2O2VB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
total genus 22
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vB01
5JH5C 4TQ1A 1FXTB 4IUMB 1EO6A 1P1AA 3N30A 3ZTDA 2KANA 1WF9A 2G4DB 4PYZA 4NJ7A 3A9JB 3DBLI 1V86A 2MA9B 4I6NB 1TZ1A 2RD0A 3R3MA 2EMSA 2G4SA 4BFRA 1UZXB 4NQKE 2XEWA 2NVUI 1P3QU 5TR5A 3DBHI 2IO2B 1T0YA 3DOWA 4NAWA 1WJ6A 3IVFA 2BWES 2NBWB 2JUOA 4II2B 3RYTA 3WAPA 3ENEA 4DHJB 2ZZPB 3WIMA 4GB9A 4TV3A 2JXXA 3ZNID 4HPLB 3A1QA 3KVFB 2KDBA 4WQOB 2N9XA 4JLCA 3U30A 1GG3A 2WDTB 3ZUNA 4W9HA 3N32A 1M94A 1WJUA 3SHQA 4HWIB 5AEKB 2M4NA 2WYQA 4E71A 2J0MA 5DPSA 1EUVB 2J7QB 3QCAA 3WA0A 1LXDA 2CR5A 4NY0A 3UQBA 3R66C 1V9JA 4IM3A 1F9JA 2GBMA 2FIFA 3VDZA 2KD0A 5DPWA 1ZKHA 2KVRA 3VH4B 2L76A 2B3AA 2IY0B 3NOBA 1NDDA 1V5TA 4JQWC 3ZNGC 4BBNF 2KQSA 1L2NA 2NBVB 3WAOA 3PRPB 2O2VB 4HLEA 3GOEA 4M8MA 5AZFA 4FULA 3APFA 4HCNB 1OQYA 4W9IA 4JIOU 3DVGY 3NZUA 4PYUA 2R2QA 3U8ZA 2ZVOA 2V1YA 1RLFA 3PGEA 1H4RA 1WM2A 4NNJB 3Q3JA 4PS7A 4YL8A 4HXDA 2KDEB 2LVOA 2ZCCA 1OEYJ 1S3SG 2KTRB 3EHVA 2KZRA 3H7PB 5L95C 3AI5A 1I42A 3V61A 2KJ6A 2JF5A 2GBNA 4KIKA 5D7GA 1WE6A 1KJTA 1WXAA 3K9OB 5GMVA 3PHXB 2O6VB 1WYWB 3RUIB 1X1MA 3KUCB 4EEWA 2L3ZA 3NHEB 3LDZE 3PSEB 2Y5BB 2LGXA 4MSQB 4BOZB 2KK8A 5AZHA 4IWPA 2GBJA 4F1SA 2K25A 4ANWA 4XC2A 1R4MI 4K7WA 2MBEA 4P7IA 2DZMA 2C7NB 2PPHA 3U7DA 3UIPB 1YX5B 2M17A 3AU4A 2FNJB 2KWCA 2AYOB 3CSTA 4KZCA 3VAWA 3VQIA 4F7ZA 4URKA 4A3OA 2O6VA 1QZEA 1XQQA 2MX2A 1E8XA 2LGYA 3S2AA 4BOSC 2FCSA 3OJ3A 5DCNA 3UINB 2CHXA 4MJSB 3R7QA 3ZVVA 4FADA 2CHZA 4ZDVA 4PS3A 4GMVA 3GZNI 2NCNA 3N3KB 2FCQA 3OJ4B 3QHTA 1JRUA 2V4LA 3DQVA 1Z5SB 2K39A 4GU2A 3B08A 2KKCA 1ISNA 4BKGA 5LXHA 4FBJB 2DAFA 1GUAB 2ZCBA 2UWQA 3OAWA 2L8JA 4MGIE 1C1YB 1VD2A 4HDQA 1LQBA 4MGZE 4W9GA 1WFYA 2Z0EB 4JGHB 1XD3B 3VUYA 1WX9A 2KOXA 2AWTA 2N4FA 3DVNU 2DYOA 4W9DA 1H8CA 3PREA 1GC6A 2KHWB 2G3QB 4ZRKA 2PE6B 2PEAA 4FJZA 1GJZA 1UBQA 2KFKA 3EC8A 2HTHA 1WY8A 4KVGB 4AJYB 3P2BA 3L13A 2HJ8A 3A4RA 2FCNA 3VUWA 1GNUA 4IC7B 4B6WA 2UYZB 2Z59B 3MJWA 5C1ZA 4IWQA 4K7SA 3VFKA 4WWPA 4HK2A 3EECA 3ONSA 2M0XA 5DPTA 2DENB 3B0AA 4IG7B 4DXAB 4RM8A 3L17A 3OLMD 5G2NA 1LM8B 2DYMA 3A9KB 5G55A 4W9KA 2LD9A 3TBLD 5E6NA 2XK5B 2D3GA 1WMHB 1WJ4A 2K1FA 2JWZA 2FCMA 4CHKA 3ZIMA 4LCDE 3W1YA 1E5WA 2KWVB 2RGFA 3ECIA 4CO7A 4EKUA 1U4AA 1YJ1A 2XK5A 3A33B 2CKHB 4PS8A 2CHWA 3ZDMC 1WH3A 2BKRB 2KLGA 4MELA 2O2VA 1S1QB 3ALBA 2LUEA 3QQ8B 4GIVA 1TBEA 3RT3B 3WALA 4ANVA 3H9DA 5KHQA 1KLVA 2REXA 1YD8U 3C0RB 4AWJA 2LRUA 4NQLB 2KQ7A 3BY4B 3ZLZA 4EZKA 3V60A 2K6QA 2A4ZA 2HE7A 4GXBA 4W9FA 2RSUA 2CU1A 3I3TB 3PZDA 1J8CA 2NS5A 4WJPA 3SU8X 4BBNC 3QJZA 4FHKA 4J6IA 2L05A 4II3B 4GDKA 4IWOA 4GOCA 2ZNVB 1OEYA 3HIZA 4TUUA 3H7SA 3ZO5B 4ZRIA 2DZIA 3IBEA 2MWSB 3TIXA 2KTRA 4K1RB 3PHWB 2KC1A 2KFJA 4FLHA 1UH6A 3JSVA 2KDIA 2R2OA 2AEHA 2HD5B 5AZGA 2LVQA 5D6JB 4RMAA 4HCPB 1UBIA 4W9CA 3A4SC 3UIOB 1V81A 2K8HA 4W9JA 3ML8A 2MW5A 1WJNA 4G0NB 1E8WA 5DPRA 1YIWA 2DX5B 3HM3A 3H1UA 4XZ4A 5J18A 2OJRA 2LXCA 3B1LX 4ASWC 2BYFA 3DCGA 2L0TA 3DBSA 1SE9A 3PLVA 1OTRB 2D11A 3RZWC 3T8MA 5D94A 4DHZB 4ZRJA 2KDFB 2MRPA 3KH0A 3UQAA 2XBBC 1D3ZA 2JT4B 1WGYA 5E6PA 4M0WB 3PPAA 3UF8A 1IPGA 2JRIB 1V2YA 2RR9A 2ZPYA 4GDLB 1LFDA 1WR6E 2FAZA 2IYDB 3JSVB 3PRZA 2KXJA 2KJHB 4ICUA 1AARA 4IM2A 5BO4B 5KHOA 2MBBB 2N1WA 4OVUA 4HJKA 3RZFA 2W9NA 1WXSA 1KOTA 1WMHA 1ZW7A 5D2MB 1WGHA 3ZNZB 1K8RB 4LJOB 2ZNVC 2KC2A 4TKNA 3DBRI 5IAAC 4K7UA 3VH3B 4DBGA 4N9F4 1P9DU 2KMAA 1SGHA 2IO1B 2C7MB 1L7YA 3ZKJC 1KM7A 3A9JA 4WJQA 2DZKA 1WXMA 4GDKB 2JY6A 2ZPNA 3CMMB 3QX1A 4E74A 2LASA 3KUDB 4FJVB 1V5OA 2JZZA 3PT2B 5LLIA 2LVPA 2AL3A 1YX6B 2D2QA 4BKSA 3MTNB 2GBRA 3O65B 2YLMA 2L0FA 5JHBA 1XT9B 2NPTA 2ASQA 2N9PC 2IO3B 2K8BA 3L0WB 1C3TA 3SD5A 2DHZA 3A9KA 2MQJA 3K9PB 2C9WB 4ICVA 2IY1B 4RM9A 1RRBA 2A5UA 2L7RA 3PVLA 4JL9A 4TQ0A 4KDIC 3VXWA 4AP4C 1WIAA 2PE9A 4WJOA 5HKHA 3D32A 1G6JA 3QK0A 4WWNA 3V62A 2FUHB 4HDOA 1P0RA 2BKFA 4G50A 4FA6A 4MJSA 2LGDA 3H7PA 2JRHA 1R4NI 3APCA 3MHSD 4B9KA 1Q5WB 5CHVC 5EDSA 2WX0A 3JYUA 2MCNB 1WGGA 3T9LA 3W1SA 2LRWA 1OGWA 3KYDD 4KIKB 4DK5A 3HK0A 2N9EB 4BKSD 4EZJA 3M62B 4DWFA 5L83A 2KTFA 3M63B 4NPNA 5CHFA 2O6VD 3QC8B 1I35A 4WWOA 4XX5A 2QHOA 2I1JA 2LXAA 2RPQA 4EOYA 1WX7A 2C7HA 4MM3A 1MG8A 1E7UA 3KYCD 4HVBA 1NBFC 2GBKA 3AXCA 3KW5B 4I6PA 2WX1A 5C23A 3QAQA 2D10A 5LXIB 1CMXB 4GSWA 2M1MA 5J17A 3HHMA 5IA7A 1GC7A 1YQBA 2KWUB 3WAMA 4LDTB 1RFAA 3RULA 4W9LA 3ML9A 2JVCA 3ZDTA 1J19A 3NZSA 3QWZB 4LJPB 2AL6A 1WM3A 4A20A 3TL5A 4B95A 3QA8A 4I6LB 4BKTA 2KX0A 1SIFA 4ANXA 4GDLA 4MH0E 2LJ5A 2NPTB 4X57B 3L54A 4ANUA 5J2RA 2ZEQA 2IO0B 4HPMB 4MSMB 1VCBA 4G11A 1IYFA 3V6CB 3L10B 2ZVNA 3IG3A 4M8NA 3RCZA 2BYVE 3M95A 4FHJA 3Q3FA 4IW0A 1WR1A 3CF6E 4GN1A 1WZ0A 2MLBA 1PQSA 3PS6A 2N7DA 1EF1A 2BYEA 3L08A 2Z0DB 5CX3A 1UELA 2DYBA 2J0KA 4CYEA 1BT0A 4NJ6A 3PLUA 2GMIC 5CHWA 5E6OA 1WGDA 3ZNHB 1HE8A 3NY5A 1NI2A 3R7RA 1WRDB 1ZGUB 3PRMB 2KNBA 3TJPA 3X23A 2BWFA 2JPHA 2C60A 3ZW3A 2MP2B 3VHTC 3ZRFA 2BF8B 2C5LC 1J0GA 2BGFA 2JZ3B 2KLCA 4MDKE 1A5RA 3APDA 2CS4A 2DAJA 2NR2A 4DDGD 2D07B 4DDID 2DZJA 2KMCA 3ZTCA 1UGMA 4NAWB 2L00B 4LDTD 2OOBB 2I1KA 2N1VA 2LWPA 1EF5A 5FR6A 4KSKC 1E90A 4IM0A 3VTUA 4MEMA 1Q1OA 3AULA 4KZ0A 1P98A 3VUXA 3DDCB 3WANA 2KX3A 2MBHA 4AOFA 1TTNA 3H6NA 2KN5A 3VTVA 2M8SA 3V6EB 1WGRA 4AUQC 2FIDA 2K8CA 2MSED 1RAXA 3PV1A 2EKEC 1UD7A 4WJNA 4KDLB 2GOWA 2WWZA 4MGKE 4FJYA 2MP2A 1WX8A 1Y8RC 3ZRCA 3AU5A 1V80A 4W9EA 4EZLA 3TCAA 2KJRA 2MBQA 4OVVA 3A1QB 4GGQA 3EFUA 2V3SA 4G3XB 4KSLC 2KO3A 3JVZX 2MBOA 2ZJDA 3HM6X 3TMPB 2KFKB 3L16A 2NBUA 3QIJA 2IZVB 1WZ3A 1V49A 4WAAA 2J0JA 4BVUC 4DHZE 2EMTA 3KUZA 3SDLC 1Q0WB 4A3PA 3RD2A 4ZYNA 1TGZB 4DHJD 2K6DB 3M3JA 4AJWA 3QARA 3LJ3A 1E7VA 5CTRC 3DPDA 3PTFC 1V6EA 1WXVA 3UGBB 4E3CA 4F8CB 4EUTA 2LI5A 2PJHA 3IFWB 3VTWA 4K81A 2VRRB 2N7EA 3NS8A 1IP9A 3BINA 3W1SC 1E8YA 2IBIB 1WI0A 1WE7A 3DVNV 2G45B 1E8ZA 2LZ6A 2BPSA 5JZEB 4EFOA 2YVCA 4FN2A 3X0WA 5JHAA 1Z2MA 4MGYE 4KV2A 3IHPC 3JW0X 3DVGX 3VVWB 3CSFA
chains in the Genus database with same CATH superfamily
5JH5C 1P1AA 3N30A 3ZTDA 2KANA 4I6NB 1TZ1A 2PLPA 1P3QU 2IO2B 1T0YA 4NAWA 1GOZA 3IVFA 4II2B 2ZZPB 2LHEA 2IDYA 3VRBB 4N6EB 3BVMA 2JXXA 4HPLB 3A1QA 2KDBA 2YEPB 1GG3A 2WDTB 5AEKB 3V3XA 3VRAB 5DPSA 4UDUC 4P1CC 4NY0A 3UQBA 1NI3A 4TMAB 4XGAB 1L0XB 4JQWC 3ZNGC 2KQSA 4NAMA 2M19A 4USAA 2K3UA 3LB8C 1I4GA 3APFA 4HCNB 4W9IA 4JIOU 1EU4A 1CJEA 2QC8A 1RLFA 3PGEA 2LHDA 4PS7A 3Q3JA 3SR6A 2LVOA 2ZCCA 1OEYJ 1S3SG 3EHVA 3H7PB 5JXVA 3V61A 1VR9A 2JF5A 4KIKA 5GMVA 3PHXB 1KH0A 1X1MA 4L23A 3LDZE 4XWWA 3PSEB 4MSQB 5AZHA 4F1SA 4K7WA 4ACFA 2WXNA 3IXSA 3P4SB 1R7SA 3VAWA 2AYOB 4KZCA 2CJNA 4M02A 1TS2A 1QZEA 1ZE3D 1E8XA 3S2AA 1FM0D 2FCSA 3OJ3A 2BTEA 1FNUA 1C4CA 4ZDVA 1K53A 3N3KB 2FCQA 3OJ4B 2WDRB 1HEZE 3B08A 3OAWA 1JQ4A 2ZW1A 4MGIE 3SEBA 1C1YB 3IT4B 2AQ3B 1HQRD 3VUYA 4YTMB 2KOXA 2N4FA 1H8CA 2DYOA 3ZJVA 1UF0A 1YQ4B 3PREA 2YEPF 4FJZA 3BVZA 4KKIA 3L13A 4OHJA 1XCQL 4B6WA 4M01A 2UYZB 1QOGA 3ONSA 2E3TA 3B0AA 1TS3A 3RNFC 1GPXA 2JSVX 3ZQ4A 1QOBA 4JWSC 3TBLD 1WJ4A 2K1FA 2FCMA 4CO7A 1JWUD 3A33B 2O2VA 3ALBA 3RT3B 1PGBA 4MACA 2WXIA 2SAKA 4BZAA 2REXA 1KLVA 2PVOD 3C0RB 2LRUA 3V60A 2RSUA 2CU1A 4WJPA 3QJZA 1YN3A 4II3B 4GDKA 1NENB 4GOCA 2VZKD 