2O2VB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
total genus 22
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vB01
2KC1A 4TQ1A 2N4FA 5JZEB 4FA6A 3RZWC 5JH5C 1H4RA 4GU2A 2FCSA 1WF9A 3A9KB 3VH4B 4EOYA 4EFOA 1OTRB 2BGFA 4KVGB 1BT0A 5D7GA 3ZNHB 2DAJA 4FADA 2CHXA 1WXSA 1RLFA 2HD5B 2PE9A 3AU5A 3A4RA 3SU8X 1WR6E 2J0KA 2WWZA 3GZNI 1KOTA 1KM7A 1YQBA 2O6VB 4ZRJA 1M94A 2YVCA 3VFKA 2J0JA 2L0FA 2R2OA 2MCNB 1GC6A 4IWQA 4RM8A 3MTNB 3KYCD 5LLIA 1LM8B 4WWOA 1L2NA 1V5OA 3ZRFA 2GMIC 3PRMB 3CMMB 2KOXA 1WX9A 4FHKA 3A9JA 2KFKA 3ECIA 3PV1A 2N9PC 4GDLB 4AUQC 3Q3JA 1VCBA 3L16A 3R66C 2M4NA 2NVUI 2D2QA 3WA0A 2JZ3B 4JQWC 5CHFA 3O65B 3KUDB 2JT4B 2V4LA 2L8JA 2L3ZA 3RZFA 4KIKB 3ZO5B 1HE8A 2D11A 3VUWA 2NCNA 4FJVB 3JSVA 1UGMA 2DZKA 4M0WB 2HJ8A 4GMVA 4W9EA 5KHQA 1SGHA 1UD7A 1R4MI 2JWZA 1GJZA 2GBJA 2R2QA 4AWJA 5C1ZA 3CSFA 5EDSA 2CKHB 1WZ0A 3IVFA 2K6QA 1UELA 3DDCB 3IG3A 3LDZE 4ANVA 2LRUA 1YX5B 3KUZA 3M95A 1AARA 1GNUA 2D10A 3APCA 2Z0DB 3EC8A 4FBJB 1WX8A 3L17A 3R7RA 4DDGD 3L0WB 1CMXB 2BYVE 2RSUA 3ZDMC 4KV2A 3JYUA 3V6CB 1UBIA 2DHZA 3V62A 1V80A 3DBHI 4IUMB 3TJPA 2LGYA 3DVGY 2ZPNA 4HPMB 3ZUNA 1ISNA 4GN1A 4B9KA 1EF5A 3PRPB 4JGHB 4DHZB 4KSKC 3DVNV 2MLBA 2RPQA 1PQSA 5FR6A 3RYTA 2O2VB 1WR1A 5AZHA 4OVUA 3N3KB 2KKCA 4BVUC 2KFKB 3R3MA 2OOBB 3QAQA 4NNJB 2WX0A 1WMHA 2AL6A 3DOWA 3WAPA 5D94A 2KVRA 1G6JA 4K7WA 2CHZA 1WMHB 3H6NA 2L76A 4BFRA 4F1SA 3K9PB 4GIVA 4EUTA 1L7YA 1Q0WB 2LGDA 3DVNU 3WAMA 1WGRA 5CHVC 4MELA 4LDTD 2JRIB 2KTRB 4PS8A 4ANXA 2LI5A 4ICVA 1UZXB 4JLCA 2KZRA 3TBLD 3A33B 4AJYB 4NY0A 1F9JA 5CX3A 3KW5B 2YLMA 4K1RB 3UQBA 5TR5A 4MJSB 3PRZA 3RUIB 2MRPA 4ANUA 4W9DA 2C9WB 4DWFA 4GOCA 1WJNA 1J8CA 3PZDA 3U7DA 2QHOA 3QC8B 4XC2A 2KK8A 1E90A 3NS8A 3QX1A 4FLHA 4G50A 1WFYA 3MJWA 2MSED 1J0GA 2KANA 2K39A 5J2RA 4MJSA 3Q3FA 1TGZB 4KDIC 1YIWA 3AXCA 2FIDA 4HXDA 4J6IA 4BKSD 2A5UA 1SIFA 3ZNID 1EF1A 1S1QB 4EZJA 1E7VA 3B1LX 4HWIB 1V6EA 3ZDTA 2KMAA 2ZNVB 2K25A 4I6PA 3K9OB 3WANA 3L10B 4K7SA 3ZNZB 4OVVA 2KMCA 3RD2A 2PEAA 4PS3A 2K1FA 1U4AA 4X57B 3UIPB 3L08A 1OQYA 3AI5A 4IM2A 3W1SA 2KJRA 3APDA 5AEKB 4WAAA 2KJHB 1S3SG 1TTNA 1VD2A 4GGQA 2JRHA 3HIZA 1A5RA 3N30A 4MGKE 2KTFA 4HDOA 3PSEB 4AP4C 2Y5BB 2AYOB 4E3CA 1GG3A 1WX7A 2XK5B 3NHEB 2BF8B 5DPWA 4W9IA 3HHMA 2BYFA 2BKRB 3EECA 2M0XA 3WALA 2FCNA 3ZIMA 2O2VA 1MG8A 2FNJB 1V49A 2OJRA 4G11A 4W9HA 4E74A 3JVZX 4CO7A 1P9DU 4W9GA 5G55A 4BBNF 5LXHA 2BKFA 5JHBA 2FCQA 1ZKHA 4B95A 4DBGA 1NDDA 5JHAA 4W9JA 3SHQA 3I3TB 4HJKA 4KZ0A 2KC2A 3VHTC 2K8CA 3A9KA 3DBRI 4HCNB 2C60A 3R7QA 2J0MA 2O6VA 1XT9B 3PTFC 3T9LA 3RCZA 4DHJD 1H8CA 1WGYA 2KLGA 3PS6A 5CHWA 3VVWB 4KZCA 2JVCA 2KDEB 2PE6B 1E8YA 3PLVA 4WJNA 4TUUA 5KHOA 4WJPA 1RAXA 3C0RB 4IW0A 3LJ3A 2K8BA 1UH6A 3SDLC 4W9KA 1RRBA 1ZW7A 2KQ7A 1WM2A 2ZEQA 3W1YA 1WM3A 4JL9A 2LZ6A 2L05A 2MQJA 3DBSA 1EO6A 2KFJA 2MBQA 1C3TA 2G45B 3P2BA 2DYMA 4GDLA 4KIKA 4NAWA 3QJZA 2HTHA 1LFDA 1Q5WB 3EHVA 3A9JB 3H7SA 4FULA 4PYUA 2LXAA 5G2NA 1NBFC 4BKSA 2IY0B 1V5TA 2B3AA 4NJ6A 3VDZA 1LQBA 2FCMA 4PS7A 3ML9A 1WYWB 2DX5B 2AEHA 2I1KA 2J7QB 3PVLA 4GDKB 4IM0A 4MSMB 2DZMA 1K8RB 2XBBC 4ZDVA 1YD8U 2ZVOA 3L13A 4LDTB 2KDBA 3PHWB 3M62B 4II3B 4IG7B 2Z0EB 2KD0A 2ZJDA 1WJUA 2BPSA 2L0TA 1NI2A 2MA9B 1WE6A 3WAOA 2LASA 1WXVA 3B0AA 3A4SC 3PREA 4W9FA 4EKUA 2KXJA 4PYZA 2KX3A 4KSLC 5E6PA 1WRDB 3TIXA 1TBEA 2KWUB 2MW5A 3A1QB 1Q1OA 4WJOA 4F7ZA 2NR2A 3MHSD 3D32A 2LVOA 4I6LB 4BOZB 1V81A 2LVQA 2DYBA 2N1VA 3IHPC 4LJPB 3VUXA 1V86A 4FJYA 4HPLB 1RFAA 2L00B 2CHWA 4NPNA 1WY8A 3H9DA 3OJ4B 3VXWA 3RULA 1V2YA 3QA8A 2KJ6A 4IWOA 3VQIA 4NQLB 2BWFA 2V1YA 3NZUA 2O6VD 3B08A 3VTVA 1Z2MA 1WIAA 2MP2B 3DQVA 1D3ZA 4G0NB 2MBHA 4ZRKA 2LGXA 5E6NA 3IFWB 2IO2B 5IAAC 2GBMA 4URKA 4E71A 2PJHA 3IBEA 3PHXB 4P7IA 1WZ3A 2G3QB 2N9XA 2ZCCA 1P1AA 4MH0E 2DZIA 5AZFA 3ZRCA 3VTWA 2G4DB 3PPAA 4MGIE 1E8WA 3RT3B 5BO4B 3VAWA 4F8CB 3UGBB 2GBKA 3TL5A 1Y8RC 5IA7A 4GB9A 4MM3A 1V9JA 3KH0A 4NJ7A 5GMVA 3T8MA 3ZLZA 3DBLI 1WI0A 2LJ5A 2KHWB 4JIOU 4MEMA 5L95C 1LXDA 2AWTA 3ALBA 3JW0X 1KJTA 1OEYA 1OGWA 2LXCA 2A4ZA 4I6NB 3ZTCA 2UWQA 3V60A 2I1JA 2XEWA 3ENEA 3V6EB 2D3GA 2KNBA 3X0WA 1E7UA 3H7PA 2NBUA 1WH3A 2ZPYA 4EZKA 4LCDE 3W1SC 2KWCA 3WIMA 4CHKA 4GXBA 1P3QU 2L7RA 1R4NI 1XQQA 4A3OA 4HVBA 4BOSC 1WE7A 3H1UA 3TCAA 1OEYJ 2NBWB 4DK5A 2HE7A 4GSWA 3CF6E 4GDKA 3KUCB 2EMSA 2IY1B 2KQSA 2M8SA 4A20A 3ZNGC 4ZYNA 2N9EB 3N32A 3APFA 1TZ1A 4HLEA 2ZCBA 2LWPA 2KWVB 3L54A 4WWPA 2FAZA 2LRWA 3ZVVA 4IM3A 3S2AA 4XZ4A 1IPGA 1WGHA 1GUAB 2K8HA 2N7DA 1KLVA 2BWES 4ANWA 5J18A 1X1MA 1WGGA 3QARA 4KDLB 3DCGA 2CR5A 2MBEA 5D2MB 2W9NA 2DYOA 3OAWA 4DHJB 3U8ZA 5L83A 1EUVB 2JZZA 2DZJA 2JPHA 2REXA 3SD5A 3VH3B 2MWSB 4AOFA 2BYEA 4FJZA 4BKGA 3EFUA 1FXTB 3BY4B 3DVGX 1WJ6A 2GOWA 2ASQA 2FUHB 4M8MA 4M8NA 1E8XA 2N7EA 1I42A 1YX6B 4RMAA 3QCAA 4EZLA 2KLCA 1SE9A 2Z59B 4ZRIA 3JSVB 2IO3B 4ICUA 2GBNA 3GOEA 2JY6A 2IZVB 3ML8A 4IC7B 2N1WA 4MGYE 4TV3A 3QQ8B 4K7UA 4MGZE 1YJ1A 1IP9A 4N9F4 4FN2A 2LVPA 2KDIA 4NAWB 2NPTA 5LXIB 4WWNA 3CSTA 2C7HA 1C1YB 2NPTB 1J19A 2JXXA 1P0RA 2M1MA 3ONSA 4XX5A 5CTRC 4BBNC 2ZVNA 3UF8A 2DENB 3HK0A 4W9LA 2IBIB 3UIOB 3PGEA 2RD0A 3H7PB 1JRUA 2LD9A 4WJQA 1I35A 5J17A 1WGDA 2KX0A 4II2B 4MDKE 4MSQB 3PT2B 3A1QA 3QWZB 1Z5SB 2JF5A 2WX1A 1UBQA 2CS4A 2IO1B 3QK0A 2C7NB 4WQOB 2EMTA 4DHZE 5E6OA 4BKTA 3AULA 4IWPA 3OLMD 2CU1A 4HCPB 2ZZPB 2NS5A 4G3XB 4LJOB 1WXMA 3V61A 1GC7A 2NBVB 3QHTA 4HDQA 3VTUA 2MBOA 2WYQA 4ASWC 1WJ4A 2EKEC 2GBRA 2RGFA 3KVFB 5DPTA 4RM9A 4CYEA 3X23A 2JUOA 1E8ZA 1ZGUB 4EEWA 2MBBB 3VUYA 2AL3A 3M3JA 2DAFA 2KO3A 4DXAB 5D6JB 1P98A 3QIJA 4AJWA 2C7MB 2IO0B 4YL8A 1QZEA 2VRRB 2MP2A 2UYZB 3U30A 5DPRA 4DDID 3ZKJC 3M63B 4A3PA 2IYDB 2KTRA 2RR9A 3BINA 3NZSA 3OJ3A 5HKHA 3UQAA 5DCNA 3ZTDA 3NY5A 4FHJA 3KYDD 4NQKE 2PPHA 4HK2A 2G4SA 5DPSA 2XK5A 2V3SA 2WDTB 4TKNA 4TQ0A 4W9CA 2D07B 4K81A 1XD3B 2M17A 1E5WA 2ZNVC 3HM6X 2C5LC 5AZGA 3AU4A 1T0YA 2LUEA 2FIFA 1WXAA 3ZW3A 4B6WA 3TMPB 3UINB 3PLUA 2KDFB 5C23A 2MX2A 2KN5A 3DPDA 3HM3A 3NOBA 2K6DB 1IYFA
chains in the Genus database with same CATH superfamily
4TQ1A 1DOXA 1T6BX 5JZEB 3RZWC 5JH5C 4EOYA 4KVGB 1BT0A 2E6XA 2CHXA 1WXSA 1WR6E 1PFDA 1YQBA 1M94A 3ZJVA 2J0JA 5IKCM 2MCNB 3KWLA 1F77A 3KYCD 4USAA 2DBYA 1V5OA 4L1BA 2G1EA 2BW2A 3CMMB 4FHKA 1JALA 1XXGA 3ECIA 3PV1A 1VRAB 2BTEA 4L2YA 4JX1C 2WDQB 2NVUI 3BYYB 1L0VB 3WA0A 4YT0B 3O65B 2JT4B 3RN9C 1J7AA 1R4MB 2BS3B 3N9YC 3AM9A 3JSVA 2Y5CA 4W9EA 2HJ8A 4WIPA 1NENB 1R4MI 1UD7A 2JWZA 3GB1A 1GJZA 5C1ZA 3MP9A 5EDSA 3IG3A 2K22A 4NAMA 4ANVA 4N58A 2Z0DB 3MHZA 1WX8A 1FFUA 3R7RA 3L0WB 1CMXB 2W82A 1YN3A 1JCKB 3AECB 3JYUA 4YTPB 3V6CB 2V9HA 3Q3NC 2OJWA 3ZUNA 1EF5A 2BB6A 4DHZB 5AZHA 1VZ6A 1FFVA 4BVUC 2KFKB 1YNTE 3DOWA 4K3BA 2KMMA 4GIVA 1L7YA 1WGRA 2KZRA 3TEZA 4AJYB 4MT5A 2QILA 3RUIB 4ANUA 4W9DA 3PZDA 1J7CA 3Q8EA 2KK8A 3NS8A 4FLHA 4OHJA 3MJWA 1QOFA 2K39A 3GZNB 4MJSA 1TGZB 5H92C 3AXCA 3FILA 4C00A 1SIFA 1EF1A 4EZJA 4HWIB 4K7SA 2K1FA 3UIPB 3AI5A 2V3PA 1M4VA 3AEEB 3MFGA 2PVGC 4WAAA 3NUHB 1MFWA 1VD2A 1A5RA 1T0RC 1KF6B 4RF1A 2AYOB 4E3CA 1TS5A 4W9IA 2BKRB 1SIJA 1EWYC 2FCNA 2MJ3A 2O2VA 1MPEA 2OJRA 5G55A 1N6ZA 4DBGA 3SHQA 1EWCA 1WSPA 5JXVA 1RFKA 4KZ0A 3VHTC 3DBRI 2C60A 3EGRA 1XT9B 4DHJD 1B9RA 3PS6A 1I4PA 2JVCA 1E8YA 4TUUA 4WJPA 