIA 1N2CB 2AOTB 4UEWA 4YIKA 4LRUA 1XNQB 1XMXA 1JFFB 1FP7A 1Q1EA 2VDWA 3C5WP 2G4LA 5BV1A 4YCSA 4XARA 1TQHA 3DQPA 4AC9A 1GSAA 1GL9B 2AR7A 1DAMA 2VJDA 2OV6A 3L4BC 2ZBGA 3AC0A 1LV7A 1RM3A 1HOTA 3OZCA 3QVTA 4IQ4A 5AK5A 3FWPA 4NF2A 3RI3A 2VNKA 2XV1A 3OZBA 5EKTA 3E35A 3V1MA 2HWYA 3R7AA 3T0IA 4CDRA 5AKJA 5E95A 1U65A 7ADHA 2ZUSA 2OR3A 2BC9A 4ZREA 4JEIA 2H08A 3UB3A 1WNTA 4RD6A 5DDIP 5KNCD 1SXJA 1PWXA 4MQFB 1L5RA 1LPBB 1M0WA 3DFFA 1GO2A 4X71A 3R1IA 3E1KA 4XSVA 2ATVA 2F9FA 1BXGA 1U5BB 3PSAA 3U7EB 3ZHXA 1YVEI 2CUTA 1QPGA 2OVFA 1PUIA 1PQYA 2QRKA 3E5NA 3NPMA 3L1VA 4CMEC 1IBMB 2KSQA 3NG1A 1SUSA 4PX9A 2YZNA 2G82A 3KYDA 1OGJA 3P9QA 2IYEA 4MUNA 4Q4JB 4GP6A 3RYHB 3WGUA 5C1BA 4LZAA 3QNWA 1IYZA 4UNPA 1BE1A 1E6CA 4FIDA 5IBRA 2VWPA 3UT5A 4AS3A 4CPDA 5JFTA 1Q1QA 2FWPA 1NRWA 1P9OA 1YCFA 3GN2A 3N8IA 4JXKA 4UD2A 4YPVA 2R8PA 4AJ1A 4GSYA 3URKA 2BSQA 3SPXA 3WWEA 4OX9Y 3NTOA 4KO3S 1IQPA 1QCDA 4WRRA 4DYDA 1WEHA 4IHJA 4D0SA 4JOBA 3QLTA 4GBJA 3AIIA 5JZSA 5IN4A 1GKLA 1I10A 1Z68A 3AJDA 4G8CA 5DN6D 4GZ3A 3AL3A 2Y0CA 4Q9JA 3T5AA 1GTJ1 5HFNA 4UTPA 3U6KA 4LXQA 1F9AA 4U3JA 3AR3A 1UMDB 4UJ3A 1DCTA 4REOA 1USKA 2FPIA 5IC6A 4DUZB 3U16A 1Z6QA 2PO5A 3MZ0A 3D64A 4Q02A 5BUSA 3BHIA 4CIWA 1HORA 1ENPA 2K2QB 3JZMA 3U3DA 3O9MA 4UFPA 1W1IA 3G2NA 4MB6A 1V9SA 2AHOA 3D6MA 2QVBA 3K5PA 4YRLA 2R7KA 3LQ1A 1ZPDA 1MX9A 1NIJA 4I14A 5I9BA 2P90A 3QEMB 2Q5FA 1W8IA 3UA4A 4DIKA 2AR0A 4WT7A 1W5TA 3T1NA 4ZPJA 4RV5A 1CE8A 1HI9A 3LX4A 1Y37A 1P1RA 5KNDA 2AOTA 3DA8A 5CK5A 1M73E 2X1VA 1JFFA 2WP8J 3CX6A 4BUZA 2QTTA 1GGHA 4BXOA 3D02A 4MVJG 3PLNA 4N3CA 1GT91 3BE8A 1HYHA 3O2NA 4FD2A 2GAFA 4PHFA 3WBBA 1IIBA 2HLNA 3ZDZB 5EWJA 4MYSA 3V7YA 