3ZO5B 3NZ3A 2DZIA 3PHWB 4N59A 2AEHA 2LVQA 5D6JB 1M4VA 4RMAA 2BB6A 3RNAC 3T3OA 3UIOB 1WJNA 1P7EA 1FXAA 3HM3A 4XZ4A 1SXTA 2BYFA 1SE9A 1OTRB 2D11A 4DHZB 3UQAA 1YOVB 1D3ZA 2JT4B 4OZBA 3W5VB 3R2IA 4M0WB 1VLBA 3UF8A 1IPGA 2ZPYA 2FAZA 1V1PA 3AV8A 2N1WA 2W9NA 1IGDA 3ZNZB 4LLGM 2KC2A 5IAAC 2XNAC 2KWDA 2SEBD 4RF1A 1SGHA 2C7MB 1L7YA 3CMMB 1FFVA 5H92C 3MTNB 2GBRA 1FXIA 5EE1A 1C76A 3O65B 5BYQA 5FR3A 3EA6A 2J52A 3ZXVA 1GB1A 2NPTA 2ASQA 1V97A 1AN8A 2DHZA 1FNVA 2A5UA 1ET6A 4KDIC 3AE9B 5BYSA 4AP4C 1WIAA 5HKHA 3NVVA 3V62A 4HDOA 4XDCA 4QAYA 3AEBB 3T3NA 3MHSD 4B9KA 5EDSA 2WX0A 1WGGA 4EZJA 3M63B 1AW7A 2I1JA 2RPQA 4MM3A 4RGOS 1NBFC 2GBKA 2GLSA 1F1HA 3AEDB 1FCCC 4I6PA 2WX1A 2BW2A 1RM6C 1T5XD 2M1MA 3C19A 1FNWA 3WAMA 4LDTB 2JU6X 1RFAA 3HVZA 1NYRA 3ML9A 2JVCA 3NZSA 2AL6A 5TSSA 3TL5A 3QA8A 4BKTA 1SIFA 4BAXA 4MH0E 2INDC 5J2RA 3NRZA 3Q3NC 4MSMB 4G11A 1L6UA 4M8NA 3Q3FA 2UU7A 3P63A 1EF1A 2Z0DB 4HPPA 1UELA 5CX3A 2KVZA 2MJ3A 4KKJA 1BT0A 5CHWA 2PVGC 5E6OA 1WGDA 4H2AA 1I4QA 1ZGUB 2K22A 2DBYA 2W55A 3KLSX 5H8YE 3MFGA 2C60A 4ZRPA 2BGFA 2KT7A 2L52A 2DAJA 1YMHE 4DDID 4TSSA 2KMCA 1DOXA 1UGMA 4RCOA 2L00B 2CJOA 2OOBB 3ZYYX 4MT5A 4KSKC 2NTSA 3I57A 1MHXA 3R2TA 3V6EB 2FIDA 2BS4B 1DGJA 2MP2A 4KGTA 5G5GA 1MPEA 3WCQA 2MBQA 4OVVA 3A1QB 4GGQA 3U52E 3EFUA 2BB5A 4KSLC 2ZJDA 3UI3A 2NBUA 4WAAA 4BVUC 1C4AA 3N1YC 3RN9C 1SE4A 3AE3B 4DHJD 2K6DB 3B2FA 3M3JA 3H8HA 5CTRC 1FD6A 2IPKD 3UGBB 1VDVA 4S17A 4EUTA 2LI5A 1L4ZB 2PW9A 1E10A 1T6BX 2E6XA 2G45B 3P1MA 2YVCA 5JHAA 3X0WA 4KV2A 2DLBA 3VVWB 3CSFA 4US8A 4TQ1A 1ESFA 2WXLA 4IUMB 2N9LA 5E6JA 2G4DB 4PYZA 4NJ7A 1YQ3B 2J53A 2XEWA 4PT5A 3DBHI 1WJ6A 4DHJB 2BWES 2NBWB 2JUOA 1IBXA 3WAPA 1IUEA 3WIMA 4WH4A 3ZNID 2WQYB 1D5MC 2N9XA 3U30A 2G9HD 1SB3C 2BVCA 1WJUA 4L1BA 2M4NA 4E71A 3QCAA 3WA0A 2CR5A 4YSXB 3AM9A 4P16A 1V9JA 1F9JA 3VDZA 4R3DA 2IY0B 1TS4A 2OHFA 4BBNF 2NBVB 5I4DA 2O2VB 1ZXIA 3GOEA 3DBLB 4M8MA 1P7FA 1XEEA 4FULA 3U8ZA 4PYUA 1RWSA 4NNJB 4AS1A 1SSNA 1I42A 3IAS1 1XO3A 2LJIA 4XDDA 1Q10A 3B9JA 4LTUA 1WE6A 1KJTA 2DWQA 1WYWB 2LGXA 2KK8A 4P6VF 2WDQB 2L32A 3SFDB 2K25A 4ANWA 1R4MI 2DZMA 3U7DA 1YX5B 1JALA 2FNJB 1XQQA 4A55A 3U7ZA 4C80A 2CHXA 4JWUC 1E6EB 4LK0M 3GZNI 2WXQA 5AUIA 2VH1A 3QHTA 1JRUA 2KKCA 4XWTA 4BKGA 5LXHA 4FBJB 2DAFA 3MHZA 2L8JA 2Y3AA 3VR8B 1VD2A 1KLUD 3EFCA 3DVNU 4ARIA 1GC6A 2PE6B 2KFKA 2HTHA 1WY8A 2PTLA 2HJ8A 3A4RA 2FCNA 2MJDA 1GNUA 1PUTA 4K7SA 4HK2A 4S0RA 3EECA 2M0XA 5DPTA 2DENB 3NUHB 3A9KB 1EU3A 3BYYB 1GAQB 2QDFA 1B9RA 2LD9A 2HDEA 1AYFA 2WHIA 2JWZA 3B2GA 4CHKA 3ZIMA 4LCDE 5IOIA 2RGFA 4M00A 4EKUA 4ITKA 1YJ1A 4PS8A 2CKHB 2CHWA 1V1PB 5BMIA 3ZDMC 1WH3A 2FUG1 3PZ7A 4MELA 4K3CA 2QCZA 3QQ8B 3WALA 4KGSA 1YD8U 4WAFA 3ZLZA 4EZKA 1ACCA 3CWIA 2HE7A 2W82A 4GXBA 2PIAA 4W9FA 1XLNA 2WNMA 3DHIC 3PZDA 4C7YA 2NS5A 1J8CA 3SU8X 4BBNC 2X8XX 4TUUA 2KTRA 1K52A 2KFJA 1ENFA 3JSVA 2R2OA 4HCPB 1UBIA 4W9CA 3A4SC 3AH7A 3ML8A 3TEWA 1E8WA 2LXCA 4ASWC 2L0TA 1V1OA 3DBSA 3RZWC 3P4QB 4ZRJA 3KH0A 3I5JC 1YJJA 2V3PA 2RR9A 1LFDA 3PRZA 2V0GA 2L83A 1DOIA 4IM2A 5KHOA 2QIEB 1NVID 1K8RB 1WRIA 4LJOB 4TKNA 4C7ZA 1PDXA 3KWLA 3VH3B 4DBGA 4N9F4 1ZPSA 5HG2A 1I4HA 4J3OD 2AX5A 4LNOA 4REZA 1WWTA 3A9JA 2DZKA 1WXMA 2I38A 2JY6A 1K50A 2HJ1A 4E74A 2LASA 4FJVB 2JZZA 1SIJA 1ZOYB 3PT2B 1QLBB 4DXGA 1WGKA 1TYGB 2YLMA 2L0FA 3V05A 1XT9B 2K8BA 3SD5A 1F77A 4M0WA 2C9WB 2GB1A 3U4EG 4LNIA 2IY1B 4RM9A 4JL9A 3HVDA 1FFUA 2KQ4X 2KYWA 2ICIA 3D32A 3QK0A 3GE3C 2WXGA 1E9MA 4FA6A 2QJLA 2JRHA 3C8YA 3ETRA 4PK1A 1R4NI 3APCA 2AQ2B 1Q5WB 3JYUA 3T9LA 4LNFA 2LRWA 3KYDD 3W1SA 4DK5A 3HK0A 4BKSD 2O6VD 5HFYA 1JROA 4EOYA 2C7HA 2RDGA 1MG8A 2WXRA 4KX6B 3KW5B 3GB1A 1CMXB 3AE8B 5J17A 1VZ6A 1GC7A 3GE8C 2KWUB 2DNFA 1ZP0B 2RDBC 4W9LA 1J19A 3DWGC 4ZOHC 4NJCA 5EE9A 4B95A 3O13A 2NMQA 3VR9B 1PGAA 4ANXA 4X57B 4A8XC 3Q8CA 1FEHA 2IO0B 2MEKA 3RNBC 3AE5B 3M95A 1C79A 1R4NB 1WR1A 2JX5A 3CF6E 4YXDB 2MLBA 1PQSA 1AWDA 2J0KA 3TSSA 3FKYA 1HE8A 1NI2A 3R7RA 3PRMB 2KNBA 3X23A 2MHJA 2INCC 4RGMA 5IP4D 3J9CA 1TIFA 1IGCA 1YJIA 2BF8B 2JZ3B 2KLCA 1KFYB 3APDA 2NR2A 1T0RC 4DDGD 1VRAB 3AEEB 4NAWB 4LDTD 1WSPA 2I1KA 2LWPA 5FR6A 3VTUA 1L6VA 2BYTA 4MEMA 3KQ4A 4AOFA 3ABVB 4AUQC 2BQQA 3N1ZC 4WJNA 1T3QA 2GOWA 2WWZA 4FJYA 2WU5B 3OWEB 4EZLA 2WXJA 2ON8A 3N9YC 4ZHOA 1DOYA 2KO3A 1FO4A 2MBOA 3TMPB 2KFKB 3L16A 4ZRQA 3QIJA 2IZVB 3SDLC 1E0ZA 3RD2A 5C2TB 3BIID 3I63C 1KF6B 4E3CA 3IFWB 2WLBA 3VTWA 4HJGE 1QOFA 2N7EA 1IP9A 3DHGC 3W1SC 4KGRA 1WE7A 1E8ZA 5JZEB 3EUB2 1OFFA 3IHPC 3JW0X 2V9HA 1ROEA 3PZ8A 1HTOA 1EO6A 2FBWB 3DBLI 1V86A 2RD0A 2EMSA 1QKZA 2W3SA 2NVUI 2G1EA 3DOWA 3RYTA 4OW0A 3ENEA 1F2RC 4YTPB 3KVFB 3ZUNA 3N32A 1J7BA 4HWIB 2WYQA 1EUVB 2J7QB 1FRRA 3R66C 4IM3A 1K51A 2FIFA 2KD0A 5DPWA 2KVRA 3BVGA 3VH4B 1GB4A 1V5TA 3WAOA 4HLEA 1EWCA 5AZFA 1OQYA 4AQ7A 4N58A 3NZUA 4WIPA 2N7JA 2V1YA 1H4RA 2JYEA 2KDEB 4FXCA 5L95C 1WYGA 2GBNA 1SE3A 2JZPA 1SF0A 5D7GA 2O6VB 3KUCB 4EEWA 3NHEB 2Y5BB 4BOZB 3ZJTA 3Q8FA 4D2KA 5HI1A 3Q69A 4XC2A 3P42A 2D3AA 2Y5PA 2C7NB 2PPHA 4OZAA 3UIPB 2IGDA 3RMKC 3VQIA 2B76B 4A3OA 2O6VA 4C4VA 2LGYA 3NG0A 4BOSC 1FCLA 3UINB 3ZVVA 4MJSB 1L5PA 4PS3A 4GMVA 4WQMA 1WXQA 3DQVA 2K39A 4GU2A 4IOIE 4DQOC 1ZDXA 1GUAB 2UWQA 2INPE 4MGZE 3ZJUA 2Z0EB 1XD3B 1WX9A 1N63A 2Y5CA 1FPYA 2LMCA 1UBQA 2RPVA 2IGGA 3P2BA 1PGXA 3VUWA 2J4XA 2V4IB 3MC8A 4WWPA 1CZPA 3KWVA 4IG7B 2EKIA 2DYMA 5G55A 2H88B 3Q8BA 3AEFB 1UNSA 2CU3A 5E6NA 2XK5B 2D3GA 3W1YA 1E5WA 2KWVB 3ECIA 5GXGB 3DBRB 2XK5A 1SE2A 2KLGA 2WXHA 1S1QB 2LUEA 3LYYA 4GIVA 1TBEA 4ANVA 3H9DA 4AWJA 2KQ7A 2K6QA 2QSDA 3N1XC 4HEA1 2L05A 4IWOA 1OEYA 1XLPA 3H7SA 1XF5L 4ZRIA 3TIXA 4K1RB 2X38A 2KC1A 4FLHA 3Q8EA 1JWBD 5IO9A 1V81A 2K8HA 4W9JA 3MJ5A 3E9SA 3LXFA 1I4RA 1JWSD 5LNK1 2OJRA 1C9FA 3T8MA 3FILB 2KDFB 1F52A 2XBBC 5E6PA 3PPAA 2JRIB 4GDLB 2IYDB 5FK9C 4MM3B 2R61A 2KJHB 1AARA 3RI7C 1D5XC 4HJKA 1WMHA 1TKGA 1WGHA 5D2MB 2ZNVC 2LUMA 3AE4B 2TSSA 4K7UA 3GS2A 3BK1A 3NVYA 1P9DU 2KMAA 2IO1B 2LFIA 1KM7A 4WJQA 2M56B 2LGSA 2ZPNA 1V5OA 3AEAB 2K9XA 3Q6BA 2LVPA 5IN7A 2L1AA 4BKSA 2Z8LA 1B1ZA 2ZW0A 4CQNA 1TKEA 5BMHA 3AE1B 4JX1C 5JHBA 4EE2A 2QMTA 3MC0B 1N61A 2N9PC 2IO3B 3L0WB 3N20C 1SBBB 2L7RA 4TQ0A 3VXWA 1TY2A 1XLOA 4RFBA 1G6JA 4G50A 4B0EA 2LGDA 1N60A 5CHVC 1OGWA 4KIKB 5IKCM 5L83A 4DWFA 1A70A 2KTFA 4NPNA 3QC8B 1I35A 1NEKB 2MJEA 1N5XA 1E7UA 4JE3B 3CIRB 3AXCA 4IDIA 5LXIB 2D10A 4GSWA 2VZKB 1YQBA 4A90A 3RULA 3ZDTA 4K3BA 4LJPB 1WM3A 4A20A 2KX0A 3HUIA 2PKOA 2LJ5A 1SJHD 3L54A 1JW9D 2ZEQA 1LGRA 4HPMB 2Q5WD 1EM7A 1VCBA 2AQ1B 1IYFA 2ZVNA 1N5WA 3IG3A 3RCZA 4FHJA 1C78A 4GN1A 4A9AA 2N7DA 3AEGB 2BYEA 1MFWA 2WXFA 4NJ6A 3PLUA 1JRPA 1KTKA 1F0ZA 3NY5A 1WRDB 3PO0A 2QILA 3TJPA 3RNGC 2WU2B 2JPHA 1DYQA 3RPFC 3VHTC 3NVWA 1R4MB 1FMAD 2C5LC 4MDKE 2HTME 1JMLA 2D07B 1J7CA 4YWGG 2MH7A 3Q8AA 5G5HA 1TJEA 1I7HA 2D3CA 4IM0A 3FILA 1HZ6A 1HA5A 3Q3MC 4KZ0A 3VUXA 3DDCB 1TTNA 4L2YA 3H6NA 2KN5A 1RYJA 2RMMA 2M8SA 1WGRA 2MSED 3PV1A 2EKEC 4MGKE 2BS2B 1Y8RC 3AU5A 4W9EA 2KJRA 2WXPA 2H89B 3BYTB 2V3SA 3HM6X 2LGIA 1WZ3A 1V49A 2J0JA 1JCKB 5D3IB 2EMTA 3KUZA 1XCTL 4ZYNA 1TGZB 3OG5A 3NVZA 3QARA 4AJWA 3BZDB 3AE6B 3PTFC 1V6EA 4P1BC 1FIQA 4HRSA 5C3JB 2PJHA 1STEA 1KRHA 4XYCA 3BINA 2IBIB 3DVNV 2BPSA 4EFOA 4FN2A 4MGYE 1QT9A 2NTTA 1SJED 1FXTB 