1ZUD2 3C0RB 3CIRB 1FIQA 2K8BA 3AE2B 3SDLC 2XN9C 1WM2A 3BK1A 1C3TA 2G45B 2UU7A 4NAWA 3W5UB 2HTHA 3H7SA 1Q5WB 3A9JB 4C56C 1E9MA 4FULA 4BKSA 1SE2A 2IY0B 1I4XA 1MHHE 4NJ6A 2Q5WD 1LQBA 2QMTA 2J7QB 2I1KA 2KAJA 2PLPA 2DZMA 1WGKA 4REZA 1K8RB 2XBBC 4ZRQA 4II3B 2ZJDA 1WJUA 2BPSA 1DOYA 4WURA 1NI2A 2LASA 3PREA 5C2TB 4PYZA 4KSLC 1FXIA 2AQ3B 2MW5A 3RMKC 4OZBA 5D3IB 4WJOA 4F7ZA 2NR2A 3MHSD 4I6LB 2DYBA 4FJYA 4HPLB 1WY8A 1YQ3B 2AX5A 3H9DA 3OJ4B 3W9CB 3QA8A 1YMHE 2KJ6A 3DWMA 4IWOA 3SR6A 3BVZA 1FCCC 2EELA 4G0NB 4ZRKA 4M01A 1SEBD 3AEBB 5BYRA 4URKA 4P7IA 2ZCCA 4C4VA 3ZRCA 3CWIA 3HRDD 4HROA 5BO4B 3R2IA 1OQQA 1XLQA 4YSYB 1FEHA 5IA7A 3T8MA 2M56B 4EE2A 3ALBA 4I6NB 4QAYA 2UWQA 4LTUA 4L23A 3ENEA 3V6EB 2D3GA 3H7PA 2NBUA 1WH3A 4TMAB 3P1MA 1JWMD 2JX5A 4GXBA 4HVBA 1R4NI 2Y5PA 2WP9B 1KFYB 4DK5A 4GSWA 2M8SA 2Z8LA 1L6UA 4A20A 3ZNGC 4ZYNA 1TIFA 3NS1A 4PT5A 3N32A 3MC0B 2LGSA 2LWPA 3IXSA 4N59A 4IM3A 4M00A 4XZ4A 3RNGC 2ZW0A 2K8HA 1F2RC 2N7DA 1SE3A 3QARA 4KDLB 5BYQA 3Q8FA 3L4PA 3U8ZA 3SD5A 2BYEA 4FJZA 2WHIA 3EFUA 1FNWA 3BY4B 2FUHB 4KGTA 4M8MA 1E8XA 2IDYA 2K9XA 4WH4A 4RMAA 1ZXHA 2IO3B 4ICUA 2GBNA 3U7ZA 4IDIA 1N5XA 1TY0A 4TV3A 1QILA 3QQ8B 2INCC 4FN2A 4DQOC 1J19A 1JWSD 3HVDA 1P0RA 1QKZA 2M1MA 3AE7B 4BBNC 4O1NA 3HK0A 3UIOB 2IBIB 3RNBC 3FKYA 1JRUA 4II2B 4MDKE 3QWZB 1UBQA 5H8YE 1T0SC 2EMTA 1ET6A 2JWUA 2V4IB 4JE3B 3U4EG 4LJOB 1WXMA 2INDC 5IN7A 2WXKA 4ASWC 3SEBA 2EKEC 5DPTA 1E8ZA 2MBBB 4DXAB 2KO3A 1P7EA 2DWQA 2IGDA 3U30A 5DPRA 3DBHB 2IYDB 3Q3OC 3BINA 3NZSA 1TZOA 3OJ3A 1SF0A 2SAKA 3P42A 3NY5A 3ZTDA 4TQ0A 4W9CA 2M17A 2LJIA 2WS3B 2WXNA 1T0YA 2LUEA 1WXAA 3TMPB 3PLUA 5C23A 1SJHD 2MX2A 4MACA 3NOBA 1IYFA 2PIAA 2KC1A 2RPVA 2VZKB 2MHJA 4FA6A 1H4RA 4GU2A 2FCSA 1WF9A 3A9KB 2BGFA 5D7GA 3ZNHB 1EU4A 2DAJA 4FADA 3AU5A 2HD5B 1KOTA 2D3AA 3R2TA 2O6VB 2YVCA 4S0RA 2R2OA 4RM8A 1FD6A 3EUB2 1PYWD 1LM8B 4WWOA 1YQ4B 2NTTA 2Y3AA 2GMIC 1WX9A 4GDLB 2WXGA 2PTLA 2JYEA 4K3CA 3RZFA 4KIKB 3VUWA 3AV8A 1UGMA 1T0QC 1FRDA 4LNKA 2GI9A 4US8A 2R2QA 4AWJA 3CSFA 3I63C 2CKHB 3IVFA 4ZYSA 3DDCB 4HPPA 4KKIA 1XLOA 1AARA 1GNUA 2K5PA 3APCA 1F2RI 2LHEA 3MC9A 2RSUA 2ON8A 3ZDMC 3V62A 2DHZA 1E7PB 3TJPA 3TEYA 3DVGY 2ZPNA 1I7HA 4CQNA 1BMLC 2RPQA 2J52A 2O2VB 4BAXA 4OVUA 2G9HD 2WX0A 5BMGA 1G6JA 4K7WA 1WMHB 2BS4B 3KQ4A 2HDEA 2OEDA 5CHVC 4MELA 4LDTD 3Q8CA 2JRIB 4PS8A 3BVMA 3AE8B 3TBLD 4NY0A 1F9JA 3BK2A 5TR5A 4WWMA 1F0ZA 1J8CA 3ZYYX 2KVZA 4ZRPA 3P4RB 2KANA 1I4GA 3FILB 3DWGC 2FIDA 4HXDA 1C79A 1CZPA 4ACFA 1E7VA 2GB1A 3B1LX 4GLSC 2K25A 3Q2AC 3ZNZB 3AE6B 2QCZA 2PEAA 4PS3A 4X57B 1OQYA 4IM2A 3W1SA 5AEKB 4IOIE 1TTNA 3HIZA 3VR8B 1JROA 3PSEB 4ZHPA 1XCTL 2ICIA 3TSSA 2BYFA 3ZIMA 3WALA 3AMZA 1LGRA 4W9HA 1EM7A 1P9DU 4W9GA 2LUMA 5JHBA 3AB5A 2FCQA 1NYRA 1ZKHA 4OVZA 3I3TB 4HJKA 4MM3B 2KC2A 2K8CA 3A9KA 4M02A 4HCNB 3R7QA 2J0MA 3PTFC 3T9LA 1H8CA 1WGYA 3LXFA 5CHWA 2PE6B 2KDEB 5MPOA 4H2AA 3U2SC 5TSSA 1RAXA 3LJ3A 2YEPB 1ZW7A 5EE9A 3AEDB 1XLNA 3NVZA 3DBSA 1EO6A 2KFJA 1DOIA 2KQ4X 2D3BA 3P2BA 2DYMA 4GDLA 4KIKA 3RPFC 3U52E 3EHVA 4AQ7A 3P4PB 5G2NA 3IT6B 4XWWA 1V5TA 2B3AA 1ZDVA 3VDZA 4PS7A 1WYWB 2DX5B 2AEHA 3UI3A 4MSMB 4IKGA 2ZVOA 4LDTB 2KDBA 1KTKA 2KD0A 2QSDA 5FR3A 2MA9B 1WXVA 3A4SC 4EKUA 3AE9B 3IT4B 5E6PA 3Q69A 1ACCA 3OWEB 3D32A 1IUEA 2CHWA 3VXWA 3RULA 1V2YA 4LNNA 1E10A 1R7SA 2BWFA 2V1YA 3B08A 3VTVA 1YOVB 2MP2B 2EKIA 3DQVA 2IGGA 2LGXA 1K50A 2GBMA 2LGIA 4E71A 2PJHA 3PHXB 1AW7A 1WZ3A 2D3CA 2KWDA 5G5HA 2DZIA 3VTWA 4F8CB 3PPAA 4MGIE 2GBKA 4GB9A 4MM3A 5GMVA 3DBLI 1JMLA 4MEMA 5L95C 1VLBA 3JW0X 1TS3A 2LXCA 2A4ZA 3ZTCA 2PVOD 2XEWA 2BB5A 2WU5B 2X8XX 1D4BA 2ZPYA 5EE0A 4P6VF 3W1SC 5EE1A 2INPE 2JYTA 5T8IA 4BOSC 1OEYJ 1YJIA 2K0PA 4GDKA 2EMSA 2KQSA 2M0AA 1XO3A 2WXFA 2N9EB 3SFEB 5D3DA 3APFA 2XNAC 4HLEA 2KT7A 1V1OA 2FAZA 2WXJA 4N6EB 1HEZE 1WGHA 1GUAB 2WXIA 4YTNB 1KLVA 1TJEA 1K51A 2CR5A 2MBEA 2VH2A 2W9NA 5D2MB 5BMIA 2DZJA 1T5XD 3WCQA 4BKGA 1RWSA 1WJ6A 2N7EA 1I42A 4EZLA 1SE9A 2CU3A 1JRPA 2Z59B 4ZRIA 5HHDG 3GOEA 1FNVA 4P1CC 4IC7B 2N1WA 4A55A 4K7UA 1I4QA 4N9F4 2BVCA 2MEKA 1V1PB 3CSTA 2N7JA 2NPTB 2JXXA 2LFIA 3H8HA 3VR9B 3DHGC 2DENB 2N9LA 2X38A 2RD0A 2LD9A 4WJQA 5J17A 1WGDA 4US9A 1D5MC 3PT2B 3A1QA 1QOGA 4AS1A 2WX1A 1TY2A 3QK0A 1TT5B 4WQOB 4BKTA 3AULA 3Q14C 2W55A 4G3XB 1XEEA 3V61A 1L4DB 3VTUA 3QHTA 2WYQA 1JWBD 2PKOA 3X23A 5IOIA 1ZGUB 1TS4A 1XLPA 3ABVB 2DAFA 2ONQA 3QIJA 3ETRA 2MP2A 2N0SB 4DDID 3TUOA 3M63B 2KTRA 5FKAC 1ZP0B 4FHJA 2CJOA 1QOAA 4RCOA 1JWAD 1HTOA 2XK5A 2V3SA 4TKNA 1E0ZA 3HVZA 3AU4A 3ZW3A 2FIFA 2KN5A 2NMQA 3HM3A 2K6DB 3P4SB 2N4FA 4EFOA 1C77A 3A4RA 2J0KA 1KM7A 4ZRJA 3VFKA 1C9FA 1UNSA 3J9CA 4IWQA 1ET9A 3MTNB 2DLBA 5LLIA 3N1YC 1L2NA 1SB3C 4LK0M 3PRMB 4DXFA 3A9JA 2N9PC 3DBLB 1VCBA 3L16A 3R66C 2M4NA 2D2QA 5IO9A 4JQWC 1SBBB 3KUDB 3NZ3A 2L8JA 2L3ZA 1C4PA 3ZO5B 4MH8A 1DYQA 1HE8A 2IJ0A 2W54A 2NCNA 3W5VB 4FJVB 4M0WB 5KHQA 4GMVA 1N60A 1SGHA 3HUIA 1WZ0A 3IAM1 2V0GA 2LRUA 1N62A 3KUZA 3M95A 4JPSA 1JQ4A 1ZDXA 2L52A 4FBJB 3L17A 4DDGD 2BYVE 2BS2B 2WXOA 3NRZA 4KV2A 1C78A 2VZKD 4IUMB 3DBHI 3KLSX 2LGYA 1FMAD 1ZE3D 4HPMB 2JSVX 2SEBD 3DVNV 3PZ7A 2MLBA 4J3OD 1PQSA 5FR6A 1SSNA 1T3QA 1WR1A 1V1PA 3N3KB 3N1XC 2OOBB 3QAQA 4NNJB 3WAPA 1WMHA 2AL6A 4A90A 4RH6A 2CHZA 2L76A 4LLGM 3WAMA 3DVNU 3Q8BA 2LI5A 3BYTB 1UZXB 4ICVA 2ACZB 3A33B 5CX3A 3KW5B 2YLMA 4K1RB 3PRZA 2C9WB 2MH7A 4DWFA 1WJNA 3EFCA 4A9AA 4XC2A 1HXYD 4G50A 3QX1A 4HEA1 1WFYA 2MSED 5J2RA 2RMMA 3Q3FA 4J6IA 4BKSD 2A5UA 3OG5A 4ZOHC 1V6EA 2ZNVB 3C8YA 4I6PA 3K9OB 4OVVA 3NJTA 2RDBC 2IPKD 3L08A 3RFZB 4S17A 1HTQA 1L0XB 3APDA 5HI1A 4GGQA 2JRHA 3N30A 1C4AA 2KTFA 4HDOA 2WXHA 4AP4C 2Y5BB 1GG3A 3NHEB 2XK5B 5GXGB 5DPWA 2H88B 1QF6A 3EECA 2M0XA 2WXLA 4RFBA 2FNJB 4CO7A 4BBNF 1ESFA 5LXHA 3C19A 4OZAA 5AUKA 4B95A 1NDDA 4W9JA 1YJJA 4RGNA 4LNOA 1SXTA 5BYSA 1C76A 4KZCA 5AUIA 3GS2A 1VZ7A 4IW0A 2NTSA 1GAQB 4W9KA 1RRBA 3Q6BA 1KH0A 2ZEQA 1WM3A 4JL9A 2LZ6A 1ENFA 2MQJA 2MBQA 2GLSA 3QJZA 1LFDA 5HFYA 4PYUA 1NBFC 4YTMB 2MJEA 4ZHOA 1DGJA 2FCMA 1HQRD 1VDVA 2PW9A 3FC4A 3PVLA 4OZCA 4IM0A 3PHWB 2WDVB 3M62B 3LYYA 4IG7B 1TYGB 2VH1A 2B76B 2HTME 4KKJA 1XCQL 3WAOA 4W9FA 3AH7A 3RNCC 2KXJA 1NI3A 3R8BA 1ZXIA 3TIXA 4JWSC 3A1QB 1Q1OA 3I9V1 2LVOA 4BOZB 3V3XA 3AN1A 1TKYA 2N1VA 3IHPC 3VUXA 1V86A 2HJ1A 3BIID 4NQLB 4KGSA 4KGRA 3NZUA 2M19A 3ZXRA 2MBHA 1JW9D 2WXPA 5IAAC 4P1BC 1KLUD 1BXTA 1P1AA 1AN8A 3RT3B 3VAWA 3P4QB 3TL5A 2FUG1 3DHIC 3ZLZA 3KH0A 4JWUC 4NJ7A 2LJ5A 2WQYB 1LXDA 1KJTA 4YSZB 1EU3A 4M0WA 2W3SA 5C3JB 3X0WA 2D5GA 1UGJA 1TS2A 4EZKA 3Q3MC 1C4CA 5I4DA 4A3OA 3ZXVA 1WE7A 3H1UA 3TCAA 1OFFA 2NBWB 2HE7A 1IBXA 2PMVA 3KUCB 4HKZE 1AWDA 2JQRB 1PGBA 2LMCA 2LEKA 2H89B 2JU6X 1TZ1A 3DBRB 3GP7A 2KWVB 3L54A 4WWPA 2LRWA 3ZVVA 1E6EB 2WXRA 1IPGA 2KYWA 2BT6A 3DCGA 2DYOA 3OAWA 5L83A 2JZZA 2JPHA 2TSSA 2REXA 2MWSB 3MJ5A 1VZ8A 1HZ5A 1FXTB 3DVGX 2GOWA 2ASQA 3MC8A 4M8NA 1YX6B 3QCAA 4B0EA 1L6VA 3JSVB 2QEJC 2QIEB 4P16A 4ARIA 1WRIA 4MGYE 4XYCA 1IP9A 2LVPA 4NAWB 2NPTA 4WWNA 1YN5A 1C1YB 2C7HA 5BMHA 4RGMA 3AEFB 2CJNA 3ONSA 4XX5A 1IGDA 2GRIA 5CTRC 2ZVNA 3UF8A 1RYJA 4W9LA 3PGEA 2KX0A 1GB4A 2JXTA 4LNFA 4XDCA 2JF5A 2IO1B 1WYGA 2C7NB 2MJDA 2WU2B 1QT9A 2JZPA 2L1AA 2NS5A 5FK9C 1GC7A 3BVGA 2YEPF 3KVFB 4RM9A 3I5JC 3B9JA 4XDDA 1YN4A 