4Z7NB 2HF7A 2AFIE 3NUZA 1GNVA 4ACBA 1TQ4A 2VNHA 1FLVA 1NG1A 3AEQB 2DYKA 1IOWA 4AF7A 2V7QA 1HEYA 1VGRA 1JYSA 3GC6A 4XQGA 1U7OA 4B75A 3OOHA 2O2HA 1TRKA 3Q3JB 3UMCA 5EP4A 1M2EA 1POWA 3SVTA 3FYSA 1WQ4A 3TNYA 3DM9B 5JNWA 4PQEA 5K0BA 1D2AA 3D6AA 3CLTD 3KHUA 4YH1A 3BGVA 2XGSA 3I04M 3LHKA 4MLZA 3TQHA 3TTTA 4E5YA 3CSUA 2R5WA 1UMKA 3X2FA 3C6ZA 3TLKA 4B3GA 2J3IA 2WG2A 2QMEA 4QU8A 1T2DA 5IW8A 4HI0E 2EL7A 3LC7O 3V55A 1IXZA 3T1YB 2WTEA 1QMGA 3F6SA 1RAGA 1NFFA 4J7AA 5KHAA 3WKEA 3KV1A 4X97A 3U4DA 5CYOA 3HBNA 3I23A 1YD7A 1LBIA 4P9NA 2E5FA 1ZXBA 2I3DA 4Q4JA 3U4AA 4ANFA 1ZHOA 3GK3A 3EIQA 4EHBA 1P8JA 3OCCA 1PHPA 4GEKA 2VJLA 2BEJA 4E2XA 1DI0A 4GKAA 4W6ZA 1PT7A 2HV9A 1PGJA 5EY5B 2YJTD 1PVOA 1EZZA 2HJRA 2YWGA 1XQVA 3TNLA 4I7EA 2PL5A 4Y67A 1NXSA 4ZQFA 2OFOA 3I62A 2COUA 4ROTA 3AW8A 3SIPA 1E99A 3TX2A 2HRBA 5I5EA 4Z53A 1U4OA 3OMWA 1Y81A 3CQ9A 3A11A 4JELA 4HNUA 3A9WA 1TU4A 2FPPA 1XZKA 1VJDA 2IU6A 1OZ0A 2X77A 3VO2A 3DXFA 3WYAA 2ZUFA 4F4UA 3A1NA 1Z5PA 3Q3CA 3O95A 4N47A 2F8MA 3THSA 3L8DA 1CY6A 1U99A 3EWIA 5KMGB 5ISMA 3Q0EA 1HYGA 1YS2X 3U2QA 4D26A 2NVUA 1SBTA 1XVLA 3L1IA 4P5EA 1S96A 3BRSA 4Q3AA 4TQUS 4YJ2F 5DCWA 5J5AA 1VL0A 1L5WA 1I3LA 4XX1A 1CZRA 2IU3A 5AVYA 1R4MB 1FUEA 4IX1A 5JVDF 5CW1A 1Z25A 3KLMX 3O7MA 4LHSA 1FYVA 1QHYA 2IVZA 3GAFA 1W75A 1KJYA 3CH7A 4KQMA 5E8JA 3EGOA 5KX5B 3ZCSA 1O08A 2F3RA 1ESNA 5D3ZA 4JI5B 3QEMA 4DSUA 1J2RA 1FFWA 1WDTA 1XVUA 3AVQA 3SHQA 5LP6F 2BR4A 2NO6A 1DCKA 1T9CA 4JLAA 2OBFA 4MR9B 3VR4D 4BJ5A 2WIBA 5LWHA 1T0IA 5AVQA 4KDEA 1G5FA 1O97C 2AYXA 2FMHA 1HDGO 1C4WA 1Q6YA 3G2OA 1PJBA 1W2GA 3GWZA 4JLPA 4LVNA 4F4CA 2YIJA 2HBRA 1Q0TA 1OLUB 4GWKA 3V4ZA 4G5RA 2RHRA 3P26A 4YRQA 