2O2VB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
molecule tags Transferase
source organism Homo sapiens
total genus 22
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vB01
3JYUA 4A3PA 2LJ5A 4IG7B 3IVFA 3C0RB 4JIOU 3L13A 2LI5A 4FHKA 3ZVVA 1OTRB 1KOTA 3VQIA 2KHWB 2LXAA 2K39A 4BVUC 1E8YA 1WX8A 2HJ8A 2LGYA 4J6IA 2YVCA 4MH0E 3ZTDA 2MBHA 4FJVB 2MP2B 1WY8A 4W9FA 5CHWA 2MBEA 5JZEB 1LM8B 2BKFA 1WX9A 2A4ZA 2PEAA 3QX1A 2IBIB 2O2VB 4PYUA 5E6NA 3EHVA 4NAWA 3DVGX 1Y8RC 4ZRKA 3KUZA 3QHTA 4NJ6A 1E8ZA 3NY5A 4KSKC 2J0KA 2CR5A 1OGWA 3SHQA 4MJSB 4W9DA 2MCNB 4IWOA 1OEYA 2C9WB 3H1UA 3H7SA 3JSVB 4LJPB 2LVQA 3VUWA 4ICUA 4DHJD 2FCSA 1WJNA 2EKEC 2PE6B 3QJZA 4HXDA 2XBBC 4GIVA 5E6PA 2KX0A 2J0JA 2BYEA 2AL6A 2BPSA 1WE6A 2IY0B 2KANA 5LLIA 3ZLZA 2KX3A 4IM2A 4JQWC 4BKSA 3ZNZB 1IP9A 3JW0X 4NJ7A 1GJZA 1V5TA 2GMIC 2K6DB 2MRPA 3AI5A 3UIPB 4EZJA 1ISNA 1WIAA 2L76A 2D11A 1I35A 1EF1A 2KTFA 2ZPNA 2M1MA 3ZKJC 2N7DA 4II2B 3B1LX 3DBRI 4HPLB 3PHWB 5JHAA 4M8MA 4YL8A 4CYEA 1T0YA 5DPSA 3V62A 1QZEA 4KDLB 2MBBB 2KK8A 1E8WA 2C7MB 1UH6A 3EECA 3T8MA 4URKA 3DBSA 2M0XA 1C3TA 1C1YB 3GOEA 1X1MA 3EC8A 3HM3A 4BFRA 1R4NI 3Q3FA 3DBHI 2KN5A 1WGRA 3N30A 3QAQA 1VCBA 3KYDD 3ZW3A 1UD7A 2KMCA 2IYDB 4TQ1A 3ZDMC 2I1JA 2ZVNA 3BY4B 4HPMB 4NAWB 2RPQA 4EKUA 3L17A 4HCPB 4MGZE 2JT4B 2KZRA 2BWES 4DBGA 2UYZB 2KFKB 2WWZA 1GC6A 4NPNA 2G3QB 2NBUA 3RT3B 3IG3A 1V81A 1L2NA 4ZYNA 5JHBA 1NI2A 3A9JB 4GDKB 1ZKHA 1UZXB 2ZCBA 1OEYJ 2DYBA 3SD5A 4ZDVA 3CF6E 3ONSA 4IWPA 1RFAA 3IFWB 4II3B 3W1SA 2BF8B 2IO0B 2LXCA 3SDLC 1EUVB 2G4SA 2KNBA 3N3KB 4GSWA 4HJKA 3PGEA 3X0WA 3AXCA 1WXSA 3ZRFA 3DBLI 4F8CB 2ZPYA 4G50A 3ZIMA 4HDQA 4IUMB 5HKHA 2D10A 2LRUA 3AU4A 2IY1B 4WJQA 4KZCA 2KQ7A 3DVNV 1P1AA 3U7DA 2NPTA 2FAZA 2KDEB 4I6LB 4CO7A 4GMVA 1UELA 1KJTA 2C60A 2V4LA 2HTHA 4G0NB 4WWOA 3QARA 4WJOA 4KDIC 4W9LA 5CHVC 5D2MB 1ZW7A 4HDOA 4M8NA 1PQSA 2NCNA 2KVRA 3M63B 4GXBA 1GUAB 4K7SA 3WAPA 5G2NA 5AEKB 1SIFA 1WXVA 3PZDA 3RUIB 2FCQA 1V80A 2LGDA 3PRPB 3DQVA 2MX2A 1LXDA 4W9EA 3RZWC 1WR1A 2KWCA 3KUDB 1WJ4A 3A1QA 4LCDE 3ZNID 3LJ3A 2IO2B 4WJNA 3UGBB 1V6EA 1WM3A 2KJ6A 1BT0A 1WGYA 1Z2MA 2NS5A 3L10B 4MELA 1WX7A 2DENB 3EFUA 3NZUA 3DPDA 4GGQA 4BKSD 5DPWA 2KOXA 3VTVA 2KFKA 2KMAA 1WR6E 1F9JA 3W1YA 1V49A 2KC2A 2J0MA 3RD2A 4XX5A 3A9JA 4GDKA 2MW5A 3VUXA 5C23A 2EMSA 3V6EB 2N7EA 1P9DU 2OOBB 2C7NB 3QCAA 4W9JA 3PV1A 4F7ZA 2MLBA 2JWZA 1WYWB 1H8CA 2WDTB 4OVVA 2MA9B 2Z59B 3O65B 3OJ3A 2KWUB 5IAAC 2KJHB 4EUTA 1XQQA 3B0AA 2LGXA 4FJYA 3PVLA 4K7UA 5AZHA 3L08A 5D6JB 1WH3A 2KLCA 3HM6X 5LXHA 5BO4B 4W9IA 2N1WA 2VRRB 4AJYB 3S2AA 2KDIA 3AU5A 4B95A 2FCMA 2MBQA 1SGHA 2DZJA 2G4DB 3IBEA 3QIJA 3ZDTA 2GBJA 3WAMA 3CMMB 4MSQB 3U8ZA 4ANWA 1P0RA 2NPTB 3OAWA 4IW0A 1D3ZA 1WFYA 3KUCB 4LJOB 4HCNB 2CHZA 3CSTA 5DCNA 1TZ1A 2GBRA 3BINA 1NBFC 2DX5B 2L0TA 2O6VA 3IHPC 3PREA 1J8CA 1LFDA 3ML9A 5L95C 3M3JA 4AP4C 2LUEA 1WMHB 3MHSD 5D94A 4BBNF 1RRBA 2AYOB 5EDSA 4AOFA 2KFJA 3L0WB 2C7HA 2PE9A 2JRIB 2ZNVB 4FBJB 2ZCCA 3L16A 3SU8X 2LZ6A 3UIOB 2OJRA 2KO3A 2JXXA 3ZUNA 1R4MI 4I6NB 5E6OA 1TBEA 4F1SA 2PJHA 5LXIB 3B08A 1WZ3A 1YQBA 2IO1B 1P98A 5D7GA 