2O2VB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vB01
2K8CA 3HK0A 1WH3A 3ZNID 5J2RA 1OEYA 4KZCA 3PT2B 3QAQA 3L13A 3DOWA 3DBLI 2C5LC 4K7UA 4J6IA 3JSVA 1UBQA 1GJZA 1VD2A 3L10B 3ML9A 4P7IA 3VHTC 3PGEA 1TTNA 3QHTA 3B08A 2CHXA 2PPHA 2HD5B 2K8BA 2EKEC 2ZCCA 5AZFA 3RD2A 2L8JA 3A4RA 3U7DA 1V49A 3HHMA 4HWIB 2JF5A 3QARA 2CU1A 2G45B 4MJSB 3ZIMA 3I3TB 3VFKA 3WANA 3ZLZA 3KYCD 1ZW7A 3A1QB 3PHWB 1UZXB 2ZCBA 2LGXA 2UYZB 1WMHB 4ICUA 1NI2A 3UINB 2ZEQA 2LXAA 1E8WA 1R4MI 5D94A 4A3PA 3UQAA 4I6NB 4XC2A 2C7NB 2DYBA 4K81A 3QQ8B 3IBEA 2O6VA 2LXCA 3NY5A 3P2BA 2GBMA 4M8NA 2FUHB 4RM9A 2NR2A 4LJOB 1OTRB 3WAPA 4F7ZA 1QZEA 3DVGX 4K7WA 2WWZA 4JGHB 1WZ0A 1YX6B 4HDOA 3OLMD 3TBLD 3PV1A 4A20A 1Z2MA 3A33B 3UF8A 3X23A 1C1YB 3QK0A 2JWZA 2M17A 3DDCB 1TGZB 3K9OB 3GOEA 2LJ5A 1UBIA 1V2YA 5JHAA 1P1AA 2XK5A 3JVZX 2D11A 3UIPB 1I35A 1C3TA 4KDLB 2MBBB 4AWJA 3GZNI 3VQIA 4IM3A 3CF6E 3ZO5B 2JVCA 2DHZA 2XBBC 2D3GA 3TIXA 5KHQA 4MGYE 2EMTA 4FJZA 4MM3A 1WRDB 2JZ3B 3M3JA 1A5RA 2KANA 4WJQA 5DPSA 1IP9A 3VUXA 1SE9A 2HJ8A 1LXDA 4WAAA 4MGZE 4MJSA 2KHWB 2KWUB 3DVNU 2MQJA 3KW5B 1XD3B 2UWQA 4AUQC 3A1QA 2HTHA 1WMHA 1V5OA 4FJVB 3AU5A 4X57B 2Y5BB 3DCGA 4MEMA 2V3SA 1WXMA 3BINA 4N9F4 5DPRA 4FADA 4BKSA 3QIJA 1NDDA 2AEHA 4PS8A 4FN2A 2A5UA 1WX7A 2AL3A 4EOYA 4GIVA 4MH0E 3U30A 4AJYB 3W1YA 1ISNA 2ZZPB 1E7UA 4W9CA 4HPMB 4LDTD 2FCQA 4GDLB 4M8MA 2DYMA 4NAWB 2L0TA 4W9DA 3W1SA 3X0WA 1YJ1A 2DENB 4OVUA 1E8ZA 1E8YA 1E8XA 4KVGB 3WAOA 3ONSA 1WGYA 4KDIC 1IYFA 3APDA 3QCAA 3SHQA 1MG8A 3ZTCA 2IO1B 3RULA 4TQ0A 3NOBA 1PQSA 3HIZA 4GMVA 4BKTA 2OJRA 2JRIB 1OGWA 1J19A 4HK2A 2M4NA 2W9NA 2AWTA 3PVLA 2BYEA 2ZJDA 3VH4B 5CX3A 1D3ZA 4W9EA 4DBGA 2M0XA 2LRUA 2LD9A 2BWFA 4G3XB 3ZW3A 2LVQA 5DPWA 3S2AA 2G3QB 3O65B 4WWNA 3RYTA 3V60A 3L16A 3ML8A 3PPAA 1F9JA 4PS3A 1OQYA 4LCDE 1WE6A 4WWPA 1AARA 2M8SA 4W9KA 4ANVA 1YQBA 4ZRIA 3L08A 3H7SA 3HM6X 2NPTB 3DBHI 3LDZE 1RAXA 2XEWA 1J8CA 4HCPB 2MBEA 1IPGA 4G11A 4MSQB 5E6PA 3NHEB 2KWVB 2PEAA 3SU8X 4BVUC 3TJPA 2ZNVB 3OAWA 2DZJA 4ZRJA 3VVWB 4KZ0A 3T9LA 3PHXB 4GDLA 5FR6A 3TMPB 4NAWA 2C7MB 3JW0X 4DHZE 2BGFA 3VH3B 2G4SA 1ZGUB 2IO3B 2Z0DB 3V62A 5JH5C 3DPDA 5JHBA 2FAZA 3WIMA 5G2NA 2PJHA 3AI5A 3PRPB 3PTFC 2NBWB 5E6OA 1Q1OA 1WM3A 3U8ZA 1TZ1A 4DHJB 4FA6A 3KYDD 3A9KB 4FHJA 3V6EB 5LXIB 3R7QA 3M62B 4EZJA 4GXBA 1V6EA 4IM0A 1J0GA 2DYOA 2ZVNA 2JT4B 2FNJB 2KTFA 2GMIC 1TBEA 4IUMB 2NBUA 3R66C 1V86A 4JL9A 5CHFA 5CHVC 4DHZB 2BYFA 3ZVVA 1E5WA 5J18A 2N4FA 2D07B 3VUWA 2KKCA 2D2QA 4BBNC 1OEYJ 3V6CB 2J0KA 4IG7B 4EZKA 4G50A 2KDFB 3KUDB 4W9FA 4NQLB 2C9WB 1WGRA 2N9XA 3QC8B 4ZRKA 2NPTA 3CSFA 4RM8A 1R4NI 2KX0A 4BFRA 2YVCA 3VTVA 2D10A 3PRMB 3ZRFA 1WX8A 3L54A 2JRHA 5CHWA 4MGIE 3B1LX 1U4AA 3ZKJC 2K6DB 3B0AA 1Q5WB 3W1SC 1KLVA 4ICVA 1WFYA 2KC2A 4B6WA 4XZ4A 1I42A 1E7VA 2KJHB 3K9PB 1WXVA 4IW0A 1SIFA 5C1ZA 2DX5B 1UGMA 4JQWC 2LGDA 1WZ3A 3H6NA 1L2NA 3M95A 2LGYA 1L7YA 1GNUA 3RUIB 4I6PA 2L76A 2C7HA 2MX2A 2O6VD 3TL5A 2WDTB 3PS6A 3ZDMC 4JIOU 2V4LA 2MLBA 4TV3A 2N9PC 4DXAB 4PYUA 2ZPYA 3EC8A 3T8MA 1VCBA 2KJRA 2N1WA 3A9KA 3H9DA 4E71A 4TUUA 4B9KA 2R2QA 3QWZB 4NNJB 1H8CA 5C23A 3UIOB 1P98A 4NJ6A 1ZKHA 1M94A 3M63B 4ANXA 1KJTA 2KQ7A 5IAAC 2AL6A 2K25A 2KDIA 2KK8A 2N9EB 3AXCA 3OJ4B 4AP4C 4ASWC 2ASQA 3ZNZB 4FULA 4MSMB 2IY0B 2N7DA 4PYZA 2FIFA 2MW5A 2ZPNA 3IG3A 5GMVA 2CR5A 4CYEA 3UGBB 1WGGA 4GDKB 4M0WB 2C60A 4B95A 2KLCA 3NZUA 5L83A 2JZZA 2N7EA 4AJWA 4GN1A 4W9HA 4DK5A 2BPSA 2KFKB 2NVUI 2RR9A 3AU4A 1V80A 4MDKE 3ZUNA 2JPHA 3N32A 5L95C 1P0RA 3IFWB 4DDID 5D6JB 4EZLA 1EUVB 2MBOA 3VUYA 3PSEB 2MP2B 5BO4B 2KO3A 2MSED 3DBSA 3N3KB 2J0MA 2KWCA 4EEWA 1V9JA 2K6QA 4RMAA 3AULA 2JUOA 5AZGA 2FIDA 1K8RB 4W9JA 3A4SC 1Q0WB 3C0RB 4IC7B 4FBJB 3L17A 3LJ3A 1WF9A 1WR1A 3APCA 2BKFA 2MA9B 3H1UA 1RRBA 5KHOA 2DZIA 4F8CB 2R2OA 4CO7A 2J7QB 4BKSD 1KOTA 1WYWB 3KH0A 2OOBB 3ENEA 4LDTB 4ANUA 5JZEB 4FJYA 2LVOA 2REXA 2O2VB 4G0NB 4IWPA 2KLGA 4NY0A 1XT9B 2JXXA 4WQOB 1YIWA 5G55A 3ZDTA 4HCNB 2CHWA 1HE8A 2MRPA 3VTWA 2Z59B 2BYVE 5CTRC 4W9LA 3PLUA 3A9JB 2M1MA 2KN5A 4IM2A 2KFJA 2HE7A 4MGKE 2GBJA 3ZRCA 4EUTA 1Z5SB 3APFA 2B3AA 2GBRA 3Q3FA 2DZMA 1V5TA 3OJ3A 4WJPA 3R3MA 4HPLB 4GDKA 1XQQA 1RLFA 4ZDVA 2DAFA 4JLCA 5DPTA 4BOSC 2IY1B 2ZNVC 4GSWA 2L00B 2I1KA 2G4DB 1WJNA 3PREA 2V1YA 5D2MB 2KFKA 4CHKA 1GG3A 2N1VA 3JYUA 5LLIA 1EF5A 1WY8A 3KUCB 1WM2A 2LRWA 2IYDB 3SD5A 3V61A 4WWOA 3RCZA 2NS5A 1S3SG 1P9DU 1EO6A 2MP2A 4IWOA 4K7SA 2L0FA 4II3B 2WX0A 3DVGY 2K1FA 3EFUA 4KIKB 4I6LB 4WJNA 1H4RA 3CMMB 1LFDA 3QA8A 4W9IA 3DBRI 1LQBA 1WGHA 2KMCA 5IA7A 3L0WB 3PLVA 4FLHA 3VAWA 4URKA 2NBVB 4II2B 1CMXB 4E3CA 3EHVA 2O2VA 2ZVOA 5AZHA 4NQKE 2AYOB 2BF8B 2KNBA 1UD7A 2KZRA 1WR6E 2LUEA 3EECA 4F1SA 5LXHA 4HVBA 1WJ4A 1WI0A 2EMSA 2GOWA 2WYQA 4LJPB 1WJUA 2CS4A 3VXWA 4ANWA 4W9GA 2LI5A 2CKHB 3VTUA 4A3OA 2RPQA 3H7PB 3ZNGC 1SGHA 2LWPA 1WXSA 3A9JA 2KMAA 3MTNB 4DDGD 3ZTDA 1E90A 4WJOA 3ECIA 1UH6A 3PRZA 1NBFC 2MBQA 3ZNHB 2GBKA 2CHZA 3PZDA 2NCNA 2L3ZA 1WJ6A 4GGQA 3BY4B 2K8HA 2FCMA 2GBNA 2KD0A 4MELA 2K39A 2BKRB 4BKGA 1YX5B 2KJ6A 3N30A 2PE6B 2KC1A 2KTRB 2FCNA 1RFAA 3IVFA 3KUZA 2IO2B 2LVPA 3RZWC 1WXAA 1P3QU 4PS7A 2DAJA 3QX1A 2KDEB 1BT0A 2KVRA 1G6JA 2Z0EB 3JSVB 1EF1A 4HLEA 3D32A 5HKHA 2I1JA 4IWQA 4KIKA 5AEKB 2IZVB 1V81A 3VDZA 4HJKA 4NJ7A 5D7GA 2VRRB 4E74A 3WAMA 1LM8B 2MCNB 3RZFA 2RD0A 1JRUA 3WA0A 2KOXA 3CSTA 5E6NA 4HDQA 4GU2A 3RT3B 2WX1A 1WE7A 4YL8A 2KQSA 1Y8RC 2LASA 3KVFB 5TR5A 4KV2A 4KSLC 3TCAA 1UELA 3DVNV 5EDSA 5J17A 2L7RA 3MHSD 1WIAA 4FHKA 4DWFA 4NPNA 3IHPC 3HM3A 2LZ6A 2MWSB 3SDLC 4GOCA 3NZSA 2YLMA 3H7PA 3NS8A 2O6VB 2L05A 4OVVA 2KX3A 3Q3JA 1X1MA 2RGFA 4EFOA 1FXTB 1GC7A 3ALBA 4AOFA 2DZKA 5DCNA 2A4ZA 4TQ1A 3UQBA 2RSUA 4HXDA 1GUAB 1WX9A 3MJWA 4KSKC 3QJZA 4GB9A 1T0YA 2IBIB 2MBHA 4DHJD 4EKUA 2FCSA 1KM7A 1WGDA 2KXJA 4TKNA 2J0JA 2IO0B 1GC6A 2BWES 3DQVA 1S1QB 2JY6A 2PE9A 2KTRA 2QHOA 4K1RB 1YD8U 3R7RA 3WALA 4BBNF 2KDBA 4ZYNA 4BOZB 2XK5B 4XX5A
chains in the Genus database with same CATH superfamily
5J2RA 1QLBB 3L13A 3DOWA 3I9V1 1P7FA 4J6IA 1AN8A 3ML9A 3VHTC 3PGEA 1TTNA 3B08A 5D3DA 2K8BA 2R61A 2BS2B 1T3QA 4MJSB 2CU1A 2G45B 2K3UA 3I3TB 3KYCD 3A1QB 2ZCBA 1N63A 1WMHB 5D94A 3AECB 1PGBA 2G9HD 4N59A 1YN5A 2WXFA 1N5WA 3NY5A 2YEPB 2GBMA 4LJOB 4F7ZA 3DVGX 4IKGA 1MHHE 5BYQA 2BYTA 3TSSA 3DDCB 1TGZB 2D11A 1C3TA 1Q10A 3EFCA 4IM3A 3CF6E 3ZO5B 1D5MC 2DHZA 1I4RA 2XBBC 4FXCA 4MGYE 4FJZA 4MM3A 3M3JA 4ZHOA 4XGAB 1L4ZB 4WURA 1V1PA 4YSXB 1SE9A 2ZW0A 1LXDA 4WAAA 5BMIA 3RNGC 2MJEA 3LB8C 1V5OA 2PMVA 4X57B 4LNKA 1XCTL 1GB4A 1WXMA 2WXPA 4BKSA 4PS8A 4EOYA 4OZAA 1ISNA 4HPMB 2FCQA 4M8MA 2DYMA 4RGTA 1E8ZA 3B2GA 4KVGB 1CK1A 2DLBA 3SHQA 1MG8A 2JYEA 1KFYB 2IO1B 3NOBA 2OJRA 1OGWA 1AYFA 2W9NA 2BYEA 1D3ZA 1MPEA 1HZ5A 3HVZA 2LD9A 4WH4A 3V60A 3AN1A 1DOYA 4AS1A 3MC9A 3UI3A 2WXGA 2AQ3B 1OQYA 2SAKA 3FILA 4ANVA 4ZRIA 4ARCA 4ACFA 3DBHI 2IGGA 1RAXA 4HCPB 2MBEA 2DZJA 3NG0A 3AE4B 1PYWD 4GDLA 3TMPB 1NYRA 5EE1A 1IGCA 3VH3B 5JH5C 1AWDA 3KWVA 2NBWB 3NS1A 1Q1OA 2INPE 5HI1A 3A9KB 5LXIB 1V6EA 1L6UA 2FNJB 4L2YA 3R66C 1V86A 2BYFA 3N20C 3VUWA 4BBNC 1UWXA 4IG7B 2KDFB 2ZW1A 1E7PB 4NQLB 3VR9B 1WGRA 2N9XA 3QC8B 1HEZE 3DHGC 3CSFA 3J9CA 4RM8A 1KLGD 3P1MA 2KX0A 4BFRA 2YVCA 4TSSA 5CHWA 3RNAC 3RNFC 2K6DB 3B0AA 