1VZ8A 1WF9A 1RFKA 2BS3B 3A9JB 1F2RI 2MA9B 3R3MA 2G4SA 4BFRA 1UZXB 4NQKE 3U2SC 5TR5A 1XXGA 4GB9A 4TV3A 4WQOB 4JLCA 4W9HA 1M94A 5T8IA 3SHQA 1BXTA 3W2DA 1E7PB 4HKQA 2J0MA 2N0SB 1LXDA 1YNTE 1QOAA 3AMZA 3DWMA 2GBMA 4XE0A 2QEJC 1ZKHA 1MJDA 5BMGA 2L76A 2B3AA 3NOBA 1NDDA 1L2NA 1TY0A 1VJKA 3PRPB 3DVGY 2R2QA 1TKYA 2ZVOA 3I9V1 4IKGA 1WM2A 4YL8A 4HXDA 1ET9A 2KTRB 2I2YA 2KZRA 3AI5A 4US9A 2KJ6A 3Q14C 1WXAA 3K9OB 2EELA 3RUIB 2L3ZA 4IWPA 2GBJA 1VZ7A 4C56C 2MBEA 4P7IA 3EGRA 1LO5D 2M17A 3TUOA 3AU4A 2KWCA 3CSTA 2KAJA 4F7ZA 4URKA 2INNE 3AE2B 2MX2A 5DCNA 3R7QA 4FADA 2CHZA 1D6EC 2NCNA 2V4LA 1Z5SB 4ARCA 2JXTA 1ISNA 2BT6A 4LNKA 2ZCBA 4HDQA 4W9GA 1LQBA 1WFYA 4JGHB 4W9DA 2AWTA 1ZUD2 2KHWB 4NZLB 2G3QB 4ZRKA 2PEAA 2WGSA 4OZCA 1GJZA 2K5PA 3EC8A 4KVGB 4AJYB 4WWMA 3AN1A 2ACZB 4IC7B 2Z59B 5C1ZA 3MJWA 3HRDD 4IWQA 3VFKA 2OJWA 4RGTA 4DXAB 2D5GA 4RM8A 3L17A 4JPSA 1IBXB 3OLMD 1CK1A 5G2NA 3IAM1 1LM8B 4W9KA 3Q2AC 2BBCA 1L0VB 1WMHB 1ZXHA 1U4AA 2D3BA 1C4PA 2BKRB 2OEDA 1V8CA 1XLQA 1PYWD 1T0SC 5KHQA 4ZHPA 4NQLB 3BY4B 4HKZE 4C00A 3GZNB 2A4ZA 3I3TB 2V3NA 4FHKA 4J6IA 2ZNVB 3HIZA 3P4RB 3IBEA 2MWSB 5EE0A 2GRIA 5FKAC 1UH6A 1UWXA 2KDIA 5AZGA 2HD5B 1MI0A 2MW5A 1QILA 3L4PA 4G0NB 3NJTA 1YIWA 5DPRA 2KDMA 3RNCC 2DX5B 2W54A 1UUPA 3H1UA 5J18A 2W3RA 3B1LX 5MPOA 3DCGA 1YN4A 3PLVA 1EWYC 5D94A 4RH6A 1I4XA 2MRPA 1WGYA 2GI9A 1V2YA 1WR6E 2IGHA 3JSVB 2KXJA 4ICUA 3AB5A 5BO4B 4RNAA 1OQQA 2MBBB 1HXYD 4OVUA 1UGJA 1HZ5A 3RZFA 1WXSA 3URYA 1KOTA 1QQRA 1L4DB 1ZW7A 5HHDG 2ONQA 1Y56A 1ZDVA 3MP9A 3DBRI 3W5UB 4GLSC 4ZYSA 3ZKJC 2WXMA 4GDKB 5D3DA 1OQRA 3E56A 3P4PB 3QX1A 3KUDB 5LLIA 4MH8A 2AL3A 1YX6B 2D2QA 4OVZA 1D5ZC 1MVKA 1C3TA 1T0QC 3A9KA 2MQJA 1L0YB 3K9PB 4ICVA 1RRBA 3PVLA 2WXOA 3FAHA 1J7AA 3BK2A 1JWMD 4WJOA 2PE9A 3SFEB 1NYQA 1PFDA 4WURA 4C4VB 4WWNA 2WXKA 2FUHB 2K0PA 4O1NA 1P0RA 2BKFA 4MJSA 3H7PA 4YSYB 1TS5A 4RF0A 2JWUA 2MCNB 1D4BA 2N9KA 2N9EB 3DBHB 3M62B 5CHFA 4YSZB 4WWOA 4XX5A 2QHOA 4YT0B 2LXAA 1MHHE 5AUKA 2RDHA 1WX7A 3KYCD 4HVBA 1KLGD 5C23A 2WP9B 3AECB 3QAQA 3TEZA 3HHMA 5IA7A 1BUIC 2FE8A 3MC9A 1TT5B 1QF6A 3QWZB 1JWAD 1N62A 2IJ0A 3TEYA 4I6LB 4GDLA 3ZGZA 2NPTB 3DHHC 4ANUA 2KN4A 2KMMA 3V6CB 3L10B 3AE7B 2BYVE 4IW0A 4DXFA 1WZ0A 3PS6A 2XN9C 3L08A 2DYBA 1FRDA 4CYEA 2GMIC 3ZNHB 5EE3A 4YTNB 3R8BA 1MG4A 2LEKA 2BWFA 1C77A 3RNEC 3ZW3A 2MP2B 3W9CB 5BYRA 1HTQA 3ZRFA 4Q2JA 1J0GA 1A5RA 1BMLC 2CS4A 3IT6B 2DZJA 4LNNA 3ZTCA 2N1VA 1EF5A 3RFZB 1E90A 3Q3OC 2JYTA 1Q1OA 3AULA 1P98A 3WANA 2KX3A 2MBHA 2KACA 3FC4A 1UWMA 3VTVA 2K8CA 1RAXA 1UD7A 4KDLB 1WX8A 4RGNA 3ZRCA 1V80A 3TCAA 2PMVA 3ZXRA 1I4PA 3GP7A 3TEXA 4G3XB 2JQRB 3JVZX 2WDVB 2WS3B 4DHZE 4A6QA 1Q0WB 4A3PA 1CQVA 1YN5A 2J42A 3LJ3A 1E7VA 3DPDA 2VH2A 1TZOA 1WXVA 4F8CB 2M0AA 4K81A 2VRRB 4B0MA 4HROA 1N6ZA 3NS8A 1E8YA 1WI0A 3BWUD 2LZ6A 1Z2MA 3DVGX 3NS1A 1SEBD
chains in the Genus database with same CATH topology
5JH5C 4TQ1A 1FXTB 4IUMB 1EO6A 1P1AA 3N30A 3ZTDA 2KANA 1WF9A 2G4DB 4PYZA 4NJ7A 3A9JB 3DBLI 1V86A 2MA9B 4I6NB 1TZ1A 2RD0A 3R3MA 2EMSA 2G4SA 4BFRA 1UZXB 4NQKE 2XEWA 2NVUI 1P3QU 5TR5A 3DBHI 2IO2B 1T0YA 3DOWA 4NAWA 1WJ6A 3IVFA 2BWES 2NBWB 2JUOA 4II2B 3RYTA 3WAPA 3ENEA 4DHJB 2ZZPB 3WIMA 4GB9A 4TV3A 2JXXA 3ZNID 4HPLB 3A1QA 3KVFB 2KDBA 4WQOB 2N9XA 4JLCA 3U30A 1GG3A 2WDTB 3ZUNA 4W9HA 3N32A 1M94A 1WJUA 3SHQA 4HWIB 5AEKB 2M4NA 2WYQA 4E71A 2J0MA 5DPSA 1EUVB 2J7QB 3QCAA 3WA0A 1LXDA 2CR5A 4NY0A 3UQBA 3R66C 1V9JA 4IM3A 1F9JA 2GBMA 2FIFA 3VDZA 2KD0A 5DPWA 1ZKHA 2KVRA 3VH4B 2L76A 2B3AA 2IY0B 3NOBA 1NDDA 1V5TA 4JQWC 3ZNGC 4BBNF 2KQSA 1L2NA 2NBVB 3WAOA 3PRPB 2O2VB 4HLEA 3GOEA 4M8MA 5AZFA 4FULA 3APFA 4HCNB 1OQYA 4W9IA 4JIOU 3DVGY 3NZUA 4PYUA 2R2QA 3U8ZA 2ZVOA 2V1YA 1RLFA 3PGEA 1H4RA 1WM2A 4NNJB 3Q3JA 4PS7A 4YL8A 4HXDA 2KDEB 2LVOA 2ZCCA 1OEYJ 1S3SG 2KTRB 3EHVA 2KZRA 3H7PB 5L95C 3AI5A 1I42A 3V61A 2KJ6A 2JF5A 2GBNA 4KIKA 5D7GA 1WE6A 1KJTA 1WXAA 3K9OB 5GMVA 3PHXB 2O6VB 1WYWB 3RUIB 1X1MA 3KUCB 4EEWA 2L3ZA 3NHEB 3LDZE 3PSEB 2Y5BB 2LGXA 4MSQB 4BOZB 2KK8A 5AZHA 4IWPA 2GBJA 4F1SA 2K25A 4ANWA 4XC2A 1R4MI 4K7WA 2MBEA 4P7IA 2DZMA 2C7NB 2PPHA 3U7DA 3UIPB 1YX5B 2M17A 3AU4A 2FNJB 2KWCA 2AYOB 3CSTA 4KZCA 3VAWA 3VQIA 4F7ZA 4URKA 4A3OA 2O6VA 1QZEA 1XQQA 2MX2A 1E8XA 2LGYA 3S2AA 4BOSC 2FCSA 3OJ3A 5DCNA 3UINB 2CHXA 4MJSB 3R7QA 3ZVVA 4FADA 2CHZA 4ZDVA 4PS3A 4GMVA 3GZNI 2NCNA 3N3KB 2FCQA 3OJ4B 3QHTA 1JRUA 2V4LA 3DQVA 1Z5SB 2K39A 4GU2A 3B08A 2KKCA 1ISNA 4BKGA 5LXHA 4FBJB 2DAFA 1GUAB 2ZCBA 2UWQA 3OAWA 2L8JA 4MGIE 1C1YB 1VD2A 4HDQA 1LQBA 4MGZE 4W9GA 1WFYA 2Z0EB 4JGHB 1XD3B 3VUYA 1WX9A 2KOXA 2AWTA 2N4FA 3DVNU 2DYOA 4W9DA 1H8CA 3PREA 1GC6A 2KHWB 2G3QB 4ZRKA 2PE6B 2PEAA 4FJZA 1GJZA 1UBQA 2KFKA 3EC8A 2HTHA 1WY8A 4KVGB 4AJYB 3P2BA 3L13A 2HJ8A 3A4RA 2FCNA 3VUWA 1GNUA 4IC7B 4B6WA 2UYZB 2Z59B 3MJWA 5C1ZA 4IWQA 4K7SA 3VFKA 4WWPA 4HK2A 3EECA 3ONSA 2M0XA 5DPTA 2DENB 3B0AA 4IG7B 4DXAB 4RM8A 3L17A 3OLMD 5G2NA 1LM8B 2DYMA 3A9KB 5G55A 4W9KA 2LD9A 3TBLD 5E6NA 2XK5B 2D3GA 1WMHB 1WJ4A 2K1FA 2JWZA 2FCMA 4CHKA 3ZIMA 4LCDE 3W1YA 1E5WA 2KWVB 2RGFA 3ECIA 4CO7A 4EKUA 1U4AA 1YJ1A 2XK5A 3A33B 2CKHB 4PS8A 2CHWA 3ZDMC 1WH3A 2BKRB 2KLGA 4MELA 2O2VA 1S1QB 3ALBA 2LUEA 3QQ8B 4GIVA 1TBEA 3RT3B 3WALA 4ANVA 3H9DA 5KHQA 1KLVA 2REXA 1YD8U 3C0RB 4AWJA 2LRUA 4NQLB 2KQ7A 3BY4B 3ZLZA 4EZKA 3V60A 2K6QA 2A4ZA 2HE7A 4GXBA 4W9FA 2RSUA 2CU1A 3I3TB 3PZDA 1J8CA 2NS5A 4WJPA 3SU8X 4BBNC 3QJZA 4FHKA 4J6IA 2L05A 4II3B 4GDKA 4IWOA 4GOCA 2ZNVB 1OEYA 3HIZA 4TUUA 3H7SA 3ZO5B 4ZRIA 2DZIA 3IBEA 2MWSB 3TIXA 2KTRA 4K1RB 3PHWB 2KC1A 2KFJA 4FLHA 1UH6A 3JSVA 2KDIA 2R2OA 2AEHA 2HD5B 5AZGA 2LVQA 5D6JB 4RMAA 4HCPB 1UBIA 4W9CA 3A4SC 3UIOB 1V81A 2K8HA 4W9JA 3ML8A 2MW5A 1WJNA 4G0NB 1E8WA 5DPRA 1YIWA 2DX5B 3HM3A 3H1UA 4XZ4A 5J18A 2OJRA 2LXCA 3B1LX 4ASWC 2BYFA 3DCGA 2L0TA 3DBSA 1SE9A 3PLVA 1OTRB 2D11A 3RZWC 3T8MA 5D94A 4DHZB 4ZRJA 2KDFB 2MRPA 3KH0A 3UQAA 2XBBC 1D3ZA 2JT4B 1WGYA 5E6PA 4M0WB 3PPAA 3UF8A 1IPGA 2JRIB 1V2YA 2RR9A 2ZPYA 4GDLB 1LFDA 1WR6E 2FAZA 2IYDB 3JSVB 3PRZA 2KXJA 2KJHB 4ICUA 1AARA 4IM2A 5BO4B 5KHOA 2MBBB 2N1WA 4OVUA 4HJKA 3RZFA 2W9NA 1WXSA 1KOTA 1WMHA 1ZW7A 5D2MB 1WGHA 3ZNZB 1K8RB 4LJOB 2ZNVC 2KC2A 4TKNA 3DBRI 5IAAC 4K7UA 3VH3B 4DBGA 4N9F4 1P9DU 2KMAA 1SGHA 2IO1B 2C7MB 1L7YA 3ZKJC 1KM7A 3A9JA 4WJQA 2DZKA 1WXMA 4GDKB 2JY6A 2ZPNA 3CMMB 3QX1A 4E74A 2LASA 3KUDB 4FJVB 1V5OA 2JZZA 3PT2B 5LLIA 2LVPA 2AL3A 1YX6B 2D2QA 4BKSA 3MTNB 2GBRA 3O65B 2YLMA 2L0FA 5JHBA 1XT9B 2NPTA 2ASQA 2N9PC 2IO3B 2K8BA 3L0WB 1C3TA 3SD5A 2DHZA 3A9KA 2MQJA 3K9PB 2C9WB 4ICVA 2IY1B 4RM9A 1RRBA 2A5UA 2L7RA 3PVLA 4JL9A 4TQ0A 4KDIC 3VXWA 4AP4C 1WIAA 2PE9A 4WJOA 5HKHA 3D32A 1G6JA 3QK0A 4WWNA 3V62A 2FUHB 4HDOA 1P0RA 2BKFA 4G50A 4FA6A 4MJSA 2LGDA 3H7PA 2JRHA 1R4NI 3APCA 3MHSD 4B9KA 1Q5WB 5CHVC 5EDSA 2WX0A 3JYUA 2MCNB 1WGGA 3T9LA 3W1SA 2LRWA 1OGWA 3KYDD 4KIKB 4DK5A 3HK0A 2N9EB 4BKSD 4EZJA 3M62B 4DWFA 5L83A 2KTFA 3M63B 4NPNA 5CHFA 2O6VD 3QC8B 1I35A 4WWOA 4XX5A 2QHOA 2I1JA 2LXAA 2RPQA 4EOYA 1WX7A 2C7HA 4MM3A 1MG8A 1E7UA 3KYCD 4HVBA 1NBFC 2GBKA 3AXCA 3KW5B 4I6PA 2WX1A 5C23A 3QAQA 2D10A 5LXIB 1CMXB 4GSWA 2M1MA 5J17A 3HHMA 5IA7A 1GC7A 1YQBA 2KWUB 3WAMA 4LDTB 1RFAA 3RULA 4W9LA 3ML9A 2JVCA 3ZDTA 1J19A 3NZSA 3QWZB 4LJPB 2AL6A 