4MSMB 4P7IA 4ANUA 1WE7A 3H9DA 2MQJA 4EOYA 4WQOB 1A5RA 1S3SG 2MBOA 4NQLB 2CU1A 4BOSC 4ANXA 1V9JA 4FN2A 2KTRB 4KIKB 4WWNA 3TCAA 1V86A 3A1QB 5J2RA 2JVCA 1VD2A 2FIFA 3LDZE 5KHOA 2RSUA 2CHWA 3AULA 2LVOA 2N9EB 1UBQA 3KH0A 3WA0A 3VAWA 3OJ4B 4TUUA 5L83A 1YX6B 5C1ZA 4PS7A 1YIWA 2EMTA 2KQSA 4IWQA 1Q5WB 3P2BA 4LDTB 3D32A 3A33B 1GNUA 4BBNC 2G45B 2M4NA 1E5WA 5GMVA 4FLHA 3ZTCA 4MGYE 3Q3JA 3TJPA 3NS8A 2D2QA 3PPAA 4MDKE 3ECIA 2ZJDA 2LVPA 2N4FA 3PHXB 3VTUA 1K8RB 4AJWA 2NBVB 3APFA 1AARA 1E8XA 1MG8A 4NNJB 2KWVB 5AZGA 3VH3B 4XZ4A 3ZO5B 4ANVA 5CHFA 3ENEA 4EZLA 3TL5A 4W9HA 1L7YA 1XT9B 2LD9A 1NDDA 2DZKA 3RULA 2K1FA 4K7WA 3H6NA 1I42A 3VHTC 2C5LC 4NY0A 2L0FA 2W9NA 3UF8A 1Z5SB 4DHZE 2UWQA 1WMHA 3QA8A 2JF5A 3RZFA 4MGIE 4E74A 2LASA 2AWTA 2NVUI 2O6VB 2PPHA 1TTNA 4HLEA 2ZEQA 4GDLA 2N9PC 3PT2B 3PRMB 4DK5A 2YLMA 4ICVA 1Q1OA 1HE8A 4W9GA 4XC2A 3W1SC 3ZNHB 4BKTA 4EEWA 4EZKA 2KKCA 2NBWB 3HIZA 1J19A 1U4AA 3QQ8B 3VXWA 3A4RA 4EFOA 4WJPA 3WAOA 4HWIB 2BYFA 2CKHB 2GBNA 4KVGB 3V60A 4RMAA 4KIKA 2KTRA 2ASQA 2Z0DB 4DHJB 1OQYA 1P3QU 4KZ0A 2GBMA 1WXMA 2WX1A 3PTFC 3R66C 4I6PA 5CTRC 4DDGD 2L7RA 2KC1A 3L54A 2R2OA 2Y5BB 5TR5A 1JRUA 2HE7A 2MWSB 3PRZA 3PSEB 2FNJB 2L8JA 5J17A 4RM9A 3PLVA 4RM8A 4W9KA 5G55A 2DHZA 2WYQA 4OVUA 2CS4A 1SE9A 1UGMA 3A9KA 4GN1A 1XD3B 4B9KA 1WM2A 3H7PB 2XK5B 2IZVB 2D07B 2FUHB 1H4RA 2ZNVC 4G11A 3PLUA 2BYVE 2HD5B 5FR6A 3WIMA 2AL3A 3K9PB 1EF5A 2KD0A 2O6VD 4GOCA 4B6WA 1IPGA 1V2YA 1WF9A 1Q0WB 2LWPA 1YJ1A 2I1KA 1WI0A 5KHQA 2LRWA 3A4SC 3VH4B 5AZFA 3VTWA 2BGFA 2ZZPB 4HVBA 4W9CA 5CX3A 3T9LA 3ML8A 4CHKA 3UQAA 1E7UA 3APDA 3M95A 5DPTA 2DAJA 2RGFA 3ALBA 4K1RB 3VUYA 2WX0A 4K81A 5DPRA 4ZRJA 3JVZX 3CSFA 4ASWC 1IYFA 3RCZA 2K25A 1YX5B 2K8HA 3VVWB 4A20A 4IC7B 2NR2A 1EO6A 3WANA 2V3SA 2DYOA 4GU2A 4PS3A 4JL9A 2A5UA 4AUQC 1CMXB 4TKNA 1S1QB 4AWJA 1GC7A 4E3CA 2L00B 3DVGY 1J0GA 2M17A 4GDLB 3HK0A 5JH5C 3VFKA 1WGGA 1WGHA 1WJ6A 3I3TB 1RLFA 4IM3A 4WWPA 3OLMD 3UQBA 4X57B 1GG3A 1E90A 3DVNU 2JRHA 4ZRIA 3UINB 3PS6A 4WAAA 2JZZA 1KM7A 4GB9A 3TBLD 4N9F4 2KLGA 1LQBA 2KJRA 2JPHA 3APCA 2L3ZA 4KSLC 4IM0A 1YD8U 2GOWA 4TQ0A 3HHMA 2QHOA 3TIXA 1FXTB 4KV2A 3TMPB 2MP2A 3NHEB 3H7PA 2XK5A 4E71A 4BKGA 2JZ3B 3DCGA 4DWFA 1E7VA 2M8SA 3A9KB 2GBKA 2O2VA 4FHJA 1WGDA 4DDID 3RYTA 3QC8B 2R2QA 2REXA 3QK0A 1ZGUB 4FJZA 4BOZB 2N9XA 3M62B 2K8BA 4PS8A 3WALA 4MEMA 1RAXA 2K8CA 3N32A 3GZNI 4MJSA 3KVFB 1M94A 1WRDB 3KW5B 3ZNGC 3JSVA 3VDZA 2FCNA 2KXJA 2CHXA 2V1YA 4JLCA 4DXAB 2RD0A 3K9OB 3DDCB 2ZVOA 1V5OA 4M0WB 4DHZB 1WZ0A 2B3AA 2IO3B 1WJUA 4G3XB 3V6CB 3MTNB 2DZIA 3ZRCA 2L05A 3QWZB 2JUOA 3NZSA 1WXAA 3X23A 2BKRB 2DYMA 4FULA 3R7QA 2RR9A 2XEWA 2AEHA 4HK2A 1TGZB 1G6JA 3V61A 1KLVA 2BWFA 4MM3A 3NOBA 4PYZA 1UBIA 2MSED 3KYCD 2K6QA 3R7RA 5IA7A 4NQKE 2D3GA 4LDTD 2KDBA 2DAFA 2FIDA 2J7QB 3R3MA 5J18A 2N1VA 4FADA 4FA6A 2Z0EB 3U30A 4A3OA 3MJWA 2KDFB 3DOWA 4TV3A 2DZMA 2JY6A 4JGHB 4MGKE
chains in the Genus database with same CATH superfamily