1Q5WB 1I4PA 3W1SC 2KJHB 1GPXA 4RGOS 1I4QA 5C1ZA 4YSZB 3RUIB 4I6PA 4P1BC 2GI9A 2WDTB 3PS6A 4JIOU 4TV3A 4N58A 2KJRA 4TUUA 4B9KA 4NNJB 1IBXA 5C23A 3UIOB 4ZHPA 1KJTA 2KQ7A 1EWCA 2KDIA 2KK8A 4IDIA 4ASWC 5JXVA 2WU2B 3AE2B 2WXMA 2CR5A 2OEDA 4GDKB 3Q2AC 4B95A 5L83A 4AJWA 4GN1A 4W9HA 2KFKB 2PTLA 1C4PA 4MDKE 5AUIA 2WGSA 3IFWB 3NZ3A 4RF1A 2D3BA 2KYWA 2MBOA 4ZOHC 1V9JA 1FNWA 3AH7A 3URYA 1HA5A 1Q0WB 3C0RB 4HKQA 3L17A 1N61A 2BKFA 2R2OA 4LDTB 5JZEB 1FPYA 2LVOA 4FJYA 4RGNA 3RMKC 3ZDTA 2EKIA 2WS3B 3BYYB 2KFJA 1CJEA 1L0VB 3ZRCA 3APFA 5BMGA 5HG2A 2GBRA 4MM3B 3OJ3A 3V05A 1XQQA 4M0WA 5DPTA 3GB1A 1OQRA 3PREA 2V1YA 1GG3A 1FXIA 1WY8A 3KUCB 2JZPA 2IYDB 1JWUD 2DWQA 4HJGE 4BZAA 2NS5A 2J42A 1P9DU 4IWOA 4KIKB 3EFUA 1K50A 4L1BA 4EE2A 1QKZA 4WJNA 1H4RA 3SR6A 3LYYA 1TY2A 1DOXA 2KMCA 5IA7A 3PLVA 1JWMD 3VAWA 3EHVA 2O2VA 5AZHA 4NQKE 1WR6E 4C00A 1EU4A 4HVBA 2WYQA 4LJPB 4W9GA 2LI5A 2WDVB 2HJ1A 3H7PB 4KGRA 4DDGD 4JPSA 3ZTDA 1E90A 1RFKA 4RCOA 1UH6A 2D5GA 3RI7C 3TEZA 1T0RC 2MBQA 3ZNHB 2CHZA 1ESFA 1E9MA 4BKGA 3IXSA 3NJTA 2PE6B 5GXGB 3IVFA 3TEXA 3RZWC 1P3QU 4HROA 1WXQA 1BT0A 2CJOA 3JSVB 1EF1A 3P4RB 1V81A 2QDFA 1JRUA 3ZXRA 1KTKA 3PO0A 5BYRA 4LK0M 1TZOA 2ACZB 3RT3B 3KLSX 1VDVA 2KQSA 2WLBA 4KV2A 4KSLC 3DVNV 1WIAA 2J4XA 4FHKA 3U4EG 1WGKA 4NPNA 3HM3A 3N1XC 2Y5CA 2LZ6A 3NZSA 2YLMA 2IDYA 2PKOA 4OVVA 3Q3JA 5G5GA 4A8XC 2QEJC 1BMLC 4A9AA 5DCNA 3DHIC 4TQ1A 1WX9A 3QJZA 4P6VF 2J0JA 2IO0B 3NUHB 1GC6A 3DQVA 1K51A 2JY6A 2NMQA 2QHOA 3Q8BA 2W3SA 1YQ4B 3HK0A 4N6EB 3QAQA 2C5LC 2H89B 1XF5L 1ACCA 2PPHA 2PVOD 2HD5B 2EKEC 5AZFA 3A4RA 1V49A 1YNTE 2KACA 1F1HA 3QARA 4OVZA 2M0AA 3VFKA 3WANA 3N1ZC 5C2TB 2UYZB 1RM6C 1NI2A 4JX1C 3EGRA 4NZLB 1R4MI 2J53A 2LEKA 4WAFA 4K81A 1HXYD 2O6VA 3IBEA 2LXCA 3P2BA 1WSPA 4M8NA 2NR2A 2WU5B 2MJDA 1OTRB 3WAPA 2D3CA 1QZEA 1V8CA 2WWZA 1YX6B 3OLMD 3TBLD 3P4QB 1TKYA 3QK0A 1I35A 2XK5A 2MBBB 3GZNI 3I57A 2JVCA 2D3GA 3TIXA 5KHQA 3RNCC 2JZ3B 4C4VA 1ZE3D 1WYGA 1AW7A 2HJ8A 4YWGG 5FKAC 2KWUB 2MQJA 1XD3B 4ZRPA 2HTHA 4YTMB 5IP4D 2Y5BB 2V3SA 1JQ4A 5BMHA 4FADA 2ICIA 3QIJA 1ZXIA 4AJYB 3W1YA 1E7UA 1RYJA 3BVZA 4LDTD 3ZGZA 1FEHA 1JROA 1YJ1A 1T6BX 2DENB 2LGSA 2IPKD 3AM9A 3WAOA 1FCLA 4IOIE 3ONSA 1SJED 3QCAA 1RWSA 3ZTCA 3HIZA 1J19A 1YJIA 2M4NA 2ZJDA 4C7YA 2PW9A 3SFEB 2BWFA 1JRPA 1C78A 2LVQA 1I4GA 2G3QB 5IN7A 4P16A 2HTME 4PS3A 4UDUC 2V9HA 4WWPA 4W9KA 5MPOA 1YQBA 3BVGA 2LUMA 1XLQA 3AMZA 3AE1B 2BQQA 4K3CA 2RMMA 1J8CA 1CQVA 2LGIA 1IPGA 3NHEB 1Y56A 4BVUC 2BVCA 3VVWB 4CQNA 3PHXB 4NAWA 2C7MB 2HDEA 2JU6X 4DHZE 3LXFA 1ZGUB 1K52A 3V62A 5JHBA 3C19A 2J52A 3FC4A 3AI5A 1ET6A 5E6OA 3BWUD 4DHJB 3KYDD 1TKEA 1XO3A 3RPFC 3P63A 4GXBA 4EZJA 2JT4B 2JSVX 4DHZB 1C77A 2CU3A 1E5WA 2D07B 3TEYA 2SEBD 2D2QA 2KN4A 2J0KA 4G50A 2NPTA 1QT9A 1SB3C 3OG5A 3VTVA 1TYGB 2N0SB 3L54A 1B9RA 3B1LX 1KLVA 2M19A 3NVYA 4ICVA 2KC2A 1YOVB 2PIAA 1P7EA 1I42A 1E7VA 3K9PB 3KQ4A 1SIFA 2DX5B 3NVWA 1L2NA 1L7YA 1GNUA 2C7HA 1R4MB 2L52A 3ZDMC 2V4LA 1ZOYB 4DXAB 3AEDB 3T8MA 1VCBA 3H9DA 2V0GA 1FFVA 2UU7A 3IT4B 3QWZB 1H8CA 3ZQ4A 1N6ZA 1P98A 4OZBA 1OQQA 1PGXA 1KH0A 2AL6A 4KX6B 1SE3A 2WXKA 4FULA 4B0EA 1FRRA 1JMLA 2C60A 3GZNB 3NZUA 1YJJA 2N7EA 1QOBA 2NVUI 3ZUNA 1V80A 3P4SB 1P0RA 1F77A 2I2YA 1EUVB 2MP2B 2KO3A 2J0MA 2KWCA 4EEWA 3AULA 2JUOA 5AZGA 5T8IA 2FIDA 3A4SC 2VH1A 4IC7B 3LJ3A 1WR1A 3APCA 1FXAA 2MA9B 3H1UA 5KHOA 4F8CB 4CO7A 4DXFA 3KH0A 2OOBB 3ENEA 1FO4A 3AE3B 5H8YE 1HTQA 4G0NB 4IWPA 3SFDB 2L83A 4C7ZA 1BXTA 4HCNB 2GB1A 2MH7A 2Z59B 3Q3OC 2BYVE 4USAA 4W9LA 3PLUA 2M1MA 3TEWA 4D2KA 1GOZA 2RDGA 2G1EA 4MGKE 2GBJA 1IUEA 2LMCA 1V5TA 4C4VB 2YEPF 4HPLB 2DAFA 2EELA 2IY1B 4BOSC 2K9XA 4GSWA 2I1KA 2G4DB 4CHKA 5LLIA 1C79A 1WM2A 4K3BA 1N62A 2CJNA 3RCZA 1JWAD 2XN9C 4II3B 3PZ8A 5IO9A 1EU3A 3CMMB 4M00A 4W9IA 3DBRI 1F0ZA 1CZPA 2WXNA 4RH6A 1ET9A 1XCQL 1CMXB 3VRBB 2BBCA 2AYOB 2KNBA 1M4VA 1UD7A 2WXOA 4F1SA 1WJ4A 1WI0A 2CKHB 3HVDA 4A3OA 2RPQA 4QAYA 3ZNGC 2KWDA 3A9JA 3OWEB 3PRZA 2RDBC 2BS3B 2GBKA 3BY4B 2PLPA 2K39A 3TUOA 2BKRB 4LNIA 2V4IB 3N30A 3ZXVA 2KTRB 3ZJVA 2QC8A 1ZXHA 2ON8A 2KAJA 2KVRA 2E3TA 2IGDA 4NJ7A 4OZCA 3RNEC 5D7GA 4KGSA 4L23A 4E74A 2MCNB 3WA0A 2BB5A 1N60A 2N9LA 1TY0A 1Y8RC 2LASA 3KVFB 1UELA 5EDSA 2WHIA 4DWFA 4LTUA 2DBYA 3AB5A 4GOCA 1MI0A 1MHXA 1KLUD 1JWBD 3CIRB 2KX3A 2RGFA 3ALBA 4MACA 3UQBA 2RSUA 4HXDA 2K22A 2XNAC 4KSKC 4DHJD 4EKUA 2FCSA 2KXJA 2BWES 4JE3B 3R2TA 1S1QB 1NVID 4K1RB 2K8CA 3ZNID 1OEYA 3DBLI 4K7UA 4OW0A 2W82A 3GE8C 4P7IA 3Q8FA 4R3DA 1PFDA 2ZCCA 1V1PB 2L8JA 3RD2A 3U7DA 1TJEA 3MP9A 2JF5A 3P42A 3ZIMA 2V3PA 2KVZA 1ZW7A 1UZXB 2AQ2B 3UINB 1C4AA 3UQAA 5EE0A 4I6NB 2C7NB 1V97A 3GS2A 1XLPA 3DBHB 4RM9A 2Q5WD 4JWSC 4K7WA 4JGHB 4YTPB 1WZ0A 1ZDXA 4HDOA 2W3RA 1Z2MA 3UF8A 2M17A 3K9OB 2LJ5A 1V2YA 2L1AA 3JVZX 3ZJUA 4AWJA 1SIJA 2EMTA 1WRDB 3IT6B 4XE0A 2KANA 4WJQA 3NVZA 1TKGA 3VUXA 3FILB 3Q14C 1MFWA 3GP7A 4MGZE 3AV8A 4HPPA 3U7ZA 4MJSA 2KHWB 3DVNU 2UWQA 4AUQC 5LNK1 3A1QA 1D6EC 1WMHA 2Y5PA 4FJVB 2MJ3A 3RN9C 1I4HA 5IKCM 4FN2A 2A5UA 2ZZPB 1FNUA 4W9CA 1F52A 4GDLB 3X0WA 4W9DA 3W1SA 4LLGM 4OVUA 3DWGC 1E8YA 3AE6B 1WGYA 1ZPSA 4GMVA 4BKTA 3PVLA 2AWTA 4XDCA 1QOGA 3NRZA 3NVVA 4W9EA 2LRUA 1SJHD 1LGRA 3ZW3A 3Q3NC 3S2AA 5DPWA 4WWNA 3BVMA 3PPAA 1F9JA 4ARIA 3AE7B 3VR8B 1SF0A 1YN3A 3ZJTA 1N5XA 3HUIA 3U52E 4G11A 4MSQB 2X8XX 5E6PA 2KWVB 2PEAA 5FR3A 1T0QC 3TJPA 2ZNVB 3OAWA 1HQRD 1SXTA 3N9YC 2M56B 3IAM1 3Q8EA 3T9LA 5FR6A 2G4SA 1PDXA 2Z0DB 3PRPB 1WM3A 3U8ZA 4RF0A 2ONQA 4FHJA 3V6EB 2LJIA 3R7QA 4DXGA 2QCZA 3M62B 4WQMA 1IBXB 5E6JA 2N9KA 2KTFA 2GMIC 2QMTA 4XDDA 5CHVC 2NTSA 2N4FA 2KKCA 1OEYJ 2GLSA 2QJLA 3V6CB 1J7AA 4EZKA 1T5XD 1D5ZC 3KUDB 4W9FA 4ZRKA 3DBLB 1C9FA 1GAQB 3PRMB 1U4AA 1XEEA 2LHEA 1WFYA 4B6WA 3AEEB 3AE5B 1WXVA 3V3XA 1F2RI 1UGMA 4JQWC 1EM7A 5HHDG 1L5PA 4PK1A 2L76A 2MX2A 3TL5A 2MLBA 2V3NA 4PYUA 1SSNA 2N1WA 3A9KA 4HEA1 1XLNA 1V1OA 1VRAB 2LHDA 4NJ6A 2OJWA 1ZKHA 1M94A 4M02A 3M63B 2RPVA 3B9JA 4AP4C 3OJ4B 2K25A 2N9EB 1HTOA 3ZNZB 4MSMB 2IY0B 3Q69A 2MW5A 2ZPNA 3IG3A 5GMVA 4O1NA 1WGGA 5EE9A 4M0WB 2KLCA 3MJ5A 2RR9A 2JPHA 1VJKA 3GE3C 4DDID 5D6JB 4EZLA 2Y3AA 5BO4B 4KKJA 2BT6A 3MC0B 3N3KB 2K6QA 1VR9A 2JYTA 4W9JA 1K8RB 4FBJB 2BB6A 4J3OD 1SEBD 2DZIA 4BKSD 2WQYB 1WYWB 2LFIA 2O2VB 3P4PB 4DQOC 1YIWA 2IGHA 5G55A 4ITKA 1PUTA 2CHWA 1HE8A 3VTWA 1K53A 1UF0A 2FBWB 2KN5A 2WNMA 4LNFA 4EUTA 3BK1A 1Z5SB 2BW2A 2DZMA 1MJDA 3W5UB 4WJPA 3R3MA 4GDKA 1RLFA 4ZDVA 4JLCA 2ZNVC 1QQRA 2L00B 5D2MB 3IAS1 2KFKA 2WP9B 3JYUA 1EF5A 1HZ6A 3SD5A 3V61A 4WIPA 3T3OA 1VZ8A 1S3SG 2W54A 1EO6A 2L0FA 2WX0A 3L4PA 3MFGA 4I6LB 3QA8A 1LQBA 1WGHA 3L0WB 1ZP0B 1UGJA 4FLHA 1JALA 1XLOA 2WDQB 2ZVOA 2BF8B 2KZRA 2LUEA 3EECA 2EMSA 2GOWA 3VXWA 1WJUA 2CS4A 4MT5A 1DYQA 1SGHA 2LWPA 2KMAA 3MTNB 3ECIA 3T3NA 1J7BA 1NBFC 2FCMA 2GBNA 2KD0A 4MELA 2KJ6A 2W55A 2FCNA 1RFAA 3KUZA 2LVPA 1WXAA 4PS7A 4XYCA 2DAJA 3QX1A 1JWSD 3C8YA 2KDEB 1ROEA 3D32A 2I1JA 1ZDVA 4IWQA 4KIKA 5AEKB 3VDZA 4HJKA 4NAMA 3PZ7A 1NEKB 3AEGB 3WAMA 3RZFA 2KMMA 5TSSA 3CSTA 1WE7A 5TR5A 3TCAA 1SE4A 4HKZE 2JX5A 3FAHA 3IHPC 3SDLC 1L0YB 3H7PA 3NS8A 1TIFA 2NTTA 2O6VB 2DZKA 2A4ZA 3E56A 1SE2A 3N1YC 2RDHA 3VRAB 1T0SC 4GB9A 2MBHA 1KM7A 1WGDA 4OHJA 4TKNA 1ENFA 1DGJA 1YD8U 3R7RA 3WALA 4BBNF 2KDBA 4BOZB 2XK5B 2X38A 