4EEWA 2BBCA 1TKGA 3VRAB 4RGOS 5D6JB 1QLBB 4AJWA 2C7MB 4YL8A 1QZEA 4DXGA 1FXAA 3NG0A 3ZKJC 4A6QA 4A3PA 2RR9A 3T3NA 5HKHA 5DCNA 2PPHA 4HK2A 5DPSA 1FCLA 2D07B 1KRHA 1XD3B 3ZJTA 2INNE 1P7FA 2C5LC 3PZ8A 5AZGA 1MG4A 1FRRA 4B6WA 3UINB 3BZDB 1IGCA 3DPDA 3VH4B 1OTRB 1FPYA 2PE9A 1RLFA 2ZW1A 5G5GA 3SU8X 2WWZA 3GZNI 2AQ2B 2QDFA 2L0FA 1GC6A 1N5WA 2OHFA 3ZRFA 2KOXA 1PDXA 2KFKA 3AEAB 1WXQA 4AUQC 3B2GA 3Q3JA 1WWTA 1GOZA 1LO5D 3RNFC 1NYQA 2FE8A 2JZ3B 5CHFA 1I4RA 4D2KA 2V4LA 3TEWA 1GB1A 2D11A 2QC8A 1IBXB 2DZKA 3W2DA 3ZGZA 1B1ZA 2GBJA 1UF0A 4NZLB 2K6QA 1UELA 3LDZE 1YX5B 2D10A 4YXDB 3EC8A 1MVKA 1SJED 1FM0D 2J53A 1UBIA 1CK1A 1V80A 1OQRA 1AYFA 2KDMA 4BZAA 1ISNA 4GN1A 1CQVA 1MHXA 4B9KA 3PRPB 4JGHB 4KSKC 3E56A 4LNIA 1NVID 3RYTA 1K53A 2KKCA 4UDUC 3R3MA 3NVYA 3EA6A 5D94A 2KVRA 4TSSA 1MJDA 1PGAA 3H6NA 4BFRA 4F1SA 3K9PB 4EUTA 2LGDA 1D5ZC 1Q0WB 2V3NA 1JWUD 2KTRB 4ANXA 4JLCA 4C7YA 2I2YA 3UQBA 4MJSB 2MRPA 1PGXA 4GOCA 3U7DA 2QHOA 3QC8B 1PUTA 4XWTA 1E90A 1J0GA 4KDIC 1YIWA 4C4VB 3ZNID 1S1QB 4Q2JA 4RGTA 1V8CA 3AE3B 3ZDTA 2KMAA 4HRSA 3WANA 3L10B 2KMCA 3B2FA 3RD2A 1UWXA 1U4AA 2KJRA 2KJHB 1S3SG 2L83A 1Q10A 1V97A 1QQRA 2AQ1B 4MGKE 1FO4A 2N9KA 3E9SA 1WX7A 2BF8B 3HHMA 2BYTA 1Y56A 1MG8A 1V49A 1F1HA 4G11A 4E74A 3JVZX 2WXQA 2BKFA 4B0MA 3RNAC 5JHAA 2O6VA 3BWUD 3RCZA 2KLGA 3VVWB 2QJLA 4OW0A 2I38A 4R3DA 4YSXB 3PLVA 4WJNA 2K3UA 5KHOA 1UH6A 1VJKA 3N1ZC 2KQ7A 1L0YB 1N63A 3W1YA 1KLGD 2L05A 2IGHA 2KN4A 4RF0A 5HG2A 1QOBA 1RM6C 2LXAA 2WGSA 3AE1B 4WAFA 3ML9A 4XGAB 4GDKB 1STEA 1SE4A 4ZDVA 1YD8U 3L13A 3V05A 2Z0EB 2L0TA 1ZPSA 3Q8AA 2W3RA 1WE6A 3N20C 5E6JA 3B0AA 4HJGE 2BQQA 4YWGG 2KX3A 1WRDB 2RDGA 1R4NB 1TBEA 2KWUB 2J4XA 1CJEA 4RNAA 1V81A 2LVQA 3VRBB 4LJPB 1D5XC 1RFAA 2L00B 3AE4B 4NPNA 2R61A 3VQIA 3KWVA 2DNFA 2O6VD 3RI7C 1Z2MA 1WIAA 3RNEC 1D3ZA 1ZOYB 5E6NA 3IFWB 4ITKA 2IO2B 1L4ZB 4WQMA 3IBEA 2G3QB 2N9XA 4MH0E 4PK1A 1ROEA 5AZFA 2KACA 3GE3C 2G4DB 1D6EC 1E8WA 3UGBB 3IAS1 1Y8RC 1V9JA 3P63A 1WI0A 2KHWB 4JIOU 2AWTA 3SFDB 1OEYA 1OGWA 3GE8C 3V60A 2I1JA 2KNBA 1E7UA 1L5PA 4LCDE 2KWCA 3DHHC 3WIMA 4CHKA 1P3QU 2L7RA 1XQQA 2WLBA 3O13A 3CF6E 2IY1B 1K52A 2WDRB 1GPXA 1J7BA 4C7ZA 2ZCBA 5IP4D 1TKEA 3URYA 3S2AA 3T3OA 3PO0A 3FAHA 2BWES 4ANWA 5J18A 1X1MA 1WGGA 4FXCA 4DHJB 1EUVB 1VR9A 3ZJUA 3VH3B 4AOFA 5LNK1 1A70A 4NJCA 2KLCA 1I4HA 2JY6A 2IZVB 1XF5L 3ML8A 2WXMA 2E3TA 3AEGB 3NVVA 4MGZE 1YJ1A 2KDIA 5LXIB 3ZQ4A 2L32A 3H7PB 1I35A 5EE3A 4C80A 4MSQB 1NEKB 1Z5SB 1HZ6A 1F52A 2CS4A 4DHZE 2FBWB 1BUIC 5E6OA 2RDHA 3TEXA 4IWPA 3OLMD 1UUPA 2CU1A 4HCPB 2ZZPB 2NBVB 4HDQA 2MBOA 1WJ4A 4ARCA 2GBRA 2RGFA 3AE5B 4CYEA 2JUOA 1HA5A 3VUYA 2AL3A 3M3JA 4KX6B 4HKQA 1P98A 1FNUA 2IO0B 2VRRB 2UYZB 4XE0A 2LHDA 3NVWA 3I57A 3UQAA 4NQKE 3KYDD 1N61A 2G4SA 2WDTB 4K81A 3HM6X 2ZNVC 1E5WA 3LB8C 4A8XC 1MI0A 2WNMA 2J42A 1UWMA 2KDFB
chains in the Genus database with same CATH topology
2KC1A 4TQ1A 2N4FA 5JZEB 4FA6A 3RZWC 5JH5C 1H4RA 4GU2A 2FCSA 1WF9A 3A9KB 3VH4B 4EOYA 4EFOA 1OTRB 2BGFA 4KVGB 1BT0A 5D7GA 3ZNHB 2DAJA 4FADA 2CHXA 1WXSA 1RLFA 2HD5B 2PE9A 3AU5A 3A4RA 3SU8X 1WR6E 2J0KA 2WWZA 3GZNI 1KOTA 1KM7A 1YQBA 2O6VB 4ZRJA 1M94A 2YVCA 3VFKA 2J0JA 2L0FA 2R2OA 2MCNB 1GC6A 4IWQA 4RM8A 3MTNB 3KYCD 5LLIA 1LM8B 4WWOA 1L2NA 1V5OA 3ZRFA 2GMIC 3PRMB 3CMMB 2KOXA 1WX9A 4FHKA 3A9JA 2KFKA 3ECIA 3PV1A 2N9PC 4GDLB 4AUQC 3Q3JA 1VCBA 3L16A 3R66C 2M4NA 2NVUI 2D2QA 3WA0A 2JZ3B 4JQWC 5CHFA 3O65B 3KUDB 2JT4B 2V4LA 2L8JA 2L3ZA 3RZFA 4KIKB 3ZO5B 1HE8A 2D11A 3VUWA 2NCNA 4FJVB 3JSVA 1UGMA 2DZKA 4M0WB 2HJ8A 4GMVA 4W9EA 5KHQA 1SGHA 1UD7A 1R4MI 2JWZA 1GJZA 2GBJA 2R2QA 4AWJA 5C1ZA 3CSFA 5EDSA 2CKHB 1WZ0A 3IVFA 2K6QA 1UELA 3DDCB 3IG3A 3LDZE 4ANVA 2LRUA 1YX5B 3KUZA 3M95A 1AARA 1GNUA 2D10A 3APCA 2Z0DB 3EC8A 4FBJB 1WX8A 3L17A 3R7RA 4DDGD 3L0WB 1CMXB 2BYVE 2RSUA 3ZDMC 4KV2A 3JYUA 3V6CB 1UBIA 2DHZA 3V62A 1V80A 3DBHI 4IUMB 3TJPA 2LGYA 3DVGY 2ZPNA 4HPMB 3ZUNA 1ISNA 4GN1A 4B9KA 1EF5A 3PRPB 4JGHB 4DHZB 4KSKC 3DVNV 2MLBA 2RPQA 1PQSA 5FR6A 3RYTA 2O2VB 1WR1A 5AZHA 4OVUA 3N3KB 2KKCA 4BVUC 2KFKB 3R3MA 2OOBB 3QAQA 4NNJB 2WX0A 1WMHA 2AL6A 3DOWA 3WAPA 5D94A 2KVRA 1G6JA 4K7WA 2CHZA 1WMHB 3H6NA 2L76A 4BFRA 4F1SA 3K9PB 4GIVA 4EUTA 1L7YA 1Q0WB 2LGDA 3DVNU 3WAMA 1WGRA 5CHVC 4MELA 4LDTD 2JRIB 2KTRB 4PS8A 4ANXA 2LI5A 4ICVA 1UZXB 4JLCA 2KZRA 3TBLD 3A33B 4AJYB 4NY0A 1F9JA 5CX3A 3KW5B 2YLMA 4K1RB 3UQBA 5TR5A 4MJSB 3PRZA 3RUIB 2MRPA 4ANUA 4W9DA 2C9WB 4DWFA 4GOCA 1WJNA 1J8CA 3PZDA 3U7DA 2QHOA 3QC8B 4XC2A 2KK8A 1E90A 3NS8A 3QX1A 4FLHA 4G50A 1WFYA 3MJWA 2MSED 1J0GA 2KANA 2K39A 5J2RA 4MJSA 3Q3FA 1TGZB 4KDIC 1YIWA 3AXCA 2FIDA 4HXDA 4J6IA 4BKSD 2A5UA 1SIFA 3ZNID 1EF1A 1S1QB 4EZJA 1E7VA 3B1LX 4HWIB 1V6EA 3ZDTA 2KMAA 2ZNVB 2K25A 4I6PA 3K9OB 3WANA 3L10B 4K7SA 3ZNZB 4OVVA 2KMCA 3RD2A 2PEAA 4PS3A 2K1FA 1U4AA 4X57B 3UIPB 3L08A 1OQYA 3AI5A 4IM2A 3W1SA 2KJRA 3APDA 5AEKB 4WAAA 2KJHB 1S3SG 1TTNA 1VD2A 4GGQA 2JRHA 3HIZA 1A5RA 3N30A 4MGKE 2KTFA 4HDOA 3PSEB 4AP4C 2Y5BB 2AYOB 4E3CA 1GG3A 1WX7A 2XK5B 3NHEB 2BF8B 5DPWA 4W9IA 3HHMA 2BYFA 2BKRB 3EECA 2M0XA 3WALA 2FCNA 3ZIMA 2O2VA 1MG8A 2FNJB 1V49A 2OJRA 4G11A 4W9HA 4E74A 3JVZX 4CO7A 1P9DU 4W9GA 5G55A 4BBNF 5LXHA 2BKFA 5JHBA 2FCQA 1ZKHA 4B95A 4DBGA 1NDDA 5JHAA 4W9JA 3SHQA 3I3TB 4HJKA 4KZ0A 2KC2A 3VHTC 2K8CA 3A9KA 3DBRI 4HCNB 2C60A 3R7QA 2J0MA 2O6VA 1XT9B 3PTFC 3T9LA 3RCZA 4DHJD 1H8CA 1WGYA 2KLGA 3PS6A 5CHWA 3VVWB 4KZCA 2JVCA 2KDEB 2PE6B 1E8YA 3PLVA 4WJNA 4TUUA 5KHOA 4WJPA 1RAXA 3C0RB 4IW0A 3LJ3A 2K8BA 1UH6A 3SDLC 4W9KA 1RRBA 1ZW7A 2KQ7A 1WM2A 2ZEQA 3W1YA 1WM3A 4JL9A 2LZ6A 2L05A 2MQJA 3DBSA 1EO6A 2KFJA 2MBQA 1C3TA 2G45B 3P2BA 2DYMA 4GDLA 4KIKA 4NAWA 3QJZA 2HTHA 1LFDA 1Q5WB 3EHVA 3A9JB 3H7SA 4FULA 4PYUA 2LXAA 5G2NA 1NBFC 4BKSA 2IY0B 1V5TA 2B3AA 4NJ6A 3VDZA 1LQBA 2FCMA 4PS7A 3ML9A 1WYWB 2DX5B 2AEHA 2I1KA 2J7QB 3PVLA 4GDKB 4IM0A 4MSMB 2DZMA 1K8RB 2XBBC 4ZDVA 1YD8U 2ZVOA 3L13A 4LDTB 2KDBA 3PHWB 3M62B 4II3B 4IG7B 2Z0EB 2KD0A 2ZJDA 1WJUA 2BPSA 2L0TA 1NI2A 2MA9B 1WE6A 3WAOA 2LASA 1WXVA 3B0AA 3A4SC 3PREA 4W9FA 4EKUA 2KXJA 4PYZA 2KX3A 4KSLC 5E6PA 1WRDB 3TIXA 1TBEA 2KWUB 2MW5A 3A1QB 1Q1OA 4WJOA 4F7ZA 2NR2A 3MHSD 3D32A 2LVOA 4I6LB 4BOZB 1V81A 2LVQA 2DYBA 2N1VA 3IHPC 4LJPB 3VUXA 1V86A 4FJYA 4HPLB 1RFAA 2L00B 2CHWA 4NPNA 1WY8A 3H9DA 3OJ4B 3VXWA 3RULA 1V2YA 3QA8A 2KJ6A 4IWOA 3VQIA 4NQLB 2BWFA 2V1YA 3NZUA 2O6VD 3B08A 3VTVA 1Z2MA 1WIAA 2MP2B 3DQVA 1D3ZA 4G0NB 2MBHA 4ZRKA 2LGXA 5E6NA 3IFWB 2IO2B 5IAAC 2GBMA 4URKA 4E71A 2PJHA 3IBEA 3PHXB 4P7IA 1WZ3A 2G3QB 2N9XA 2ZCCA 1P1AA 4MH0E 2DZIA 5AZFA 3ZRCA 3VTWA 2G4DB 3PPAA 4MGIE 1E8WA 3RT3B 5BO4B 3VAWA 4F8CB 3UGBB 2GBKA 3TL5A 1Y8RC 5IA7A 4GB9A 4MM3A 1V9JA 3KH0A 4NJ7A 5GMVA 3T8MA 3ZLZA 3DBLI 1WI0A 2LJ5A 2KHWB 4JIOU 4MEMA 5L95C 1LXDA 2AWTA 3ALBA 3JW0X 1KJTA 1OEYA 1OGWA 2LXCA 2A4ZA 4I6NB 3ZTCA 2UWQA 3V60A 2I1JA 2XEWA 3ENEA 3V6EB 2D3GA 2KNBA 3X0WA 1E7UA 3H7PA 2NBUA 1WH3A 2ZPYA 4EZKA 4LCDE 3W1SC 2KWCA 3WIMA 4CHKA 4GXBA 1P3QU 2L7RA 1R4NI 1XQQA 4A3OA 4HVBA 4BOSC 1WE7A 3H1UA 3TCAA 1OEYJ 2NBWB 4DK5A 2HE7A 4GSWA 3CF6E 4GDKA 3KUCB 2EMSA 2IY1B 2KQSA 2M8SA 4A20A 3ZNGC 4ZYNA 2N9EB 3N32A 3APFA 1TZ1A 4HLEA 2ZCBA 2LWPA 2KWVB 3L54A 4WWPA 2FAZA 2LRWA 3ZVVA 4IM3A 3S2AA 4XZ4A 1IPGA 1WGHA 