3JYUA 4A3PA 3PZ8A 4FHKA 3ZVVA 1C77A 3VQIA 1E8YA 1WX8A 2HJ8A 4J6IA 3ZTDA 2MBHA 4FJVB 1TY2A 5D3DA 2J4XA 5IP4D 2IBIB 4PYUA 1PGXA 4NAWA 3DVGX 3NY5A 2CR5A 4MJSB 2L32A 2C9WB 3H7SA 4LJPB 3VUWA 1AWDA 4RGMA 2KVZA 3I57A 2XBBC 4GIVA 3TSSA 3TEWA 2IY0B 2KANA 1ZPSA 2WGSA 3B2FA 2PKOA 1YNTE 1GOZA 3AEFB 1GJZA 1JWMD 2JXTA 4EZJA 1SJED 4C80A 1EF1A 1D5ZC 3B1LX 3U52E 4CYEA 2WQYB 5HI1A 3P4QB 2KK8A 1E8WA 3T8MA 4PK1A 4URKA 1YMHE 2M0XA 1C1YB 1X1MA 3NG0A 3RN9C 1R4NI 2W55A 1MVKA 3QAQA 1R4NB 3ZW3A 1UD7A 2IYDB 2L1AA 2MHJA 3BY4B 2RPQA 4EKUA 1DOYA 2YEPB 2BWES 2UYZB 3P63A 2WWZA 3AE9B 3VR9B 1L2NA 1FFUA 2G3QB 3RT3B 3IG3A 4A8XC 4GDKB 3T3OA 4ZDVA 3CF6E 4IWPA 1RFAA 2J42A 2IO0B 2LXCA 1EUVB 3X0WA 3AXCA 1WXSA 4NAMA 3DBLI 4G50A 1L0XB 2D10A 2LRUA 3DBLB 2IY1B 3MC9A 4WJQA 4KZCA 2KQ7A 3DVNV 2FAZA 1EM7A 2Z8LA 4CO7A 2C60A 2G9HD 4WJOA 3MP9A 5D2MB 2N7JA 3WAPA 1WXVA 5E6JA 3PZDA 3RUIB 2FCQA 4C7ZA 1LXDA 4KGSA 4W9EA 4HJGE 1HEZE 2KWCA 2K5PA 3ZNID 1BT0A 4B0MA 2IGDA 5C3JB 1WX7A 1PGAA 2KFKA 1T5XD 1WR6E 2I38A 2KC2A 2MJDA 2MW5A 4YTPB 1PGBA 3V6EB 3QCAA 1EWCA 4S17A 3TEZA 1D5XC 1F1HA 4KGTA 1H8CA 2MA9B 2J53A 3OJ3A 5IAAC 1WSPA 1C76A 3PVLA 3HM6X 1TS2A 2N1WA 2VRRB 2PMVA 3IAS1 4MSQB 3OAWA 2HJ1A 4IW0A 1D3ZA 4LJOB 4HCNB 3T3NA 1SE2A 5DCNA 1NBFC 1WXQA 3PREA 2JYEA 5L95C 4MT5A 3M3JA 3NS1A 3MHSD 1RRBA 5EDSA 2C7HA 1SE3A 2JRIB 4JWUC 2ZNVB 2ZCCA 3L16A 2LZ6A 5E6OA 3FILB 3B08A 2IO1B 1I7HA 4P7IA 1WE7A 4XDDA 2MQJA 1A5RA 4WQOB 1FM0D 4NQLB 4M01A 4BOSC 4FN2A 3CIRB 2KTRB 1V86A 5J2RA 2JVCA 5KHOA 3TUOA 1F77A 1FRRA 2CJNA 1JCKB 2EMTA 2KQSA 1WGKA 1Q5WB 3D32A 3OWEB 1GNUA 4BBNC 1YN3A 2M4NA 4FLHA 3Q3JA 2D2QA 3PPAA 4MDKE 2VZKB 3ECIA 4C56C 2LVPA 1K8RB 1FXIA 1TYGB 1AARA 1MG8A 1T0RC 4NNJB 3RNBC 1LO5D 5CHFA 3ENEA 3H6NA 1K53A 3RNEC 4LNIA 2W9NA 4DHZE 5HHDG 4MGIE 4E74A 2LASA 2AWTA 2PPHA 2O6VB 3NVVA 1TTNA 3PT2B 4DK5A 1FNVA 2D5GA 1HE8A 2KKCA 3HIZA 4EFOA 4HWIB 4KVGB 2ON8A 2Z0DB 1OQYA 2LJIA 4RFBA 4KZ0A 2WX1A 3PTFC 2QC8A 3PLVA 2DHZA 2EKIA 1NVID 1SE9A 3A9KA 4BAXA 1VDVA 3PLUA 1CJEA 3K9PB 1EF5A 2W3SA 1Q0WB 1WI0A 2I1KA 4XDCA 1L6VA 2MEKA 3ZJVA 3OG5A 3VH4B 5AZFA 3N9YC 1B1ZA 3ML8A 3BYTB 4CHKA 1XLNA 5DPTA 2RGFA 3ALBA 2K9XA 3VUYA 3HRDD 4ASWC 1IYFA 1YX5B 2K8HA 3AE4B 2BW2A 4AUQC 4TKNA 3IXSA 2L00B 2M17A 3VFKA 1WGHA 3I3TB 3FAHA 1FCLA 3DVNU 4ZRIA 3UINB 3NVWA 4WAAA 4N9F4 1LQBA 3TEYA 4L23A 4IM0A 2GOWA 3AE1B 3NRZA 3HHMA 3TIXA 1C9FA 3NHEB 2Q5WD 2XK5A 4BKGA 1M4VA 4RCOA 2LGSA 1T0QC 1E7VA 1VRAB 2JQRB 4FJZA 3QK0A 2REXA 3QC8B 1KLUD 1ZGUB 2WU2B 3Q8BA 4ZYSA 4MJSA 1M94A 3KW5B 4DXAB 1BXTA 4O1NA 5AUIA 4DHZB 2B3AA 3V6CB 1UWXA 3NZSA 3X23A 2KT7A 1FIQA 2RR9A 3IT6B 3AEGB 3O13A 1KLVA 2SAKA 2BWFA 3KYCD 1KFYB 1ZXIA 4DXGA 2N1VA 2FBWB 3SFDB 3DOWA 3N1YC 5EE9A 3NJTA 2DZMA 1UGJA 4J3OD 1MHXA 3IVFA 4JIOU 1JWBD 1OTRB 4P1BC 3E9SA 1EU4A 2K39A 2QJLA 1WY8A 1Y56A 4HKQA 5G5GA 5JZEB 4PT5A 1LM8B 2BQQA 1WX9A 2MJ3A 2A4ZA 1T0SC 1SB3C 4XWWA 3EA6A 5E6NA 3EHVA 1Y8RC 3KUZA 2WXHA 1E8ZA 1GB4A 4W9DA 2MCNB 2WDQB 1OEYA 2LVQA 1V8CA 4ICUA 4DHJD 1B9RA 2FCSA 2EKEC 2KQ4X 3QJZA 1RWSA 2ACZB 4LLGM 2KX0A 2J0JA 1WE6A 2CJOA 4JQWC 1IP9A 1K51A 1ZE3D 3B2GA 3Q3NC 2K0PA 2WXJA 2GMIC 3AI5A 3ZYYX 1WIAA 3SEBA 2N7DA 4YWGG 1UNSA 4HPLB 5JHAA 3W2DA 1UWMA 4YL8A 1JROA 4P16A 2INPE 1L4ZB 1MJDA 1JMLA 5T8IA 1SEBD 1I4XA 