1WH3A 4KZCA 3PT2B 3JSVA 1UBQA 1OFFA 1GJZA 1VD2A 3L10B 3R2IA 1JW9D 1KRHA 3QHTA 2CHXA 3HHMA 4HWIB 1TT5B 2L32A 2WXQA 3ZLZA 3PHWB 2LGXA 4ICUA 1UUPA 2ZEQA 2LXAA 1ZUD2 1FD6A 1E8WA 4A3PA 1VLBA 4XC2A 2OHFA 2DYBA 2WXRA 3QQ8B 1FCCC 4ZYSA 2Z8LA 1C76A 2FUHB 1R7SA 4XWWA 1MG4A 4HRSA 3EA6A 4C56C 1TS2A 1PGAA 5BYSA 3PV1A 2IJ0A 4A20A 3A33B 3X23A 1C1YB 2JWZA 4YT0B 2E6XA 3GOEA 1UBIA 5JHAA 1P1AA 3UIPB 4KDLB 3VQIA 2VZKB 3KWLA 5G5HA 1NENB 1A5RA 1FNVA 5DPSA 1IP9A 3ETRA 4GLSC 4YXDB 1QILA 3AEBB 4YSYB 3ZYYX 3KW5B 2WXLA 3AU5A 1TS3A 3DCGA 4MEMA 1YQ3B 1IGDA 3BINA 4N9F4 1JCKB 5DPRA 2WXHA 2K0PA 1NDDA 2AEHA 1WX7A 2AL3A 4GIVA 4MH0E 1I4XA 4WWMA 3U30A 4NAWB 2L0TA 2BTEA 1E8XA 1FIQA 4KDIC 1IYFA 3APDA 2KDMA 2QSDA 3RULA 4TQ0A 1PQSA 1L0XB 2JRIB 4HK2A 3VH4B 4S0RA 5CX3A 3AE8B 4DBGA 2M0XA 4US9A 4M01A 4G3XB 3O65B 3RYTA 3L16A 3ML8A 4Q2JA 4A6QA 4LCDE 1WE6A 2INNE 1AARA 2M8SA 3L08A 3H7SA 3HM6X 2NPTB 4S17A 3LDZE 2KQ4X 1F2RC 2XEWA 3SU8X 4ZRJA 2AQ1B 4KZ0A 3H8HA 4JWUC 3JW0X 2BGFA 3DWMA 2IO3B 5FK9C 3DPDA 3I63C 2FAZA 3WIMA 5G2NA 2PJHA 2GRIA 5H92C 2QIEB 3PTFC 5AUKA 2VH2A 3E9SA 1TZ1A 3SEBA 4FA6A 1QF6A 1J0GA 4IM0A 2DYOA 2ZVNA 1TBEA 2KT7A 4IUMB 2NBUA 5CHFA 4JL9A 4ZRQA 2FE8A 1WWTA 3ZVVA 5J18A 3CWIA 2FUG1 2AX5A 4RNAA 2C9WB 4LNNA 2H88B 4YTNB 1R4NI 4TMAB 1I7HA 2D10A 3ZRFA 1WX8A 2JRHA 3DHHC 4MGIE 3ZKJC 1STEA 4XZ4A 1WRIA 4IW0A 3W2DA 2LGDA 2BS4B 1WZ3A 3H6NA 4LNOA 3M95A 2LGYA 1QOAA 1LO5D 1L4DB 3BIID 2O6VD 3ABVB 1E6EB 1L6VA 2N9PC 2ZPYA 4H2AA 1NYQA 3EC8A 3RFZB 3DBRB 4E71A 4KGTA 2R2QA 1FFUA 3Q3MC 4NJCA 4ANXA 5IAAC 4B0MA 3AXCA 4XWTA 2ASQA 2B76B 2N7DA 4PYZA 2FIFA 4CYEA 3UGBB 1MVKA 1BUIC 3AE9B 2WXIA 2JWUA 2JZZA 1C4CA 4DK5A 2BPSA 3AU4A 3N32A 4BAXA 5L95C 2INDC 5HFYA 1UNSA 3VUYA 3PSEB 2MSED 3DBSA 4RGMA 1B1ZA 2TSSA 4RMAA 1WF9A 1RRBA 1KOTA 2J7QB 3HRDD 3MC8A 4ANUA 2JXTA 1TS4A 2REXA 2KLGA 4NY0A 1XT9B 2JXXA 4WQOB 4P1CC 2WDRB 2N7JA 5I4DA 1QOFA 2MRPA 1FRDA 5CTRC 4C80A 4US8A 3A9JB 4IM2A 1E10A 2HE7A 2B3AA 3Q3FA 1UWMA 4RFBA 2VZKD 2INCC 1WJNA 2N1VA 3U2SC 2LRWA 3R8BA 2I38A 1VZ7A 4WWOA 1A70A 2MP2A 4K7SA 4A90A 3DVGY 2K1FA 3BYTB 2MEKA 1LFDA 1EWYC 1D5XC 3I5JC 4URKA 1YMHE 2NBVB 4II2B 4E3CA 3W5VB 1DOIA 5LXHA 3Q8AA 3EUB2 5EE3A 4MH8A 3FKYA 3Q8CA 4ANWA 3AEAB 3O13A 5D3IB 3VTUA 3AEFB 1WXSA 4WJOA 3PZDA 5C3JB 2NCNA 2L3ZA 1WJ6A 4GGQA 2K8HA 2WXJA 1FM0D 4AQ7A 1YX5B 4PT5A 1J7CA 2KC1A 2IO2B 4KKIA 3MHZA 1G6JA 2Z0EB 4HLEA 5HKHA 2D3AA 2IZVB 2JQRB 2DNFA 3WCQA 2VRRB 2K5PA 1LM8B 1R4NB 1D4BA 2RD0A 1E0ZA 2KOXA 5E6NA 4HDQA 4GU2A 2WX1A 3BZDB 1GB1A 3BK2A 4YL8A 1KF6B 2MHJA 2PVGC 5J17A 2L7RA 1SBBB 3B2FA 3MHSD 1XXGA 4A55A 4REZA 3W9CB 2MWSB 1NI3A 1TS5A 2L05A 1VZ6A 1X1MA 4EFOA 1FXTB 1GC7A 4AOFA 1GUAB 1YN4A 3MJWA 1T0YA 2IBIB 1FMAD 3RNBC 2QILA 2PE9A 2KTRA 5IOIA 3Q6BA 4ZYNA 4XX5A
chains in the Genus database with same CATH topology
2K8CA 3HK0A 1WH3A 3ZNID 5J2RA 1OEYA 4KZCA 3PT2B 3QAQA 3L13A 3DOWA 3DBLI 2C5LC 4K7UA 4J6IA 3JSVA 1UBQA 1GJZA 1VD2A 3L10B 3ML9A 4P7IA 3VHTC 3PGEA 1TTNA 3QHTA 3B08A 2CHXA 2PPHA 2HD5B 2K8BA 2EKEC 2ZCCA 5AZFA 3RD2A 2L8JA 3A4RA 3U7DA 1V49A 3HHMA 4HWIB 2JF5A 3QARA 2CU1A 2G45B 4MJSB 3ZIMA 3I3TB 3VFKA 3WANA 3ZLZA 3KYCD 1ZW7A 3A1QB 3PHWB 1UZXB 2ZCBA 2LGXA 2UYZB 1WMHB 4ICUA 1NI2A 3UINB 2ZEQA 2LXAA 1E8WA 1R4MI 5D94A 4A3PA 3UQAA 4I6NB 4XC2A 2C7NB 2DYBA 4K81A 3QQ8B 3IBEA 2O6VA 2LXCA 3NY5A 3P2BA 2GBMA 4M8NA 2FUHB 4RM9A 2NR2A 4LJOB 1OTRB 3WAPA 4F7ZA 1QZEA 3DVGX 4K7WA 2WWZA 4JGHB 1WZ0A 1YX6B 4HDOA 3OLMD 3TBLD 3PV1A 4A20A 1Z2MA 3A33B 3UF8A 3X23A 1C1YB 3QK0A 2JWZA 2M17A 3DDCB 1TGZB 3K9OB 3GOEA 2LJ5A 1UBIA 1V2YA 5JHAA 1P1AA 2XK5A 3JVZX 2D11A 3UIPB 1I35A 1C3TA 4KDLB 2MBBB 4AWJA 3GZNI 3VQIA 4IM3A 3CF6E 3ZO5B 2JVCA 2DHZA 2XBBC 2D3GA 3TIXA 5KHQA 4MGYE 2EMTA 4FJZA 4MM3A 1WRDB 2JZ3B 3M3JA 1A5RA 2KANA 4WJQA 5DPSA 1IP9A 3VUXA 1SE9A 2HJ8A 1LXDA 4WAAA 4MGZE 4MJSA 2KHWB 2KWUB 3DVNU 2MQJA 3KW5B 1XD3B 2UWQA 4AUQC 3A1QA 2HTHA 1WMHA 1V5OA 4FJVB 3AU5A 4X57B 2Y5BB 3DCGA 4MEMA 2V3SA 1WXMA 3BINA 4N9F4 5DPRA 4FADA 4BKSA 3QIJA 1NDDA 2AEHA 4PS8A 4FN2A 2A5UA 1WX7A 2AL3A 4EOYA 4GIVA 4MH0E 3U30A 4AJYB 3W1YA 1ISNA 2ZZPB 1E7UA 4W9CA 4HPMB 4LDTD 2FCQA 4GDLB 4M8MA 2DYMA 4NAWB 2L0TA 4W9DA 3W1SA 3X0WA 1YJ1A 2DENB 4OVUA 1E8ZA 1E8YA 1E8XA 4KVGB 3WAOA 3ONSA 1WGYA 4KDIC 1IYFA 3APDA 3QCAA 3SHQA 1MG8A 3ZTCA 2IO1B 3RULA 4TQ0A 3NOBA 1PQSA 3HIZA 4GMVA 4BKTA 2OJRA 2JRIB 1OGWA 1J19A 4HK2A 2M4NA 2W9NA 2AWTA 3PVLA 2BYEA 2ZJDA 3VH4B 5CX3A 1D3ZA 4W9EA 4DBGA 2M0XA 2LRUA 2LD9A 2BWFA 4G3XB 3ZW3A 2LVQA 5DPWA 3S2AA 2G3QB 3O65B 4WWNA 3RYTA 3V60A 3L16A 3ML8A 3PPAA 1F9JA 4PS3A 1OQYA 4LCDE 1WE6A 4WWPA 1AARA 2M8SA 4W9KA 4ANVA 1YQBA 4ZRIA 3L08A 3H7SA 3HM6X 2NPTB 3DBHI 3LDZE 1RAXA 2XEWA 1J8CA 4HCPB 2MBEA 1IPGA 4G11A 4MSQB 5E6PA 3NHEB 2KWVB 2PEAA 3SU8X 4BVUC 3TJPA 2ZNVB 3OAWA 2DZJA 4ZRJA 3VVWB 4KZ0A 3T9LA 3PHXB 4GDLA 5FR6A 3TMPB 4NAWA 2C7MB 3JW0X 4DHZE 2BGFA 3VH3B 2G4SA 1ZGUB 2IO3B 2Z0DB 3V62A 5JH5C 3DPDA 5JHBA 2FAZA 3WIMA 5G2NA 2PJHA 3AI5A 3PRPB 3PTFC 2NBWB 5E6OA 1Q1OA 1WM3A 3U8ZA 1TZ1A 4DHJB 4FA6A 3KYDD 3A9KB 4FHJA 3V6EB 5LXIB 3R7QA 3M62B 4EZJA 4GXBA 1V6EA 4IM0A 1J0GA 2DYOA 2ZVNA 2JT4B 2FNJB 2KTFA 2GMIC 1TBEA 4IUMB 2NBUA 3R66C 1V86A 4JL9A 5CHFA 5CHVC 4DHZB 2BYFA 3ZVVA 1E5WA 5J18A 2N4FA 2D07B 3VUWA 2KKCA 2D2QA 4BBNC 1OEYJ 3V6CB 2J0KA 4IG7B 4EZKA 4G50A 2KDFB 3KUDB 4W9FA 4NQLB 2C9WB 1WGRA 2N9XA 3QC8B 4ZRKA 2NPTA 3CSFA 4RM8A 1R4NI 2KX0A 4BFRA 2YVCA 3VTVA 2D10A 3PRMB 3ZRFA 1WX8A 3L54A 2JRHA 5CHWA 4MGIE 3B1LX 1U4AA 3ZKJC 2K6DB 3B0AA 1Q5WB 3W1SC 1KLVA 4ICVA 1WFYA 2KC2A 4B6WA 4XZ4A 1I42A 1E7VA 2KJHB 3K9PB 1WXVA 4IW0A 1SIFA 5C1ZA 2DX5B 1UGMA 4JQWC 2LGDA 1WZ3A 3H6NA 1L2NA 3M95A 2LGYA 1L7YA 1GNUA 3RUIB 4I6PA 2L76A 2C7HA 2MX2A 2O6VD 3TL5A 2WDTB 3PS6A 3ZDMC 4JIOU 2V4LA 2MLBA 4TV3A 2N9PC 4DXAB 4PYUA 2ZPYA 3EC8A 3T8MA 1VCBA 2KJRA 2N1WA 3A9KA 3H9DA 4E71A 4TUUA 4B9KA 2R2QA 3QWZB 4NNJB 1H8CA 5C23A 3UIOB 1P98A 4NJ6A 1ZKHA 1M94A 3M63B 4ANXA 1KJTA 2KQ7A 5IAAC 2AL6A 2K25A 2KDIA 2KK8A 2N9EB 3AXCA 3OJ4B 4AP4C 4ASWC 2ASQA 3ZNZB 4FULA 4MSMB 2IY0B 2N7DA 4PYZA 2FIFA 2MW5A 2ZPNA 3IG3A 5GMVA 2CR5A 4CYEA 3UGBB 1WGGA 4GDKB 4M0WB 2C60A 4B95A 2KLCA 3NZUA 5L83A 2JZZA 2N7EA 4AJWA 4GN1A 4W9HA 4DK5A 2BPSA 2KFKB 2NVUI 2RR9A 3AU4A 1V80A 4MDKE 3ZUNA 2JPHA 3N32A 5L95C 1P0RA 3IFWB 4DDID 5D6JB 4EZLA 1EUVB 2MBOA 3VUYA 3PSEB 2MP2B 5BO4B 2KO3A 2MSED 3DBSA 3N3KB 2J0MA 2KWCA 4EEWA 1V9JA 2K6QA 4RMAA 3AULA 2JUOA 5AZGA 2FIDA 1K8RB 4W9JA 3A4SC 1Q0WB 3C0RB 4IC7B 4FBJB 3L17A 3LJ3A 1WF9A 1WR1A 3APCA 2BKFA 2MA9B 3H1UA 1RRBA 5KHOA 2DZIA 4F8CB 2R2OA 4CO7A 2J7QB 4BKSD 1KOTA 1WYWB 3KH0A 2OOBB 3ENEA 4LDTB 4ANUA 5JZEB 4FJYA 2LVOA 2REXA 2O2VB 4G0NB 4IWPA 2KLGA 4NY0A 1XT9B 2JXXA 4WQOB 1YIWA 5G55A 3ZDTA 4HCNB 2CHWA 1HE8A 2MRPA 3VTWA 2Z59B 2BYVE 5CTRC 4W9LA 3PLUA 3A9JB 2M1MA 2KN5A 4IM2A 2KFJA 2HE7A 4MGKE 2GBJA 3ZRCA 4EUTA 1Z5SB 3APFA 2B3AA 2GBRA 3Q3FA 2DZMA 1V5TA 3OJ3A 4WJPA 3R3MA 4HPLB 4GDKA 1XQQA 1RLFA 4ZDVA 2DAFA 4JLCA 5DPTA 4BOSC 2IY1B 2ZNVC 4GSWA 2L00B 2I1KA 2G4DB 1WJNA 3PREA 2V1YA 5D2MB 2KFKA 4CHKA 1GG3A 2N1VA 3JYUA 5LLIA 1EF5A 1WY8A 3KUCB 1WM2A 2LRWA 2IYDB 3SD5A 3V61A 4WWOA 3RCZA 2NS5A 1S3SG 1P9DU 1EO6A 2MP2A 4IWOA 4K7SA 2L0FA 4II3B 2WX0A 3DVGY 2K1FA 