1GUAB 2K8HA 2N7DA 1KLVA 2BWES 4ANWA 5J18A 1X1MA 1WGGA 3QARA 4KDLB 3DCGA 2CR5A 2MBEA 5D2MB 2W9NA 2DYOA 3OAWA 4DHJB 3U8ZA 5L83A 1EUVB 2JZZA 2DZJA 2JPHA 2REXA 3SD5A 3VH3B 2MWSB 4AOFA 2BYEA 4FJZA 4BKGA 3EFUA 1FXTB 3BY4B 3DVGX 1WJ6A 2GOWA 2ASQA 2FUHB 4M8MA 4M8NA 1E8XA 2N7EA 1I42A 1YX6B 4RMAA 3QCAA 4EZLA 2KLCA 1SE9A 2Z59B 4ZRIA 3JSVB 2IO3B 4ICUA 2GBNA 3GOEA 2JY6A 2IZVB 3ML8A 4IC7B 2N1WA 4MGYE 4TV3A 3QQ8B 4K7UA 4MGZE 1YJ1A 1IP9A 4N9F4 4FN2A 2LVPA 2KDIA 4NAWB 2NPTA 5LXIB 4WWNA 3CSTA 2C7HA 1C1YB 2NPTB 1J19A 2JXXA 1P0RA 2M1MA 3ONSA 4XX5A 5CTRC 4BBNC 2ZVNA 3UF8A 2DENB 3HK0A 4W9LA 2IBIB 3UIOB 3PGEA 2RD0A 3H7PB 1JRUA 2LD9A 4WJQA 1I35A 5J17A 1WGDA 2KX0A 4II2B 4MDKE 4MSQB 3PT2B 3A1QA 3QWZB 1Z5SB 2JF5A 2WX1A 1UBQA 2CS4A 2IO1B 3QK0A 2C7NB 4WQOB 2EMTA 4DHZE 5E6OA 4BKTA 3AULA 4IWPA 3OLMD 2CU1A 4HCPB 2ZZPB 2NS5A 4G3XB 4LJOB 1WXMA 3V61A 1GC7A 2NBVB 3QHTA 4HDQA 3VTUA 2MBOA 2WYQA 4ASWC 1WJ4A 2EKEC 2GBRA 2RGFA 3KVFB 5DPTA 4RM9A 4CYEA 3X23A 2JUOA 1E8ZA 1ZGUB 4EEWA 2MBBB 3VUYA 2AL3A 3M3JA 2DAFA 2KO3A 4DXAB 5D6JB 1P98A 3QIJA 4AJWA 2C7MB 2IO0B 4YL8A 1QZEA 2VRRB 2MP2A 2UYZB 3U30A 5DPRA 4DDID 3ZKJC 3M63B 4A3PA 2IYDB 2KTRA 2RR9A 3BINA 3NZSA 3OJ3A 5HKHA 3UQAA 5DCNA 3ZTDA 3NY5A 4FHJA 3KYDD 4NQKE 2PPHA 4HK2A 2G4SA 5DPSA 2XK5A 2V3SA 2WDTB 4TKNA 4TQ0A 4W9CA 2D07B 4K81A 1XD3B 2M17A 1E5WA 2ZNVC 3HM6X 2C5LC 5AZGA 3AU4A 1T0YA 2LUEA 2FIFA 1WXAA 3ZW3A 4B6WA 3TMPB 3UINB 3PLUA 2KDFB 5C23A 2MX2A 2KN5A 3DPDA 3HM3A 3NOBA 2K6DB 1IYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC1 A;  4TQ1 A;  2N4F A;  5JZE B;  4FA6 A;  3RZW C;  5JH5 C;  1H4R A;  4GU2 A;  2FCS A;  1WF9 A;  3A9K B;  3VH4 B;  4EOY A;  4EFO A;  1OTR B;  2BGF A;  4KVG B;  1BT0 A;  5D7G A;  3ZNH B;  2DAJ A;  4FAD A;  2CHX A;  1WXS A;  1RLF A;  2HD5 B;  2PE9 A;  3AU5 A;  3A4R A;  3SU8 X;  1WR6 E;  2J0K A;  2WWZ A;  3GZN I;  1KOT A;  1KM7 A;  1YQB A;  2O6V B;  4ZRJ A;  1M94 A;  2YVC A;  3VFK A;  2J0J A;  2L0F A;  2R2O A;  2MCN B;  1GC6 A;  4IWQ A;  4RM8 A;  3MTN B;  3KYC D;  5LLI A;  1LM8 B;  4WWO A;  1L2N A;  1V5O A;  3ZRF A;  2GMI C;  3PRM B;  3CMM B;  2KOX A;  1WX9 A;  4FHK A;  3A9J A;  2KFK A;  3ECI A;  3PV1 A;  2N9P C;  4GDL B;  4AUQ C;  3Q3J A;  1VCB A;  3L16 A;  3R66 C;  2M4N A;  2NVU I;  2D2Q A;  3WA0 A;  2JZ3 B;  4JQW C;  5CHF A;  3O65 B;  3KUD B;  2JT4 B;  2V4L A;  2L8J A;  2L3Z A;  3RZF A;  4KIK B;  3ZO5 B;  1HE8 A;  2D11 A;  3VUW A;  2NCN A;  4FJV B;  3JSV A;  1UGM A;  2DZK A;  4M0W B;  2HJ8 A;  4GMV A;  4W9E A;  5KHQ A;  1SGH A;  1UD7 A;  1R4M I;  2JWZ A;  1GJZ A;  2GBJ A;  2R2Q A;  4AWJ A;  5C1Z A;  3CSF A;  5EDS A;  2CKH B;  1WZ0 A;  3IVF A;  2K6Q A;  1UEL A;  3DDC B;  3IG3 A;  3LDZ E;  4ANV A;  2LRU A;  1YX5 B;  3KUZ A;  3M95 A;  1AAR A;  1GNU A;  2D10 A;  3APC A;  2Z0D B;  3EC8 A;  4FBJ B;  1WX8 A;  3L17 A;  3R7R A;  4DDG D;  3L0W B;  1CMX B;  2BYV E;  2RSU A;  3ZDM C;  4KV2 A;  3JYU A;  3V6C B;  1UBI A;  2DHZ A;  3V62 A;  1V80 A;  3DBH I;  4IUM B;  3TJP A;  2LGY A;  3DVG Y;  2ZPN A;  4HPM B;  3ZUN A;  1ISN A;  4GN1 A;  4B9K A;  1EF5 A;  3PRP B;  4JGH B;  4DHZ B;  4KSK C;  3DVN V;  2MLB A;  2RPQ A;  1PQS A;  5FR6 A;  3RYT A;  2O2V B;  1WR1 A;  5AZH A;  4OVU A;  3N3K B;  2KKC A;  4BVU C;  2KFK B;  3R3M A;  2OOB B;  3QAQ A;  4NNJ B;  2WX0 A;  1WMH A;  2AL6 A;  3DOW A;  3WAP A;  5D94 A;  2KVR A;  1G6J A;  4K7W A;  2CHZ A;  1WMH B;  3H6N A;  2L76 A;  4BFR A;  4F1S A;  3K9P B;  4GIV A;  4EUT A;  1L7Y A;  1Q0W B;  2LGD A;  3DVN U;  3WAM A;  1WGR A;  5CHV C;  4MEL A;  4LDT D;  2JRI B;  2KTR B;  4PS8 A;  4ANX A;  2LI5 A;  4ICV A;  1UZX B;  4JLC A;  2KZR A;  3TBL D;  3A33 B;  4AJY B;  4NY0 A;  1F9J A;  5CX3 A;  3KW5 B;  2YLM A;  4K1R B;  3UQB A;  5TR5 A;  4MJS B;  3PRZ A;  3RUI B;  2MRP A;  4ANU A;  4W9D A;  2C9W B;  4DWF A;  4GOC A;  1WJN A;  1J8C A;  3PZD A;  3U7D A;  2QHO A;  3QC8 B;  4XC2 A;  2KK8 A;  1E90 A;  3NS8 A;  3QX1 A;  4FLH A;  4G50 A;  1WFY A;  3MJW A;  2MSE D;  1J0G A;  2KAN A;  2K39 A;  5J2R A;  4MJS A;  3Q3F A;  1TGZ B;  4KDI C;  1YIW A;  3AXC A;  2FID A;  4HXD A;  4J6I A;  4BKS D;  2A5U A;  1SIF A;  3ZNI D;  1EF1 A;  1S1Q B;  4EZJ A;  1E7V A;  3B1L X;  4HWI B;  1V6E A;  3ZDT A;  2KMA A;  2ZNV B;  2K25 A;  4I6P A;  3K9O B;  3WAN A;  3L10 B;  4K7S A;  3ZNZ B;  4OVV A;  2KMC A;  3RD2 A;  2PEA A;  4PS3 A;  2K1F A;  1U4A A;  4X57 B;  3UIP B;  3L08 A;  1OQY A;  3AI5 A;  4IM2 A;  3W1S A;  2KJR A;  3APD A;  5AEK B;  4WAA A;  2KJH B;  1S3S G;  1TTN A;  1VD2 A;  4GGQ A;  2JRH A;  3HIZ A;  1A5R A;  3N30 A;  4MGK E;  2KTF A;  4HDO A;  3PSE B;  4AP4 C;  2Y5B B;  2AYO B;  4E3C A;  1GG3 A;  1WX7 A;  2XK5 B;  3NHE B;  2BF8 B;  5DPW A;  4W9I A;  3HHM A;  2BYF A;  2BKR B;  3EEC A;  2M0X A;  3WAL A;  2FCN A;  3ZIM A;  2O2V A;  1MG8 A;  2FNJ B;  1V49 A;  2OJR A;  4G11 A;  4W9H A;  4E74 A;  3JVZ X;  4CO7 A;  1P9D U;  4W9G A;  5G55 A;  4BBN F;  5LXH A;  2BKF A;  5JHB A;  2FCQ A;  1ZKH A;  4B95 A;  4DBG A;  1NDD A;  5JHA A;  4W9J A;  3SHQ A;  3I3T B;  4HJK A;  4KZ0 A;  2KC2 A;  3VHT C;  2K8C A;  3A9K A;  3DBR I;  4HCN B;  2C60 A;  3R7Q A;  2J0M A;  2O6V A;  1XT9 B;  3PTF C;  3T9L A;  3RCZ A;  4DHJ D;  1H8C A;  1WGY A;  2KLG A;  3PS6 A;  5CHW A;  3VVW B;  4KZC A;  2JVC A;  2KDE B;  2PE6 B;  1E8Y A;  3PLV A;  4WJN A;  4TUU A;  5KHO A;  4WJP A;  1RAX A;  3C0R B;  4IW0 A;  3LJ3 A;  2K8B A;  1UH6 A;  3SDL C;  4W9K A;  1RRB A;  1ZW7 A;  2KQ7 A;  1WM2 A;  2ZEQ A;  3W1Y A;  1WM3 A;  4JL9 A;  2LZ6 A;  2L05 A;  2MQJ A;  3DBS A;  1EO6 A;  2KFJ A;  2MBQ A;  1C3T A;  2G45 B;  3P2B A;  2DYM A;  4GDL A;  4KIK A;  4NAW A;  3QJZ A;  2HTH A;  1LFD A;  1Q5W B;  3EHV A;  3A9J B;  3H7S A;  4FUL A;  4PYU A;  2LXA A;  5G2N A;  1NBF C;  4BKS A;  2IY0 B;  1V5T A;  2B3A A;  4NJ6 A;  3VDZ A;  1LQB A;  2FCM A;  4PS7 A;  3ML9 A;  1WYW B;  2DX5 B;  2AEH A;  2I1K A;  2J7Q B;  3PVL A;  4GDK B;  4IM0 A;  4MSM B;  2DZM A;  1K8R B;  2XBB C;  4ZDV A;  1YD8 U;  2ZVO A;  3L13 A;  4LDT B;  2KDB A;  3PHW B;  3M62 B;  4II3 B;  4IG7 B;  2Z0E B;  2KD0 A;  2ZJD A;  1WJU A;  2BPS A;  2L0T A;  1NI2 A;  2MA9 B;  1WE6 A;  3WAO A;  2LAS A;  1WXV A;  3B0A A;  3A4S C;  3PRE A;  4W9F A;  4EKU A;  2KXJ A;  4PYZ A;  2KX3 A;  4KSL C;  5E6P A;  1WRD B;  3TIX A;  1TBE A;  2KWU B;  2MW5 A;  3A1Q B;  1Q1O A;  4WJO A;  4F7Z A;  2NR2 A;  3MHS D;  3D32 A;  2LVO A;  4I6L B;  4BOZ B;  1V81 A;  2LVQ A;  2DYB A;  2N1V A;  3IHP C;  4LJP B;  3VUX A;  1V86 A;  4FJY A;  4HPL B;  1RFA A;  2L00 B;  2CHW A;  4NPN A;  1WY8 A;  3H9D A;  3OJ4 B;  3VXW A;  3RUL A;  1V2Y A;  3QA8 A;  2KJ6 A;  4IWO A;  3VQI A;  4NQL B;  2BWF A;  2V1Y A;  3NZU A;  2O6V D;  3B08 A;  3VTV A;  1Z2M A;  1WIA A;  2MP2 B;  3DQV A;  1D3Z A;  4G0N B;  2MBH A;  4ZRK A;  2LGX A;  5E6N A;  3IFW B;  2IO2 B;  5IAA C;  2GBM A;  4URK A;  4E71 A;  2PJH A;  3IBE A;  3PHX B;  4P7I A;  1WZ3 A;  2G3Q B;  2N9X A;  2ZCC A;  1P1A A;  4MH0 E;  2DZI A;  5AZF A;  3ZRC A;  3VTW A;  2G4D B;  3PPA A;  4MGI E;  1E8W A;  3RT3 B;  5BO4 B;  3VAW A;  4F8C B;  3UGB B;  2GBK A;  3TL5 A;  1Y8R C;  5IA7 A;  4GB9 A;  4MM3 A;  1V9J A;  3KH0 