1C3TA 3MFGA 3EC8A 1FPYA 2KACA 3GE8C 3LYYA 2I1JA 1VZ7A 4USAA 4HPMB 3L17A 4HCPB 4RGNA 1YJJA 4K3BA 5HFYA 3LXFA 1FO4A 1GC6A 4NPNA 2I2YA 3RNFC 1UZXB 2ZCBA 1OEYJ 4LNOA 2BF8B 2KNBA 3N3KB 4F8CB 3AU4A 1QILA 1KRHA 3U7DA 2ICIA 2IJ0A 4ZHOA 4OHJA 3QARA 3BIID 5CHVC 4HDOA 2NCNA 5LNK1 1GUAB 4K7SA 5G2NA 1SIFA 3FILA 3DWMA 1XLQA 1V80A 3PRPB 3DQVA 2MX2A 4WQMA 4WAFA 3RI7C 4WJNA 2IO2B 1V6EA 2KJ6A 3L10B 1WGYA 2UU7A 3DPDA 4GGQA 5DPWA 5H8YE 1ZP0B 2KMAA 1F9JA 4HKZE 3RD2A 4XX5A 3A9JA 1MPEA 4P1CC 1P9DU 2OOBB 2C7NB 4F7ZA 1QQRA 2MLBA 2JWZA 4KGRA 2KYWA 3EFCA 2GLSA 2Z59B 3O65B 4KKIA 1XQQA 2LGXA 2BS4B 1I4RA 5TSSA 5BO4B 3ETRA 3S2AA 2KDIA 2G4DB 5FKAC 3IBEA 3ZDTA 3WAMA 2OEDA 4ANWA 1P0RA 2NPTB 1WFYA 3R8BA 3RPFC 4M00A 1TZ1A 2GBRA 3BINA 2L0TA 2O6VA 4QAYA 2LUEA 2MH7A 3AV8A 1SSNA 1TKEA 2PE9A 5BYQA 2JX5A 3AE3B 3UIOB 2OJRA 2KO3A 2JXXA 4HRSA 1TBEA 5LXIB 1YQBA 1P98A 4ARCA 4JWSC 3GB1A 4WWNA 4KIKB 3A1QB 2D3AA 1TIFA 3LDZE 2RSUA 2X38A 3KH0A 2LVOA 3WA0A 1UBQA 3KWLA 3IAM1 1YX6B 1ET6A 2TSSA 4R3DA 1KH0A 3B9JA 4MGYE 1NYRA 3NS8A 2NTTA 3PHXB 3VTUA 4YT0B 2KWVB 1TZOA 1D5MC 3ZO5B 1DOIA 4W9HA 1XT9B 4TMAB 3ZXRA 4GLSC 1XXGA 4YXDB 1Z5SB 1WMHA 3QA8A 1JQ4A 4N59A 4HLEA 3PO0A 2HTME 1RM6C 4ICVA 2IGHA 1Q1OA 4XC2A 2KDMA 3V60A 2CKHB 2GBNA 4N58A 2WNMA 4DHJB 3IT4B 4DDGD 3R66C 2L7RA 3L54A 2Y5BB 5TR5A 1JRUA 3TEXA 1JRPA 1I4QA 2M56B 3PRZA 3PSEB 4RM9A 1TS3A 1I4GA 1T6BX 1ZDXA 4GN1A 1J7AA 4B9KA 2FUHB 2WXQA 2QIEB 5FR6A 1TKYA 3Q3OC 3PZ7A 4IKGA 4B6WA 2QSDA 2H88B 5KHQA 3HVDA 2BBCA 2ZZPB 1L0VB 2DNFA 4A9AA 1WRIA 1FRDA 2WX0A 2V4IB 3Q14C 2L52A 3U4EG 3CSFA 4A20A 2RPVA 1FXAA 4GU2A 1CMXB 4AWJA 1GC7A 3HK0A 4YSYB 1IBXB 3Q8CA 1D6EC 1RLFA 4IM3A 3UQBA 3OLMD 3PS6A 2AQ2B 2JZZA 3U7ZA 1JWSD 1V1PB 3RMKC 2KJRA 4LK0M 2OJWA 2L3ZA 2N9LA 2VH1A 4KSLC 4WIPA 2WDRB 1TS4A 3J9CA 3TMPB 3H7PA 3DCGA 2HDEA 2Y5PA 1ZOYB 4FHJA 3BVMA 4DDID 1WWTA 4C4VA 3M62B 2K8CA 3Q8AA 3N32A 2V0GA 3GZNI 1WRDB 4ZRPA 3GZNB 3ZNGC 2FCNA 3WCQA 4OZCA 3MC8A 2ZVOA 3MTNB 2DZIA 1JWAD 2JUOA 2BKRB 3R7QA 2AEHA 1JALA 4HK2A 4EE2A 3N20C 5FR3A 2D3CA 4MM3A 4PYZA 2BB5A 2MSED 5IA7A 2D3GA 4LDTD 5G5HA 2FIDA 2KDBA 3R3MA 2J7QB 4FADA 2Z0EB 4TV3A 3AEBB 1FCCC 2GI9A 2RMMA 3C0RB 1DOXA 3RNAC 1C78A 2KHWB 1ACCA 2LGYA 4MH0E 4W9FA 2LGIA 2PEAA 3QX1A 3BVZA 1QF6A 2WXNA 2J52A 3KQ4A 3QHTA 4NJ6A 1UUPA 4IOIE 1FNWA 2J0KA 1OGWA 1ET9A 2AQ3B 1RYJA 3JSVB 5BMIA 4Q2JA 1WJNA 2PE6B 1EU3A 2EELA 2LUMA 5IN7A 5E6PA 1KLGD 5FK9C 3ZLZA 3ZJTA 4A55A 4BKSA 2WXGA 3JW0X 2N0SB 4NJ7A 1V5TA 4JPSA 2KTFA 2ZPNA 2M1MA 3DBRI 3PHWB 4M8MA 3DBRB 3DWGC 4XGAB 1T0YA 3V62A 1F2RC 2FE8A 4KDLB 2MBBB 2C7MB 1UH6A 3DBSA 1E7PB 2KN4A 3GOEA 1FFVA 2IDYA 4REZA 4BFRA 3Q3FA 2KN5A 4H2AA 3N30A 2KMCA 1P7FA 2ZVNA 1HQRD 2LEKA 4MGZE 2JT4B 2KZRA 4DBGA 2KFKB 3BYYB 2W54A 1N61A 1ZKHA 1V97A 3AE2B 2DYBA 3ONSA 4II3B 1C79A 3W1SA 4B0EA 1J7BA 2G4SA 4GSWA 4HJKA 3ZRFA 1PDXA 3ZIMA 4C00A 4L2YA 1OFFA 5MPOA 1P1AA 2NPTA 2JSVX 2RDBC 1UELA 2V4LA 3R2IA 4WWOA 2JWUA 2XNAC 1C4AA 2NTSA 4KDIC 3RNGC 1K52A 4W9LA 3RFZB 1ZW7A 1WYGA 1PQSA 1GB1A 5AEKB 3RNCC 2CU3A 2LGDA 1L4DB 3A1QA 3UGBB 3MHZA 1XCQL 1Z2MA 2OHFA 3EFUA 3NZUA 4JX1C 3VTVA 