1W96A 2C8KA 3K9QO 1NBOA 1KEKA 1VXRA 1LB1B 2AL7A 3FLEA 2CHGA 9LDBA 1YU9A 4BKUA 2QRPA 1DWQA 4DADA 1J5XA 3OZIA 3OT4A 2IE0A 3UH0A 4BFSA 4EL0A 4Q1AA 1JR2A 1Z83A 2VF5X 3AWDA 4LJ9A 3KWLA 2H4FA 1X0XA 2YZ2A 4JQZA 4LQLA 2ZPUA 2ZAOA 3T4UA 2ZRHA 1VECA 3GGPA 3VUEA 1RBZA 4DY6A 4MVWA 1EWYA 3M81A 4JKYA 4HF7A 1N9ZA 1G5IA 2O8DA 1ZUIA 2VQSA 3HU3A 4KLRA 3GBPA 4WBSA 1E5XA 1YS9A 4KVAA 5K0TA 1XZCA 2EQ5A 2Z4TA 5GAJA 1QZZA 3G1WA 4A91A 4DMKA 2QTCA 4QYIB 3UF0A 3TFQA 4B4VA 3ZWPA 4QXQA 1FYXA 1JR3E 2WSBA 5DPMA 1EVIA 3PEUA 3V4PB 2ZZNA 1Z06A 3S8MA 2OORA 4Z4HA 2CL6X 4RQBA 3UBMA 4NZ9A 3NHYA 2F3PA 4RQUA 1LPAB 4KG7A 4QGHA 1AHHA 4AK9A 1RLIA 4OAOA 5JQWA 1A8IA 2ZR9A 5AFSA 1WB9A 4XWYA 3DEHA 1BC5A 2PU5A 4UAUA 4DCJA 3BMNB 4D9GA 4EY7A 2GZHA 4N49A 2AVNA 1A8HA 4LJYA 4CF5A 3IQFA 5CLIA 3ZJTA 2A4MA 3KJNA 2VCHA 4NPAA 1KMHB 1HDXA 3V1KA 4QO8A 4XFJA 4BO4A 1W19A 3S2GA 3TL2A 5I5GA 1U7UA 5KB3A 1FP4B 1KE2A 2H1FA 1ZC4A 5BOSB 2O8FB 3AUAA 5G1PA 5KMGA 1VP9A 2WKSA 2PGIA 3T5DA 2X5XA 3QXCA 1UIMA 1ZGCA 2J41A 4L08A 3ELWA 3SD7A 1E9CA 4UHHA 3CF4A 5L3ZA 1OAAA 1M72A 2PFGA 3H18A 4QOHA 2PFKA 3G17A 1KC1A 3E3OA 3BL5A 3K2IA 3MQFA 3O8RA 1LX6A 2AFVA 4NCXA 5DHRA 1II8B 1D07A 4FS3A 3M4XA 4V0LA 4PTZA 4C89A 4ALJA 1PEYA 1XCBA 2Q50A 1WX1A 2C99A 2JGMA 1Z29A 2G5GX 2X1HA 4QEZA 4C6HA 4PO9A 1AOXA 4BNHA 4IS3A 3ZI4A 2G36A 4M9RA 1QS0B 4QXOA 2PL1A 4ICIA 3DR3A 5JXWA 3BXXA 4ZTZB 1RTTA 3QUQA 2PJRA 4AI6A 4WZBE 1X1SA 2VR1A 2IPLA 3P2JA 3KXIA 4HD8A 2BTOA 1LNSA 1ADYA 2QGFA 1KSHA 2G0AA 3I2YX 5JXHA 1OLUA 5K01A 1RNLA 2AZ4A 4N3NA 1C1XA 1I5OA 3EF0A 3BORA 4MWTA 4Q5IA 2JA1A 2VDOB 4RIIA 3KQLA 4IL5A 1KZ9A 3O26A 3G23A 1AF4A 1CVRA 4JJGA 3GZNB 1PBTA 2HH9A 5EVCA 