A;  4NJ7 A;  5GMV A;  3T8M A;  3ZLZ A;  3DBL I;  1WI0 A;  2LJ5 A;  2KHW B;  4JIO U;  4MEM A;  5L95 C;  1LXD A;  2AWT A;  3ALB A;  3JW0 X;  1KJT A;  1OEY A;  1OGW A;  2LXC A;  2A4Z A;  4I6N B;  3ZTC A;  2UWQ A;  3V60 A;  2I1J A;  2XEW A;  3ENE A;  3V6E B;  2D3G A;  2KNB A;  3X0W A;  1E7U A;  3H7P A;  2NBU A;  1WH3 A;  2ZPY A;  4EZK A;  4LCD E;  3W1S C;  2KWC A;  3WIM A;  4CHK A;  4GXB A;  1P3Q U;  2L7R A;  1R4N I;  1XQQ A;  4A3O A;  4HVB A;  4BOS C;  1WE7 A;  3H1U A;  3TCA A;  1OEY J;  2NBW B;  4DK5 A;  2HE7 A;  4GSW A;  3CF6 E;  4GDK A;  3KUC B;  2EMS A;  2IY1 B;  2KQS A;  2M8S A;  4A20 A;  3ZNG C;  4ZYN A;  2N9E B;  3N32 A;  3APF A;  1TZ1 A;  4HLE A;  2ZCB A;  2LWP A;  2KWV B;  3L54 A;  4WWP A;  2FAZ A;  2LRW A;  3ZVV A;  4IM3 A;  3S2A A;  4XZ4 A;  1IPG A;  1WGH A;  1GUA B;  2K8H A;  2N7D A;  1KLV A;  2BWE S;  4ANW A;  5J18 A;  1X1M A;  1WGG A;  3QAR A;  4KDL B;  3DCG A;  2CR5 A;  2MBE A;  5D2M B;  2W9N A;  2DYO A;  3OAW A;  4DHJ B;  3U8Z A;  5L83 A;  1EUV B;  2JZZ A;  2DZJ A;  2JPH A;  2REX A;  3SD5 A;  3VH3 B;  2MWS B;  4AOF A;  2BYE A;  4FJZ A;  4BKG A;  3EFU A;  1FXT B;  3BY4 B;  3DVG X;  1WJ6 A;  2GOW A;  2ASQ A;  2FUH B;  4M8M A;  4M8N A;  1E8X A;  2N7E A;  1I42 A;  1YX6 B;  4RMA A;  3QCA A;  4EZL A;  2KLC A;  1SE9 A;  2Z59 B;  4ZRI A;  3JSV B;  2IO3 B;  4ICU A;  2GBN A;  3GOE A;  2JY6 A;  2IZV B;  3ML8 A;  4IC7 B;  2N1W A;  4MGY E;  4TV3 A;  3QQ8 B;  4K7U A;  4MGZ E;  1YJ1 A;  1IP9 A;  4N9F 4;  4FN2 A;  2LVP A;  2KDI A;  4NAW B;  2NPT A;  5LXI B;  4WWN A;  3CST A;  2C7H A;  1C1Y B;  2NPT B;  1J19 A;  2JXX A;  1P0R A;  2M1M A;  3ONS A;  4XX5 A;  5CTR C;  4BBN C;  2ZVN A;  3UF8 A;  2DEN B;  3HK0 A;  4W9L A;  2IBI B;  3UIO B;  3PGE A;  2RD0 A;  3H7P B;  1JRU A;  2LD9 A;  4WJQ A;  1I35 A;  5J17 A;  1WGD A;  2KX0 A;  4II2 B;  4MDK E;  4MSQ B;  3PT2 B;  3A1Q A;  3QWZ B;  1Z5S B;  2JF5 A;  2WX1 A;  1UBQ A;  2CS4 A;  2IO1 B;  3QK0 A;  2C7N B;  4WQO B;  2EMT A;  4DHZ E;  5E6O A;  4BKT A;  3AUL A;  4IWP A;  3OLM D;  2CU1 A;  4HCP B;  2ZZP B;  2NS5 A;  4G3X B;  4LJO B;  1WXM A;  3V61 A;  1GC7 A;  2NBV B;  3QHT A;  4HDQ A;  3VTU A;  2MBO A;  2WYQ A;  4ASW C;  1WJ4 A;  2EKE C;  2GBR A;  2RGF A;  3KVF B;  5DPT A;  4RM9 A;  4CYE A;  3X23 A;  2JUO A;  1E8Z A;  1ZGU B;  4EEW A;  2MBB B;  3VUY A;  2AL3 A;  3M3J A;  2DAF A;  2KO3 A;  4DXA B;  5D6J B;  1P98 A;  3QIJ A;  4AJW A;  2C7M B;  2IO0 B;  4YL8 A;  1QZE A;  2VRR B;  2MP2 A;  2UYZ B;  3U30 A;  5DPR A;  4DDI D;  3ZKJ C;  3M63 B;  4A3P A;  2IYD B;  2KTR A;  2RR9 A;  3BIN A;  3NZS A;  3OJ3 A;  5HKH A;  3UQA A;  5DCN A;  3ZTD A;  3NY5 A;  4FHJ A;  3KYD D;  4NQK E;  2PPH A;  4HK2 A;  2G4S A;  5DPS A;  2XK5 A;  2V3S A;  2WDT B;  4TKN A;  4TQ0 A;  4W9C A;  2D07 B;  4K81 A;  1XD3 B;  2M17 A;  1E5W A;  2ZNV C;  3HM6 X;  2C5L C;  5AZG A;  3AU4 A;  1T0Y A;  2LUE A;  2FIF A;  1WXA A;  3ZW3 A;  4B6W A;  3TMP B;  3UIN B;  3PLU A;  2KDF B;  5C23 A;  2MX2 A;  2KN5 A;  3DPD A;  3HM3 A;  3NOB A;  2K6D B;  1IYF A; 
#chains in the Genus database with same CATH topology
 4TQ1 A;  1DOX A;  1T6B X;  5JZE B;  3RZW C;  5JH5 C;  4EOY A;  4KVG B;  1BT0 A;  2E6X A;  2CHX A;  1WXS A;  1WR6 E;  1PFD A;  1YQB A;  1M94 A;  3ZJV A;  2J0J A;  5IKC M;  2MCN B;  3KWL A;  1F77 A;  3KYC D;  4USA A;  2DBY A;  1V5O A;  4L1B A;  2G1E A;  2BW2 A;  3CMM B;  4FHK A;  1JAL A;  1XXG A;  3ECI A;  3PV1 A;  1VRA B;  2BTE A;  4L2Y A;  4JX1 C;  2WDQ B;  2NVU I;  3BYY B;  1L0V B;  3WA0 A;  4YT0 B;  3O65 B;  2JT4 B;  3RN9 C;  1J7A A;  1R4M B;  2BS3 B;  3N9Y C;  3AM9 A;  3JSV A;  2Y5C A;  4W9E A;  2HJ8 A;  4WIP A;  1NEN B;  1R4M I;  1UD7 A;  2JWZ A;  3GB1 A;  1GJZ A;  5C1Z A;  3MP9 A;  5EDS A;  3IG3 A;  2K22 A;  4NAM A;  4ANV A;  4N58 A;  2Z0D B;  3MHZ A;  1WX8 A;  1FFU A;  3R7R A;  3L0W B;  1CMX B;  2W82 A;  1YN3 A;  1JCK B;  3AEC B;  3JYU A;  4YTP B;  3V6C B;  2V9H A;  3Q3N C;  2OJW A;  3ZUN A;  1EF5 A;  2BB6 A;  4DHZ B;  5AZH A;  1VZ6 A;  1FFV A;  4BVU C;  2KFK B;  1YNT E;  3DOW A;  4K3B A;  2KMM A;  4GIV A;  1L7Y A;  1WGR A;  2KZR A;  3TEZ A;  4AJY B;  4MT5 A;  2QIL A;  3RUI B;  4ANU A;  4W9D A;  3PZD A;  1J7C A;  3Q8E A;  2KK8 A;  3NS8 A;  4FLH A;  4OHJ A;  3MJW A;  1QOF A;  2K39 A;  3GZN B;  4MJS A;  1TGZ B;  5H92 C;  3AXC A;  3FIL A;  4C00 A;  1SIF A;  1EF1 A;  4EZJ A;  4HWI B;  4K7S A;  2K1F A;  3UIP B;  3AI5 A;  2V3P A;  1M4V A;  3AEE B;  3MFG A;  2PVG C;  4WAA A;  3NUH B;  1MFW A;  1VD2 A;  1A5R A;  1T0R C;  1KF6 B;  4RF1 A;  2AYO B;  4E3C A;  1TS5 A;  4W9I A;  2BKR B;  1SIJ A;  1EWY C;  2FCN A;  2MJ3 A;  2O2V A;  1MPE A;  2OJR A;  5G55 A;  1N6Z A;  4DBG A;  3SHQ A;  1EWC A;  1WSP A;  5JXV A;  1RFK A;  4KZ0 A;  3VHT C;  3DBR I;  2C60 A;  3EGR A;  1XT9 B;  4DHJ D;  1B9R A;  3PS6 A;  1I4P A;  2JVC A;  1E8Y A;  4TUU A;  4WJP A;  1ZUD 2;  3C0R B;  3CIR B;  1FIQ A;  2K8B A;  3AE2 B;  3SDL C;  2XN9 C;  1WM2 A;  3BK1 A;  1C3T A;  2G45 B;  2UU7 A;  4NAW A;  3W5U B;  2HTH A;  3H7S A;  1Q5W B;  3A9J B;  4C56 C;  1E9M A;  4FUL A;  4BKS A;  1SE2 A;  2IY0 B;  1I4X A;  1MHH E;  4NJ6 A;  2Q5W D;  1LQB A;  2QMT A;  2J7Q B;  2I1K A;  2KAJ A;  2PLP A;  2DZM A;  1WGK A;  4REZ A;  1K8R B;  2XBB C;  4ZRQ A;  4II3 B;  2ZJD A;  1WJU A;  2BPS A;  1DOY A;  4WUR A;  1NI2 A;  2LAS A;  3PRE A;  5C2T B;  4PYZ A;  4KSL C;  1FXI A;  2AQ3 B;  2MW5 A;  3RMK C;  4OZB A;  5D3I B;  4WJO A;  4F7Z A;  2NR2 A;  3MHS D;  4I6L B;  2DYB A;  4FJY A;  4HPL B;  1WY8 A;  1YQ3 B;  2AX5 A;  3H9D A;  3OJ4 B;  3W9C B;  3QA8 A;  1YMH E;  2KJ6 A;  3DWM A;  4IWO A;  3SR6 A;  3BVZ A;  1FCC C;  2EEL A;  4G0N B;  4ZRK A;  4M01 A;  1SEB D;  3AEB B;  5BYR A;  4URK A;  4P7I A;  2ZCC A;  4C4V A;  3ZRC A;  3CWI A;  3HRD D;  4HRO A;  5BO4 B;  3R2I A;  1OQQ A;  1XLQ A;  4YSY B;  1FEH A;  5IA7 A;  3T8M A;  2M56 B;  4EE2 A;  3ALB A;  4I6N B;  4QAY A;  2UWQ A;  4LTU A;  4L23 A;  3ENE A;  3V6E B;  2D3G A;  3H7P A;  2NBU A;  1WH3 A;  4TMA B;  3P1M A;  1JWM D;  2JX5 A;  4GXB A;  4HVB A;  1R4N I;  2Y5P A;  2WP9 B;  1KFY B;  4DK5 A;  4GSW A;  2M8S A;  2Z8L A;  1L6U A;  4A20 A;  3ZNG C;  4ZYN A;  1TIF A;  3NS1 A;  4PT5 A;  3N32 A;  3MC0 B;  2LGS A;  2LWP A;  3IXS A;  4N59 A;  4IM3 A;  4M00 A;  4XZ4 A;  3RNG C;  2ZW0 A;  2K8H A;  1F2R C;  2N7D A;  1SE3 A;  3QAR A;  4KDL B;  5BYQ A;  3Q8F A;  3L4P A;  3U8Z A;  3SD5 A;  2BYE A;  4FJZ A;  2WHI A;  3EFU A;  1FNW A;  3BY4 B;  2FUH B;  4KGT A;  4M8M A;  1E8X A;  2IDY A;  2K9X A;  4WH4 A;  4RMA A;  1ZXH A;  2IO3 B;  4ICU A;  2GBN A;  3U7Z A;  4IDI A;  1N5X A;  1TY0 A;  4TV3 A;  1QIL A;  3QQ8 B;  2INC C;  4FN2 A;  4DQO C;  1J19 A;  1JWS D;  3HVD A;  1P0R A;  1QKZ A;  2M1M A;  3AE7 B;  4BBN C;  4O1N A;  3HK0 A;  3UIO B;  2IBI B;  3RNB C;  3FKY A;  1JRU A;  4II2 B;  4MDK E;  3QWZ B;  1UBQ A;  5H8Y E;  1T0S C;  2EMT A;  1ET6 A;  2JWU A;  2V4I B;  4JE3 B;  3U4E G;  4LJO B;  1WXM A;  2IND C;  5IN7 A;  2WXK A;  4ASW C;  3SEB A;  2EKE C;  5DPT A;  1E8Z A;  2MBB B;  4DXA B;  2KO3 A;  1P7E A;  2DWQ A;  2IGD A;  3U30 A;  5DPR A;  3DBH B;  2IYD B;  3Q3O C;  3BIN A;  