3W1YA 1V49A 2J0MA 2WXFA 4GDKA 3VUXA 5C23A 2EMSA 3PV1A 1IGCA 1WYWB 3GP7A 3P1MA 1MI0A 3B0AA 4FJYA 4K7UA 5AZHA 3L08A 5D6JB 3AE6B 1ZDVA 4W9IA 2KAJA 3AU5A 1SGHA 1PUTA 3QIJA 2GBJA 3CMMB 3U8ZA 2B76B 1XLPA 3CSTA 3KWVA 3IHPC 1J8CA 1NYQA 5D94A 2AYOB 2KFJA 3L0WB 3Q6BA 4FBJB 2DWQA 2E6XA 3SU8X 3ZUNA 4K3CA 4F1SA 3P4PB 5IOIA 5D7GA 4MSMB 3H9DA 4EOYA 1S3SG 2MBOA 1TY0A 1V9JA 2WLBA 1C4PA 2CHWA 2N9EB 2WXOA 1FEHA 3OJ4B 4TUUA 2VH2A 4PS7A 1YIWA 4IWQA 2WXLA 3P2BA 4LDTB 5BMGA 3A33B 1ZUD2 5GMVA 2LMCA 1E10A 3BK1A 2INCC 2N4FA 1E8XA 3VH3B 2W3RA 5AZGA 2PVOD 4XZ4A 4ANVA 4EZLA 3TL5A 3RULA 1HZ6A 2DZKA 2LD9A 2RDGA 1F2RI 2K1FA 4K7WA 3BWUD 3VHTC 4TSSA 4NY0A 3UF8A 1QT9A 3AM9A 2UWQA 2JF5A 1AN8A 2BTEA 2WS3B 4LNNA 1I4HA 2N9PC 2YLMA 5H92C 3ZJUA 4ITKA 4W9GA 3ZNHB 4BKTA 1U4AA 4WJPA 3WAOA 2BYFA 1STEA 3AMZA 1V1PA 2KTRA 4US8A 2GBMA 1WXMA 4I6PA 1YQ4B 4LNFA 2R2OA 2HE7A 2MWSB 3AEDB 1N6ZA 2YEPF 2FNJB 2L8JA 5J17A 5G55A 2Y3AA 4ZRQA 2WYQA 2QCZA 1UGMA 5D3IB 5C2TB 1XD3B 1WM2A 4LTUA 2XK5B 2GRIA 2IZVB 2D07B 1F0ZA 1H4RA 2ZNVC 3WIMA 2BYVE 2AL3A 2QEJC 2WXMA 4ZOHC 2O6VD 3HUIA 4GOCA 1V2YA 1WF9A 1YJ1A 1SBBB 4OW0A 1XF5L 1E7UA 2NMQA 3APDA 4ACFA 4C7YA 1JWUD 1PYWD 2DAJA 4K1RB 3JVZX 3EGRA 3RCZA 3C8YA 2NR2A 1EO6A 4M02A 2V3SA 3V05A 4YSZB 4JL9A 2A5UA 1S1QB 3LB8C 1J0GA 4GDLB 1HZ5A 1WJ6A 2GB1A 1ENFA 1GG3A 3P4SB 1SJHD 3H8HA 3BVGA 3N1ZC 4GB9A 4HEA1 1P7EA 4TQ0A 3HVZA 2RDHA 3E56A 4KV2A 4S0RA 2LHDA 3Q8FA 1VR9A 5BMHA 1BUIC 4OVZA 4RGOS 1F52A 4DWFA 2JU6X 2SEBD 1WGDA 3SR6A 1E6EB 1FNUA 1QLBB 1CQVA 2N9XA 4PS8A 3WALA 1RAXA 3NVZA 1L5PA 4RGTA 3URYA 3JSVA 2KXJA 1SXTA 2CHXA 2V1YA 2RD0A 3DDCB 1V5OA 4M0WB 4WURA 2IO3B 4G3XB 3CWIA 2DYMA 4FULA 1TGZB 1G6JA 3V61A 2BT6A 1YOVB 4UDUC 4OZBA 3R7RA 1HTOA 3AH7A 5J18A 4N6EB 4OZAA 4A3OA 3BZDB 2INDC 2JY6A 3I5JC 4JGHB 4MGKE 1TT5B 1EWYC 2QDFA 2LJ5A 4IG7B 3ZGZA 3L13A 1FMAD 2LI5A 3P42A 2KMMA 3VRBB 5IO9A 1GAQB 4MH8A 1KOTA 4WH4A 2LXAA 4BVUC 1QKZA 5I4DA 2YVCA 2MP2B 3Q8EA 3C19A 5CHWA 2MBEA 4DQOC 2BKFA 1TS5A 4RF1A 5JXVA 2FUG1 1E9MA 1OQRA 2O2VB 2BB6A 4US9A 4ZRKA 3NVYA 4KSKC 3SHQA 2ZW0A 4IWOA 3H1UA 1J7CA 2LHEA 3GE3C 1NEKB 2WU5B 4HXDA 4YTMB 3U2SC 1HTQA 2H89B 1TJEA 2AL6A 2BPSA 2BYEA 5LLIA 2KX3A 4IM2A 3ZNZB 1UF0A 3SFEB 4DXFA 1DGJA 2K6DB 2MRPA 3UIPB 1ISNA 2L76A 2D11A 1I35A 3L4PA 3ZKJC 4II2B 5DPSA 1QOBA 1QZEA 3AEEB 3P4RB 3EECA 1IUEA 3HM3A 1IGDA 1N63A 3DBHI 3DHIC 1WGRA 2X8XX 1VCBA 3KYDD 3DBHB 3ZDMC 4TQ1A 3AE8B 4NAWB 2E3TA 2IGGA 1SF0A 1HA5A 2D3BA 2ZW1A 2NBUA 1V81A 5BYRA 4ZYNA 5JHBA 1NI2A 3A9JB 3UI3A 3GS2A 3NZ3A 4HROA 3SD5A 3IFWB 3MC0B 3SDLC 3PGEA 2ZPYA 2WXPA 4HDQA 4IUMB 5HKHA 3AEAB 5GXGB 4MACA 4ARIA 1N60A 2KDEB 4I6LB 4GMVA 1KJTA 1MFWA 2HTHA 4G0NB 3VRAB 1CZPA 1YJIA 4XE0A 4D2KA 4M8NA 2KVRA 3M63B 4GXBA 2V9HA 2XN9C 4HPPA 4AQ7A 2IPKD 1Q10A 5EE1A 1WR1A 2M0AA 3RZWC 1VLBA 3KUDB 1WJ4A 4LCDE 1A70A 2WXKA 3LJ3A 1WM3A 4MELA 1QOGA 2NS5A 2DENB 3ZQ4A 4BKSD 2KOXA 1SIJA 2WXRA 3MJ5A 4P6VF 1HXYD 1ESFA 4WWMA 2AQ1B 2W82A 2ONQA 2N7EA 4W9JA 3AN1A 5IKCM 4JE3B 2WDTB 4OVVA 2KWDA 2PLPA 2KWUB 1RFKA 2KJHB 2PVGC 4EUTA 3AECB 1WH3A 2KLCA 5LXHA 3BK2A 4B95A 4AJYB 4IDIA 3W5UB 2FCMA 