3EFUA 4KIKB 4I6LB 4WJNA 1H4RA 3CMMB 1LFDA 3QA8A 4W9IA 3DBRI 1LQBA 1WGHA 2KMCA 5IA7A 3L0WB 3PLVA 4FLHA 3VAWA 4URKA 2NBVB 4II2B 1CMXB 4E3CA 3EHVA 2O2VA 2ZVOA 5AZHA 4NQKE 2AYOB 2BF8B 2KNBA 1UD7A 2KZRA 1WR6E 2LUEA 3EECA 4F1SA 5LXHA 4HVBA 1WJ4A 1WI0A 2EMSA 2GOWA 2WYQA 4LJPB 1WJUA 2CS4A 3VXWA 4ANWA 4W9GA 2LI5A 2CKHB 3VTUA 4A3OA 2RPQA 3H7PB 3ZNGC 1SGHA 2LWPA 1WXSA 3A9JA 2KMAA 3MTNB 4DDGD 3ZTDA 1E90A 4WJOA 3ECIA 1UH6A 3PRZA 1NBFC 2MBQA 3ZNHB 2GBKA 2CHZA 3PZDA 2NCNA 2L3ZA 1WJ6A 4GGQA 3BY4B 2K8HA 2FCMA 2GBNA 2KD0A 4MELA 2K39A 2BKRB 4BKGA 1YX5B 2KJ6A 3N30A 2PE6B 2KC1A 2KTRB 2FCNA 1RFAA 3IVFA 3KUZA 2IO2B 2LVPA 3RZWC 1WXAA 1P3QU 4PS7A 2DAJA 3QX1A 2KDEB 1BT0A 2KVRA 1G6JA 2Z0EB 3JSVB 1EF1A 4HLEA 3D32A 5HKHA 2I1JA 4IWQA 4KIKA 5AEKB 2IZVB 1V81A 3VDZA 4HJKA 4NJ7A 5D7GA 2VRRB 4E74A 3WAMA 1LM8B 2MCNB 3RZFA 2RD0A 1JRUA 3WA0A 2KOXA 3CSTA 5E6NA 4HDQA 4GU2A 3RT3B 2WX1A 1WE7A 4YL8A 2KQSA 1Y8RC 2LASA 3KVFB 5TR5A 4KV2A 4KSLC 3TCAA 1UELA 3DVNV 5EDSA 5J17A 2L7RA 3MHSD 1WIAA 4FHKA 4DWFA 4NPNA 3IHPC 3HM3A 2LZ6A 2MWSB 3SDLC 4GOCA 3NZSA 2YLMA 3H7PA 3NS8A 2O6VB 2L05A 4OVVA 2KX3A 3Q3JA 1X1MA 2RGFA 4EFOA 1FXTB 1GC7A 3ALBA 4AOFA 2DZKA 5DCNA 2A4ZA 4TQ1A 3UQBA 2RSUA 4HXDA 1GUAB 1WX9A 3MJWA 4KSKC 3QJZA 4GB9A 1T0YA 2IBIB 2MBHA 4DHJD 4EKUA 2FCSA 1KM7A 1WGDA 2KXJA 4TKNA 2J0JA 2IO0B 1GC6A 2BWES 3DQVA 1S1QB 2JY6A 2PE9A 2KTRA 2QHOA 4K1RB 1YD8U 3R7RA 3WALA 4BBNF 2KDBA 4ZYNA 4BOZB 2XK5B 4XX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8C A;  3HK0 A;  1WH3 A;  3ZNI D;  5J2R A;  1OEY A;  4KZC A;  3PT2 B;  3QAQ A;  3L13 A;  3DOW A;  3DBL I;  2C5L C;  4K7U A;  4J6I A;  3JSV A;  1UBQ A;  1GJZ A;  1VD2 A;  3L10 B;  3ML9 A;  4P7I A;  3VHT C;  3PGE A;  1TTN A;  3QHT A;  3B08 A;  2CHX A;  2PPH A;  2HD5 B;  2K8B A;  2EKE C;  2ZCC A;  5AZF A;  3RD2 A;  2L8J A;  3A4R A;  3U7D A;  1V49 A;  3HHM A;  4HWI B;  2JF5 A;  3QAR A;  2CU1 A;  2G45 B;  4MJS B;  3ZIM A;  3I3T B;  3VFK A;  3WAN A;  3ZLZ A;  3KYC D;  1ZW7 A;  3A1Q B;  3PHW B;  1UZX B;  2ZCB A;  2LGX A;  2UYZ B;  1WMH B;  4ICU A;  1NI2 A;  3UIN B;  2ZEQ A;  2LXA A;  1E8W A;  1R4M I;  5D94 A;  4A3P A;  3UQA A;  4I6N B;  4XC2 A;  2C7N B;  2DYB A;  4K81 A;  3QQ8 B;  3IBE A;  2O6V A;  2LXC A;  3NY5 A;  3P2B A;  2GBM A;  4M8N A;  2FUH B;  4RM9 A;  2NR2 A;  4LJO B;  1OTR B;  3WAP A;  4F7Z A;  1QZE A;  3DVG X;  4K7W A;  2WWZ A;  4JGH B;  1WZ0 A;  1YX6 B;  4HDO A;  3OLM D;  3TBL D;  3PV1 A;  4A20 A;  1Z2M A;  3A33 B;  3UF8 A;  3X23 A;  1C1Y B;  3QK0 A;  2JWZ A;  2M17 A;  3DDC B;  1TGZ B;  3K9O B;  3GOE A;  2LJ5 A;  1UBI A;  1V2Y A;  5JHA A;  1P1A A;  2XK5 A;  3JVZ X;  2D11 A;  3UIP B;  1I35 A;  1C3T A;  4KDL B;  2MBB B;  4AWJ A;  3GZN I;  3VQI A;  4IM3 A;  3CF6 E;  3ZO5 B;  2JVC A;  2DHZ A;  2XBB C;  2D3G A;  3TIX A;  5KHQ A;  4MGY E;  2EMT A;  4FJZ A;  4MM3 A;  1WRD B;  2JZ3 B;  3M3J A;  1A5R A;  2KAN A;  4WJQ A;  5DPS A;  1IP9 A;  3VUX A;  1SE9 A;  2HJ8 A;  1LXD A;  4WAA A;  4MGZ E;  4MJS A;  2KHW B;  2KWU B;  3DVN U;  2MQJ A;  3KW5 B;  1XD3 B;  2UWQ A;  4AUQ C;  3A1Q A;  2HTH A;  1WMH A;  1V5O A;  4FJV B;  3AU5 A;  4X57 B;  2Y5B B;  3DCG A;  4MEM A;  2V3S A;  1WXM A;  3BIN A;  4N9F 4;  5DPR A;  4FAD A;  4BKS A;  3QIJ A;  1NDD A;  2AEH A;  4PS8 A;  4FN2 A;  2A5U A;  1WX7 A;  2AL3 A;  4EOY A;  4GIV A;  4MH0 E;  3U30 A;  4AJY B;  3W1Y A;  1ISN A;  2ZZP B;  1E7U A;  4W9C A;  4HPM B;  4LDT D;  2FCQ A;  4GDL B;  4M8M A;  2DYM A;  4NAW B;  2L0T A;  4W9D A;  3W1S A;  3X0W A;  1YJ1 A;  2DEN B;  4OVU A;  1E8Z A;  1E8Y A;  1E8X A;  4KVG B;  3WAO A;  3ONS A;  1WGY A;  4KDI C;  1IYF A;  3APD A;  3QCA A;  3SHQ A;  1MG8 A;  3ZTC A;  2IO1 B;  3RUL A;  4TQ0 A;  3NOB A;  1PQS A;  3HIZ A;  4GMV A;  4BKT A;  2OJR A;  2JRI B;  1OGW A;  1J19 A;  4HK2 A;  2M4N A;  2W9N A;  2AWT A;  3PVL A;  2BYE A;  2ZJD A;  3VH4 B;  5CX3 A;  1D3Z A;  4W9E A;  4DBG A;  2M0X A;  2LRU A;  2LD9 A;  2BWF A;  4G3X B;  3ZW3 A;  2LVQ A;  5DPW A;  3S2A A;  2G3Q B;  3O65 B;  4WWN A;  3RYT A;  3V60 A;  3L16 A;  3ML8 A;  3PPA A;  1F9J A;  4PS3 A;  1OQY A;  4LCD E;  1WE6 A;  4WWP A;  1AAR A;  2M8S A;  4W9K A;  4ANV A;  1YQB A;  4ZRI A;  3L08 A;  3H7S A;  3HM6 X;  2NPT B;  3DBH I;  3LDZ E;  1RAX A;  2XEW A;  1J8C A;  4HCP B;  2MBE A;  1IPG A;  4G11 A;  4MSQ B;  5E6P A;  3NHE B;  2KWV B;  2PEA A;  3SU8 X;  4BVU C;  3TJP A;  2ZNV B;  3OAW A;  2DZJ A;  4ZRJ A;  3VVW B;  4KZ0 A;  3T9L A;  3PHX B;  4GDL A;  5FR6 A;  3TMP B;  4NAW A;  2C7M B;  3JW0 X;  4DHZ E;  2BGF A;  3VH3 B;  2G4S A;  1ZGU B;  2IO3 B;  2Z0D B;  3V62 A;  5JH5 C;  3DPD A;  5JHB A;  2FAZ A;  3WIM A;  5G2N A;  2PJH A;  3AI5 A;  3PRP B;  3PTF C;  2NBW B;  5E6O A;  1Q1O A;  1WM3 A;  3U8Z A;  1TZ1 A;  4DHJ B;  4FA6 A;  3KYD D;  3A9K B;  4FHJ A;  3V6E B;  5LXI B;  3R7Q A;  3M62 B;  4EZJ A;  4GXB A;  1V6E A;  4IM0 A;  1J0G A;  2DYO A;  2ZVN A;  2JT4 B;  2FNJ B;  2KTF A;  2GMI C;  1TBE A;  4IUM B;  2NBU A;  3R66 C;  1V86 A;  4JL9 A;  5CHF A;  5CHV C;  4DHZ B;  2BYF A;  3ZVV A;  1E5W A;  5J18 A;  2N4F A;  2D07 B;  3VUW A;  2KKC A;  2D2Q A;  4BBN C;  1OEY J;  3V6C B;  2J0K A;  4IG7 B;  4EZK A;  4G50 A;  2KDF B;  3KUD B;  4W9F A;  4NQL B;  2C9W B;  1WGR A;  2N9X A;  3QC8 B;  4ZRK A;  2NPT A;  3CSF A;  4RM8 A;  1R4N I;  2KX0 A;  4BFR A;  2YVC A;  3VTV A;  2D10 A;  3PRM B;  3ZRF A;  1WX8 A;  3L54 A;  2JRH A;  5CHW A;  4MGI E;  3B1L X;  1U4A A;  3ZKJ C;  2K6D B;  3B0A A;  1Q5W B;  3W1S C;  1KLV A;  4ICV A;  1WFY A;  2KC2 A;  4B6W A;  4XZ4 A;  1I42 A;  1E7V A;  2KJH B;  3K9P B;  1WXV A;  4IW0 A;  1SIF A;  5C1Z A;  2DX5 B;  1UGM A;  4JQW C;  2LGD A;  1WZ3 A;  3H6N A;  1L2N A;  3M95 A;  2LGY A;  1L7Y A;  1GNU A;  3RUI B;  4I6P A;  2L76 A;  2C7H A;  2MX2 A;  2O6V D;  3TL5 A;  2WDT B;  3PS6 A;  3ZDM C;  4JIO U;  2V4L A;  2MLB A;  4TV3 A;  2N9P C;  4DXA B;  4PYU A;  2ZPY A;  3EC8 A;  3T8M A;  1VCB A;  2KJR A;  2N1W A;  3A9K A;  3H9D A;  4E71 A;  4TUU A;  4B9K A;  2R2Q A;  3QWZ B;  4NNJ B;  1H8C A;  5C23 A;  3UIO B;  1P98 A;  4NJ6 A;  1ZKH A;  1M94 A;  3M63 B;  4ANX A;  1KJT A;  2KQ7 A;  5IAA C;  2AL6 A;  2K25 A;  2KDI A;  2KK8 A;  2N9E B;  3AXC A;  3OJ4 B;  4AP4 C;  4ASW C;  2ASQ A;  3ZNZ B;  4FUL A;  4MSM B;  2IY0 B;  2N7D A;  4PYZ A;  2FIF A;  2MW5 A;  2ZPN A;  3IG3 A;  5GMV A;  2CR5 A;  4CYE A;  3UGB B;  1WGG A;  4GDK B;  4M0W B;  2C60 A;  4B95 A;  2KLC A;  3NZU A;  5L83 A;  2JZZ A;  2N7E A;  4AJW A;  4GN1 A;  4W9H A;  4DK5 A;  2BPS A;  2KFK B;  2NVU I;  2RR9 A;  3AU4 A;  1V80 A;  4MDK E;  3ZUN A;  2JPH A;  3N32 A;  5L95 C;  1P0R A;  3IFW B;  4DDI D;  5D6J B;  4EZL A;  1EUV B;  2MBO A;  3VUY A;  3PSE B;  2MP2 B;  5BO4 B;  2KO3 A;  2MSE D;  3DBS A;  3N3K B;  2J0M A;  2KWC A;  4EEW A;  1V9J A;  2K6Q A;  4RMA A;  3AUL A;  2JUO A;  5AZG A;  2FID A;  1K8R B;  4W9J A;  3A4S C;  1Q0W B;  3C0R B;  4IC7 B;  4FBJ B;  3L17 A;  3LJ3 A;  1WF9 A;  1WR1 A;  3APC A;  2BKF A;  2MA9 B;  3H1U A;  1RRB A;  5KHO A;  2DZI A;  4F8C B;  2R2O A;  4CO7 A;  2J7Q B;  4BKS D;  1KOT A;  1WYW B;  3KH0 A;  2OOB B;  3ENE A;  4LDT B;  4ANU A;  5JZE B;  4FJY A;  2LVO