1P1KA 1E6KA 3NKFA 3BHNA 3DMPA 2O3SA 2HKIA 4E14A 1Z88A 1VMIA 2VK4A 4FT4A 4QUDA 1WF6A 3EEOA 5EMMA 1T1EA 2OLKA 1QZTA 3SSNA 4UQLA 1E7MA 4KAXA 3DXYA 5CNMA 5IUJC 1NXWA 4URWR 1E3WB 2WVHA 2HR1A 4LNHA 5I7FA 1FDVA 1WUIS 2JJYA 1O57A 1ZN2A 3VR6D 1LY1A 5LUAA 1NQAO 2DWQA 3UC5A 4B3IA 4DPKA 4RSMA 4QYIA 1DG1G 2DU8A 4HGZA 1Q12A 2I2WA 3FSRA 3PC8C 4BU0A 2QU7A 4R2MA 5KKCA 2R6FA 1NXTA 5CH3A 2VNSA 1SKQA 1WULS 2OBBA 3KJEA 3O4IA 5JH7F 3NX4A 4QDTA 2QB5A 4F4IA 3D3JA 4NONA 3IVXA 4O1HA 3M3PA 1A5AB 1JEQB 3NS7A 3SE7A 2QRHA 4EMUA 5AJXA 2XUGA 3CN7A 1KMHA 1L4KA 1QYCA 1Q2UA 4C87A 1KJZA 4QUHA 1N36B 1MP0A 2Z30A 5BOVA 2J0UB 4NOJA 5F1PA 3GLFE 4IW3B 5L4SA 3EC7A 1N5IA 2H2AA 3M6XA 3LWNA 1RLUA 2I0FA 4QXRA 2A7XA 2A0FA 4YDRA 4N0MA 2P5TB 3TLJA 1LJUA 4GPZA 1T13A 5DYGA 1JDBB 1U7PA 1GG9A 4YDQA 1N0HA 1NQTA 2HK9A 2NSYA 3DD5A 3QX7A 4GM4A 1V4NA 4L27A 4COOA 4EA7A 3IILA 2ATXA 5DGXA 2EOAA 3F67A 4LC9A 6ADHA 3AQ4A 3MHPA 5K0FA 1KMMA 4RMJA 3ZHVA 3CW9A 1KQFA 2YWBA 1P5ZB 4JU8A 1YQXA 2PL3A 1E3TA 4HDNB 2ONKA 3KJHA 5E1DA 2XUIA 4N41A 2C3OA 4YR7A 3JTMA 3GUUA 1J25A 1QS0A 2D4AA 5ECGC 1N2ZA 1XXHE 5A7GA 1HT3A 1MQSA 2CVHA 5JATA 4BTEA 5JBQA 4C2UA 2L82A 4BNGA 4DOMA 2GERA 2H8KA 5D1HA 1YB4A 2V74B 1L4BA 2HTFA 2H06A 3I28A 3JWJA 4KQ9A 5EL0A 4NULA 4EKNB 1IFXA 4IDHA 4KR3A 4F56A 4D6YA 5F1OA 3C3MA 2ABWA 2PZFA 2RGXA 4KLZA 2N42A 4RV9A 1Y3DE 1SIBE 3TSYA 1UZMA 4UHFA 3ESRA 1KSFX 1Z9BA 2OK7A 1OFTA 2JPDA 4P2BA 3D8SA 1TK9A 2BRUA 3KR1A 3PDCA 4MV9A 1L7QA 2IEYA 5KNLA 1RCUA 1GGJA 1P7WA 2ZYDA 4DMUB 2BEWB 1QE0A 2O57A 3BHJA 5I7EA 1PZFA 2FWIA 3GT7A 4H15A 4ZALA 3U37A 5C4IA 1OKKA 1YZKA 5EESA 3C3WA 3O1LA 2A9VA 3FZGA 5TVKA 4DVGA 4EUNA 5I7WA 1K5PA 3FWKA 2YHUA 