2L83A 2MBQA 2DZJA 1N5XA 1AW7A 4NZLB 1XLOA 1XO3A 3KUCB 4YSXB 2CHZA 2MJEA 2DX5B 1LFDA 3ML9A 5EE0A 4AP4C 4BBNF 1WMHB 4AOFA 1NENB 2BS2B 4RNAA 1KF6B 1QOAA 1R4MI 4I6NB 2PJHA 1R4MB 1WZ3A 2G1EA 3I63C 4ANUA 1E0ZA 2QMTA 4BZAA 4ANXA 2CU1A 3TCAA 1VD2A 2FIFA 2JZPA 1CK1A 3AULA 1VJKA 1AYFA 1I4PA 3VAWA 5L83A 4A90A 5C1ZA 2K22A 1NI3A 2M19A 2G45B 3I9V1 1E5WA 3ZTCA 3TJPA 2ZJDA 4AJWA 1YN4A 2NBVB 3APFA 3R2TA 1TKGA 2AX5A 1PFDA 1VZ8A 2R61A 1ZXHA 1L7YA 1NDDA 5EE3A 1DYQA 1D4BA 3AE5B 2Y5CA 1I42A 2C5LC 2L0FA 2N9KA 4YTNB 1OQQA 3ABVB 3RZFA 2INNE 2NVUI 2ZEQA 4GDLA 3ZXVA 3PRMB 3W1SC 4EEWA 4EZKA 2NBWB 3QQ8B 1J19A 3VXWA 3A4RA 2WP9B 4RMAA 4KIKA 2ASQA 1P3QU 2PIAA 1L6UA 5CTRC 2KC1A 1V1OA 3NUHB 4XWTA 1N5WA 1GPXA 2DLBA 2DBYA 2PTLA 4RM8A 4L1BA 4W9KA 3N1XC 4OVUA 2CS4A 3AE7B 1R7SA 2PW9A 1LGRA 3H7PB 4KX6B 4G11A 2HD5B 1L0YB 4RF0A 1N62A 1T3QA 2KD0A 5HG2A 3W9CB 4A6QA 1IPGA 1YN5A 4C4VB 2LWPA 2LRWA 3A4SC 4KKJA 4LNKA 2BGFA 3VTWA 4HVBA 4FXCA 4W9CA 5CX3A 3T9LA 4M0WA 1SE4A 3EUB2 3UQAA 3Q69A 3FC4A 3M95A 4K81A 5DPRA 4ZRJA 4RH6A 3VVWB 2K25A 4IC7B 1MG4A 3WANA 2WXIA 2DYOA 2V3NA 3W5VB 4PS3A 4MM3B 3FKYA 4E3CA 3DVGY 5JH5C 1WGGA 4WWPA 2QILA 4X57B 1E90A 1C4CA 2JRHA 3DHGC 1KM7A 3TBLD 5AUKA 2KLGA 1BMLC 2JPHA 3APCA 1YD8U 2BYTA 1YQ3B 2QHOA 1FXTB 2WDVB 1XCTL 2MP2A 4E71A 2JZ3B 4XYCA 2M8SA 3A9KB 2GBKA 2O2VA 3RYTA 1K50A 2V3PA 2R2QA 4BOZB 1XEEA 2K8BA 2K3UA 4MEMA 1MHHE 1KTKA 3KVFB 4ZHPA 3VDZA 4JLCA 3Q2AC 3K9OB 2BVCA 3DHHC 1WZ0A 1WJUA 4CQNA 3ZRCA 2L05A 3QWZB 1WXAA 1VZ6A 4AS1A 3V3XA 2XEWA 1JW9D 2WHIA 4NJCA 2BS3B 2JYTA 3KLSX 3NOBA 1ROEA 1UBIA 2K6QA 4NQKE 3Q3MC 1IBXA 5BYSA 2DAFA 4FA6A 3U30A 3MJWA 2KDFB 2LFIA 1FD6A 1QOFA 2VZKD 3VR8B 3AB5A
chains in the Genus database with same CATH topology
3JYUA 4A3PA 2LJ5A 4IG7B 3IVFA 3C0RB 4JIOU 3L13A 2LI5A 4FHKA 3ZVVA 1OTRB 1KOTA 3VQIA 2KHWB 2LXAA 2K39A 4BVUC 1E8YA 1WX8A 2HJ8A 2LGYA 4J6IA 2YVCA 4MH0E 3ZTDA 2MBHA 4FJVB 2MP2B 1WY8A 4W9FA 5CHWA 2MBEA 5JZEB 1LM8B 2BKFA 1WX9A 2A4ZA 2PEAA 3QX1A 2IBIB 2O2VB 4PYUA 5E6NA 3EHVA 4NAWA 3DVGX 1Y8RC 4ZRKA 3KUZA 3QHTA 4NJ6A 1E8ZA 3NY5A 4KSKC 2J0KA 2CR5A 1OGWA 3SHQA 4MJSB 4W9DA 2MCNB 4IWOA 1OEYA 2C9WB 3H1UA 3H7SA 3JSVB 4LJPB 2LVQA 3VUWA 4ICUA 4DHJD 2FCSA 1WJNA 2EKEC 2PE6B 3QJZA 4HXDA 2XBBC 4GIVA 5E6PA 2KX0A 2J0JA 2BYEA 2AL6A 2BPSA 1WE6A 2IY0B 2KANA 5LLIA 3ZLZA 2KX3A 4IM2A 4JQWC 4BKSA 3ZNZB 1IP9A 3JW0X 4NJ7A 1GJZA 1V5TA 2GMIC 2K6DB 2MRPA 3AI5A 3UIPB 4EZJA 1ISNA 1WIAA 2L76A 2D11A 1I35A 1EF1A 2KTFA 2ZPNA 2M1MA 3ZKJC 2N7DA 4II2B 3B1LX 3DBRI 4HPLB 3PHWB 5JHAA 4M8MA 4YL8A 4CYEA 1T0YA 5DPSA 3V62A 1QZEA 4KDLB 2MBBB 2KK8A 1E8WA 2C7MB 1UH6A 3EECA 3T8MA 4URKA 3DBSA 2M0XA 1C3TA 1C1YB 3GOEA 1X1MA 3EC8A 3HM3A 4BFRA 1R4NI 3Q3FA 3DBHI 2KN5A 1WGRA 3N30A 3QAQA 1VCBA 3KYDD 3ZW3A 1UD7A 2KMCA 2IYDB 4TQ1A 3ZDMC 2I1JA 2ZVNA 3BY4B 4HPMB 4NAWB 2RPQA 4EKUA 3L17A 4HCPB 4MGZE 2JT4B 2KZRA 2BWES 4DBGA 2UYZB 2KFKB 2WWZA 1GC6A 4NPNA 2G3QB 2NBUA 3RT3B 3IG3A 1V81A 1L2NA 4ZYNA 5JHBA 1NI2A 3A9JB 4GDKB 1ZKHA 1UZXB 2ZCBA 1OEYJ 2DYBA 3SD5A 4ZDVA 3CF6E 3ONSA 4IWPA 1RFAA 3IFWB 4II3B 3W1SA 2BF8B 2IO0B 2LXCA 3SDLC 1EUVB 