A;  2REX A;  2O2V B;  4G0N B;  4IWP A;  2KLG A;  4NY0 A;  1XT9 B;  2JXX A;  4WQO B;  1YIW A;  5G55 A;  3ZDT A;  4HCN B;  2CHW A;  1HE8 A;  2MRP A;  3VTW A;  2Z59 B;  2BYV E;  5CTR C;  4W9L A;  3PLU A;  3A9J B;  2M1M A;  2KN5 A;  4IM2 A;  2KFJ A;  2HE7 A;  4MGK E;  2GBJ A;  3ZRC A;  4EUT A;  1Z5S B;  3APF A;  2B3A A;  2GBR A;  3Q3F A;  2DZM A;  1V5T A;  3OJ3 A;  4WJP A;  3R3M A;  4HPL B;  4GDK A;  1XQQ A;  1RLF A;  4ZDV A;  2DAF A;  4JLC A;  5DPT A;  4BOS C;  2IY1 B;  2ZNV C;  4GSW A;  2L00 B;  2I1K A;  2G4D B;  1WJN A;  3PRE A;  2V1Y A;  5D2M B;  2KFK A;  4CHK A;  1GG3 A;  2N1V A;  3JYU A;  5LLI A;  1EF5 A;  1WY8 A;  3KUC B;  1WM2 A;  2LRW A;  2IYD B;  3SD5 A;  3V61 A;  4WWO A;  3RCZ A;  2NS5 A;  1S3S G;  1P9D U;  1EO6 A;  2MP2 A;  4IWO A;  4K7S A;  2L0F A;  4II3 B;  2WX0 A;  3DVG Y;  2K1F A;  3EFU A;  4KIK B;  4I6L B;  4WJN A;  1H4R A;  3CMM B;  1LFD A;  3QA8 A;  4W9I A;  3DBR I;  1LQB A;  1WGH A;  2KMC A;  5IA7 A;  3L0W B;  3PLV A;  4FLH A;  3VAW A;  4URK A;  2NBV B;  4II2 B;  1CMX B;  4E3C A;  3EHV A;  2O2V A;  2ZVO A;  5AZH A;  4NQK E;  2AYO B;  2BF8 B;  2KNB A;  1UD7 A;  2KZR A;  1WR6 E;  2LUE A;  3EEC A;  4F1S A;  5LXH A;  4HVB A;  1WJ4 A;  1WI0 A;  2EMS A;  2GOW A;  2WYQ A;  4LJP B;  1WJU A;  2CS4 A;  3VXW A;  4ANW A;  4W9G A;  2LI5 A;  2CKH B;  3VTU A;  4A3O A;  2RPQ A;  3H7P B;  3ZNG C;  1SGH A;  2LWP A;  1WXS A;  3A9J A;  2KMA A;  3MTN B;  4DDG D;  3ZTD A;  1E90 A;  4WJO A;  3ECI A;  1UH6 A;  3PRZ A;  1NBF C;  2MBQ A;  3ZNH B;  2GBK A;  2CHZ A;  3PZD A;  2NCN A;  2L3Z A;  1WJ6 A;  4GGQ A;  3BY4 B;  2K8H A;  2FCM A;  2GBN A;  2KD0 A;  4MEL A;  2K39 A;  2BKR B;  4BKG A;  1YX5 B;  2KJ6 A;  3N30 A;  2PE6 B;  2KC1 A;  2KTR B;  2FCN A;  1RFA A;  3IVF A;  3KUZ A;  2IO2 B;  2LVP A;  3RZW C;  1WXA A;  1P3Q U;  4PS7 A;  2DAJ A;  3QX1 A;  2KDE B;  1BT0 A;  2KVR A;  1G6J A;  2Z0E B;  3JSV B;  1EF1 A;  4HLE A;  3D32 A;  5HKH A;  2I1J A;  4IWQ A;  4KIK A;  5AEK B;  2IZV B;  1V81 A;  3VDZ A;  4HJK A;  4NJ7 A;  5D7G A;  2VRR B;  4E74 A;  3WAM A;  1LM8 B;  2MCN B;  3RZF A;  2RD0 A;  1JRU A;  3WA0 A;  2KOX A;  3CST A;  5E6N A;  4HDQ A;  4GU2 A;  3RT3 B;  2WX1 A;  1WE7 A;  4YL8 A;  2KQS A;  1Y8R C;  2LAS A;  3KVF B;  5TR5 A;  4KV2 A;  4KSL C;  3TCA A;  1UEL A;  3DVN V;  5EDS A;  5J17 A;  2L7R A;  3MHS D;  1WIA A;  4FHK A;  4DWF A;  4NPN A;  3IHP C;  3HM3 A;  2LZ6 A;  2MWS B;  3SDL C;  4GOC A;  3NZS A;  2YLM A;  3H7P A;  3NS8 A;  2O6V B;  2L05 A;  4OVV A;  2KX3 A;  3Q3J A;  1X1M A;  2RGF A;  4EFO A;  1FXT B;  1GC7 A;  3ALB A;  4AOF A;  2DZK A;  5DCN A;  2A4Z A;  4TQ1 A;  3UQB A;  2RSU A;  4HXD A;  1GUA B;  1WX9 A;  3MJW A;  4KSK C;  3QJZ A;  4GB9 A;  1T0Y A;  2IBI B;  2MBH A;  4DHJ D;  4EKU A;  2FCS A;  1KM7 A;  1WGD A;  2KXJ A;  4TKN A;  2J0J A;  2IO0 B;  1GC6 A;  2BWE S;  3DQV A;  1S1Q B;  2JY6 A;  2PE9 A;  2KTR A;  2QHO A;  4K1R B;  1YD8 U;  3R7R A;  3WAL A;  4BBN F;  2KDB A;  4ZYN A;  4BOZ B;  2XK5 B;  4XX5 A; 
#chains in the Genus database with same CATH topology
 5J2R A;  1QLB B;  3L13 A;  3DOW A;  3I9V 1;  1P7F A;  4J6I A;  1AN8 A;  3ML9 A;  3VHT C;  3PGE A;  1TTN A;  3B08 A;  5D3D A;  2K8B A;  2R61 A;  2BS2 B;  1T3Q A;  4MJS B;  2CU1 A;  2G45 B;  2K3U A;  3I3T B;  3KYC D;  3A1Q B;  2ZCB A;  1N63 A;  1WMH B;  5D94 A;  3AEC B;  1PGB A;  2G9H D;  4N59 A;  1YN5 A;  2WXF A;  1N5W A;  3NY5 A;  2YEP B;  2GBM A;  4LJO B;  4F7Z A;  3DVG X;  4IKG A;  1MHH E;  5BYQ A;  2BYT A;  3TSS A;  3DDC B;  1TGZ B;  2D11 A;  1C3T A;  1Q10 A;  3EFC A;  4IM3 A;  3CF6 E;  3ZO5 B;  1D5M C;  2DHZ A;  1I4R A;  2XBB C;  4FXC A;  4MGY E;  4FJZ A;  4MM3 A;  3M3J A;  4ZHO A;  4XGA B;  1L4Z B;  4WUR A;  1V1P A;  4YSX B;  1SE9 A;  2ZW0 A;  1LXD A;  4WAA A;  5BMI A;  3RNG C;  2MJE A;  3LB8 C;  1V5O A;  2PMV A;  4X57 B;  4LNK A;  1XCT L;  1GB4 A;  1WXM A;  2WXP A;  4BKS A;  4PS8 A;  4EOY A;  4OZA A;  1ISN A;  4HPM B;  2FCQ A;  4M8M A;  2DYM A;  4RGT A;  1E8Z A;  3B2G A;  4KVG B;  1CK1 A;  2DLB A;  3SHQ A;  1MG8 A;  2JYE A;  1KFY B;  2IO1 B;  3NOB A;  2OJR A;  1OGW A;  1AYF A;  2W9N A;  2BYE A;  1D3Z A;  1MPE A;  1HZ5 A;  3HVZ A;  2LD9 A;  4WH4 A;  3V60 A;  3AN1 A;  1DOY A;  4AS1 A;  3MC9 A;  3UI3 A;  2WXG A;  2AQ3 B;  1OQY A;  2SAK A;  3FIL A;  4ANV A;  4ZRI A;  4ARC A;  4ACF A;  3DBH I;  2IGG A;  1RAX A;  4HCP B;  2MBE A;  2DZJ A;  3NG0 A;  3AE4 B;  1PYW D;  4GDL A;  3TMP B;  1NYR A;  5EE1 A;  1IGC A;  3VH3 B;  5JH5 C;  1AWD A;  3KWV A;  2NBW B;  3NS1 A;  1Q1O A;  2INP E;  5HI1 A;  3A9K B;  5LXI B;  1V6E A;  1L6U A;  2FNJ B;  4L2Y A;  3R66 C;  1V86 A;  2BYF A;  3N20 C;  3VUW A;  4BBN C;  1UWX A;  4IG7 B;  2KDF B;  2ZW1 A;  1E7P B;  4NQL B;  3VR9 B;  1WGR A;  2N9X A;  3QC8 B;  1HEZ E;  3DHG C;  3CSF A;  3J9C A;  4RM8 A;  1KLG D;  3P1M A;  2KX0 A;  4BFR A;  2YVC A;  4TSS A;  5CHW A;  3RNA C;  3RNF C;  2K6D B;  3B0A A;  1Q5W B;  1I4P A;  3W1S C;  2KJH B;  1GPX A;  4RGO S;  1I4Q A;  5C1Z A;  4YSZ B;  3RUI B;  4I6P A;  4P1B C;  2GI9 A;  2WDT B;  3PS6 A;  4JIO U;  4TV3 A;  4N58 A;  2KJR A;  4TUU A;  4B9K A;  4NNJ B;  1IBX A;  5C23 A;  3UIO B;  4ZHP A;  1KJT A;  2KQ7 A;  1EWC A;  2KDI A;  2KK8 A;  4IDI A;  4ASW C;  5JXV A;  2WU2 B;  3AE2 B;  2WXM A;  2CR5 A;  2OED A;  4GDK B;  3Q2A C;  4B95 A;  5L83 A;  4AJW A;  4GN1 A;  4W9H A;  2KFK B;  2PTL A;  1C4P A;  4MDK E;  5AUI A;  2WGS A;  3IFW B;  3NZ3 A;  4RF1 A;  2D3B A;  2KYW A;  2MBO A;  4ZOH C;  1V9J A;  1FNW A;  3AH7 A;  3URY A;  1HA5 A;  1Q0W B;  3C0R B;  4HKQ A;  3L17 A;  1N61 A;  2BKF A;  2R2O A;  4LDT B;  5JZE B;  1FPY A;  2LVO A;  4FJY A;  4RGN A;  3RMK C;  3ZDT A;  2EKI A;  2WS3 B;  3BYY B;  2KFJ A;  1CJE A;  1L0V B;  3ZRC A;  3APF A;  5BMG A;  5HG2 A;  2GBR A;  4MM3 B;  3OJ3 A;  3V05 A;  1XQQ A;  4M0W A;  5DPT A;  3GB1 A;  1OQR A;  3PRE A;  2V1Y A;  1GG3 A;  1FXI A;  1WY8 A;  3KUC B;  2JZP A;  2IYD B;  1JWU D;  2DWQ A;  4HJG E;  4BZA A;  2NS5 A;  2J42 A;  1P9D U;  4IWO A;  4KIK B;  3EFU A;  1K50 A;  4L1B A;  4EE2 A;  1QKZ A;  4WJN A;  1H4R A;  3SR6 A;  3LYY A;  1TY2 A;  1DOX A;  2KMC A;  5IA7 A;  3PLV A;  1JWM D;  3VAW A;  3EHV A;  2O2V A;  5AZH A;  4NQK E;  1WR6 E;  4C00 A;  1EU4 A;  4HVB A;  2WYQ A;  4LJP B;  4W9G A;  2LI5 A;  2WDV B;  2HJ1 A;  3H7P B;  4KGR A;  4DDG D;  4JPS A;  3ZTD A;  1E90 A;  1RFK A;  4RCO A;  1UH6 A;  2D5G A;  3RI7 C;  3TEZ A;  1T0R C;  2MBQ A;  3ZNH B;  2CHZ A;  1ESF A;  1E9M A;  4BKG A;  3IXS A;  3NJT A;  2PE6 B;  5GXG B;  3IVF A;  3TEX A;  3RZW C;  1P3Q U;  4HRO A;  1WXQ A;  1BT0 A;  2CJO A;  3JSV B;  1EF1 A;  3P4R B;  1V81 A;  2QDF A;  1JRU A;  3ZXR A;  1KTK A;  3PO0 A;  5BYR A;  4LK0 M;  1TZO A;  2ACZ B;  3RT3 B;  3KLS X;  1VDV A;  2KQS A;  2WLB A;  4KV2 A;  4KSL C;  3DVN V;  1WIA A;  2J4X A;  4FHK A;  3U4E G;  1WGK A;  4NPN A;  3HM3 A;  3N1X C;  2Y5C A;  2LZ6 A;  3NZS A;  2YLM A;  2IDY A;  2PKO A;  4OVV A;  3Q3J A;  5G5G A;  4A8X C;  2QEJ C;  1BML C;  4A9A A;  5DCN A;  3DHI C;  4TQ1 A;  1WX9 A;  3QJZ A;  4P6V F;  2J0J A;  2IO0 B;  3NUH B;  1GC6 A;  3DQV A;  1K51 A;  2JY6 A;  