3NZS A;  1TZO A;  3OJ3 A;  1SF0 A;  2SAK A;  3P42 A;  3NY5 A;  3ZTD A;  4TQ0 A;  4W9C A;  2M17 A;  2LJI A;  2WS3 B;  2WXN A;  1T0Y A;  2LUE A;  1WXA A;  3TMP B;  3PLU A;  5C23 A;  1SJH D;  2MX2 A;  4MAC A;  3NOB A;  1IYF A;  2PIA A;  2KC1 A;  2RPV A;  2VZK B;  2MHJ A;  4FA6 A;  1H4R A;  4GU2 A;  2FCS A;  1WF9 A;  3A9K B;  2BGF A;  5D7G A;  3ZNH B;  1EU4 A;  2DAJ A;  4FAD A;  3AU5 A;  2HD5 B;  1KOT A;  2D3A A;  3R2T A;  2O6V B;  2YVC A;  4S0R A;  2R2O A;  4RM8 A;  1FD6 A;  3EUB 2;  1PYW D;  1LM8 B;  4WWO A;  1YQ4 B;  2NTT A;  2Y3A A;  2GMI C;  1WX9 A;  4GDL B;  2WXG A;  2PTL A;  2JYE A;  4K3C A;  3RZF A;  4KIK B;  3VUW A;  3AV8 A;  1UGM A;  1T0Q C;  1FRD A;  4LNK A;  2GI9 A;  4US8 A;  2R2Q A;  4AWJ A;  3CSF A;  3I63 C;  2CKH B;  3IVF A;  4ZYS A;  3DDC B;  4HPP A;  4KKI A;  1XLO A;  1AAR A;  1GNU A;  2K5P A;  3APC A;  1F2R I;  2LHE A;  3MC9 A;  2RSU A;  2ON8 A;  3ZDM C;  3V62 A;  2DHZ A;  1E7P B;  3TJP A;  3TEY A;  3DVG Y;  2ZPN A;  1I7H A;  4CQN A;  1BML C;  2RPQ A;  2J52 A;  2O2V B;  4BAX A;  4OVU A;  2G9H D;  2WX0 A;  5BMG A;  1G6J A;  4K7W A;  1WMH B;  2BS4 B;  3KQ4 A;  2HDE A;  2OED A;  5CHV C;  4MEL A;  4LDT D;  3Q8C A;  2JRI B;  4PS8 A;  3BVM A;  3AE8 B;  3TBL D;  4NY0 A;  1F9J A;  3BK2 A;  5TR5 A;  4WWM A;  1F0Z A;  1J8C A;  3ZYY X;  2KVZ A;  4ZRP A;  3P4R B;  2KAN A;  1I4G A;  3FIL B;  3DWG C;  2FID A;  4HXD A;  1C79 A;  1CZP A;  4ACF A;  1E7V A;  2GB1 A;  3B1L X;  4GLS C;  2K25 A;  3Q2A C;  3ZNZ B;  3AE6 B;  2QCZ A;  2PEA A;  4PS3 A;  4X57 B;  1OQY A;  4IM2 A;  3W1S A;  5AEK B;  4IOI E;  1TTN A;  3HIZ A;  3VR8 B;  1JRO A;  3PSE B;  4ZHP A;  1XCT L;  2ICI A;  3TSS A;  2BYF A;  3ZIM A;  3WAL A;  3AMZ A;  1LGR A;  4W9H A;  1EM7 A;  1P9D U;  4W9G A;  2LUM A;  5JHB A;  3AB5 A;  2FCQ A;  1NYR A;  1ZKH A;  4OVZ A;  3I3T B;  4HJK A;  4MM3 B;  2KC2 A;  2K8C A;  3A9K A;  4M02 A;  4HCN B;  3R7Q A;  2J0M A;  3PTF C;  3T9L A;  1H8C A;  1WGY A;  3LXF A;  5CHW A;  2PE6 B;  2KDE B;  5MPO A;  4H2A A;  3U2S C;  5TSS A;  1RAX A;  3LJ3 A;  2YEP B;  1ZW7 A;  5EE9 A;  3AED B;  1XLN A;  3NVZ A;  3DBS A;  1EO6 A;  2KFJ A;  1DOI A;  2KQ4 X;  2D3B A;  3P2B A;  2DYM A;  4GDL A;  4KIK A;  3RPF C;  3U52 E;  3EHV A;  4AQ7 A;  3P4P B;  5G2N A;  3IT6 B;  4XWW A;  1V5T A;  2B3A A;  1ZDV A;  3VDZ A;  4PS7 A;  1WYW B;  2DX5 B;  2AEH A;  3UI3 A;  4MSM B;  4IKG A;  2ZVO A;  4LDT B;  2KDB A;  1KTK A;  2KD0 A;  2QSD A;  5FR3 A;  2MA9 B;  1WXV A;  3A4S C;  4EKU A;  3AE9 B;  3IT4 B;  5E6P A;  3Q69 A;  1ACC A;  3OWE B;  3D32 A;  1IUE A;  2CHW A;  3VXW A;  3RUL A;  1V2Y A;  4LNN A;  1E10 A;  1R7S A;  2BWF A;  2V1Y A;  3B08 A;  3VTV A;  1YOV B;  2MP2 B;  2EKI A;  3DQV A;  2IGG A;  2LGX A;  1K50 A;  2GBM A;  2LGI A;  4E71 A;  2PJH A;  3PHX B;  1AW7 A;  1WZ3 A;  2D3C A;  2KWD A;  5G5H A;  2DZI A;  3VTW A;  4F8C B;  3PPA A;  4MGI E;  2GBK A;  4GB9 A;  4MM3 A;  5GMV A;  3DBL I;  1JML A;  4MEM A;  5L95 C;  1VLB A;  3JW0 X;  1TS3 A;  2LXC A;  2A4Z A;  3ZTC A;  2PVO D;  2XEW A;  2BB5 A;  2WU5 B;  2X8X X;  1D4B A;  2ZPY A;  5EE0 A;  4P6V F;  3W1S C;  5EE1 A;  2INP E;  2JYT A;  5T8I A;  4BOS C;  1OEY J;  1YJI A;  2K0P A;  4GDK A;  2EMS A;  2KQS A;  2M0A A;  1XO3 A;  2WXF A;  2N9E B;  3SFE B;  5D3D A;  3APF A;  2XNA C;  4HLE A;  2KT7 A;  1V1O A;  2FAZ A;  2WXJ A;  4N6E B;  1HEZ E;  1WGH A;  1GUA B;  2WXI A;  4YTN B;  1KLV A;  1TJE A;  1K51 A;  2CR5 A;  2MBE A;  2VH2 A;  2W9N A;  5D2M B;  5BMI A;  2DZJ A;  1T5X D;  3WCQ A;  4BKG A;  1RWS A;  1WJ6 A;  2N7E A;  1I42 A;  4EZL A;  1SE9 A;  2CU3 A;  1JRP A;  2Z59 B;  4ZRI A;  5HHD G;  3GOE A;  1FNV A;  4P1C C;  4IC7 B;  2N1W A;  4A55 A;  4K7U A;  1I4Q A;  4N9F 4;  2BVC A;  2MEK A;  1V1P B;  3CST A;  2N7J A;  2NPT B;  2JXX A;  2LFI A;  3H8H A;  3VR9 B;  3DHG C;  2DEN B;  2N9L A;  2X38 A;  2RD0 A;  2LD9 A;  4WJQ A;  5J17 A;  1WGD A;  4US9 A;  1D5M C;  3PT2 B;  3A1Q A;  1QOG A;  4AS1 A;  2WX1 A;  1TY2 A;  3QK0 A;  1TT5 B;  4WQO B;  4BKT A;  3AUL A;  3Q14 C;  2W55 A;  4G3X B;  1XEE A;  3V61 A;  1L4D B;  3VTU A;  3QHT A;  2WYQ A;  1JWB D;  2PKO A;  3X23 A;  5IOI A;  1ZGU B;  1TS4 A;  1XLP A;  3ABV B;  2DAF A;  2ONQ A;  3QIJ A;  3ETR A;  2MP2 A;  2N0S B;  4DDI D;  3TUO A;  3M63 B;  2KTR A;  5FKA C;  1ZP0 B;  4FHJ A;  2CJO A;  1QOA A;  4RCO A;  1JWA D;  1HTO A;  2XK5 A;  2V3S A;  4TKN A;  1E0Z A;  3HVZ A;  3AU4 A;  3ZW3 A;  2FIF A;  2KN5 A;  2NMQ A;  3HM3 A;  2K6D B;  3P4S B;  2N4F A;  4EFO A;  1C77 A;  3A4R A;  2J0K A;  1KM7 A;  4ZRJ A;  3VFK A;  1C9F A;  1UNS A;  3J9C A;  4IWQ A;  1ET9 A;  3MTN B;  2DLB A;  5LLI A;  3N1Y C;  1L2N A;  1SB3 C;  4LK0 M;  3PRM B;  4DXF A;  3A9J A;  2N9P C;  3DBL B;  1VCB A;  3L16 A;  3R66 C;  2M4N A;  2D2Q A;  5IO9 A;  4JQW C;  1SBB B;  3KUD B;  3NZ3 A;  2L8J A;  2L3Z A;  1C4P A;  3ZO5 B;  4MH8 A;  1DYQ A;  1HE8 A;  2IJ0 A;  2W54 A;  2NCN A;  3W5V B;  4FJV B;  4M0W B;  5KHQ A;  4GMV A;  1N60 A;  1SGH A;  3HUI A;  1WZ0 A;  3IAM 1;  2V0G A;  2LRU A;  1N62 A;  3KUZ A;  3M95 A;  4JPS A;  1JQ4 A;  1ZDX A;  2L52 A;  4FBJ B;  3L17 A;  4DDG D;  2BYV E;  2BS2 B;  2WXO A;  3NRZ A;  4KV2 A;  1C78 A;  2VZK D;  4IUM B;  3DBH I;  3KLS X;  2LGY A;  1FMA D;  1ZE3 D;  4HPM B;  2JSV X;  2SEB D;  3DVN V;  3PZ7 A;  2MLB A;  4J3O D;  1PQS A;  5FR6 A;  1SSN A;  1T3Q A;  1WR1 A;  1V1P A;  3N3K B;  3N1X C;  2OOB B;  3QAQ A;  4NNJ B;  3WAP A;  1WMH A;  2AL6 A;  4A90 A;  4RH6 A;  2CHZ A;  2L76 A;  4LLG M;  3WAM A;  3DVN U;  3Q8B A;  2LI5 A;  3BYT B;  1UZX B;  4ICV A;  2ACZ B;  3A33 B;  5CX3 A;  3KW5 B;  2YLM A;  4K1R B;  3PRZ A;  2C9W B;  2MH7 A;  4DWF A;  1WJN A;  3EFC A;  4A9A A;  4XC2 A;  1HXY D;  4G50 A;  3QX1 A;  4HEA 1;  1WFY A;  2MSE D;  5J2R A;  2RMM A;  3Q3F A;  4J6I A;  4BKS D;  2A5U A;  3OG5 A;  4ZOH C;  1V6E A;  2ZNV B;  3C8Y A;  4I6P A;  3K9O B;  4OVV A;  3NJT A;  2RDB C;  2IPK D;  3L08 A;  3RFZ B;  4S17 A;  1HTQ A;  1L0X B;  3APD A;  5HI1 A;  4GGQ A;  2JRH A;  3N30 A;  1C4A A;  2KTF A;  4HDO A;  2WXH A;  4AP4 C;  2Y5B B;  1GG3 A;  3NHE B;  2XK5 B;  5GXG B;  5DPW A;  2H88 B;  1QF6 A;  3EEC A;  2M0X A;  2WXL A;  4RFB A;  2FNJ B;  4CO7 A;  4BBN F;  1ESF A;  5LXH A;  3C19 A;  4OZA A;  5AUK A;  4B95 A;  1NDD A;  4W9J A;  1YJJ A;  4RGN A;  4LNO A;  1SXT A;  5BYS A;  1C76 A;  4KZC A;  5AUI A;  3GS2 A;  1VZ7 A;  4IW0 A;  2NTS A;  1GAQ B;  4W9K A;  1RRB A;  3Q6B A;  1KH0 A;  2ZEQ A;  1WM3 A;  4JL9 A;  2LZ6 A;  1ENF A;  2MQJ A;  2MBQ A;  2GLS A;  3QJZ A;  1LFD A;  5HFY A;  4PYU A;  1NBF C;  4YTM B;  2MJE A;  4ZHO A;  1DGJ A;  2FCM A;  1HQR D;  1VDV A;  2PW9 A;  3FC4 A;  3PVL A;  4OZC A;  4IM0 A;  3PHW B;  2WDV B;  3M62 B;  3LYY A;  4IG7 B;  1TYG B;  2VH1 A;  2B76 B;  2HTM E;  4KKJ A;  1XCQ L;  3WAO A;  4W9F A;  3AH7 A;  3RNC C;  2KXJ A;  1NI3 A;  3R8B A;  1ZXI A;  3TIX A;  4JWS C;  3A1Q B;  1Q1O A;  3I9V 1;  2LVO A;  4BOZ B;  3V3X A;  3AN1 A;  1TKY A;  2N1V A;  3IHP C;  3VUX A;  1V86 A;  2HJ1 A;  3BII D;  4NQL B;  4KGS A;  4KGR A;  3NZU A;  2M19 A;  3ZXR A;  2MBH A;  1JW9 D;  2WXP A;  5IAA C;  4P1B C;  1KLU D;  1BXT A;  1P1A A;  