2G4SA 2KNBA 3N3KB 4GSWA 4HJKA 3PGEA 3X0WA 3AXCA 1WXSA 3ZRFA 3DBLI 4F8CB 2ZPYA 4G50A 3ZIMA 4HDQA 4IUMB 5HKHA 2D10A 2LRUA 3AU4A 2IY1B 4WJQA 4KZCA 2KQ7A 3DVNV 1P1AA 3U7DA 2NPTA 2FAZA 2KDEB 4I6LB 4CO7A 4GMVA 1UELA 1KJTA 2C60A 2V4LA 2HTHA 4G0NB 4WWOA 3QARA 4WJOA 4KDIC 4W9LA 5CHVC 5D2MB 1ZW7A 4HDOA 4M8NA 1PQSA 2NCNA 2KVRA 3M63B 4GXBA 1GUAB 4K7SA 3WAPA 5G2NA 5AEKB 1SIFA 1WXVA 3PZDA 3RUIB 2FCQA 1V80A 2LGDA 3PRPB 3DQVA 2MX2A 1LXDA 4W9EA 3RZWC 1WR1A 2KWCA 3KUDB 1WJ4A 3A1QA 4LCDE 3ZNID 3LJ3A 2IO2B 4WJNA 3UGBB 1V6EA 1WM3A 2KJ6A 1BT0A 1WGYA 1Z2MA 2NS5A 3L10B 4MELA 1WX7A 2DENB 3EFUA 3NZUA 3DPDA 4GGQA 4BKSD 5DPWA 2KOXA 3VTVA 2KFKA 2KMAA 1WR6E 1F9JA 3W1YA 1V49A 2KC2A 2J0MA 3RD2A 4XX5A 3A9JA 4GDKA 2MW5A 3VUXA 5C23A 2EMSA 3V6EB 2N7EA 1P9DU 2OOBB 2C7NB 3QCAA 4W9JA 3PV1A 4F7ZA 2MLBA 2JWZA 1WYWB 1H8CA 2WDTB 4OVVA 2MA9B 2Z59B 3O65B 3OJ3A 2KWUB 5IAAC 2KJHB 4EUTA 1XQQA 3B0AA 2LGXA 4FJYA 3PVLA 4K7UA 5AZHA 3L08A 5D6JB 1WH3A 2KLCA 3HM6X 5LXHA 5BO4B 4W9IA 2N1WA 2VRRB 4AJYB 3S2AA 2KDIA 3AU5A 4B95A 2FCMA 2MBQA 1SGHA 2DZJA 2G4DB 3IBEA 3QIJA 3ZDTA 2GBJA 3WAMA 3CMMB 4MSQB 3U8ZA 4ANWA 1P0RA 2NPTB 3OAWA 4IW0A 1D3ZA 1WFYA 3KUCB 4LJOB 4HCNB 2CHZA 3CSTA 5DCNA 1TZ1A 2GBRA 3BINA 1NBFC 2DX5B 2L0TA 2O6VA 3IHPC 3PREA 1J8CA 1LFDA 3ML9A 5L95C 3M3JA 4AP4C 2LUEA 1WMHB 3MHSD 5D94A 4BBNF 1RRBA 2AYOB 5EDSA 4AOFA 2KFJA 3L0WB 2C7HA 2PE9A 2JRIB 2ZNVB 4FBJB 2ZCCA 3L16A 3SU8X 2LZ6A 3UIOB 2OJRA 2KO3A 2JXXA 3ZUNA 1R4MI 4I6NB 5E6OA 1TBEA 4F1SA 2PJHA 5LXIB 3B08A 1WZ3A 1YQBA 2IO1B 1P98A 5D7GA 4MSMB 4P7IA 4ANUA 1WE7A 3H9DA 2MQJA 4EOYA 4WQOB 1A5RA 1S3SG 2MBOA 4NQLB 2CU1A 4BOSC 4ANXA 1V9JA 4FN2A 2KTRB 4KIKB 4WWNA 3TCAA 1V86A 3A1QB 5J2RA 2JVCA 1VD2A 2FIFA 3LDZE 5KHOA 2RSUA 2CHWA 3AULA 2LVOA 2N9EB 1UBQA 3KH0A 3WA0A 3VAWA 3OJ4B 4TUUA 5L83A 1YX6B 5C1ZA 4PS7A 1YIWA 2EMTA 2KQSA 4IWQA 1Q5WB 3P2BA 4LDTB 3D32A 3A33B 1GNUA 4BBNC 2G45B 2M4NA 1E5WA 5GMVA 4FLHA 3ZTCA 4MGYE 3Q3JA 3TJPA 3NS8A 2D2QA 3PPAA 4MDKE 3ECIA 2ZJDA 2LVPA 2N4FA 3PHXB 3VTUA 1K8RB 4AJWA 2NBVB 3APFA 1AARA 1E8XA 1MG8A 4NNJB 2KWVB 5AZGA 3VH3B 4XZ4A 3ZO5B 4ANVA 5CHFA 3ENEA 4EZLA 3TL5A 4W9HA 1L7YA 1XT9B 2LD9A 1NDDA 2DZKA 3RULA 2K1FA 4K7WA 3H6NA 1I42A 3VHTC 2C5LC 4NY0A 2L0FA 2W9NA 3UF8A 1Z5SB 4DHZE 2UWQA 1WMHA 3QA8A 2JF5A 3RZFA 4MGIE 4E74A 2LASA 2AWTA 2NVUI 2O6VB 2PPHA 1TTNA 4HLEA 2ZEQA 4GDLA 2N9PC 3PT2B 3PRMB 4DK5A 2YLMA 4ICVA 1Q1OA 1HE8A 4W9GA 4XC2A 3W1SC 3ZNHB 4BKTA 4EEWA 4EZKA 2KKCA 2NBWB 3HIZA 1J19A 1U4AA 3QQ8B 3VXWA 3A4RA 4EFOA 4WJPA 3WAOA 4HWIB 2BYFA 2CKHB 2GBNA 4KVGB 3V60A 4RMAA 4KIKA 2KTRA 2ASQA 2Z0DB 4DHJB 1OQYA 1P3QU 4KZ0A 2GBMA 1WXMA 2WX1A 3PTFC 3R66C 4I6PA 5CTRC 4DDGD 2L7RA 2KC1A 3L54A 2R2OA 2Y5BB 5TR5A 1JRUA 2HE7A 2MWSB 3PRZA 3PSEB 2FNJB 2L8JA 5J17A 4RM9A 3PLVA 4RM8A 4W9KA 5G55A 2DHZA 2WYQA 4OVUA 2CS4A 1SE9A 1UGMA 3A9KA 4GN1A 1XD3B 4B9KA 1WM2A 3H7PB 2XK5B 2IZVB 2D07B 2FUHB 1H4RA 2ZNVC 4G11A 3PLUA 2BYVE 2HD5B 5FR6A 3WIMA 2AL3A 3K9PB 1EF5A 2KD0A 2O6VD 4GOCA 4B6WA 1IPGA 1V2YA 1WF9A 1Q0WB 2LWPA 1YJ1A 2I1KA 1WI0A 5KHQA 2LRWA 3A4SC 3VH4B 5AZFA 3VTWA 2BGFA 2ZZPB 4HVBA 4W9CA 5CX3A 