1WM3A 4A20A 3TL5A 4B95A 3QA8A 4I6LB 4BKTA 2KX0A 1SIFA 4ANXA 4GDLA 4MH0E 2LJ5A 2NPTB 4X57B 3L54A 4ANUA 5J2RA 2ZEQA 2IO0B 4HPMB 4MSMB 1VCBA 4G11A 1IYFA 3V6CB 3L10B 2ZVNA 3IG3A 4M8NA 3RCZA 2BYVE 3M95A 4FHJA 3Q3FA 4IW0A 1WR1A 3CF6E 4GN1A 1WZ0A 2MLBA 1PQSA 3PS6A 2N7DA 1EF1A 2BYEA 3L08A 2Z0DB 5CX3A 1UELA 2DYBA 2J0KA 4CYEA 1BT0A 4NJ6A 3PLUA 2GMIC 5CHWA 5E6OA 1WGDA 3ZNHB 1HE8A 3NY5A 1NI2A 3R7RA 1WRDB 1ZGUB 3PRMB 2KNBA 3TJPA 3X23A 2BWFA 2JPHA 2C60A 3ZW3A 2MP2B 3VHTC 3ZRFA 2BF8B 2C5LC 1J0GA 2BGFA 2JZ3B 2KLCA 4MDKE 1A5RA 3APDA 2CS4A 2DAJA 2NR2A 4DDGD 2D07B 4DDID 2DZJA 2KMCA 3ZTCA 1UGMA 4NAWB 2L00B 4LDTD 2OOBB 2I1KA 2N1VA 2LWPA 1EF5A 5FR6A 4KSKC 1E90A 4IM0A 3VTUA 4MEMA 1Q1OA 3AULA 4KZ0A 1P98A 3VUXA 3DDCB 3WANA 2KX3A 2MBHA 4AOFA 1TTNA 3H6NA 2KN5A 3VTVA 2M8SA 3V6EB 1WGRA 4AUQC 2FIDA 2K8CA 2MSED 1RAXA 3PV1A 2EKEC 1UD7A 4WJNA 4KDLB 2GOWA 2WWZA 4MGKE 4FJYA 2MP2A 1WX8A 1Y8RC 3ZRCA 3AU5A 1V80A 4W9EA 4EZLA 3TCAA 2KJRA 2MBQA 4OVVA 3A1QB 4GGQA 3EFUA 2V3SA 4G3XB 4KSLC 2KO3A 3JVZX 2MBOA 2ZJDA 3HM6X 3TMPB 2KFKB 3L16A 2NBUA 3QIJA 2IZVB 1WZ3A 1V49A 4WAAA 2J0JA 4BVUC 4DHZE 2EMTA 3KUZA 3SDLC 1Q0WB 4A3PA 3RD2A 4ZYNA 1TGZB 4DHJD 2K6DB 3M3JA 4AJWA 3QARA 3LJ3A 1E7VA 5CTRC 3DPDA 3PTFC 1V6EA 1WXVA 3UGBB 4E3CA 4F8CB 4EUTA 2LI5A 2PJHA 3IFWB 3VTWA 4K81A 2VRRB 2N7EA 3NS8A 1IP9A 3BINA 3W1SC 1E8YA 2IBIB 1WI0A 1WE7A 3DVNV 2G45B 1E8ZA 2LZ6A 2BPSA 5JZEB 4EFOA 2YVCA 4FN2A 3X0WA 5JHAA 1Z2MA 4MGYE 4KV2A 3IHPC 3JW0X 3DVGX 3VVWB 3CSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JH5 C;  4TQ1 A;  1FXT B;  4IUM B;  1EO6 A;  1P1A A;  3N30 A;  3ZTD A;  2KAN A;  1WF9 A;  2G4D B;  4PYZ A;  4NJ7 A;  3A9J B;  3DBL I;  1V86 A;  2MA9 B;  4I6N B;  1TZ1 A;  2RD0 A;  3R3M A;  2EMS A;  2G4S A;  4BFR A;  1UZX B;  4NQK E;  2XEW A;  2NVU I;  1P3Q U;  5TR5 A;  3DBH I;  2IO2 B;  1T0Y A;  3DOW A;  4NAW A;  1WJ6 A;  3IVF A;  2BWE S;  2NBW B;  2JUO A;  4II2 B;  3RYT A;  3WAP A;  3ENE A;  4DHJ B;  2ZZP B;  3WIM A;  4GB9 A;  4TV3 A;  2JXX A;  3ZNI D;  4HPL B;  3A1Q A;  3KVF B;  2KDB A;  4WQO B;  2N9X A;  4JLC A;  3U30 A;  1GG3 A;  2WDT B;  3ZUN A;  4W9H A;  3N32 A;  1M94 A;  1WJU A;  3SHQ A;  4HWI B;  5AEK B;  2M4N A;  2WYQ A;  4E71 A;  2J0M A;  5DPS A;  1EUV B;  2J7Q B;  3QCA A;  3WA0 A;  1LXD A;  2CR5 A;  4NY0 A;  3UQB A;  3R66 C;  1V9J A;  4IM3 A;  1F9J A;  2GBM A;  2FIF A;  3VDZ A;  2KD0 A;  5DPW A;  1ZKH A;  2KVR A;  3VH4 B;  2L76 A;  2B3A A;  2IY0 B;  3NOB A;  1NDD A;  1V5T A;  4JQW C;  3ZNG C;  4BBN F;  2KQS A;  1L2N A;  2NBV B;  3WAO A;  3PRP B;  2O2V B;  4HLE A;  3GOE A;  4M8M A;  5AZF A;  4FUL A;  3APF A;  4HCN B;  1OQY A;  4W9I A;  4JIO U;  3DVG Y;  3NZU A;  4PYU A;  2R2Q A;  3U8Z A;  2ZVO A;  2V1Y A;  1RLF A;  3PGE A;  1H4R A;  1WM2 A;  4NNJ B;  3Q3J A;  4PS7 A;  4YL8 A;  4HXD A;  2KDE B;  2LVO A;  2ZCC A;  1OEY J;  1S3S G;  2KTR B;  3EHV A;  2KZR A;  3H7P B;  5L95 C;  3AI5 A;  1I42 A;  3V61 A;  2KJ6 A;  2JF5 A;  2GBN A;  4KIK A;  5D7G A;  1WE6 A;  1KJT A;  1WXA A;  3K9O B;  5GMV A;  3PHX B;  2O6V B;  1WYW B;  3RUI B;  1X1M A;  3KUC B;  4EEW A;  2L3Z A;  3NHE B;  3LDZ E;  3PSE B;  2Y5B B;  2LGX A;  4MSQ B;  4BOZ B;  2KK8 A;  5AZH A;  4IWP A;  2GBJ A;  4F1S A;  2K25 A;  4ANW A;  4XC2 A;  1R4M I;  4K7W A;  2MBE A;  4P7I A;  2DZM A;  2C7N B;  2PPH A;  3U7D A;  3UIP B;  1YX5 B;  2M17 A;  3AU4 A;  2FNJ B;  2KWC A;  2AYO B;  3CST A;  4KZC A;  3VAW A;  3VQI A;  4F7Z A;  4URK A;  4A3O A;  2O6V A;  1QZE A;  1XQQ A;  2MX2 A;  1E8X A;  2LGY A;  3S2A A;  4BOS C;  2FCS A;  3OJ3 A;  5DCN A;  3UIN B;  2CHX A;  4MJS B;  3R7Q A;  3ZVV A;  4FAD A;  2CHZ A;  4ZDV A;  4PS3 A;  4GMV A;  3GZN I;  2NCN A;  3N3K B;  2FCQ A;  3OJ4 B;  3QHT A;  1JRU A;  2V4L A;  3DQV A;  1Z5S B;  2K39 A;  4GU2 A;  3B08 A;  2KKC A;  1ISN A;  4BKG A;  5LXH A;  4FBJ B;  2DAF A;  1GUA B;  2ZCB A;  2UWQ A;  3OAW A;  2L8J A;  4MGI E;  1C1Y B;  1VD2 A;  4HDQ A;  1LQB A;  4MGZ E;  4W9G A;  1WFY A;  2Z0E B;  4JGH B;  1XD3 B;  3VUY A;  1WX9 A;  2KOX A;  2AWT A;  2N4F A;  3DVN U;  2DYO A;  4W9D A;  1H8C A;  3PRE A;  1GC6 A;  2KHW B;  2G3Q B;  4ZRK A;  2PE6 B;  2PEA A;  4FJZ A;  1GJZ A;  1UBQ A;  2KFK A;  3EC8 A;  2HTH A;  1WY8 A;  4KVG B;  4AJY B;  3P2B A;  3L13 A;  2HJ8 A;  3A4R A;  2FCN A;  3VUW A;  1GNU A;  4IC7 B;  4B6W A;  2UYZ B;  2Z59 B;  3MJW A;  5C1Z A;  4IWQ A;  4K7S A;  3VFK A;  4WWP A;  4HK2 A;  3EEC A;  3ONS A;  2M0X A;  5DPT A;  2DEN B;  3B0A A;  4IG7 B;  4DXA B;  4RM8 A;  3L17 A;  3OLM D;  5G2N A;  1LM8 B;  2DYM A;  3A9K B;  5G55 A;  4W9K A;  2LD9 A;  3TBL D;  5E6N A;  2XK5 B;  2D3G A;  1WMH B;  1WJ4 A;  2K1F A;  2JWZ A;  2FCM A;  4CHK A;  3ZIM A;  4LCD E;  3W1Y A;  1E5W A;  2KWV B;  2RGF A;  3ECI A;  4CO7 A;  4EKU A;  1U4A A;  1YJ1 A;  2XK5 A;  3A33 B;  2CKH B;  4PS8 A;  2CHW A;  3ZDM C;  1WH3 A;  2BKR B;  2KLG A;  4MEL A;  2O2V A;  1S1Q B;  3ALB A;  2LUE A;  3QQ8 B;  4GIV A;  1TBE A;  3RT3 B;  3WAL A;  4ANV A;  3H9D A;  5KHQ A;  1KLV A;  2REX A;  1YD8 U;  3C0R B;  4AWJ A;  2LRU A;  4NQL B;  2KQ7 A;  3BY4 B;  3ZLZ A;  4EZK A;  3V60 A;  2K6Q A;  2A4Z A;  2HE7 A;  4GXB A;  4W9F A;  2RSU A;  2CU1 A;  3I3T B;  3PZD A;  1J8C A;  2NS5 A;  4WJP A;  3SU8 X;  4BBN C;  3QJZ A;  4FHK A;  4J6I A;  2L05 A;  4II3 B;  4GDK A;  4IWO A;  4GOC A;  2ZNV B;  1OEY A;  3HIZ A;  4TUU A;  3H7S A;  3ZO5 B;  4ZRI A;  2DZI A;  3IBE A;  2MWS B;  3TIX A;  2KTR A;  4K1R B;  3PHW B;  2KC1 A;  2KFJ A;  4FLH A;  1UH6 A;  3JSV A;  2KDI A;  2R2O A;  2AEH A;  2HD5 B;  5AZG A;  2LVQ A;  5D6J B;  4RMA A;  4HCP B;  1UBI A;  4W9C A;  3A4S C;  3UIO B;  1V81 A;  2K8H A;  4W9J A;  3ML8 A;  2MW5 A;  1WJN A;  4G0N B;  1E8W A;  5DPR A;  1YIW A;  2DX5 B;  3HM3 A;  3H1U A;  4XZ4 A;  5J18 A;  2OJR A;  2LXC A;  3B1L X;  4ASW C;  2BYF A;  3DCG A;  2L0T A;  3DBS A;  1SE9 A;  3PLV A;  1OTR B;  2D11 A;  3RZW C;  3T8M A;  5D94 A;  4DHZ B;  4ZRJ A;  2KDF B;  2MRP A;  3KH0 A;  3UQA A;  2XBB C;  1D3Z A;  2JT4 B;  1WGY A;  5E6P A;  4M0W B;  3PPA A;  3UF8 A;  1IPG A;  2JRI B;  1V2Y A;  2RR9 A;  2ZPY A;  4GDL B;  1LFD A;  1WR6 E;  2FAZ A;  2IYD B;  3JSV B;  3PRZ A;  2KXJ A;  2KJH B;  4ICU A;  1AAR A;  4IM2 A;  5BO4 B;  5KHO A;  2MBB B;  2N1W A;  4OVU A;  4HJK A;  3RZF A;  2W9N A;  1WXS A;  1KOT A;  1WMH A;  1ZW7 A;  5D2M B;  1WGH A;  3ZNZ B;  1K8R B;  4LJO B;  2ZNV C;  2KC2 A;  4TKN A;  3DBR I;  5IAA C;  4K7U A;  3VH3 B;  4DBG A;  4N9F 4;  1P9D U;  2KMA A;  1SGH A;  2IO1 B;  2C7M B;  1L7Y A;  3ZKJ C;  1KM7 A;  3A9J A;  4WJQ A;  2DZK A;  1WXM A;  4GDK B;  2JY6 A;  2ZPN A;  3CMM B;  3QX1 A;  4E74 A;  2LAS A;  3KUD B;  4FJV B;  1V5O A;  2JZZ A;  3PT2 B;  5LLI A;  2LVP A;  2AL3 A;  1YX6 B;  2D2Q A;  4BKS A;  3MTN B;  2GBR A;  3O65 B;  2YLM A;  2L0F A;  5JHB A;  1XT9 B;  2NPT A;  2ASQ A;  2N9P C;  2IO3 B;  2K8B A;  3L0W B;  1C3T A;  3SD5 A;  2DHZ A;  3A9K A;  2MQJ A;  3K9P B;  2C9W B;  4ICV A;  2IY1 B;  4RM9 A;  1RRB A;  2A5U A;  2L7R A;  3PVL A;  4JL9 A;  4TQ0 A;  4KDI C;  3VXW A;  4AP4 C;  1WIA A;  2PE9 A;  4WJO A;  5HKH A;  3D32 A;  1G6J A;  3QK0 A;  4WWN A;  3V62 A;  2FUH B;  4HDO