2NMQ A;  2QHO A;  3Q8B A;  2W3S A;  1YQ4 B;  3HK0 A;  4N6E B;  3QAQ A;  2C5L C;  2H89 B;  1XF5 L;  1ACC A;  2PPH A;  2PVO D;  2HD5 B;  2EKE C;  5AZF A;  3A4R A;  1V49 A;  1YNT E;  2KAC A;  1F1H A;  3QAR A;  4OVZ A;  2M0A A;  3VFK A;  3WAN A;  3N1Z C;  5C2T B;  2UYZ B;  1RM6 C;  1NI2 A;  4JX1 C;  3EGR A;  4NZL B;  1R4M I;  2J53 A;  2LEK A;  4WAF A;  4K81 A;  1HXY D;  2O6V A;  3IBE A;  2LXC A;  3P2B A;  1WSP A;  4M8N A;  2NR2 A;  2WU5 B;  2MJD A;  1OTR B;  3WAP A;  2D3C A;  1QZE A;  1V8C A;  2WWZ A;  1YX6 B;  3OLM D;  3TBL D;  3P4Q B;  1TKY A;  3QK0 A;  1I35 A;  2XK5 A;  2MBB B;  3GZN I;  3I57 A;  2JVC A;  2D3G A;  3TIX A;  5KHQ A;  3RNC C;  2JZ3 B;  4C4V A;  1ZE3 D;  1WYG A;  1AW7 A;  2HJ8 A;  4YWG G;  5FKA C;  2KWU B;  2MQJ A;  1XD3 B;  4ZRP A;  2HTH A;  4YTM B;  5IP4 D;  2Y5B B;  2V3S A;  1JQ4 A;  5BMH A;  4FAD A;  2ICI A;  3QIJ A;  1ZXI A;  4AJY B;  3W1Y A;  1E7U A;  1RYJ A;  3BVZ A;  4LDT D;  3ZGZ A;  1FEH A;  1JRO A;  1YJ1 A;  1T6B X;  2DEN B;  2LGS A;  2IPK D;  3AM9 A;  3WAO A;  1FCL A;  4IOI E;  3ONS A;  1SJE D;  3QCA A;  1RWS A;  3ZTC A;  3HIZ A;  1J19 A;  1YJI A;  2M4N A;  2ZJD A;  4C7Y A;  2PW9 A;  3SFE B;  2BWF A;  1JRP A;  1C78 A;  2LVQ A;  1I4G A;  2G3Q B;  5IN7 A;  4P16 A;  2HTM E;  4PS3 A;  4UDU C;  2V9H A;  4WWP A;  4W9K A;  5MPO A;  1YQB A;  3BVG A;  2LUM A;  1XLQ A;  3AMZ A;  3AE1 B;  2BQQ A;  4K3C A;  2RMM A;  1J8C A;  1CQV A;  2LGI A;  1IPG A;  3NHE B;  1Y56 A;  4BVU C;  2BVC A;  3VVW B;  4CQN A;  3PHX B;  4NAW A;  2C7M B;  2HDE A;  2JU6 X;  4DHZ E;  3LXF A;  1ZGU B;  1K52 A;  3V62 A;  5JHB A;  3C19 A;  2J52 A;  3FC4 A;  3AI5 A;  1ET6 A;  5E6O A;  3BWU D;  4DHJ B;  3KYD D;  1TKE A;  1XO3 A;  3RPF C;  3P63 A;  4GXB A;  4EZJ A;  2JT4 B;  2JSV X;  4DHZ B;  1C77 A;  2CU3 A;  1E5W A;  2D07 B;  3TEY A;  2SEB D;  2D2Q A;  2KN4 A;  2J0K A;  4G50 A;  2NPT A;  1QT9 A;  1SB3 C;  3OG5 A;  3VTV A;  1TYG B;  2N0S B;  3L54 A;  1B9R A;  3B1L X;  1KLV A;  2M19 A;  3NVY A;  4ICV A;  2KC2 A;  1YOV B;  2PIA A;  1P7E A;  1I42 A;  1E7V A;  3K9P B;  3KQ4 A;  1SIF A;  2DX5 B;  3NVW A;  1L2N A;  1L7Y A;  1GNU A;  2C7H A;  1R4M B;  2L52 A;  3ZDM C;  2V4L A;  1ZOY B;  4DXA B;  3AED B;  3T8M A;  1VCB A;  3H9D A;  2V0G A;  1FFV A;  2UU7 A;  3IT4 B;  3QWZ B;  1H8C A;  3ZQ4 A;  1N6Z A;  1P98 A;  4OZB A;  1OQQ A;  1PGX A;  1KH0 A;  2AL6 A;  4KX6 B;  1SE3 A;  2WXK A;  4FUL A;  4B0E A;  1FRR A;  1JML A;  2C60 A;  3GZN B;  3NZU A;  1YJJ A;  2N7E A;  1QOB A;  2NVU I;  3ZUN A;  1V80 A;  3P4S B;  1P0R A;  1F77 A;  2I2Y A;  1EUV B;  2MP2 B;  2KO3 A;  2J0M A;  2KWC A;  4EEW A;  3AUL A;  2JUO A;  5AZG A;  5T8I A;  2FID A;  3A4S C;  2VH1 A;  4IC7 B;  3LJ3 A;  1WR1 A;  3APC A;  1FXA A;  2MA9 B;  3H1U A;  5KHO A;  4F8C B;  4CO7 A;  4DXF A;  3KH0 A;  2OOB B;  3ENE A;  1FO4 A;  3AE3 B;  5H8Y E;  1HTQ A;  4G0N B;  4IWP A;  3SFD B;  2L83 A;  4C7Z A;  1BXT A;  4HCN B;  2GB1 A;  2MH7 A;  2Z59 B;  3Q3O C;  2BYV E;  4USA A;  4W9L A;  3PLU A;  2M1M A;  3TEW A;  4D2K A;  1GOZ A;  2RDG A;  2G1E A;  4MGK E;  2GBJ A;  1IUE A;  2LMC A;  1V5T A;  4C4V B;  2YEP F;  4HPL B;  2DAF A;  2EEL A;  2IY1 B;  4BOS C;  2K9X A;  4GSW A;  2I1K A;  2G4D B;  4CHK A;  5LLI A;  1C79 A;  1WM2 A;  4K3B A;  1N62 A;  2CJN A;  3RCZ A;  1JWA D;  2XN9 C;  4II3 B;  3PZ8 A;  5IO9 A;  1EU3 A;  3CMM B;  4M00 A;  4W9I A;  3DBR I;  1F0Z A;  1CZP A;  2WXN A;  4RH6 A;  1ET9 A;  1XCQ L;  1CMX B;  3VRB B;  2BBC A;  2AYO B;  2KNB A;  1M4V A;  1UD7 A;  2WXO A;  4F1S A;  1WJ4 A;  1WI0 A;  2CKH B;  3HVD A;  4A3O A;  2RPQ A;  4QAY A;  3ZNG C;  2KWD A;  3A9J A;  3OWE B;  3PRZ A;  2RDB C;  2BS3 B;  2GBK A;  3BY4 B;  2PLP A;  2K39 A;  3TUO A;  2BKR B;  4LNI A;  2V4I B;  3N30 A;  3ZXV A;  2KTR B;  3ZJV A;  2QC8 A;  1ZXH A;  2ON8 A;  2KAJ A;  2KVR A;  2E3T A;  2IGD A;  4NJ7 A;  4OZC A;  3RNE C;  5D7G A;  4KGS A;  4L23 A;  4E74 A;  2MCN B;  3WA0 A;  2BB5 A;  1N60 A;  2N9L A;  1TY0 A;  1Y8R C;  2LAS A;  3KVF B;  1UEL A;  5EDS A;  2WHI A;  4DWF A;  4LTU A;  2DBY A;  3AB5 A;  4GOC A;  1MI0 A;  1MHX A;  1KLU D;  1JWB D;  3CIR B;  2KX3 A;  2RGF A;  3ALB A;  4MAC A;  3UQB A;  2RSU A;  4HXD A;  2K22 A;  2XNA C;  4KSK C;  4DHJ D;  4EKU A;  2FCS A;  2KXJ A;  2BWE S;  4JE3 B;  3R2T A;  1S1Q B;  1NVI D;  4K1R B;  2K8C A;  3ZNI D;  1OEY A;  3DBL I;  4K7U A;  4OW0 A;  2W82 A;  3GE8 C;  4P7I A;  3Q8F A;  4R3D A;  1PFD A;  2ZCC A;  1V1P B;  2L8J A;  3RD2 A;  3U7D A;  1TJE A;  3MP9 A;  2JF5 A;  3P42 A;  3ZIM A;  2V3P A;  2KVZ A;  1ZW7 A;  1UZX B;  2AQ2 B;  3UIN B;  1C4A A;  3UQA A;  5EE0 A;  4I6N B;  2C7N B;  1V97 A;  3GS2 A;  1XLP A;  3DBH B;  4RM9 A;  2Q5W D;  4JWS C;  4K7W A;  4JGH B;  4YTP B;  1WZ0 A;  1ZDX A;  4HDO A;  2W3R A;  1Z2M A;  3UF8 A;  2M17 A;  3K9O B;  2LJ5 A;  1V2Y A;  2L1A A;  3JVZ X;  3ZJU A;  4AWJ A;  1SIJ A;  2EMT A;  1WRD B;  3IT6 B;  4XE0 A;  2KAN A;  4WJQ A;  3NVZ A;  1TKG A;  3VUX A;  3FIL B;  3Q14 C;  1MFW A;  3GP7 A;  4MGZ E;  3AV8 A;  4HPP A;  3U7Z A;  4MJS A;  2KHW B;  3DVN U;  2UWQ A;  4AUQ C;  5LNK 1;  3A1Q A;  1D6E C;  1WMH A;  2Y5P A;  4FJV B;  2MJ3 A;  3RN9 C;  1I4H A;  5IKC M;  4FN2 A;  2A5U A;  2ZZP B;  1FNU A;  4W9C A;  1F52 A;  4GDL B;  3X0W A;  4W9D A;  3W1S A;  4LLG M;  4OVU A;  3DWG C;  1E8Y A;  3AE6 B;  1WGY A;  1ZPS A;  4GMV A;  4BKT A;  3PVL A;  2AWT A;  4XDC A;  1QOG A;  3NRZ A;  3NVV A;  4W9E A;  2LRU A;  1SJH D;  1LGR A;  3ZW3 A;  3Q3N C;  3S2A A;  5DPW A;  4WWN A;  3BVM A;  3PPA A;  1F9J A;  4ARI A;  3AE7 B;  3VR8 B;  1SF0 A;  1YN3 A;  3ZJT A;  1N5X A;  3HUI A;  3U52 E;  4G11 A;  4MSQ B;  2X8X X;  5E6P A;  2KWV B;  2PEA A;  5FR3 A;  1T0Q C;  3TJP A;  2ZNV B;  3OAW A;  1HQR D;  1SXT A;  3N9Y C;  2M56 B;  3IAM 1;  3Q8E A;  3T9L A;  5FR6 A;  2G4S A;  1PDX A;  2Z0D B;  3PRP B;  1WM3 A;  3U8Z A;  4RF0 A;  2ONQ A;  4FHJ A;  3V6E B;  2LJI A;  3R7Q A;  4DXG A;  2QCZ A;  3M62 B;  4WQM A;  1IBX B;  5E6J A;  2N9K A;  2KTF A;  2GMI C;  2QMT A;  4XDD A;  5CHV C;  2NTS A;  2N4F A;  2KKC A;  1OEY J;  2GLS A;  2QJL A;  3V6C B;  1J7A A;  4EZK A;  1T5X D;  1D5Z C;  3KUD B;  4W9F A;  4ZRK A;  3DBL B;  1C9F A;  1GAQ B;  3PRM B;  1U4A A;  1XEE A;  2LHE A;  1WFY A;  4B6W A;  3AEE B;  3AE5 B;  1WXV A;  3V3X A;  1F2R I;  1UGM A;  4JQW C;  1EM7 A;  5HHD G;  1L5P A;  4PK1 A;  2L76 A;  2MX2 A;  3TL5 A;  2MLB A;  2V3N A;  4PYU A;  1SSN A;  2N1W A;  3A9K A;  4HEA 1;  1XLN A;  1V1O A;  1VRA B;  2LHD A;  4NJ6 A;  2OJW A;  1ZKH A;  1M94 A;  4M02 A;  3M63 B;  2RPV A;  3B9J A;  4AP4 C;  3OJ4 B;  2K25 A;  2N9E B;  1HTO A;  3ZNZ B;  4MSM B;  2IY0 B;  3Q69 A;  2MW5 A;  2ZPN A;  3IG3 A;  5GMV A;  4O1N A;  1WGG A;  5EE9 A;  4M0W B;  2KLC A;  3MJ5 A;  2RR9 A;  2JPH A;  1VJK A;  3GE3 C;  4DDI D;  5D6J B;  4EZL A;  2Y3A A;  5BO4 B;  4KKJ A;  2BT6 A;  3MC0 B;  3N3K B;  2K6Q A;  1VR9 A;  2JYT A;  4W9J A;  1K8R B;  4FBJ B;  2BB6 A;  4J3O D;  1SEB D;  2DZI A;  4BKS D;  2WQY B;  1WYW B;  2LFI A;  2O2V B;  3P4P B;  4DQO C;  1YIW A;  2IGH A;  5G55 A;  4ITK A;  1PUT A;  2CHW A;  1HE8 A;  3VTW A;  1K53 A;  1UF0 A;  2FBW B;  