3FPJA 3P52A 3VHXA 3HBLA 5LFAA 4HQOA 4IRUB 4IDBA 3VO9A 3MS2A 1HWYA 1P0QA 4WV3A 5D3MB 4I5FA 3WZ2A 1TE2A 3SXUB 3HTXA 3EWSA 4X3CA 4BC1A 1GZSA 3E23A 1G8GA 2XW6A 3D3NA 4XLTA 4ENUA 1A69A 1R4NB 3RG2A 1BCRA 3ILVA 3UAWA 1BGXT 3GBSA 3WMXA 1IBCA 4AJJA 5IAOA 5KAMA 2RGYA 4K6KA 3WTBA 2J0UA 1XHEA 3PHCA 1NI5A 4BKRA 2N1BA 3D4OA 3V48A 4WCVA 2PGNA 3DNFA 3D43A 1N5OX 3MT9A 4Q03A 5BNFA 5KCMA 2OGUA 3UJHA 4EVRA 2XECA 4K46A 1IN6A 1N2SA 1TU0A 1X94A 4FGJA 3H5AA 5H3LA 5KDLA 1ZWKA 5JV5A 5G3YA 4C76A 4Q1BA 5I3CA 4KYVA 5L6LB 3EUWA 3PTAA 2EKPA 1KZ4A 2EWWA 3CJRA 4CG0A 3DMHA 4O0MA 3TFWA 3IQGX 2J5XA 4KDRA 4AAYA 5J2TB 1L3IA 3B85A 1A88A 2HC9A 2VA9A 3G5MA 2GYYA 1BXKA 4HDNA 1X7YB 4EOGA 2JAPA 2BE7A 3ABIA 4KACA 4FP9A 3VISA 2G9VA 4WN3A 3RAPR 2XUPA 5KJ6A 1PLKA 2I1LA 2WJWA 2RKOA 1U8AA 3C3DA 3D7KA 2Q1WA 3KQYA 4KIJA 4KWCA 4D0GA 1Q0SA 5BMVB 3S2EA 1L7DA 1RC1A 5ABPA 2YZMA 3PFHA 4QJIA 1T3GA 1LU9A 3BWYA 4QOGA 4CEIB 4IJ6A 5L9AA 2Z6AA 1KWKA 1HSZA 2P6PA 4RW0A 1DFHA 3WLSA 4C7VA 4D3SA 1KZYC 1MZPA 1HPLA 5DGHA 2E37A 5IH7A 3KHSA 2OOSA 3K5HA 1JVNA 1T5TA 3LXRA 3AUJB 4MPJA 1WLYA 4WWHA 2EQBA 3I9V1 4DTCA 3FTNA 1A7AA 2AOXA 3GNQA 1DPFA 1DADA 4OUDA 4UU0A 2VRBA 2PWYA 3UQZA 1YQTA 2C2WA 5ARBA 4B2PA 1KK3A 1NVWQ 2ZJ3A 3HWWA 3OX4A 2ZVPX 2EEPA 4Q7JB 1SA0A 2A0UA 1GCAA 1BX0A 1XMPA 2HLDD 3EBLA 3ED1A 3KJIA 2ZSDA 3A58B 5EFOA 1W76A 3USZA 3OY7A 1U2PA 1I80A 2IUYA 3JD0A 3W1VA 1PP4A 1XCGB 3TNFA 3ZLBA 3JSAA 3UHFA 4YT4A 1K2VN 4FZ3A 5JAZA 5A5EA 1XWWA 5JZMA 1NW9B 2FW6A 4MKXA 3ET5A 4K3UA 1HQCA 1GPMA 4TXJA 3W7AA 4JBHA 3WA7A 3K8ZA 3JZFA 3H3XA 2UKDA 3KR2A 2PUWA 4JEUA 5KQGA 3CPSA 1Q84A 4KBYA 1VJTA 4KWHA 3I5AA 4M9CA 4TLMB 1S3FA 5D3MA 5TPZD 3W7VA 1OVGA 4MRAA 1DWOA 3K70D 4DXDA 4EJSB 2GAOA 4OQNA 5LN1A 4GVXA 1TVMA 1PBNA 1VQ1A 3QKRA 5D2CA 1S0UA 1RJ9B 4DR3B 3UFBA 4W7SA 3Q8LA 2VXOA 4S1TA 2QL7A 1ETHA 4EIWA 1D4AA 5AVZA 2YNMA 1VFNA 3O4FA 2DLCX 2IYQA 3SNKA 4TRJA 2XJ4A 4CQMA 4KPYA 2PRYA 1D8TA 4BDSA 1GAQA 1NP7A 1ZR4A 2W98A 4JJAA 5LOVB 1Z4OA 4ZANA 3WGVA 4XQEA 3O21A 1KC3A 1ZKDA 2CFIA 3FCCA 1CQWA 3KKNA 1L7BA 3RWMB 2QBYA 2NQTA 7MHTA 4D81A 6ABPA 2BBTA 4JVNA 3DEZA 3S68A 3UXYA 1K8XB 3UMBA 3UKJA 4D9FA 1GPNA 4QATA 3TLEA 3RUAA 1KWGA 4BWVA 1H3FA 2WM8A 1F2DA 3MRSA 3EBPA 4KWTA 3L04A 4WKGA 3K0HA 4F3CA 2V6FA 1X7YA 2DFVA 3WYNA 4G67A 4CMIB 3DL0A 2FUEA 2QXUA 3IEIA 3LUKA 2DHEA 2DECA 2RHWA 4XOIA 5C5EA 3VPAA 1U0RA 4HQLA 3T5CA 5HPYB 1XF9A 4M0EA 4ZKEA 3UG7A 4E5SA 5CM8B 1XX6A 2C07A 2YR0A 2WV7A 4IFIA 3JRXA 4J0QA 1RM4A 4MK4A 4CEIA 1NVTA 2WVGA 1R37A 2BTQB 1KYWA 3O84A 3KTDA 1AKTA 4QNNA 4WERA 4WUVA 2HXSA 5A4AA 1OCEA 6YASA 1SCJA 3UBTA 1IDOA 1KVSA 4G0YA 1JZSA 1WLSA 3HDHA 4PAMA 2PLRA 2NN3C 3F4LA 2BGJA 3EISA 2HWKA 1TAGA 1ZUHA 2Y1DA 5EJAA 4J0FA 5CPBA 3IP1A 4RUKA 1V4BA 1ILWA 5LZ4A 4IO0A 5M5BA 2X8BA 3EYWA 4NCKA 4ZCSA 2JLUA 2ONYA 2J9GA 1X74A 3AP2A 3KPJA 4MWBA 4RESA 3S3TA 4H3VA 4MULA 1G7CA 2I22A 2XE4A 2OZPA 4N5MA 4DUYB 3C41J 3GD7A 1CIJA 4P34A 3VAYA 4R69A 2CXHA 4TL9A 1THZA 1VPEA 1XCLA 1Z5VA 1P77A 3C16C 3EOZA 1D6MA 3FCAA 4K8OA 2P1RA 2QJWA 2B7LA 4QARA 5GJCA 4DEYA 5JZVA 4M60A 4G63A 4HLUA 2WWIA 3MA0A 3BZWA 2EGUA 3DAPA 1XNHA 1V5EA 3K09C 1NT4A 5DNAA 3KZNA 5IUKC 5B6PA 3EARA 1JFSA 5BVGB 1UKZA 2DB3A 3WLEA 4KCGA 4RSRA 4FONA 4D4KA 1ZVVA 2RAPA 1KYZA 1YRHA 4QFCA 3TX6A 4C4YA 5JT1A 3NRCA 4BQQA 3QIVA 1DSSG 2D2XA 1RBMA 3TPFA 4EJSA 4EGQA 2XT6A 2DETA 2CLLB 1D2CA 5L3SA 