A;  1P0R A;  2BKF A;  4G50 A;  4FA6 A;  4MJS A;  2LGD A;  3H7P A;  2JRH A;  1R4N I;  3APC A;  3MHS D;  4B9K A;  1Q5W B;  5CHV C;  5EDS A;  2WX0 A;  3JYU A;  2MCN B;  1WGG A;  3T9L A;  3W1S A;  2LRW A;  1OGW A;  3KYD D;  4KIK B;  4DK5 A;  3HK0 A;  2N9E B;  4BKS D;  4EZJ A;  3M62 B;  4DWF A;  5L83 A;  2KTF A;  3M63 B;  4NPN A;  5CHF A;  2O6V D;  3QC8 B;  1I35 A;  4WWO A;  4XX5 A;  2QHO A;  2I1J A;  2LXA A;  2RPQ A;  4EOY A;  1WX7 A;  2C7H A;  4MM3 A;  1MG8 A;  1E7U A;  3KYC D;  4HVB A;  1NBF C;  2GBK A;  3AXC A;  3KW5 B;  4I6P A;  2WX1 A;  5C23 A;  3QAQ A;  2D10 A;  5LXI B;  1CMX B;  4GSW A;  2M1M A;  5J17 A;  3HHM A;  5IA7 A;  1GC7 A;  1YQB A;  2KWU B;  3WAM A;  4LDT B;  1RFA A;  3RUL A;  4W9L A;  3ML9 A;  2JVC A;  3ZDT A;  1J19 A;  3NZS A;  3QWZ B;  4LJP B;  2AL6 A;  1WM3 A;  4A20 A;  3TL5 A;  4B95 A;  3QA8 A;  4I6L B;  4BKT A;  2KX0 A;  1SIF A;  4ANX A;  4GDL A;  4MH0 E;  2LJ5 A;  2NPT B;  4X57 B;  3L54 A;  4ANU A;  5J2R A;  2ZEQ A;  2IO0 B;  4HPM B;  4MSM B;  1VCB A;  4G11 A;  1IYF A;  3V6C B;  3L10 B;  2ZVN A;  3IG3 A;  4M8N A;  3RCZ A;  2BYV E;  3M95 A;  4FHJ A;  3Q3F A;  4IW0 A;  1WR1 A;  3CF6 E;  4GN1 A;  1WZ0 A;  2MLB A;  1PQS A;  3PS6 A;  2N7D A;  1EF1 A;  2BYE A;  3L08 A;  2Z0D B;  5CX3 A;  1UEL A;  2DYB A;  2J0K A;  4CYE A;  1BT0 A;  4NJ6 A;  3PLU A;  2GMI C;  5CHW A;  5E6O A;  1WGD A;  3ZNH B;  1HE8 A;  3NY5 A;  1NI2 A;  3R7R A;  1WRD B;  1ZGU B;  3PRM B;  2KNB A;  3TJP A;  3X23 A;  2BWF A;  2JPH A;  2C60 A;  3ZW3 A;  2MP2 B;  3VHT C;  3ZRF A;  2BF8 B;  2C5L C;  1J0G A;  2BGF A;  2JZ3 B;  2KLC A;  4MDK E;  1A5R A;  3APD A;  2CS4 A;  2DAJ A;  2NR2 A;  4DDG D;  2D07 B;  4DDI D;  2DZJ A;  2KMC A;  3ZTC A;  1UGM A;  4NAW B;  2L00 B;  4LDT D;  2OOB B;  2I1K A;  2N1V A;  2LWP A;  1EF5 A;  5FR6 A;  4KSK C;  1E90 A;  4IM0 A;  3VTU A;  4MEM A;  1Q1O A;  3AUL A;  4KZ0 A;  1P98 A;  3VUX A;  3DDC B;  3WAN A;  2KX3 A;  2MBH A;  4AOF A;  1TTN A;  3H6N A;  2KN5 A;  3VTV A;  2M8S A;  3V6E B;  1WGR A;  4AUQ C;  2FID A;  2K8C A;  2MSE D;  1RAX A;  3PV1 A;  2EKE C;  1UD7 A;  4WJN A;  4KDL B;  2GOW A;  2WWZ A;  4MGK E;  4FJY A;  2MP2 A;  1WX8 A;  1Y8R C;  3ZRC A;  3AU5 A;  1V80 A;  4W9E A;  4EZL A;  3TCA A;  2KJR A;  2MBQ A;  4OVV A;  3A1Q B;  4GGQ A;  3EFU A;  2V3S A;  4G3X B;  4KSL C;  2KO3 A;  3JVZ X;  2MBO A;  2ZJD A;  3HM6 X;  3TMP B;  2KFK B;  3L16 A;  2NBU A;  3QIJ A;  2IZV B;  1WZ3 A;  1V49 A;  4WAA A;  2J0J A;  4BVU C;  4DHZ E;  2EMT A;  3KUZ A;  3SDL C;  1Q0W B;  4A3P A;  3RD2 A;  4ZYN A;  1TGZ B;  4DHJ D;  2K6D B;  3M3J A;  4AJW A;  3QAR A;  3LJ3 A;  1E7V A;  5CTR C;  3DPD A;  3PTF C;  1V6E A;  1WXV A;  3UGB B;  4E3C A;  4F8C B;  4EUT A;  2LI5 A;  2PJH A;  3IFW B;  3VTW A;  4K81 A;  2VRR B;  2N7E A;  3NS8 A;  1IP9 A;  3BIN A;  3W1S C;  1E8Y A;  2IBI B;  1WI0 A;  1WE7 A;  3DVN V;  2G45 B;  1E8Z A;  2LZ6 A;  2BPS A;  5JZE B;  4EFO A;  2YVC A;  4FN2 A;  3X0W A;  5JHA A;  1Z2M A;  4MGY E;  4KV2 A;  3IHP C;  3JW0 X;  3DVG X;  3VVW B;  3CSF A; 
#chains in the Genus database with same CATH topology
 5JH5 C;  1P1A A;  3N30 A;  3ZTD A;  2KAN A;  4I6N B;  1TZ1 A;  2PLP A;  1P3Q U;  2IO2 B;  1T0Y A;  4NAW A;  1GOZ A;  3IVF A;  4II2 B;  2ZZP B;  2LHE A;  2IDY A;  3VRB B;  4N6E B;  3BVM A;  2JXX A;  4HPL B;  3A1Q A;  2KDB A;  2YEP B;  1GG3 A;  2WDT B;  5AEK B;  3V3X A;  3VRA B;  5DPS A;  4UDU C;  4P1C C;  4NY0 A;  3UQB A;  1NI3 A;  4TMA B;  4XGA B;  1L0X B;  4JQW C;  3ZNG C;  2KQS A;  4NAM A;  2M19 A;  4USA A;  2K3U A;  3LB8 C;  1I4G A;  3APF A;  4HCN B;  4W9I A;  4JIO U;  1EU4 A;  1CJE A;  2QC8 A;  1RLF A;  3PGE A;  2LHD A;  4PS7 A;  3Q3J A;  3SR6 A;  2LVO A;  2ZCC A;  1OEY J;  1S3S G;  3EHV A;  3H7P B;  5JXV A;  3V61 A;  1VR9 A;  2JF5 A;  4KIK A;  5GMV A;  3PHX B;  1KH0 A;  1X1M A;  4L23 A;  3LDZ E;  4XWW A;  3PSE B;  4MSQ B;  5AZH A;  4F1S A;  4K7W A;  4ACF A;  2WXN A;  3IXS A;  3P4S B;  1R7S A;  3VAW A;  2AYO B;  4KZC A;  2CJN A;  4M02 A;  1TS2 A;  1QZE A;  1ZE3 D;  1E8X A;  3S2A A;  1FM0 D;  2FCS A;  3OJ3 A;  2BTE A;  1FNU A;  1C4C A;  4ZDV A;  1K53 A;  3N3K B;  2FCQ A;  3OJ4 B;  2WDR B;  1HEZ E;  3B08 A;  3OAW A;  1JQ4 A;  2ZW1 A;  4MGI E;  3SEB A;  1C1Y B;  3IT4 B;  2AQ3 B;  1HQR D;  3VUY A;  4YTM B;  2KOX A;  2N4F A;  1H8C A;  2DYO A;  3ZJV A;  1UF0 A;  1YQ4 B;  3PRE A;  2YEP F;  4FJZ A;  3BVZ A;  4KKI A;  3L13 A;  4OHJ A;  1XCQ L;  4B6W A;  4M01 A;  2UYZ B;  1QOG A;  3ONS A;  2E3T A;  3B0A A;  1TS3 A;  3RNF C;  1GPX A;  2JSV X;  3ZQ4 A;  1QOB A;  4JWS C;  3TBL D;  1WJ4 A;  2K1F A;  2FCM A;  4CO7 A;  1JWU D;  3A33 B;  2O2V A;  3ALB A;  3RT3 B;  1PGB A;  4MAC A;  2WXI A;  2SAK A;  4BZA A;  2REX A;  1KLV A;  2PVO D;  3C0R B;  2LRU A;  3V60 A;  2RSU A;  2CU1 A;  4WJP A;  3QJZ A;  1YN3 A;  4II3 B;  4GDK A;  1NEN B;  4GOC A;  2VZK D;  3ZO5 B;  3NZ3 A;  2DZI A;  3PHW B;  4N59 A;  2AEH A;  2LVQ A;  5D6J B;  1M4V A;  4RMA A;  2BB6 A;  3RNA C;  3T3O A;  3UIO B;  1WJN A;  1P7E A;  1FXA A;  3HM3 A;  4XZ4 A;  1SXT A;  2BYF A;  1SE9 A;  1OTR B;  2D11 A;  4DHZ B;  3UQA A;  1YOV B;  1D3Z A;  2JT4 B;  4OZB A;  3W5V B;  3R2I A;  4M0W B;  1VLB A;  3UF8 A;  1IPG A;  2ZPY A;  2FAZ A;  1V1P A;  3AV8 A;  2N1W A;  2W9N A;  1IGD A;  3ZNZ B;  4LLG M;  2KC2 A;  5IAA C;  2XNA C;  2KWD A;  2SEB D;  4RF1 A;  1SGH A;  2C7M B;  1L7Y A;  3CMM B;  1FFV A;  5H92 C;  3MTN B;  2GBR A;  1FXI A;  5EE1 A;  1C76 A;  3O65 B;  5BYQ A;  5FR3 A;  3EA6 A;  2J52 A;  3ZXV A;  1GB1 A;  2NPT A;  2ASQ A;  1V97 A;  1AN8 A;  2DHZ A;  1FNV A;  2A5U A;  1ET6 A;  4KDI C;  3AE9 B;  5BYS A;  4AP4 C;  1WIA A;  5HKH A;  3NVV A;  3V62 A;  4HDO A;  4XDC A;  4QAY A;  3AEB B;  3T3N A;  3MHS D;  4B9K A;  5EDS A;  2WX0 A;  1WGG A;  4EZJ A;  3M63 B;  1AW7 A;  2I1J A;  2RPQ A;  4MM3 A;  4RGO S;  1NBF C;  2GBK A;  2GLS A;  1F1H A;  3AED B;  1FCC C;  4I6P A;  2WX1 A;  2BW2 A;  1RM6 C;  1T5X D;  2M1M A;  3C19 A;  1FNW A;  3WAM A;  4LDT B;  2JU6 X;  1RFA A;  3HVZ A;  1NYR A;  3ML9 A;  2JVC A;  3NZS A;  2AL6 A;  5TSS A;  3TL5 A;  3QA8 A;  4BKT A;  1SIF A;  4BAX A;  4MH0 E;  2IND C;  5J2R A;  3NRZ A;  3Q3N C;  4MSM B;  4G11 A;  1L6U A;  4M8N A;  3Q3F A;  2UU7 A;  3P63 A;  1EF1 A;  2Z0D B;  4HPP A;  1UEL A;  5CX3 A;  2KVZ A;  2MJ3 A;  4KKJ A;  1BT0 A;  5CHW A;  2PVG C;  5E6O A;  1WGD A;  4H2A A;  1I4Q A;  1ZGU B;  2K22 A;  2DBY A;  2W55 A;  3KLS X;  5H8Y E;  3MFG A;  2C60 A;  4ZRP A;  2BGF A;  2KT7 A;  2L52 A;  2DAJ A;  1YMH E;  4DDI D;  4TSS A;  2KMC A;  1DOX A;  1UGM A;  4RCO A;  2L00 B;  2CJO A;  2OOB B;  3ZYY X;  4MT5 A;  4KSK C;  2NTS A;  3I57 A;  1MHX A;  3R2T A;  3V6E B;  2FID A;  2BS4 B;  1DGJ A;  2MP2 A;  4KGT A;  5G5G A;  1MPE A;  3WCQ A;  2MBQ A;  4OVV A;  3A1Q B;  4GGQ A;  3U52 E;  3EFU A;  2BB5 A;  4KSL C;  2ZJD A;  3UI3 A;  2NBU A;  4WAA A;  4BVU C;  1C4A A;  3N1Y C;  3RN9 C;  1SE4 A;  3AE3 B;  4DHJ D;  2K6D B;  3B2F A;  3M3J A;  3H8H A;  5CTR C;  1FD6 A;  2IPK D;  3UGB B;  1VDV A;  4S17 A;  4EUT A;  2LI5 A;  1L4Z B;  2PW9 A;  1E10 A;  1T6B X;  2E6X A;  2G45 B;  3P1M A;  2YVC A;  5JHA A;  