1AN8 A;  3RT3 B;  3VAW A;  3P4Q B;  3TL5 A;  2FUG 1;  3DHI C;  3ZLZ A;  3KH0 A;  4JWU C;  4NJ7 A;  2LJ5 A;  2WQY B;  1LXD A;  1KJT A;  4YSZ B;  1EU3 A;  4M0W A;  2W3S A;  5C3J B;  3X0W A;  2D5G A;  1UGJ A;  1TS2 A;  4EZK A;  3Q3M C;  1C4C A;  5I4D A;  4A3O A;  3ZXV A;  1WE7 A;  3H1U A;  3TCA A;  1OFF A;  2NBW B;  2HE7 A;  1IBX A;  2PMV A;  3KUC B;  4HKZ E;  1AWD A;  2JQR B;  1PGB A;  2LMC A;  2LEK A;  2H89 B;  2JU6 X;  1TZ1 A;  3DBR B;  3GP7 A;  2KWV B;  3L54 A;  4WWP A;  2LRW A;  3ZVV A;  1E6E B;  2WXR A;  1IPG A;  2KYW A;  2BT6 A;  3DCG A;  2DYO A;  3OAW A;  5L83 A;  2JZZ A;  2JPH A;  2TSS A;  2REX A;  2MWS B;  3MJ5 A;  1VZ8 A;  1HZ5 A;  1FXT B;  3DVG X;  2GOW A;  2ASQ A;  3MC8 A;  4M8N A;  1YX6 B;  3QCA A;  4B0E A;  1L6V A;  3JSV B;  2QEJ C;  2QIE B;  4P16 A;  4ARI A;  1WRI A;  4MGY E;  4XYC A;  1IP9 A;  2LVP A;  4NAW B;  2NPT A;  4WWN A;  1YN5 A;  1C1Y B;  2C7H A;  5BMH A;  4RGM A;  3AEF B;  2CJN A;  3ONS A;  4XX5 A;  1IGD A;  2GRI A;  5CTR C;  2ZVN A;  3UF8 A;  1RYJ A;  4W9L A;  3PGE A;  2KX0 A;  1GB4 A;  2JXT A;  4LNF A;  4XDC A;  2JF5 A;  2IO1 B;  1WYG A;  2C7N B;  2MJD A;  2WU2 B;  1QT9 A;  2JZP A;  2L1A A;  2NS5 A;  5FK9 C;  1GC7 A;  3BVG A;  2YEP F;  3KVF B;  4RM9 A;  3I5J C;  3B9J A;  4XDD A;  1YN4 A;  4EEW A;  2BBC A;  1TKG A;  3VRA B;  4RGO S;  5D6J B;  1QLB B;  4AJW A;  2C7M B;  4YL8 A;  1QZE A;  4DXG A;  1FXA A;  3NG0 A;  3ZKJ C;  4A6Q A;  4A3P A;  2RR9 A;  3T3N A;  5HKH A;  5DCN A;  2PPH A;  4HK2 A;  5DPS A;  1FCL A;  2D07 B;  1KRH A;  1XD3 B;  3ZJT A;  2INN E;  1P7F A;  2C5L C;  3PZ8 A;  5AZG A;  1MG4 A;  1FRR A;  4B6W A;  3UIN B;  3BZD B;  1IGC A;  3DPD A;  3VH4 B;  1OTR B;  1FPY A;  2PE9 A;  1RLF A;  2ZW1 A;  5G5G A;  3SU8 X;  2WWZ A;  3GZN I;  2AQ2 B;  2QDF A;  2L0F A;  1GC6 A;  1N5W A;  2OHF A;  3ZRF A;  2KOX A;  1PDX A;  2KFK A;  3AEA B;  1WXQ A;  4AUQ C;  3B2G A;  3Q3J A;  1WWT A;  1GOZ A;  1LO5 D;  3RNF C;  1NYQ A;  2FE8 A;  2JZ3 B;  5CHF A;  1I4R A;  4D2K A;  2V4L A;  3TEW A;  1GB1 A;  2D11 A;  2QC8 A;  1IBX B;  2DZK A;  3W2D A;  3ZGZ A;  1B1Z A;  2GBJ A;  1UF0 A;  4NZL B;  2K6Q A;  1UEL A;  3LDZ E;  1YX5 B;  2D10 A;  4YXD B;  3EC8 A;  1MVK A;  1SJE D;  1FM0 D;  2J53 A;  1UBI A;  1CK1 A;  1V80 A;  1OQR A;  1AYF A;  2KDM A;  4BZA A;  1ISN A;  4GN1 A;  1CQV A;  1MHX A;  4B9K A;  3PRP B;  4JGH B;  4KSK C;  3E56 A;  4LNI A;  1NVI D;  3RYT A;  1K53 A;  2KKC A;  4UDU C;  3R3M A;  3NVY A;  3EA6 A;  5D94 A;  2KVR A;  4TSS A;  1MJD A;  1PGA A;  3H6N A;  4BFR A;  4F1S A;  3K9P B;  4EUT A;  2LGD A;  1D5Z C;  1Q0W B;  2V3N A;  1JWU D;  2KTR B;  4ANX A;  4JLC A;  4C7Y A;  2I2Y A;  3UQB A;  4MJS B;  2MRP A;  1PGX A;  4GOC A;  3U7D A;  2QHO A;  3QC8 B;  1PUT A;  4XWT A;  1E90 A;  1J0G A;  4KDI C;  1YIW A;  4C4V B;  3ZNI D;  1S1Q B;  4Q2J A;  4RGT A;  1V8C A;  3AE3 B;  3ZDT A;  2KMA A;  4HRS A;  3WAN A;  3L10 B;  2KMC A;  3B2F A;  3RD2 A;  1UWX A;  1U4A A;  2KJR A;  2KJH B;  1S3S G;  2L83 A;  1Q10 A;  1V97 A;  1QQR A;  2AQ1 B;  4MGK E;  1FO4 A;  2N9K A;  3E9S A;  1WX7 A;  2BF8 B;  3HHM A;  2BYT A;  1Y56 A;  1MG8 A;  1V49 A;  1F1H A;  4G11 A;  4E74 A;  3JVZ X;  2WXQ A;  2BKF A;  4B0M A;  3RNA C;  5JHA A;  2O6V A;  3BWU D;  3RCZ A;  2KLG A;  3VVW B;  2QJL A;  4OW0 A;  2I38 A;  4R3D A;  4YSX B;  3PLV A;  4WJN A;  2K3U A;  5KHO A;  1UH6 A;  1VJK A;  3N1Z C;  2KQ7 A;  1L0Y B;  1N63 A;  3W1Y A;  1KLG D;  2L05 A;  2IGH A;  2KN4 A;  4RF0 A;  5HG2 A;  1QOB A;  1RM6 C;  2LXA A;  2WGS A;  3AE1 B;  4WAF A;  3ML9 A;  4XGA B;  4GDK B;  1STE A;  1SE4 A;  4ZDV A;  1YD8 U;  3L13 A;  3V05 A;  2Z0E B;  2L0T A;  1ZPS A;  3Q8A A;  2W3R A;  1WE6 A;  3N20 C;  5E6J A;  3B0A A;  4HJG E;  2BQQ A;  4YWG G;  2KX3 A;  1WRD B;  2RDG A;  1R4N B;  1TBE A;  2KWU B;  2J4X A;  1CJE A;  4RNA A;  1V81 A;  2LVQ A;  3VRB B;  4LJP B;  1D5X C;  1RFA A;  2L00 B;  3AE4 B;  4NPN A;  2R61 A;  3VQI A;  3KWV A;  2DNF A;  2O6V D;  3RI7 C;  1Z2M A;  1WIA A;  3RNE C;  1D3Z A;  1ZOY B;  5E6N A;  3IFW B;  4ITK A;  2IO2 B;  1L4Z B;  4WQM A;  3IBE A;  2G3Q B;  2N9X A;  4MH0 E;  4PK1 A;  1ROE A;  5AZF A;  2KAC A;  3GE3 C;  2G4D B;  1D6E C;  1E8W A;  3UGB B;  3IAS 1;  1Y8R C;  1V9J A;  3P63 A;  1WI0 A;  2KHW B;  4JIO U;  2AWT A;  3SFD B;  1OEY A;  1OGW A;  3GE8 C;  3V60 A;  2I1J A;  2KNB A;  1E7U A;  1L5P A;  4LCD E;  2KWC A;  3DHH C;  3WIM A;  4CHK A;  1P3Q U;  2L7R A;  1XQQ A;  2WLB A;  3O13 A;  3CF6 E;  2IY1 B;  1K52 A;  2WDR B;  1GPX A;  1J7B A;  4C7Z A;  2ZCB A;  5IP4 D;  1TKE A;  3URY A;  3S2A A;  3T3O A;  3PO0 A;  3FAH A;  2BWE S;  4ANW A;  5J18 A;  1X1M A;  1WGG A;  4FXC A;  4DHJ B;  1EUV B;  1VR9 A;  3ZJU A;  3VH3 B;  4AOF A;  5LNK 1;  1A70 A;  4NJC A;  2KLC A;  1I4H A;  2JY6 A;  2IZV B;  1XF5 L;  3ML8 A;  2WXM A;  2E3T A;  3AEG B;  3NVV A;  4MGZ E;  1YJ1 A;  2KDI A;  5LXI B;  3ZQ4 A;  2L32 A;  3H7P B;  1I35 A;  5EE3 A;  4C80 A;  4MSQ B;  1NEK B;  1Z5S B;  1HZ6 A;  1F52 A;  2CS4 A;  4DHZ E;  2FBW B;  1BUI C;  5E6O A;  2RDH A;  3TEX A;  4IWP A;  3OLM D;  1UUP A;  2CU1 A;  4HCP B;  2ZZP B;  2NBV B;  4HDQ A;  2MBO A;  1WJ4 A;  4ARC A;  2GBR A;  2RGF A;  3AE5 B;  4CYE A;  2JUO A;  1HA5 A;  3VUY A;  2AL3 A;  3M3J A;  4KX6 B;  4HKQ A;  1P98 A;  1FNU A;  2IO0 B;  2VRR B;  2UYZ B;  4XE0 A;  2LHD A;  3NVW A;  3I57 A;  3UQA A;  4NQK E;  3KYD D;  1N61 A;  2G4S A;  2WDT B;  4K81 A;  3HM6 X;  2ZNV C;  1E5W A;  3LB8 C;  4A8X C;  1MI0 A;  2WNM A;  2J42 A;  1UWM A;  2KDF B; 
#chains in the Genus database with same CATH homology
 2KC1 A;  4TQ1 A;  2N4F A;  5JZE B;  4FA6 A;  3RZW C;  5JH5 C;  1H4R A;  4GU2 A;  2FCS A;  1WF9 A;  3A9K B;  3VH4 B;  4EOY A;  4EFO A;  1OTR B;  2BGF A;  4KVG B;  1BT0 A;  5D7G A;  3ZNH B;  2DAJ A;  4FAD A;  2CHX A;  1WXS A;  1RLF A;  2HD5 B;  2PE9 A;  3AU5 A;  3A4R A;  3SU8 X;  1WR6 E;  2J0K A;  2WWZ A;  3GZN I;  1KOT A;  1KM7 A;  1YQB A;  2O6V B;  4ZRJ A;  1M94 A;  2YVC A;  3VFK A;  2J0J A;  2L0F A;  2R2O A;  2MCN B;  1GC6 A;  4IWQ A;  4RM8 A;  3MTN B;  3KYC D;  5LLI A;  1LM8 B;  4WWO A;  1L2N A;  1V5O A;  3ZRF A;  2GMI C;  3PRM B;  3CMM B;  2KOX A;  1WX9 A;  4FHK A;  3A9J A;  2KFK A;  3ECI A;  3PV1 A;  2N9P C;  4GDL B;  4AUQ C;  3Q3J A;  1VCB A;  3L16 A;  3R66 C;  2M4N A;  2NVU I;  2D2Q A;  3WA0 A;  2JZ3 B;  4JQW C;  5CHF A;  3O65 B;  3KUD B;  2JT4 B;  2V4L A;  2L8J A;  2L3Z A;  3RZF A;  4KIK B;  3ZO5 B;  1HE8 A;  2D11 A;  3VUW A;  2NCN A;  4FJV B;  3JSV A;  1UGM A;  2DZK A;  4M0W B;  2HJ8 A;  4GMV A;  4W9E A;  5KHQ A;  1SGH A;  1UD7 A;  1R4M I;  2JWZ A;  1GJZ A;  2GBJ A;  2R2Q A;  4AWJ A;  5C1Z A;  3CSF A;  5EDS A;  2CKH B;  1WZ0 A;  3IVF A;  2K6Q A;  1UEL A;  3DDC B;  3IG3 A;  3LDZ E;  4ANV A;  2LRU A;  1YX5 B;  3KUZ A;  3M95 A;  1AAR A;  1GNU A;  2D10 A;  3APC A;  2Z0D B;  3EC8 A;  4FBJ B;  1WX8 A;  3L17 A;  3R7R A;  4DDG D;  3L0W B;  1CMX B;  2BYV E;  2RSU A;  3ZDM C;  4KV2 A;  3JYU A;  3V6C B;  1UBI A;  2DHZ A;  3V62 A;  1V80 A;  3DBH I;  4IUM B;  3TJP A;  2LGY A;  3DVG Y;  2ZPN A;  4HPM B;  3ZUN A;  1ISN A;  4GN1 A;  4B9K A;  1EF5 A;  3PRP B;  4JGH