1X70A 1Z07A 1RJ9A 2IEZA 4YREA 2O0LA 4CV0A 1K63A 1T5HX 2OSBA 3DNPA 3R0QA 3CINA 3JR7A 3PQ3A 5TMDA 2GWRA 3TAUA 1USWA 2MCFA 1KI2A 3WMRA 2G1PA 4KQ2A 2O6HA 1V3VA 2FZ5A 3LZ6A 2P91A 2QX6A 2YV4A 3E9NA 3IAAA 3FAKA 1JALA 1VLJA 2BFBB 1UT8A 3QX3A 2J4CA 2JLBA 2HHLA 4HZIA 1SK9A 1B8OA 3R3YA 2G1KA 4ITRC 4BNUA 5CDFE 3RW9A 4DG8A 1F4VA 2FMFA 1Q7BA 2ORED 2F62A 3IP7A 2ETXA 3MJEA 5HKBA 3NWJA 5JASA 1E1QA 1AQUA 3FYTA 4P3KA 2QD2A 2GA8A 2VT7A 4IJMA 4ER6A 2Q6VA 1HKUA 2I62A 4RXTA 3V9AA 3TAXA 3VZPA 1TTPB 2NT3A 1XLTC 2XH8A 4CN8A 3EVCA 4QYXA 2ORVA 1Z37A 1YNOA 2KMLA 4B9AA 5JO9A 4Q48A 3FOCA 1PJ8A 4NY1A 4ZYUA 5FTWA 2C5SA 4RL6A 3JQDA 3ZDQA 3TECE 3CLUD 1IJBA 1NUHA 3W9UA 3U9SA 1GRVA 1REQB 2UYYA 1XB2A 2XDAA 1CC1S 1E6WA 1MKYA 3EDRA 4HO1X 4AX4A 5EWLA 2AFHB 3LS2A 5EXXA 4AN1A 2Y3IA 1UKAA 5LZ8A 2LZ0A 3LUGA 4C7XA 3GJ4A 2P9HA 1GA6A 3UZUA 2HYDA 3PVZA 3QE4A 4PWYA 1A4IA 3HWSA 1IY1A 4NFLA 1RD4A 2V5AA 4RD1A 4PLWA 5DJ5A 3EXHA 1NF2A 2O5RA 3I01M 3CF2A 4KTTE 8ADHA 4M1KA 3T9FA 2QUZA 3T4PA 5IULC 5K5EA 3PQEA 4LE1A 3N2GA 5T8KC 3EVEA 2IUUA 2XEXA 1T6BY 3K5WA 3AU8A 3EDMA 4FHDA 4HVTA 4NDNE 2NTNA 4YP7A 5J2UF 2JRCA 3BWMA 2FQXA 4LRXA 4WXMA 1JI0A 3VJRA 1KDPA 1TUGA 1T43A 1JHMA 1VG8A 2F3TA 3A1WA 1O4VA 2VI5A 2OESA 4UNNA 3UOGA 2O52A 4GX0A 3VDRA 3LDAA 3OZ7A 5FNZA 4KQXA 2ZIEA 2QY9A 2WVJA 4Y9TA 1GHTA 2BDTA 3V3KA 3WK7A 3ONVA 2HCRA 4ZZ1A 4PRKA 1M7BA 2IBSA 2HN9A 4AMGA 3OMXA 3WQRA 3EQ7A 4N7BA 1GGNA 2C2ZA 3MINA 4XVRA 3RHZA 2B36A 3BE5A 2ZIFA 4DLAA 3B70A 2EL9A 3GDOA 1YZTA 2E55A 5LP1A 2WJIA 2L42A 3IHKA 3UXMA 2EX0A 3DVQX 3NC1C 2VAWA 3GYGA 3ZUPA 3DM5A 3ZY4A 1ZP6A 1Y6GA 1R3DA 1DEKA 1SUEA 1L7VC 4HQKA 4M8IA 3MS7A 3UGJA 3ZTYA 2GN8A 1Z73A 4E1BA