3X0W A;  4KV2 A;  2DLB A;  3VVW B;  3CSF A;  4US8 A;  4TQ1 A;  1ESF A;  2WXL A;  4IUM B;  2N9L A;  5E6J A;  2G4D B;  4PYZ A;  4NJ7 A;  1YQ3 B;  2J53 A;  2XEW A;  4PT5 A;  3DBH I;  1WJ6 A;  4DHJ B;  2BWE S;  2NBW B;  2JUO A;  1IBX A;  3WAP A;  1IUE A;  3WIM A;  4WH4 A;  3ZNI D;  2WQY B;  1D5M C;  2N9X A;  3U30 A;  2G9H D;  1SB3 C;  2BVC A;  1WJU A;  4L1B A;  2M4N A;  4E71 A;  3QCA A;  3WA0 A;  2CR5 A;  4YSX B;  3AM9 A;  4P16 A;  1V9J A;  1F9J A;  3VDZ A;  4R3D A;  2IY0 B;  1TS4 A;  2OHF A;  4BBN F;  2NBV B;  5I4D A;  2O2V B;  1ZXI A;  3GOE A;  3DBL B;  4M8M A;  1P7F A;  1XEE A;  4FUL A;  3U8Z A;  4PYU A;  1RWS A;  4NNJ B;  4AS1 A;  1SSN A;  1I42 A;  3IAS 1;  1XO3 A;  2LJI A;  4XDD A;  1Q10 A;  3B9J A;  4LTU A;  1WE6 A;  1KJT A;  2DWQ A;  1WYW B;  2LGX A;  2KK8 A;  4P6V F;  2WDQ B;  2L32 A;  3SFD B;  2K25 A;  4ANW A;  1R4M I;  2DZM A;  3U7D A;  1YX5 B;  1JAL A;  2FNJ B;  1XQQ A;  4A55 A;  3U7Z A;  4C80 A;  2CHX A;  4JWU C;  1E6E B;  4LK0 M;  3GZN I;  2WXQ A;  5AUI A;  2VH1 A;  3QHT A;  1JRU A;  2KKC A;  4XWT A;  4BKG A;  5LXH A;  4FBJ B;  2DAF A;  3MHZ A;  2L8J A;  2Y3A A;  3VR8 B;  1VD2 A;  1KLU D;  3EFC A;  3DVN U;  4ARI A;  1GC6 A;  2PE6 B;  2KFK A;  2HTH A;  1WY8 A;  2PTL A;  2HJ8 A;  3A4R A;  2FCN A;  2MJD A;  1GNU A;  1PUT A;  4K7S A;  4HK2 A;  4S0R A;  3EEC A;  2M0X A;  5DPT A;  2DEN B;  3NUH B;  3A9K B;  1EU3 A;  3BYY B;  1GAQ B;  2QDF A;  1B9R A;  2LD9 A;  2HDE A;  1AYF A;  2WHI A;  2JWZ A;  3B2G A;  4CHK A;  3ZIM A;  4LCD E;  5IOI A;  2RGF A;  4M00 A;  4EKU A;  4ITK A;  1YJ1 A;  4PS8 A;  2CKH B;  2CHW A;  1V1P B;  5BMI A;  3ZDM C;  1WH3 A;  2FUG 1;  3PZ7 A;  4MEL A;  4K3C A;  2QCZ A;  3QQ8 B;  3WAL A;  4KGS A;  1YD8 U;  4WAF A;  3ZLZ A;  4EZK A;  1ACC A;  3CWI A;  2HE7 A;  2W82 A;  4GXB A;  2PIA A;  4W9F A;  1XLN A;  2WNM A;  3DHI C;  3PZD A;  4C7Y A;  2NS5 A;  1J8C A;  3SU8 X;  4BBN C;  2X8X X;  4TUU A;  2KTR A;  1K52 A;  2KFJ A;  1ENF A;  3JSV A;  2R2O A;  4HCP B;  1UBI A;  4W9C A;  3A4S C;  3AH7 A;  3ML8 A;  3TEW A;  1E8W A;  2LXC A;  4ASW C;  2L0T A;  1V1O A;  3DBS A;  3RZW C;  3P4Q B;  4ZRJ A;  3KH0 A;  3I5J C;  1YJJ A;  2V3P A;  2RR9 A;  1LFD A;  3PRZ A;  2V0G A;  2L83 A;  1DOI A;  4IM2 A;  5KHO A;  2QIE B;  1NVI D;  1K8R B;  1WRI A;  4LJO B;  4TKN A;  4C7Z A;  1PDX A;  3KWL A;  3VH3 B;  4DBG A;  4N9F 4;  1ZPS A;  5HG2 A;  1I4H A;  4J3O D;  2AX5 A;  4LNO A;  4REZ A;  1WWT A;  3A9J A;  2DZK A;  1WXM A;  2I38 A;  2JY6 A;  1K50 A;  2HJ1 A;  4E74 A;  2LAS A;  4FJV B;  2JZZ A;  1SIJ A;  1ZOY B;  3PT2 B;  1QLB B;  4DXG A;  1WGK A;  1TYG B;  2YLM A;  2L0F A;  3V05 A;  1XT9 B;  2K8B A;  3SD5 A;  1F77 A;  4M0W A;  2C9W B;  2GB1 A;  3U4E G;  4LNI A;  2IY1 B;  4RM9 A;  4JL9 A;  3HVD A;  1FFU A;  2KQ4 X;  2KYW A;  2ICI A;  3D32 A;  3QK0 A;  3GE3 C;  2WXG A;  1E9M A;  4FA6 A;  2QJL A;  2JRH A;  3C8Y A;  3ETR A;  4PK1 A;  1R4N I;  3APC A;  2AQ2 B;  1Q5W B;  3JYU A;  3T9L A;  4LNF A;  2LRW A;  3KYD D;  3W1S A;  4DK5 A;  3HK0 A;  4BKS D;  2O6V D;  5HFY A;  1JRO A;  4EOY A;  2C7H A;  2RDG A;  1MG8 A;  2WXR A;  4KX6 B;  3KW5 B;  3GB1 A;  1CMX B;  3AE8 B;  5J17 A;  1VZ6 A;  1GC7 A;  3GE8 C;  2KWU B;  2DNF A;  1ZP0 B;  2RDB C;  4W9L A;  1J19 A;  3DWG C;  4ZOH C;  4NJC A;  5EE9 A;  4B95 A;  3O13 A;  2NMQ A;  3VR9 B;  1PGA A;  4ANX A;  4X57 B;  4A8X C;  3Q8C A;  1FEH A;  2IO0 B;  2MEK A;  3RNB C;  3AE5 B;  3M95 A;  1C79 A;  1R4N B;  1WR1 A;  2JX5 A;  3CF6 E;  4YXD B;  2MLB A;  1PQS A;  1AWD A;  2J0K A;  3TSS A;  3FKY A;  1HE8 A;  1NI2 A;  3R7R A;  3PRM B;  2KNB A;  3X23 A;  2MHJ A;  2INC C;  4RGM A;  5IP4 D;  3J9C A;  1TIF A;  1IGC A;  1YJI A;  2BF8 B;  2JZ3 B;  2KLC A;  1KFY B;  3APD A;  2NR2 A;  1T0R C;  4DDG D;  1VRA B;  3AEE B;  4NAW B;  4LDT D;  1WSP A;  2I1K A;  2LWP A;  5FR6 A;  3VTU A;  1L6V A;  2BYT A;  4MEM A;  3KQ4 A;  4AOF A;  3ABV B;  4AUQ C;  2BQQ A;  3N1Z C;  4WJN A;  1T3Q A;  2GOW A;  2WWZ A;  4FJY A;  2WU5 B;  3OWE B;  4EZL A;  2WXJ A;  2ON8 A;  3N9Y C;  4ZHO A;  1DOY A;  2KO3 A;  1FO4 A;  2MBO A;  3TMP B;  2KFK B;  3L16 A;  4ZRQ A;  3QIJ A;  2IZV B;  3SDL C;  1E0Z A;  3RD2 A;  5C2T B;  3BII D;  3I63 C;  1KF6 B;  4E3C A;  3IFW B;  2WLB A;  3VTW A;  4HJG E;  1QOF A;  2N7E A;  1IP9 A;  3DHG C;  3W1S C;  4KGR A;  1WE7 A;  1E8Z A;  5JZE B;  3EUB 2;  1OFF A;  3IHP C;  3JW0 X;  2V9H A;  1ROE A;  3PZ8 A;  1HTO A;  1EO6 A;  2FBW B;  3DBL I;  1V86 A;  2RD0 A;  2EMS A;  1QKZ A;  2W3S A;  2NVU I;  2G1E A;  3DOW A;  3RYT A;  4OW0 A;  3ENE A;  1F2R C;  4YTP B;  3KVF B;  3ZUN A;  3N32 A;  1J7B A;  4HWI B;  2WYQ A;  1EUV B;  2J7Q B;  1FRR A;  3R66 C;  4IM3 A;  1K51 A;  2FIF A;  2KD0 A;  5DPW A;  2KVR A;  3BVG A;  3VH4 B;  1GB4 A;  1V5T A;  3WAO A;  4HLE A;  1EWC A;  5AZF A;  1OQY A;  4AQ7 A;  4N58 A;  3NZU A;  4WIP A;  2N7J A;  2V1Y A;  1H4R A;  2JYE A;  2KDE B;  4FXC A;  5L95 C;  1WYG A;  2GBN A;  1SE3 A;  2JZP A;  1SF0 A;  5D7G A;  2O6V B;  3KUC B;  4EEW A;  3NHE B;  2Y5B B;  4BOZ B;  3ZJT A;  3Q8F A;  4D2K A;  5HI1 A;  3Q69 A;  4XC2 A;  3P42 A;  2D3A A;  2Y5P A;  2C7N B;  2PPH A;  4OZA A;  3UIP B;  2IGD A;  3RMK C;  3VQI A;  2B76 B;  4A3O A;  2O6V A;  4C4V A;  2LGY A;  3NG0 A;  4BOS C;  1FCL A;  3UIN B;  3ZVV A;  4MJS B;  1L5P A;  4PS3 A;  4GMV A;  4WQM A;  1WXQ A;  3DQV A;  2K39 A;  4GU2 A;  4IOI E;  4DQO C;  1ZDX A;  1GUA B;  2UWQ A;  2INP E;  4MGZ E;  3ZJU A;  2Z0E B;  1XD3 B;  1WX9 A;  1N63 A;  2Y5C A;  1FPY A;  2LMC A;  1UBQ A;  2RPV A;  2IGG A;  3P2B A;  1PGX A;  3VUW A;  2J4X A;  2V4I B;  3MC8 A;  4WWP A;  1CZP A;  3KWV A;  4IG7 B;  2EKI A;  2DYM A;  5G55 A;  2H88 B;  3Q8B A;  3AEF B;  1UNS A;  2CU3 A;  5E6N A;  2XK5 B;  2D3G A;  3W1Y A;  1E5W A;  2KWV B;  3ECI A;  5GXG B;  3DBR B;  2XK5 A;  1SE2 A;  2KLG A;  2WXH A;  1S1Q B;  2LUE A;  3LYY A;  4GIV A;  1TBE A;  4ANV A;  3H9D A;  4AWJ A;  2KQ7 A;  2K6Q A;  2QSD A;  3N1X C;  4HEA 1;  2L05 A;  4IWO A;  1OEY A;  1XLP A;  3H7S A;  1XF5 L;  4ZRI A;  3TIX A;  4K1R B;  2X38 A;  2KC1 A;  4FLH A;  3Q8E A;  1JWB D;  5IO9 A;  1V81 A;  2K8H A;  4W9J A;  3MJ5 A;  3E9S A;  3LXF A;  1I4R A;  1JWS D;  5LNK 1;  2OJR A;  1C9F A;  3T8M A;  3FIL B;  2KDF B;  1F52 A;  2XBB C;  5E6P A;  3PPA A;  2JRI B;  4GDL B;  2IYD B;  5FK9 C;  4MM3 B;  2R61 A;  2KJH B;  1AAR A;  3RI7 C;  1D5X C;  4HJK A;  1WMH A;  1TKG A;  1WGH A;  5D2M B;  2ZNV C;  2LUM A;  3AE4 B;  2TSS A;  4K7U A;  3GS2 A;  3BK1 A;  3NVY A;  1P9D U;  2KMA A;  2IO1 B;  2LFI A;  1KM7 A;  4WJQ A;  2M56 B;  2LGS A;  2ZPN A;  1V5O A;  3AEA B;  2K9X A;  3Q6B A;  2LVP A;  5IN7 A;  2L1A A;  4BKS A;  2Z8L A;  1B1Z A;  2ZW0 A;  4CQN A;  1TKE A;  5BMH A;  3AE1 B;  4JX1 C;  5JHB A;  4EE2 A;  2QMT A;  3MC0 B;  1N61 A;  2N9P C;  2IO3 B;  3L0W B;  3N20 C;  1SBB B;  2L7R A;  4TQ0 A;  3VXW A;  1TY2 A;  1XLO A;  4RFB A;  1G6J A;  4G50 A;  4B0E A;  2LGD A;  1N60 A;  5CHV C;  1OGW A;  4KIK B;  5IKC M;  5L83 A;  4DWF A;  1A70 A;  2KTF A;  4NPN A;  3QC8 B;  1I35 A;  1NEK B;  2MJE A;  1N5X A;  1E7U A;  4JE3 B;  3CIR B;  3AXC A;  4IDI A;  5LXI B;  2D10 A;  4GSW A;  