2KN5 A;  2WNM A;  4LNF A;  4EUT A;  3BK1 A;  1Z5S B;  2BW2 A;  2DZM A;  1MJD A;  3W5U B;  4WJP A;  3R3M A;  4GDK A;  1RLF A;  4ZDV A;  4JLC A;  2ZNV C;  1QQR A;  2L00 B;  5D2M B;  3IAS 1;  2KFK A;  2WP9 B;  3JYU A;  1EF5 A;  1HZ6 A;  3SD5 A;  3V61 A;  4WIP A;  3T3O A;  1VZ8 A;  1S3S G;  2W54 A;  1EO6 A;  2L0F A;  2WX0 A;  3L4P A;  3MFG A;  4I6L B;  3QA8 A;  1LQB A;  1WGH A;  3L0W B;  1ZP0 B;  1UGJ A;  4FLH A;  1JAL A;  1XLO A;  2WDQ B;  2ZVO A;  2BF8 B;  2KZR A;  2LUE A;  3EEC A;  2EMS A;  2GOW A;  3VXW A;  1WJU A;  2CS4 A;  4MT5 A;  1DYQ A;  1SGH A;  2LWP A;  2KMA A;  3MTN B;  3ECI A;  3T3N A;  1J7B A;  1NBF C;  2FCM A;  2GBN A;  2KD0 A;  4MEL A;  2KJ6 A;  2W55 A;  2FCN A;  1RFA A;  3KUZ A;  2LVP A;  1WXA A;  4PS7 A;  4XYC A;  2DAJ A;  3QX1 A;  1JWS D;  3C8Y A;  2KDE B;  1ROE A;  3D32 A;  2I1J A;  1ZDV A;  4IWQ A;  4KIK A;  5AEK B;  3VDZ A;  4HJK A;  4NAM A;  3PZ7 A;  1NEK B;  3AEG B;  3WAM A;  3RZF A;  2KMM A;  5TSS A;  3CST A;  1WE7 A;  5TR5 A;  3TCA A;  1SE4 A;  4HKZ E;  2JX5 A;  3FAH A;  3IHP C;  3SDL C;  1L0Y B;  3H7P A;  3NS8 A;  1TIF A;  2NTT A;  2O6V B;  2DZK A;  2A4Z A;  3E56 A;  1SE2 A;  3N1Y C;  2RDH A;  3VRA B;  1T0S C;  4GB9 A;  2MBH A;  1KM7 A;  1WGD A;  4OHJ A;  4TKN A;  1ENF A;  1DGJ A;  1YD8 U;  3R7R A;  3WAL A;  4BBN F;  2KDB A;  4BOZ B;  2XK5 B;  2X38 A;  1WH3 A;  4KZC A;  3PT2 B;  3JSV A;  1UBQ A;  1OFF A;  1GJZ A;  1VD2 A;  3L10 B;  3R2I A;  1JW9 D;  1KRH A;  3QHT A;  2CHX A;  3HHM A;  4HWI B;  1TT5 B;  2L32 A;  2WXQ A;  3ZLZ A;  3PHW B;  2LGX A;  4ICU A;  1UUP A;  2ZEQ A;  2LXA A;  1ZUD 2;  1FD6 A;  1E8W A;  4A3P A;  1VLB A;  4XC2 A;  2OHF A;  2DYB A;  2WXR A;  3QQ8 B;  1FCC C;  4ZYS A;  2Z8L A;  1C76 A;  2FUH B;  1R7S A;  4XWW A;  1MG4 A;  4HRS A;  3EA6 A;  4C56 C;  1TS2 A;  1PGA A;  5BYS A;  3PV1 A;  2IJ0 A;  4A20 A;  3A33 B;  3X23 A;  1C1Y B;  2JWZ A;  4YT0 B;  2E6X A;  3GOE A;  1UBI A;  5JHA A;  1P1A A;  3UIP B;  4KDL B;  3VQI A;  2VZK B;  3KWL A;  5G5H A;  1NEN B;  1A5R A;  1FNV A;  5DPS A;  1IP9 A;  3ETR A;  4GLS C;  4YXD B;  1QIL A;  3AEB B;  4YSY B;  3ZYY X;  3KW5 B;  2WXL A;  3AU5 A;  1TS3 A;  3DCG A;  4MEM A;  1YQ3 B;  1IGD A;  3BIN A;  4N9F 4;  1JCK B;  5DPR A;  2WXH A;  2K0P A;  1NDD A;  2AEH A;  1WX7 A;  2AL3 A;  4GIV A;  4MH0 E;  1I4X A;  4WWM A;  3U30 A;  4NAW B;  2L0T A;  2BTE A;  1E8X A;  1FIQ A;  4KDI C;  1IYF A;  3APD A;  2KDM A;  2QSD A;  3RUL A;  4TQ0 A;  1PQS A;  1L0X B;  2JRI B;  4HK2 A;  3VH4 B;  4S0R A;  5CX3 A;  3AE8 B;  4DBG A;  2M0X A;  4US9 A;  4M01 A;  4G3X B;  3O65 B;  3RYT A;  3L16 A;  3ML8 A;  4Q2J A;  4A6Q A;  4LCD E;  1WE6 A;  2INN E;  1AAR A;  2M8S A;  3L08 A;  3H7S A;  3HM6 X;  2NPT B;  4S17 A;  3LDZ E;  2KQ4 X;  1F2R C;  2XEW A;  3SU8 X;  4ZRJ A;  2AQ1 B;  4KZ0 A;  3H8H A;  4JWU C;  3JW0 X;  2BGF A;  3DWM A;  2IO3 B;  5FK9 C;  3DPD A;  3I63 C;  2FAZ A;  3WIM A;  5G2N A;  2PJH A;  2GRI A;  5H92 C;  2QIE B;  3PTF C;  5AUK A;  2VH2 A;  3E9S A;  1TZ1 A;  3SEB A;  4FA6 A;  1QF6 A;  1J0G A;  4IM0 A;  2DYO A;  2ZVN A;  1TBE A;  2KT7 A;  4IUM B;  2NBU A;  5CHF A;  4JL9 A;  4ZRQ A;  2FE8 A;  1WWT A;  3ZVV A;  5J18 A;  3CWI A;  2FUG 1;  2AX5 A;  4RNA A;  2C9W B;  4LNN A;  2H88 B;  4YTN B;  1R4N I;  4TMA B;  1I7H A;  2D10 A;  3ZRF A;  1WX8 A;  2JRH A;  3DHH C;  4MGI E;  3ZKJ C;  1STE A;  4XZ4 A;  1WRI A;  4IW0 A;  3W2D A;  2LGD A;  2BS4 B;  1WZ3 A;  3H6N A;  4LNO A;  3M95 A;  2LGY A;  1QOA A;  1LO5 D;  1L4D B;  3BII D;  2O6V D;  3ABV B;  1E6E B;  1L6V A;  2N9P C;  2ZPY A;  4H2A A;  1NYQ A;  3EC8 A;  3RFZ B;  3DBR B;  4E71 A;  4KGT A;  2R2Q A;  1FFU A;  3Q3M C;  4NJC A;  4ANX A;  5IAA C;  4B0M A;  3AXC A;  4XWT A;  2ASQ A;  2B76 B;  2N7D A;  4PYZ A;  2FIF A;  4CYE A;  3UGB B;  1MVK A;  1BUI C;  3AE9 B;  2WXI A;  2JWU A;  2JZZ A;  1C4C A;  4DK5 A;  2BPS A;  3AU4 A;  3N32 A;  4BAX A;  5L95 C;  2IND C;  5HFY A;  1UNS A;  3VUY A;  3PSE B;  2MSE D;  3DBS A;  4RGM A;  1B1Z A;  2TSS A;  4RMA A;  1WF9 A;  1RRB A;  1KOT A;  2J7Q B;  3HRD D;  3MC8 A;  4ANU A;  2JXT A;  1TS4 A;  2REX A;  2KLG A;  4NY0 A;  1XT9 B;  2JXX A;  4WQO B;  4P1C C;  2WDR B;  2N7J A;  5I4D A;  1QOF A;  2MRP A;  1FRD A;  5CTR C;  4C80 A;  4US8 A;  3A9J B;  4IM2 A;  1E10 A;  2HE7 A;  2B3A A;  3Q3F A;  1UWM A;  4RFB A;  2VZK D;  2INC C;  1WJN A;  2N1V A;  3U2S C;  2LRW A;  3R8B A;  2I38 A;  1VZ7 A;  4WWO A;  1A70 A;  2MP2 A;  4K7S A;  4A90 A;  3DVG Y;  2K1F A;  3BYT B;  2MEK A;  1LFD A;  1EWY C;  1D5X C;  3I5J C;  4URK A;  1YMH E;  2NBV B;  4II2 B;  4E3C A;  3W5V B;  1DOI A;  5LXH A;  3Q8A A;  3EUB 2;  5EE3 A;  4MH8 A;  3FKY A;  3Q8C A;  4ANW A;  3AEA B;  3O13 A;  5D3I B;  3VTU A;  3AEF B;  1WXS A;  4WJO A;  3PZD A;  5C3J B;  2NCN A;  2L3Z A;  1WJ6 A;  4GGQ A;  2K8H A;  2WXJ A;  1FM0 D;  4AQ7 A;  1YX5 B;  4PT5 A;  1J7C A;  2KC1 A;  2IO2 B;  4KKI A;  3MHZ A;  1G6J A;  2Z0E B;  4HLE A;  5HKH A;  2D3A A;  2IZV B;  2JQR B;  2DNF A;  3WCQ A;  2VRR B;  2K5P A;  1LM8 B;  1R4N B;  1D4B A;  2RD0 A;  1E0Z A;  2KOX A;  5E6N A;  4HDQ A;  4GU2 A;  2WX1 A;  3BZD B;  1GB1 A;  3BK2 A;  4YL8 A;  1KF6 B;  2MHJ A;  2PVG C;  5J17 A;  2L7R A;  1SBB B;  3B2F A;  3MHS D;  1XXG A;  4A55 A;  4REZ A;  3W9C B;  2MWS B;  1NI3 A;  1TS5 A;  2L05 A;  1VZ6 A;  1X1M A;  4EFO A;  1FXT B;  1GC7 A;  4AOF A;  1GUA B;  1YN4 A;  3MJW A;  1T0Y A;  2IBI B;  1FMA D;  3RNB C;  2QIL A;  2PE9 A;  2KTR A;  5IOI A;  3Q6B A;  4ZYN A;  4XX5 A; 
#chains in the Genus database with same CATH homology
 2K8C A;  3HK0 A;  1WH3 A;  3ZNI D;  5J2R A;  1OEY A;  4KZC A;  3PT2 B;  3QAQ A;  3L13 A;  3DOW A;  3DBL I;  2C5L C;  4K7U A;  4J6I A;  3JSV A;  1UBQ A;  1GJZ A;  1VD2 A;  3L10 B;  3ML9 A;  4P7I A;  3VHT C;  3PGE A;  1TTN A;  3QHT A;  3B08 A;  2CHX A;  2PPH A;  2HD5 B;  2K8B A;  2EKE C;  2ZCC A;  5AZF A;  3RD2 A;  2L8J A;  3A4R A;  3U7D A;  1V49 A;  3HHM A;  4HWI B;  2JF5 A;  3QAR A;  2CU1 A;  2G45 B;  4MJS B;  3ZIM A;  3I3T B;  3VFK A;  3WAN A;  3ZLZ A;  3KYC D;  1ZW7 A;  3A1Q B;  3PHW B;  1UZX B;  2ZCB A;  2LGX A;  2UYZ B;  1WMH B;  4ICU A;  1NI2 A;  3UIN B;  2ZEQ A;  2LXA A;  1E8W A;  1R4M I;  5D94 A;  4A3P A;  3UQA A;  4I6N B;  4XC2 A;  2C7N B;  2DYB A;  4K81 A;  3QQ8 B;  3IBE A;  2O6V A;  2LXC A;  3NY5 A;  3P2B A;  2GBM A;  4M8N A;  2FUH B;  4RM9 A;  2NR2 A;  4LJO B;  1OTR B;  3WAP A;  4F7Z A;  1QZE A;  3DVG X;  4K7W A;  2WWZ A;  4JGH B;  1WZ0 A;  1YX6 B;  4HDO A;  3OLM D;  3TBL D;  3PV1 A;  4A20 A;  1Z2M A;  3A33 B;  3UF8 A;  3X23 A;  1C1Y B;  3QK0 A;  2JWZ A;  2M17 A;  3DDC B;  1TGZ B;  3K9O B;  3GOE A;  2LJ5 A;  1UBI A;  1V2Y A;  5JHA A;  1P1A A;  2XK5 A;  3JVZ X;  2D11 A;  3UIP B;  1I35 A;  1C3T A;  4KDL B;  2MBB B;  4AWJ A;  3GZN I;  3VQI A;  4IM3 A;  3CF6 E;  3ZO5 B;  2JVC A;  2DHZ A;  2XBB C;  2D3G A;  3TIX A;  5KHQ A;  4MGY E;  2EMT A;  4FJZ A;  4MM3 A;  1WRD B;  2JZ3 B;  3M3J A;  1A5R A;  2KAN A;  4WJQ A;  5DPS A;  1IP9 A;  3VUX A;  1SE9 A;  2HJ8 A;  1LXD A;  4WAA A;  4MGZ E;  4MJS A;  2KHW B;  2KWU B;  3DVN U;  2MQJ A;  3KW5 B;  1XD3 B;  2UWQ A;  4AUQ C;  3A1Q A;  2HTH A;  1WMH A;  1V5O A;  4FJV B;  3AU5 A;  4X57 B;  2Y5B B;  3DCG A;  4MEM A;  2V3S A;  1WXM A;  3BIN A;  4N9F 4;  5DPR A;  4FAD A;  4BKS A;  3QIJ A;  1NDD A;  2AEH A;  4PS8 A;  4FN2 A;  2A5U A;  1WX7 A;  2AL3 A;  4EOY A;  4GIV A;  4MH0 E;  3U30 A;  4AJY B;  3W1Y A;  1ISN A;  2ZZP B;  1E7U A;  4W9C A;  4HPM B;  4LDT D;  2FCQ A;  4GDL B;  4M8M A;  2DYM A;  4NAW B;  2L0T A;  4W9D A;  3W1S A;  3X0W A;  1YJ1 A;  2DEN B;  4OVU A;  1E8Z A;  1E8Y A;  1E8X A;  4KVG B;  3WAO A;  3ONS A;  1WGY A;  4KDI C;  1IYF A;  3APD A;  3QCA A;  3SHQ A;  1MG8 A;  3ZTC A;  2IO1 B;  3RUL A;  4TQ0 A;  3NOB A;  1PQS A;  3HIZ A;  4GMV A;  4BKT A;  2OJR A;  2JRI B;  1OGW A;  1J19 A;  4HK2 A;  2M4N A;  2W9N A;  2AWT A;  3PVL A;  2BYE A;  2ZJD A;  3VH4 B;  5CX3 A;  1D3Z A;  4W9E A;  4DBG A;  2M0X A;  2LRU A;  2LD9 A;  2BWF A;  4G3X B;  3ZW3 A;  2LVQ A;  5DPW A;  3S2A A;  2G3Q B;  3O65 B;  4WWN A;  3RYT A;  3V60 A;  3L16 A;  3ML8 A;  3PPA A;  1F9J A;  4PS3 A;  1OQY A;  4LCD E;  1WE6 A;  4WWP A;  1AAR A;  2M8S A;  4W9K A;  4ANV A;  1YQB A;  4ZRI A;  3L08 A;  3H7S A;  3HM6 X;  2NPT B;  3DBH I;  3LDZ E;  1RAX A;  2XEW A;  1J8C A;  4HCP B;  2MBE A;  1IPG A;  4G11 A;  4MSQ B;  5E6P A;  3NHE B;  2KWV B;  2PEA A;  3SU8 X;  4BVU C;  3TJP A;  2ZNV B;  3OAW A;  2DZJ A;  4ZRJ A;  3VVW B;  4KZ0 A;  3T9L A;  3PHX B;  4GDL A;  5FR6 A;  3TMP B;  4NAW A;  2C7M B;  3JW0 X;  4DHZ E;  2BGF A;  3VH3 B;  2G4S A;  1ZGU B;  2IO3 B;  2Z0D B;  3V62 A;  5JH5 C;  3DPD A;  5JHB A;  2FAZ A;  3WIM A;  5G2N A;  2PJH A;  3AI5 A;  3PRP B;  3PTF C;  2NBW B;  5E6O A;  1Q1O A;  1WM3 A;  3U8Z A;  1TZ1 A;  4DHJ B;  4FA6 A;  3KYD D;  3A9K B;  4FHJ A;  3V6E B;  5LXI B;  3R7Q A;  3M62 B;  4EZJ A;  4GXB A;  1V6E A;  4IM0 A;  1J0G A;  2DYO A;  2ZVN A;  2JT4 B;  2FNJ B;  2KTF A;  2GMI C;  1TBE A;  4IUM B;  2NBU A;  3R66 C;  1V86 A;  4JL9 A;  5CHF A;  5CHV C;  4DHZ B;  2BYF A;  3ZVV A;  1E5W A;  5J18 A;  2N4F A;  2D07 B;  3VUW A;  2KKC A;  2D2Q A;  4BBN C;  1OEY J;  3V6C B;  2J0K A;  4IG7 B;  4EZK A;  4G50 A;  2KDF B;  3KUD B;  4W9F A;  4NQL B;  2C9W B;  1WGR A;  2N9X A;  3QC8 B;  4ZRK A;  2NPT A;  3CSF A;  4RM8 A;  1R4N I;  2KX0 A;  4BFR A;  2YVC A;  3VTV A;  2D10 A;  3PRM B;  3ZRF A;  1WX8 A;  3L54 A;  2JRH A;  5CHW A;  4MGI E;  3B1L X;  1U4A A;  3ZKJ C;  2K6D B;  3B0A A;  1Q5W B;  3W1S C;  1KLV A;  4ICV A;  1WFY A;  2KC2 A;  4B6W A;  4XZ4 A;  1I42 A;  1E7V A;  2KJH B;  3K9P B;  1WXV A;  4IW0 A;  1SIF A;  5C1Z A;  2DX5 B;  1UGM A;  4JQW C;  2LGD A;  1WZ3 A;  3H6N A;  1L2N A;  3M95 A;  2LGY A;  1L7Y A;  1GNU A;  3RUI B;  4I6P A;  2L76 A;  2C7H A;  2MX2 A;  2O6V D;  3TL5 A;  2WDT B;  3PS6 A;  3ZDM C;  4JIO U;  2V4L A;  2MLB A;  4TV3 A;  2N9P C;  4DXA B;  4PYU A;  2ZPY A;  3EC8 A;  3T8M A;  1VCB A;  2KJR A;  2N1W A;  3A9K A;  3H9D A;  4E71 A;  4TUU A;  4B9K A;  2R2Q A;  3QWZ B;  4NNJ B;  1H8C A;  5C23 A;  3UIO B;  1P98 A;  4NJ6 A;  1ZKH A;  1M94 A;  3M63 B;  4ANX A;  1KJT A;  2KQ7 A;  5IAA C;  2AL6 A;  2K25 A;  2KDI A;  2KK8 A;  2N9E B;  3AXC A;  3OJ4 B;  4AP4 C;  4ASW C;  2ASQ A;  3ZNZ B;  4FUL A;  4MSM B;  2IY0 B;  2N7D A;  4PYZ A;  2FIF A;  2MW5 A;  2ZPN A;  3IG3 A;  5GMV A;  2CR5 A;  4CYE A;  3UGB B;  1WGG A;  4GDK B;  4M0W B;  2C60 A;  4B95 A;  2KLC A;  3NZU A;  5L83 A;  2JZZ A;  2N7E A;  4AJW A;  4GN1 A;  4W9H A;  4DK5 A;  2BPS A;  2KFK B;  2NVU I;  2RR9 A;  3AU4 A;  1V80 A;  4MDK E;  3ZUN A;  2JPH A;  3N32 A;  5L95 C;  1P0R A;  3IFW B;  4DDI D;  5D6J B;  4EZL A;  1EUV B;  2MBO A;  3VUY A;  3PSE B;  2MP2 B;  5BO4 B;  2KO3 A;  2MSE D;  3DBS A;  3N3K B;  2J0M A;  2KWC A;  4EEW A;  1V9J A;  2K6Q A;  4RMA A;  3AUL A;  2JUO A;  5AZG A;  2FID A;  1K8R B;  4W9J A;  3A4S C;  1Q0W B;  3C0R B;  4IC7 B;  4FBJ B;  3L17 A;  3LJ3 A;  1WF9 A;  1WR1 A;  3APC A;  2BKF A;  2MA9 B;  3H1U A;  1RRB A;  5KHO A;  2DZI A;  4F8C B;  2R2O A;  4CO7 A;  2J7Q B;  4BKS D;  1KOT A;  1WYW B;  3KH0 A;  2OOB B;  3ENE A;  4LDT B;  4ANU A;  5JZE B;  4FJY A;  2LVO A;  2REX A;  2O2V B;  4G0N B;  4IWP A;  2KLG A;  4NY0 A;  1XT9 B;  2JXX A;  4WQO B;  1YIW A;  5G55 A;  3ZDT A;  4HCN B;  2CHW A;  1HE8 A;  2MRP A;  3VTW A;  2Z59 B;  2BYV E;  5CTR C;  4W9L A;  3PLU A;  3A9J B;  2M1M A;  2KN5 A;  4IM2 A;  2KFJ A;  2HE7 A;  4MGK E;  2GBJ A;  3ZRC A;  4EUT A;  1Z5S B;  3APF A;  2B3A A;  2GBR A;  3Q3F A;  2DZM A;  1V5T A;  3OJ3 A;  4WJP A;  3R3M A;  4HPL B;  4GDK A;  1XQQ A;  1RLF A;  4ZDV A;  2DAF A;  4JLC A;  5DPT A;  4BOS C;  2IY1 B;  2ZNV C;  4GSW A;  2L00 B;  2I1K A;  2G4D B;  1WJN A;  3PRE A;  2V1Y A;  5D2M B;  2KFK A;  4CHK A;  1GG3 A;  2N1V A;  3JYU A;  5LLI A;  1EF5 A;  1WY8 A;  3KUC B;  1WM2 A;  2LRW A;  2IYD B;  3SD5 A;  3V61 A;  4WWO A;  3RCZ A;  2NS5 A;  1S3S G;  1P9D U;  1EO6 A;  2MP2 A;  4IWO A;  4K7S A;  2L0F A;  4II3 B;  2WX0 A;  3DVG Y;  2K1F A;  3EFU A;  4KIK B;  4I6L B;  4WJN A;  1H4R A;  3CMM B;  1LFD A;  3QA8 A;  4W9I A;  3DBR I;  1LQB A;  1WGH A;  2KMC A;  5IA7 A;  3L0W B;  3PLV A;  4FLH A;  3VAW A;  4URK A;  2NBV B;  4II2 B;  1CMX B;  4E3C A;  3EHV A;  2O2V A;  2ZVO A;  5AZH A;  4NQK E;  2AYO B;  2BF8 B;  2KNB A;  1UD7 A;  2KZR A;  1WR6 E;  2LUE A;  3EEC A;  4F1S A;  5LXH A;  4HVB A;  1WJ4 A;  1WI0 A;  2EMS A;  2GOW A;  2WYQ A;  4LJP B;  1WJU A;  2CS4 A;  3VXW A;  4ANW A;  4W9G A;  2LI5 A;  2CKH B;  3VTU A;  4A3O A;  2RPQ A;  3H7P B;  3ZNG C;  1SGH A;  2LWP A;  1WXS A;  3A9J A;  2KMA A;  3MTN B;  4DDG D;  3ZTD A;  1E90 A;  4WJO A;  3ECI A;  1UH6 A;  3PRZ A;  1NBF C;  2MBQ A;  3ZNH B;  2GBK A;  2CHZ A;  3PZD A;  2NCN A;  2L3Z A;  1WJ6 A;  4GGQ A;  3BY4 B;  2K8H A;  2FCM A;  2GBN A;  2KD0 A;  4MEL A;  2K39 A;  2BKR B;  4BKG A;  1YX5 B;  2KJ6 A;  3N30 A;  2PE6 B;  2KC1 A;  2KTR B;  2FCN A;  1RFA A;  3IVF A;  3KUZ A;  2IO2 B;  2LVP A;  3RZW C;  1WXA A;  1P3Q U;  4PS7 A;  2DAJ A;  3QX1 A;  2KDE B;  1BT0 A;  2KVR A;  1G6J A;  2Z0E B;  3JSV B;  1EF1 A;  4HLE A;  3D32 A;  5HKH A;  2I1J A;  4IWQ A;  4KIK A;  5AEK B;  2IZV B;  1V81 A;  3VDZ A;  4HJK A;  4NJ7 A;  5D7G A;  2VRR B;  4E74 A;  3WAM A;  1LM8 B;  2MCN B;  3RZF A;  2RD0 A;  1JRU A;  3WA0 A;  2KOX A;  3CST A;  5E6N A;  4HDQ A;  4GU2 A;  3RT3 B;  2WX1 A;  1WE7 A;  4YL8 A;  2KQS A;  1Y8R C;  2LAS A;  3KVF B;  5TR5 A;  4KV2 A;  4KSL C;  3TCA A;  1UEL A;  3DVN V;  5EDS A;  5J17 A;  2L7R A;  3MHS D;  1WIA A;  4FHK A;  4DWF A;  4NPN A;  3IHP C;  3HM3 A;  2LZ6 A;  2MWS B;  3SDL C;  4GOC A;  3NZS A;  2YLM A;  3H7P A;  3NS8 A;  2O6V B;  2L05 A;  4OVV A;  2KX3 A;  3Q3J A;  1X1M A;  2RGF A;  4EFO A;  1FXT B;  1GC7 A;  3ALB A;  4AOF A;  2DZK A;  5DCN A;  2A4Z A;  4TQ1 A;  3UQB A;  2RSU A;  4HXD A;  1GUA B;  1WX9 A;  3MJW A;  4KSK C;  3QJZ A;  4GB9 A;  1T0Y A;  2IBI B;  2MBH A;  4DHJ D;  4EKU A;  2FCS A;  1KM7 A;  1WGD A;  2KXJ A;  4TKN A;  2J0J A;  2IO0 B;  1GC6 A;  2BWE S;  3DQV A;  1S1Q B;  2JY6 A;  2PE9 A;  2KTR A;  2QHO A;  4K1R B;  1YD8 U;  3R7R A;  3WAL A;  4BBN F;  2KDB A;  4ZYN A;  4BOZ B;  2XK5 B;  4XX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...