B;  4DHZ B;  4KSK C;  3DVN V;  2MLB A;  2RPQ A;  1PQS A;  5FR6 A;  3RYT A;  2O2V B;  1WR1 A;  5AZH A;  4OVU A;  3N3K B;  2KKC A;  4BVU C;  2KFK B;  3R3M A;  2OOB B;  3QAQ A;  4NNJ B;  2WX0 A;  1WMH A;  2AL6 A;  3DOW A;  3WAP A;  5D94 A;  2KVR A;  1G6J A;  4K7W A;  2CHZ A;  1WMH B;  3H6N A;  2L76 A;  4BFR A;  4F1S A;  3K9P B;  4GIV A;  4EUT A;  1L7Y A;  1Q0W B;  2LGD A;  3DVN U;  3WAM A;  1WGR A;  5CHV C;  4MEL A;  4LDT D;  2JRI B;  2KTR B;  4PS8 A;  4ANX A;  2LI5 A;  4ICV A;  1UZX B;  4JLC A;  2KZR A;  3TBL D;  3A33 B;  4AJY B;  4NY0 A;  1F9J A;  5CX3 A;  3KW5 B;  2YLM A;  4K1R B;  3UQB A;  5TR5 A;  4MJS B;  3PRZ A;  3RUI B;  2MRP A;  4ANU A;  4W9D A;  2C9W B;  4DWF A;  4GOC A;  1WJN A;  1J8C A;  3PZD A;  3U7D A;  2QHO A;  3QC8 B;  4XC2 A;  2KK8 A;  1E90 A;  3NS8 A;  3QX1 A;  4FLH A;  4G50 A;  1WFY A;  3MJW A;  2MSE D;  1J0G A;  2KAN A;  2K39 A;  5J2R A;  4MJS A;  3Q3F A;  1TGZ B;  4KDI C;  1YIW A;  3AXC A;  2FID A;  4HXD A;  4J6I A;  4BKS D;  2A5U A;  1SIF A;  3ZNI D;  1EF1 A;  1S1Q B;  4EZJ A;  1E7V A;  3B1L X;  4HWI B;  1V6E A;  3ZDT A;  2KMA A;  2ZNV B;  2K25 A;  4I6P A;  3K9O B;  3WAN A;  3L10 B;  4K7S A;  3ZNZ B;  4OVV A;  2KMC A;  3RD2 A;  2PEA A;  4PS3 A;  2K1F A;  1U4A A;  4X57 B;  3UIP B;  3L08 A;  1OQY A;  3AI5 A;  4IM2 A;  3W1S A;  2KJR A;  3APD A;  5AEK B;  4WAA A;  2KJH B;  1S3S G;  1TTN A;  1VD2 A;  4GGQ A;  2JRH A;  3HIZ A;  1A5R A;  3N30 A;  4MGK E;  2KTF A;  4HDO A;  3PSE B;  4AP4 C;  2Y5B B;  2AYO B;  4E3C A;  1GG3 A;  1WX7 A;  2XK5 B;  3NHE B;  2BF8 B;  5DPW A;  4W9I A;  3HHM A;  2BYF A;  2BKR B;  3EEC A;  2M0X A;  3WAL A;  2FCN A;  3ZIM A;  2O2V A;  1MG8 A;  2FNJ B;  1V49 A;  2OJR A;  4G11 A;  4W9H A;  4E74 A;  3JVZ X;  4CO7 A;  1P9D U;  4W9G A;  5G55 A;  4BBN F;  5LXH A;  2BKF A;  5JHB A;  2FCQ A;  1ZKH A;  4B95 A;  4DBG A;  1NDD A;  5JHA A;  4W9J A;  3SHQ A;  3I3T B;  4HJK A;  4KZ0 A;  2KC2 A;  3VHT C;  2K8C A;  3A9K A;  3DBR I;  4HCN B;  2C60 A;  3R7Q A;  2J0M A;  2O6V A;  1XT9 B;  3PTF C;  3T9L A;  3RCZ A;  4DHJ D;  1H8C A;  1WGY A;  2KLG A;  3PS6 A;  5CHW A;  3VVW B;  4KZC A;  2JVC A;  2KDE B;  2PE6 B;  1E8Y A;  3PLV A;  4WJN A;  4TUU A;  5KHO A;  4WJP A;  1RAX A;  3C0R B;  4IW0 A;  3LJ3 A;  2K8B A;  1UH6 A;  3SDL C;  4W9K A;  1RRB A;  1ZW7 A;  2KQ7 A;  1WM2 A;  2ZEQ A;  3W1Y A;  1WM3 A;  4JL9 A;  2LZ6 A;  2L05 A;  2MQJ A;  3DBS A;  1EO6 A;  2KFJ A;  2MBQ A;  1C3T A;  2G45 B;  3P2B A;  2DYM A;  4GDL A;  4KIK A;  4NAW A;  3QJZ A;  2HTH A;  1LFD A;  1Q5W B;  3EHV A;  3A9J B;  3H7S A;  4FUL A;  4PYU A;  2LXA A;  5G2N A;  1NBF C;  4BKS A;  2IY0 B;  1V5T A;  2B3A A;  4NJ6 A;  3VDZ A;  1LQB A;  2FCM A;  4PS7 A;  3ML9 A;  1WYW B;  2DX5 B;  2AEH A;  2I1K A;  2J7Q B;  3PVL A;  4GDK B;  4IM0 A;  4MSM B;  2DZM A;  1K8R B;  2XBB C;  4ZDV A;  1YD8 U;  2ZVO A;  3L13 A;  4LDT B;  2KDB A;  3PHW B;  3M62 B;  4II3 B;  4IG7 B;  2Z0E B;  2KD0 A;  2ZJD A;  1WJU A;  2BPS A;  2L0T A;  1NI2 A;  2MA9 B;  1WE6 A;  3WAO A;  2LAS A;  1WXV A;  3B0A A;  3A4S C;  3PRE A;  4W9F A;  4EKU A;  2KXJ A;  4PYZ A;  2KX3 A;  4KSL C;  5E6P A;  1WRD B;  3TIX A;  1TBE A;  2KWU B;  2MW5 A;  3A1Q B;  1Q1O A;  4WJO A;  4F7Z A;  2NR2 A;  3MHS D;  3D32 A;  2LVO A;  4I6L B;  4BOZ B;  1V81 A;  2LVQ A;  2DYB A;  2N1V A;  3IHP C;  4LJP B;  3VUX A;  1V86 A;  4FJY A;  4HPL B;  1RFA A;  2L00 B;  2CHW A;  4NPN A;  1WY8 A;  3H9D A;  3OJ4 B;  3VXW A;  3RUL A;  1V2Y A;  3QA8 A;  2KJ6 A;  4IWO A;  3VQI A;  4NQL B;  2BWF A;  2V1Y A;  3NZU A;  2O6V D;  3B08 A;  3VTV A;  1Z2M A;  1WIA A;  2MP2 B;  3DQV A;  1D3Z A;  4G0N B;  2MBH A;  4ZRK A;  2LGX A;  5E6N A;  3IFW B;  2IO2 B;  5IAA C;  2GBM A;  4URK A;  4E71 A;  2PJH A;  3IBE A;  3PHX B;  4P7I A;  1WZ3 A;  2G3Q B;  2N9X A;  2ZCC A;  1P1A A;  4MH0 E;  2DZI A;  5AZF A;  3ZRC A;  3VTW A;  2G4D B;  3PPA A;  4MGI E;  1E8W A;  3RT3 B;  5BO4 B;  3VAW A;  4F8C B;  3UGB B;  2GBK A;  3TL5 A;  1Y8R C;  5IA7 A;  4GB9 A;  4MM3 A;  1V9J A;  3KH0 A;  4NJ7 A;  5GMV A;  3T8M A;  3ZLZ A;  3DBL I;  1WI0 A;  2LJ5 A;  2KHW B;  4JIO U;  4MEM A;  5L95 C;  1LXD A;  2AWT A;  3ALB A;  3JW0 X;  1KJT A;  1OEY A;  1OGW A;  2LXC A;  2A4Z A;  4I6N B;  3ZTC A;  2UWQ A;  3V60 A;  2I1J A;  2XEW A;  3ENE A;  3V6E B;  2D3G A;  2KNB A;  3X0W A;  1E7U A;  3H7P A;  2NBU A;  1WH3 A;  2ZPY A;  4EZK A;  4LCD E;  3W1S C;  2KWC A;  3WIM A;  4CHK A;  4GXB A;  1P3Q U;  2L7R A;  1R4N I;  1XQQ A;  4A3O A;  4HVB A;  4BOS C;  1WE7 A;  3H1U A;  3TCA A;  1OEY J;  2NBW B;  4DK5 A;  2HE7 A;  4GSW A;  3CF6 E;  4GDK A;  3KUC B;  2EMS A;  2IY1 B;  2KQS A;  2M8S A;  4A20 A;  3ZNG C;  4ZYN A;  2N9E B;  3N32 A;  3APF A;  1TZ1 A;  4HLE A;  2ZCB A;  2LWP A;  2KWV B;  3L54 A;  4WWP A;  2FAZ A;  2LRW A;  3ZVV A;  4IM3 A;  3S2A A;  4XZ4 A;  1IPG A;  1WGH A;  1GUA B;  2K8H A;  2N7D A;  1KLV A;  2BWE S;  4ANW A;  5J18 A;  1X1M A;  1WGG A;  3QAR A;  4KDL B;  3DCG A;  2CR5 A;  2MBE A;  5D2M B;  2W9N A;  2DYO A;  3OAW A;  4DHJ B;  3U8Z A;  5L83 A;  1EUV B;  2JZZ A;  2DZJ A;  2JPH A;  2REX A;  3SD5 A;  3VH3 B;  2MWS B;  4AOF A;  2BYE A;  4FJZ A;  4BKG A;  3EFU A;  1FXT B;  3BY4 B;  3DVG X;  1WJ6 A;  2GOW A;  2ASQ A;  2FUH B;  4M8M A;  4M8N A;  1E8X A;  2N7E A;  1I42 A;  1YX6 B;  4RMA A;  3QCA A;  4EZL A;  2KLC A;  1SE9 A;  2Z59 B;  4ZRI A;  3JSV B;  2IO3 B;  4ICU A;  2GBN A;  3GOE A;  2JY6 A;  2IZV B;  3ML8 A;  4IC7 B;  2N1W A;  4MGY E;  4TV3 A;  3QQ8 B;  4K7U A;  4MGZ E;  1YJ1 A;  1IP9 A;  4N9F 4;  4FN2 A;  2LVP A;  2KDI A;  4NAW B;  2NPT A;  5LXI B;  4WWN A;  3CST A;  2C7H A;  1C1Y B;  2NPT B;  1J19 A;  2JXX A;  1P0R A;  2M1M A;  3ONS A;  4XX5 A;  5CTR C;  4BBN C;  2ZVN A;  3UF8 A;  2DEN B;  3HK0 A;  4W9L A;  2IBI B;  3UIO B;  3PGE A;  2RD0 A;  3H7P B;  1JRU A;  2LD9 A;  4WJQ A;  1I35 A;  5J17 A;  1WGD A;  2KX0 A;  4II2 B;  4MDK E;  4MSQ B;  3PT2 B;  3A1Q A;  3QWZ B;  1Z5S B;  2JF5 A;  2WX1 A;  1UBQ A;  2CS4 A;  2IO1 B;  3QK0 A;  2C7N B;  4WQO B;  2EMT A;  4DHZ E;  5E6O A;  4BKT A;  3AUL A;  4IWP A;  3OLM D;  2CU1 A;  4HCP B;  2ZZP B;  2NS5 A;  4G3X B;  4LJO B;  1WXM A;  3V61 A;  1GC7 A;  2NBV B;  3QHT A;  4HDQ A;  3VTU A;  2MBO A;  2WYQ A;  4ASW C;  1WJ4 A;  2EKE C;  2GBR A;  2RGF A;  3KVF B;  5DPT A;  4RM9 A;  4CYE A;  3X23 A;  2JUO A;  1E8Z A;  1ZGU B;  4EEW A;  2MBB B;  3VUY A;  2AL3 A;  3M3J A;  2DAF A;  2KO3 A;  4DXA B;  5D6J B;  1P98 A;  3QIJ A;  4AJW A;  2C7M B;  2IO0 B;  4YL8 A;  1QZE A;  2VRR B;  2MP2 A;  2UYZ B;  3U30 A;  5DPR A;  4DDI D;  3ZKJ C;  3M63 B;  4A3P A;  2IYD B;  2KTR A;  2RR9 A;  3BIN A;  3NZS A;  3OJ3 A;  5HKH A;  3UQA A;  5DCN A;  3ZTD A;  3NY5 A;  4FHJ A;  3KYD D;  4NQK E;  2PPH A;  4HK2 A;  2G4S A;  5DPS A;  2XK5 A;  2V3S A;  2WDT B;  4TKN A;  4TQ0 A;  4W9C A;  2D07 B;  4K81 A;  1XD3 B;  2M17 A;  1E5W A;  2ZNV C;  3HM6 X;  2C5L C;  5AZG A;  3AU4 A;  1T0Y A;  2LUE A;  2FIF A;  1WXA A;  3ZW3 A;  4B6W A;  3TMP B;  3UIN B;  3PLU A;  2KDF B;  5C23 A;  2MX2 A;  2KN5 A;  3DPD A;  3HM3 A;  3NOB A;  2K6D B;  1IYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...