2VZK B;  1YQB A;  4A90 A;  3RUL A;  3ZDT A;  4K3B A;  4LJP B;  1WM3 A;  4A20 A;  2KX0 A;  3HUI A;  2PKO A;  2LJ5 A;  1SJH D;  3L54 A;  1JW9 D;  2ZEQ A;  1LGR A;  4HPM B;  2Q5W D;  1EM7 A;  1VCB A;  2AQ1 B;  1IYF A;  2ZVN A;  1N5W A;  3IG3 A;  3RCZ A;  4FHJ A;  1C78 A;  4GN1 A;  4A9A A;  2N7D A;  3AEG B;  2BYE A;  1MFW A;  2WXF A;  4NJ6 A;  3PLU A;  1JRP A;  1KTK A;  1F0Z A;  3NY5 A;  1WRD B;  3PO0 A;  2QIL A;  3TJP A;  3RNG C;  2WU2 B;  2JPH A;  1DYQ A;  3RPF C;  3VHT C;  3NVW A;  1R4M B;  1FMA D;  2C5L C;  4MDK E;  2HTM E;  1JML A;  2D07 B;  1J7C A;  4YWG G;  2MH7 A;  3Q8A A;  5G5H A;  1TJE A;  1I7H A;  2D3C A;  4IM0 A;  3FIL A;  1HZ6 A;  1HA5 A;  3Q3M C;  4KZ0 A;  3VUX A;  3DDC B;  1TTN A;  4L2Y A;  3H6N A;  2KN5 A;  1RYJ A;  2RMM A;  2M8S A;  1WGR A;  2MSE D;  3PV1 A;  2EKE C;  4MGK E;  2BS2 B;  1Y8R C;  3AU5 A;  4W9E A;  2KJR A;  2WXP A;  2H89 B;  3BYT B;  2V3S A;  3HM6 X;  2LGI A;  1WZ3 A;  1V49 A;  2J0J A;  1JCK B;  5D3I B;  2EMT A;  3KUZ A;  1XCT L;  4ZYN A;  1TGZ B;  3OG5 A;  3NVZ A;  3QAR A;  4AJW A;  3BZD B;  3AE6 B;  3PTF C;  1V6E A;  4P1B C;  1FIQ A;  4HRS A;  5C3J B;  2PJH A;  1STE A;  1KRH A;  4XYC A;  3BIN A;  2IBI B;  3DVN V;  2BPS A;  4EFO A;  4FN2 A;  4MGY E;  1QT9 A;  2NTT A;  1SJE D;  1FXT B;  1VZ8 A;  1WF9 A;  1RFK A;  2BS3 B;  3A9J B;  1F2R I;  2MA9 B;  3R3M A;  2G4S A;  4BFR A;  1UZX B;  4NQK E;  3U2S C;  5TR5 A;  1XXG A;  4GB9 A;  4TV3 A;  4WQO B;  4JLC A;  4W9H A;  1M94 A;  5T8I A;  3SHQ A;  1BXT A;  3W2D A;  1E7P B;  4HKQ A;  2J0M A;  2N0S B;  1LXD A;  1YNT E;  1QOA A;  3AMZ A;  3DWM A;  2GBM A;  4XE0 A;  2QEJ C;  1ZKH A;  1MJD A;  5BMG A;  2L76 A;  2B3A A;  3NOB A;  1NDD A;  1L2N A;  1TY0 A;  1VJK A;  3PRP B;  3DVG Y;  2R2Q A;  1TKY A;  2ZVO A;  3I9V 1;  4IKG A;  1WM2 A;  4YL8 A;  4HXD A;  1ET9 A;  2KTR B;  2I2Y A;  2KZR A;  3AI5 A;  4US9 A;  2KJ6 A;  3Q14 C;  1WXA A;  3K9O B;  2EEL A;  3RUI B;  2L3Z A;  4IWP A;  2GBJ A;  1VZ7 A;  4C56 C;  2MBE A;  4P7I A;  3EGR A;  1LO5 D;  2M17 A;  3TUO A;  3AU4 A;  2KWC A;  3CST A;  2KAJ A;  4F7Z A;  4URK A;  2INN E;  3AE2 B;  2MX2 A;  5DCN A;  3R7Q A;  4FAD A;  2CHZ A;  1D6E C;  2NCN A;  2V4L A;  1Z5S B;  4ARC A;  2JXT A;  1ISN A;  2BT6 A;  4LNK A;  2ZCB A;  4HDQ A;  4W9G A;  1LQB A;  1WFY A;  4JGH B;  4W9D A;  2AWT A;  1ZUD 2;  2KHW B;  4NZL B;  2G3Q B;  4ZRK A;  2PEA A;  2WGS A;  4OZC A;  1GJZ A;  2K5P A;  3EC8 A;  4KVG B;  4AJY B;  4WWM A;  3AN1 A;  2ACZ B;  4IC7 B;  2Z59 B;  5C1Z A;  3MJW A;  3HRD D;  4IWQ A;  3VFK A;  2OJW A;  4RGT A;  4DXA B;  2D5G A;  4RM8 A;  3L17 A;  4JPS A;  1IBX B;  3OLM D;  1CK1 A;  5G2N A;  3IAM 1;  1LM8 B;  4W9K A;  3Q2A C;  2BBC A;  1L0V B;  1WMH B;  1ZXH A;  1U4A A;  2D3B A;  1C4P A;  2BKR B;  2OED A;  1V8C A;  1XLQ A;  1PYW D;  1T0S C;  5KHQ A;  4ZHP A;  4NQL B;  3BY4 B;  4HKZ E;  4C00 A;  3GZN B;  2A4Z A;  3I3T B;  2V3N A;  4FHK A;  4J6I A;  2ZNV B;  3HIZ A;  3P4R B;  3IBE A;  2MWS B;  5EE0 A;  2GRI A;  5FKA C;  1UH6 A;  1UWX A;  2KDI A;  5AZG A;  2HD5 B;  1MI0 A;  2MW5 A;  1QIL A;  3L4P A;  4G0N B;  3NJT A;  1YIW A;  5DPR A;  2KDM A;  3RNC C;  2DX5 B;  2W54 A;  1UUP A;  3H1U A;  5J18 A;  2W3R A;  3B1L X;  5MPO A;  3DCG A;  1YN4 A;  3PLV A;  1EWY C;  5D94 A;  4RH6 A;  1I4X A;  2MRP A;  1WGY A;  2GI9 A;  1V2Y A;  1WR6 E;  2IGH A;  3JSV B;  2KXJ A;  4ICU A;  3AB5 A;  5BO4 B;  4RNA A;  1OQQ A;  2MBB B;  1HXY D;  4OVU A;  1UGJ A;  1HZ5 A;  3RZF A;  1WXS A;  3URY A;  1KOT A;  1QQR A;  1L4D B;  1ZW7 A;  5HHD G;  2ONQ A;  1Y56 A;  1ZDV A;  3MP9 A;  3DBR I;  3W5U B;  4GLS C;  4ZYS A;  3ZKJ C;  2WXM A;  4GDK B;  5D3D A;  1OQR A;  3E56 A;  3P4P B;  3QX1 A;  3KUD B;  5LLI A;  4MH8 A;  2AL3 A;  1YX6 B;  2D2Q A;  4OVZ A;  1D5Z C;  1MVK A;  1C3T A;  1T0Q C;  3A9K A;  2MQJ A;  1L0Y B;  3K9P B;  4ICV A;  1RRB A;  3PVL A;  2WXO A;  3FAH A;  1J7A A;  3BK2 A;  1JWM D;  4WJO A;  2PE9 A;  3SFE B;  1NYQ A;  1PFD A;  4WUR A;  4C4V B;  4WWN A;  2WXK A;  2FUH B;  2K0P A;  4O1N A;  1P0R A;  2BKF A;  4MJS A;  3H7P A;  4YSY B;  1TS5 A;  4RF0 A;  2JWU A;  2MCN B;  1D4B A;  2N9K A;  2N9E B;  3DBH B;  3M62 B;  5CHF A;  4YSZ B;  4WWO A;  4XX5 A;  2QHO A;  4YT0 B;  2LXA A;  1MHH E;  5AUK A;  2RDH A;  1WX7 A;  3KYC D;  4HVB A;  1KLG D;  5C23 A;  2WP9 B;  3AEC B;  3QAQ A;  3TEZ A;  3HHM A;  5IA7 A;  1BUI C;  2FE8 A;  3MC9 A;  1TT5 B;  1QF6 A;  3QWZ B;  1JWA D;  1N62 A;  2IJ0 A;  3TEY A;  4I6L B;  4GDL A;  3ZGZ A;  2NPT B;  3DHH C;  4ANU A;  2KN4 A;  2KMM A;  3V6C B;  3L10 B;  3AE7 B;  2BYV E;  4IW0 A;  4DXF A;  1WZ0 A;  3PS6 A;  2XN9 C;  3L08 A;  2DYB A;  1FRD A;  4CYE A;  2GMI C;  3ZNH B;  5EE3 A;  4YTN B;  3R8B A;  1MG4 A;  2LEK A;  2BWF A;  1C77 A;  3RNE C;  3ZW3 A;  2MP2 B;  3W9C B;  5BYR A;  1HTQ A;  3ZRF A;  4Q2J A;  1J0G A;  1A5R A;  1BML C;  2CS4 A;  3IT6 B;  2DZJ A;  4LNN A;  3ZTC A;  2N1V A;  1EF5 A;  3RFZ B;  1E90 A;  3Q3O C;  2JYT A;  1Q1O A;  3AUL A;  1P98 A;  3WAN A;  2KX3 A;  2MBH A;  2KAC A;  3FC4 A;  1UWM A;  3VTV A;  2K8C A;  1RAX A;  1UD7 A;  4KDL B;  1WX8 A;  4RGN A;  3ZRC A;  1V80 A;  3TCA A;  2PMV A;  3ZXR A;  1I4P A;  3GP7 A;  3TEX A;  4G3X B;  2JQR B;  3JVZ X;  2WDV B;  2WS3 B;  4DHZ E;  4A6Q A;  1Q0W B;  4A3P A;  1CQV A;  1YN5 A;  2J42 A;  3LJ3 A;  1E7V A;  3DPD A;  2VH2 A;  1TZO A;  1WXV A;  4F8C B;  2M0A A;  4K81 A;  2VRR B;  4B0M A;  4HRO A;  1N6Z A;  3NS8 A;  1E8Y A;  1WI0 A;  3BWU D;  2LZ6 A;  1Z2M A;  3DVG X;  3NS1 A;  1SEB D; 
#chains in the Genus database with same CATH homology
 5JH5 C;  4TQ1 A;  1FXT B;  4IUM B;  1EO6 A;  1P1A A;  3N30 A;  3ZTD A;  2KAN A;  1WF9 A;  2G4D B;  4PYZ A;  4NJ7 A;  3A9J B;  3DBL I;  1V86 A;  2MA9 B;  4I6N B;  1TZ1 A;  2RD0 A;  3R3M A;  2EMS A;  2G4S A;  4BFR A;  1UZX B;  4NQK E;  2XEW A;  2NVU I;  1P3Q U;  5TR5 A;  3DBH I;  2IO2 B;  1T0Y A;  3DOW A;  4NAW A;  1WJ6 A;  3IVF A;  2BWE S;  2NBW B;  2JUO A;  4II2 B;  3RYT A;  3WAP A;  3ENE A;  4DHJ B;  2ZZP B;  3WIM A;  4GB9 A;  4TV3 A;  2JXX A;  3ZNI D;  4HPL B;  3A1Q A;  3KVF B;  2KDB A;  4WQO B;  2N9X A;  4JLC A;  3U30 A;  1GG3 A;  2WDT B;  3ZUN A;  4W9H A;  3N32 A;  1M94 A;  1WJU A;  3SHQ A;  4HWI B;  5AEK B;  2M4N A;  2WYQ A;  4E71 A;  2J0M A;  5DPS A;  1EUV B;  2J7Q B;  3QCA A;  3WA0 A;  1LXD A;  2CR5 A;  4NY0 A;  3UQB A;  3R66 C;  1V9J A;  4IM3 A;  1F9J A;  2GBM A;  2FIF A;  3VDZ A;  2KD0 A;  5DPW A;  1ZKH A;  2KVR A;  3VH4 B;  2L76 A;  2B3A A;  2IY0 B;  3NOB A;  1NDD A;  1V5T A;  4JQW C;  3ZNG C;  4BBN F;  2KQS A;  1L2N A;  2NBV B;  3WAO A;  3PRP B;  2O2V B;  4HLE A;  3GOE A;  4M8M A;  5AZF A;  4FUL A;  3APF A;  4HCN B;  1OQY A;  4W9I A;  4JIO U;  3DVG Y;  3NZU A;  4PYU A;  2R2Q A;  3U8Z A;  2ZVO A;  2V1Y A;  1RLF A;  3PGE A;  1H4R A;  1WM2 A;  4NNJ B;  3Q3J A;  4PS7 A;  4YL8 A;  4HXD A;  2KDE B;  2LVO A;  2ZCC A;  1OEY J;  1S3S G;  2KTR B;  3EHV A;  2KZR A;  3H7P B;  5L95 C;  3AI5 A;  1I42 A;  3V61 A;  2KJ6 A;  2JF5 A;  2GBN A;  4KIK A;  5D7G A;  1WE6 A;  1KJT A;  1WXA A;  3K9O B;  5GMV A;  3PHX B;  2O6V B;  1WYW B;  3RUI B;  1X1M A;  3KUC B;  4EEW A;  2L3Z A;  3NHE B;  3LDZ E;  3PSE B;  2Y5B B;  2LGX A;  4MSQ B;  4BOZ B;  2KK8 A;  5AZH A;  4IWP A;  2GBJ A;  4F1S A;  2K25 A;  4ANW A;  4XC2 A;  1R4M I;  4K7W A;  2MBE A;  4P7I A;  2DZM A;  2C7N B;  2PPH A;  3U7D A;  3UIP B;  1YX5 B;  2M17 A;  3AU4 A;  2FNJ B;  2KWC A;  2AYO B;  3CST A;  4KZC A;  3VAW A;  3VQI A;  4F7Z A;  4URK A;  4A3O A;  2O6V A;  1QZE A;  1XQQ A;  2MX2 A;  1E8X A;  2LGY A;  3S2A A;  4BOS C;  2FCS A;  3OJ3 A;  5DCN A;  3UIN B;  2CHX A;  4MJS B;  3R7Q A;  3ZVV A;  4FAD A;  2CHZ A;  4ZDV A;  4PS3 A;  4GMV A;  3GZN I;  2NCN A;  3N3K B;  2FCQ A;  3OJ4 B;  3QHT A;  1JRU A;  2V4L A;  3DQV A;  1Z5S B;  2K39 A;  4GU2 A;  3B08 A;  2KKC A;  1ISN A;  4BKG A;  5LXH A;  4FBJ B;  2DAF A;  1GUA B;  2ZCB A;  2UWQ A;  3OAW A;  2L8J A;  4MGI E;  1C1Y B;  1VD2 A;  4HDQ A;  1LQB A;  4MGZ E;  4W9G A;  1WFY A;  2Z0E B;  4JGH B;  1XD3 B;  3VUY A;  1WX9 A;  2KOX A;  2AWT A;  2N4F A;  3DVN U;  2DYO A;  4W9D A;  1H8C A;  3PRE A;  1GC6 A;  2KHW B;  2G3Q B;  4ZRK A;  2PE6 B;  2PEA A;  4FJZ A;  1GJZ A;  1UBQ A;  2KFK A;  3EC8 A;  2HTH A;  1WY8 A;  4KVG B;  4AJY B;  3P2B A;  3L13 A;  2HJ8 A;  3A4R A;  2FCN A;  3VUW A;  1GNU A;  4IC7 B;  4B6W A;  2UYZ B;  2Z59 B;  3MJW A;  5C1Z A;  4IWQ A;  4K7S A;  3VFK A;  4WWP A;  4HK2 A;  3EEC A;  3ONS A;  2M0X A;  5DPT A;  2DEN B;  3B0A A;  4IG7 B;  4DXA B;  4RM8 A;  3L17 A;  3OLM D;  5G2N A;  1LM8 B;  2DYM A;  3A9K B;  5G55 A;  4W9K A;  2LD9 A;  3TBL D;  5E6N A;  2XK5 B;  2D3G A;  1WMH B;  1WJ4 A;  2K1F A;  2JWZ A;  2FCM A;  4CHK A;  3ZIM A;  4LCD E;  3W1Y A;  1E5W A;  2KWV B;  2RGF A;  3ECI A;  4CO7 A;  4EKU A;  1U4A A;  1YJ1 A;  2XK5 A;  3A33 B;  2CKH B;  4PS8 A;  2CHW A;  3ZDM C;  1WH3 A;  2BKR B;  2KLG A;  4MEL A;  2O2V A;  1S1Q B;  3ALB A;  2LUE A;  3QQ8 B;  4GIV A;  1TBE A;  3RT3 B;  3WAL A;  4ANV A;  3H9D A;  5KHQ A;  1KLV A;  2REX A;  1YD8 U;  3C0R B;  4AWJ A;  2LRU A;  4NQL B;  2KQ7 A;  3BY4 B;  3ZLZ A;  4EZK A;  3V60 A;  2K6Q A;  2A4Z A;  2HE7 A;  4GXB A;  4W9F A;  2RSU A;  2CU1 A;  3I3T B;  3PZD A;  1J8C A;  2NS5 A;  4WJP A;  3SU8 X;  4BBN C;  3QJZ A;  4FHK A;  4J6I A;  2L05 A;  4II3 B;  4GDK A;  4IWO A;  4GOC A;  2ZNV B;  1OEY A;  3HIZ A;  4TUU A;  3H7S A;  3ZO5 B;  4ZRI A;  2DZI A;  3IBE A;  2MWS B;  3TIX A;  2KTR A;  4K1R B;  3PHW B;  2KC1 A;  2KFJ A;  4FLH A;  1UH6 A;  3JSV A;  2KDI A;  2R2O A;  2AEH A;  2HD5 B;  5AZG A;  2LVQ A;  5D6J B;  4RMA A;  4HCP B;  1UBI A;  4W9C A;  3A4S C;  3UIO B;  1V81 A;  2K8H A;  4W9J A;  3ML8 A;  2MW5 A;  1WJN A;  4G0N B;  1E8W A;  5DPR A;  1YIW A;  2DX5 B;  3HM3 A;  3H1U A;  4XZ4 A;  5J18 A;  2OJR A;  2LXC A;  3B1L X;  4ASW C;  2BYF A;  3DCG A;  2L0T A;  3DBS A;  1SE9 A;  3PLV A;  1OTR B;  2D11 A;  3RZW C;  3T8M A;  5D94 A;  4DHZ B;  4ZRJ A;  2KDF B;  2MRP A;  3KH0 A;  3UQA A;  2XBB C;  1D3Z A;  2JT4 B;  1WGY A;  5E6P A;  4M0W B;  3PPA A;  3UF8 A;  1IPG A;  2JRI B;  1V2Y A;  2RR9 A;  2ZPY A;  4GDL B;  1LFD A;  1WR6 E;  2FAZ A;  2IYD B;  3JSV B;  3PRZ A;  2KXJ A;  2KJH B;  4ICU A;  1AAR A;  4IM2 A;  5BO4 B;  5KHO A;  2MBB B;  2N1W A;  4OVU A;  4HJK A;  3RZF A;  2W9N A;  1WXS A;  1KOT A;  1WMH A;  1ZW7 A;  5D2M B;  1WGH A;  3ZNZ B;  1K8R B;  4LJO B;  2ZNV C;  2KC2 A;  4TKN A;  3DBR I;  5IAA C;  4K7U A;  3VH3 B;  4DBG A;  4N9F 4;  1P9D U;  2KMA A;  1SGH A;  2IO1 B;  2C7M B;  1L7Y A;  3ZKJ C;  1KM7 A;  3A9J A;  4WJQ A;  2DZK A;  1WXM A;  4GDK B;  2JY6 A;  2ZPN A;  3CMM B;  3QX1 A;  4E74 A;  2LAS A;  3KUD B;  4FJV B;  1V5O A;  2JZZ A;  3PT2 B;  5LLI A;  2LVP A;  2AL3 A;  1YX6 B;  2D2Q A;  4BKS A;  3MTN B;  2GBR A;  3O65 B;  2YLM A;  2L0F A;  5JHB A;  1XT9 B;  2NPT A;  2ASQ A;  2N9P C;  2IO3 B;  2K8B A;  3L0W B;  1C3T A;  3SD5 A;  2DHZ A;  3A9K A;  2MQJ A;  3K9P B;  2C9W B;  4ICV A;  2IY1 B;  4RM9 A;  1RRB A;  2A5U A;  2L7R A;  3PVL A;  4JL9 A;  4TQ0 A;  4KDI C;  3VXW A;  4AP4 C;  1WIA A;  2PE9 A;  4WJO A;  5HKH A;  3D32 A;  1G6J A;  3QK0 A;  4WWN A;  3V62 A;  2FUH B;  4HDO A;  1P0R A;  2BKF A;  4G50 A;  4FA6 A;  4MJS A;  2LGD A;  3H7P A;  2JRH A;  1R4N I;  3APC A;  3MHS D;  4B9K A;  1Q5W B;  5CHV C;  5EDS A;  2WX0 A;  3JYU A;  2MCN B;  1WGG A;  3T9L A;  3W1S A;  2LRW A;  1OGW A;  3KYD D;  4KIK B;  4DK5 A;  3HK0 A;  2N9E B;  4BKS D;  4EZJ A;  3M62 B;  4DWF A;  5L83 A;  2KTF A;  3M63 B;  4NPN A;  5CHF A;  2O6V D;  3QC8 B;  1I35 A;  4WWO A;  4XX5 A;  2QHO A;  2I1J A;  2LXA A;  2RPQ A;  4EOY A;  1WX7 A;  2C7H A;  4MM3 A;  1MG8 A;  1E7U A;  3KYC D;  4HVB A;  1NBF C;  2GBK A;  3AXC A;  3KW5 B;  4I6P A;  2WX1 A;  5C23 A;  3QAQ A;  2D10 A;  5LXI B;  1CMX B;  4GSW A;  2M1M A;  5J17 A;  3HHM A;  5IA7 A;  1GC7 A;  1YQB A;  2KWU B;  3WAM A;  4LDT B;  1RFA A;  3RUL A;  4W9L A;  3ML9 A;  2JVC A;  3ZDT A;  1J19 A;  3NZS A;  3QWZ B;  4LJP B;  2AL6 A;  1WM3 A;  4A20 A;  3TL5 A;  4B95 A;  3QA8 A;  4I6L B;  4BKT A;  2KX0 A;  1SIF A;  4ANX A;  4GDL A;  4MH0 E;  2LJ5 A;  2NPT B;  4X57 B;  3L54 A;  4ANU A;  5J2R A;  2ZEQ A;  2IO0 B;  4HPM B;  4MSM B;  1VCB A;  4G11 A;  1IYF A;  3V6C B;  3L10 B;  2ZVN A;  3IG3 A;  4M8N A;  3RCZ A;  2BYV E;  3M95 A;  4FHJ A;  3Q3F A;  4IW0 A;  1WR1 A;  3CF6 E;  4GN1 A;  1WZ0 A;  2MLB A;  1PQS A;  3PS6 A;  2N7D A;  1EF1 A;  2BYE A;  3L08 A;  2Z0D B;  5CX3 A;  1UEL A;  2DYB A;  2J0K A;  4CYE A;  1BT0 A;  4NJ6 A;  3PLU A;  2GMI C;  5CHW A;  5E6O A;  1WGD A;  3ZNH B;  1HE8 A;  3NY5 A;  1NI2 A;  3R7R A;  1WRD B;  1ZGU B;  3PRM B;  2KNB A;  3TJP A;  3X23 A;  2BWF A;  2JPH A;  2C60 A;  3ZW3 A;  2MP2 B;  3VHT C;  3ZRF A;  2BF8 B;  2C5L C;  1J0G A;  2BGF A;  2JZ3 B;  2KLC A;  4MDK E;  1A5R A;  3APD A;  2CS4 A;  2DAJ A;  2NR2 A;  4DDG D;  2D07 B;  4DDI D;  2DZJ A;  2KMC A;  3ZTC A;  1UGM A;  4NAW B;  2L00 B;  4LDT D;  2OOB B;  2I1K A;  2N1V A;  2LWP A;  1EF5 A;  5FR6 A;  4KSK C;  1E90 A;  4IM0 A;  3VTU A;  4MEM A;  1Q1O A;  3AUL A;  4KZ0 A;  1P98 A;  3VUX A;  3DDC B;  3WAN A;  2KX3 A;  2MBH A;  4AOF A;  1TTN A;  3H6N A;  2KN5 A;  3VTV A;  2M8S A;  3V6E B;  1WGR A;  4AUQ C;  2FID A;  2K8C A;  2MSE D;  1RAX A;  3PV1 A;  2EKE C;  1UD7 A;  4WJN A;  4KDL B;  2GOW A;  2WWZ A;  4MGK E;  4FJY A;  2MP2 A;  1WX8 A;  1Y8R C;  3ZRC A;  3AU5 A;  1V80 A;  4W9E A;  4EZL A;  3TCA A;  2KJR A;  2MBQ A;  4OVV A;  3A1Q B;  4GGQ A;  3EFU A;  2V3S A;  4G3X B;  4KSL C;  2KO3 A;  3JVZ X;  2MBO A;  2ZJD A;  3HM6 X;  3TMP B;  2KFK B;  3L16 A;  2NBU A;  3QIJ A;  2IZV B;  1WZ3 A;  1V49 A;  4WAA A;  2J0J A;  4BVU C;  4DHZ E;  2EMT A;  3KUZ A;  3SDL C;  1Q0W B;  4A3P A;  3RD2 A;  4ZYN A;  1TGZ B;  4DHJ D;  2K6D B;  3M3J A;  4AJW A;  3QAR A;  3LJ3 A;  1E7V A;  5CTR C;  3DPD A;  3PTF C;  1V6E A;  1WXV A;  3UGB B;  4E3C A;  4F8C B;  4EUT A;  2LI5 A;  2PJH A;  3IFW B;  3VTW A;  4K81 A;  2VRR B;  2N7E A;  3NS8 A;  1IP9 A;  3BIN A;  3W1S C;  1E8Y A;  2IBI B;  1WI0 A;  1WE7 A;  3DVN V;  2G45 B;  1E8Z A;  2LZ6 A;  2BPS A;  5JZE B;  4EFO A;  2YVC A;  4FN2 A;  3X0W A;  5JHA A;  1Z2M A;  4MGY E;  4KV2 A;  3IHP C;  3JW0 X;  3DVG X;  3VVW B;  3CSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...