3T9LA 3ML8A 4CHKA 3UQAA 1E7UA 3APDA 3M95A 5DPTA 2DAJA 2RGFA 3ALBA 4K1RB 3VUYA 2WX0A 4K81A 5DPRA 4ZRJA 3JVZX 3CSFA 4ASWC 1IYFA 3RCZA 2K25A 1YX5B 2K8HA 3VVWB 4A20A 4IC7B 2NR2A 1EO6A 3WANA 2V3SA 2DYOA 4GU2A 4PS3A 4JL9A 2A5UA 4AUQC 1CMXB 4TKNA 1S1QB 4AWJA 1GC7A 4E3CA 2L00B 3DVGY 1J0GA 2M17A 4GDLB 3HK0A 5JH5C 3VFKA 1WGGA 1WGHA 1WJ6A 3I3TB 1RLFA 4IM3A 4WWPA 3OLMD 3UQBA 4X57B 1GG3A 1E90A 3DVNU 2JRHA 4ZRIA 3UINB 3PS6A 4WAAA 2JZZA 1KM7A 4GB9A 3TBLD 4N9F4 2KLGA 1LQBA 2KJRA 2JPHA 3APCA 2L3ZA 4KSLC 4IM0A 1YD8U 2GOWA 4TQ0A 3HHMA 2QHOA 3TIXA 1FXTB 4KV2A 3TMPB 2MP2A 3NHEB 3H7PA 2XK5A 4E71A 4BKGA 2JZ3B 3DCGA 4DWFA 1E7VA 2M8SA 3A9KB 2GBKA 2O2VA 4FHJA 1WGDA 4DDID 3RYTA 3QC8B 2R2QA 2REXA 3QK0A 1ZGUB 4FJZA 4BOZB 2N9XA 3M62B 2K8BA 4PS8A 3WALA 4MEMA 1RAXA 2K8CA 3N32A 3GZNI 4MJSA 3KVFB 1M94A 1WRDB 3KW5B 3ZNGC 3JSVA 3VDZA 2FCNA 2KXJA 2CHXA 2V1YA 4JLCA 4DXAB 2RD0A 3K9OB 3DDCB 2ZVOA 1V5OA 4M0WB 4DHZB 1WZ0A 2B3AA 2IO3B 1WJUA 4G3XB 3V6CB 3MTNB 2DZIA 3ZRCA 2L05A 3QWZB 2JUOA 3NZSA 1WXAA 3X23A 2BKRB 2DYMA 4FULA 3R7QA 2RR9A 2XEWA 2AEHA 4HK2A 1TGZB 1G6JA 3V61A 1KLVA 2BWFA 4MM3A 3NOBA 4PYZA 1UBIA 2MSED 3KYCD 2K6QA 3R7RA 5IA7A 4NQKE 2D3GA 4LDTD 2KDBA 2DAFA 2FIDA 2J7QB 3R3MA 5J18A 2N1VA 4FADA 4FA6A 2Z0EB 3U30A 4A3OA 3MJWA 2KDFB 3DOWA 4TV3A 2DZMA 2JY6A 4JGHB 4MGKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYU A;  4A3P A;  2LJ5 A;  4IG7 B;  3IVF A;  3C0R B;  4JIO U;  3L13 A;  2LI5 A;  4FHK A;  3ZVV A;  1OTR B;  1KOT A;  3VQI A;  2KHW B;  2LXA A;  2K39 A;  4BVU C;  1E8Y A;  1WX8 A;  2HJ8 A;  2LGY A;  4J6I A;  2YVC A;  4MH0 E;  3ZTD A;  2MBH A;  4FJV B;  2MP2 B;  1WY8 A;  4W9F A;  5CHW A;  2MBE A;  5JZE B;  1LM8 B;  2BKF A;  1WX9 A;  2A4Z A;  2PEA A;  3QX1 A;  2IBI B;  2O2V B;  4PYU A;  5E6N A;  3EHV A;  4NAW A;  3DVG X;  1Y8R C;  4ZRK A;  3KUZ A;  3QHT A;  4NJ6 A;  1E8Z A;  3NY5 A;  4KSK C;  2J0K A;  2CR5 A;  1OGW A;  3SHQ A;  4MJS B;  4W9D A;  2MCN B;  4IWO A;  1OEY A;  2C9W B;  3H1U A;  3H7S A;  3JSV B;  4LJP B;  2LVQ A;  3VUW A;  4ICU A;  4DHJ D;  2FCS A;  1WJN A;  2EKE C;  2PE6 B;  3QJZ A;  4HXD A;  2XBB C;  4GIV A;  5E6P A;  2KX0 A;  2J0J A;  2BYE A;  2AL6 A;  2BPS A;  1WE6 A;  2IY0 B;  2KAN A;  5LLI A;  3ZLZ A;  2KX3 A;  4IM2 A;  4JQW C;  4BKS A;  3ZNZ B;  1IP9 A;  3JW0 X;  4NJ7 A;  1GJZ A;  1V5T A;  2GMI C;  2K6D B;  2MRP A;  3AI5 A;  3UIP B;  4EZJ A;  1ISN A;  1WIA A;  2L76 A;  2D11 A;  1I35 A;  1EF1 A;  2KTF A;  2ZPN A;  2M1M A;  3ZKJ C;  2N7D A;  4II2 B;  3B1L X;  3DBR I;  4HPL B;  3PHW B;  5JHA A;  4M8M A;  4YL8 A;  4CYE A;  1T0Y A;  5DPS A;  3V62 A;  1QZE A;  4KDL B;  2MBB B;  2KK8 A;  1E8W A;  2C7M B;  1UH6 A;  3EEC A;  3T8M A;  4URK A;  3DBS A;  2M0X A;  1C3T A;  1C1Y B;  3GOE A;  1X1M A;  3EC8 A;  3HM3 A;  4BFR A;  1R4N I;  3Q3F A;  3DBH I;  2KN5 A;  1WGR A;  3N30 A;  3QAQ A;  1VCB A;  3KYD D;  3ZW3 A;  1UD7 A;  2KMC A;  2IYD B;  4TQ1 A;  3ZDM C;  2I1J A;  2ZVN A;  3BY4 B;  4HPM B;  4NAW B;  2RPQ A;  4EKU A;  3L17 A;  4HCP B;  4MGZ E;  2JT4 B;  2KZR A;  2BWE S;  4DBG A;  2UYZ B;  2KFK B;  2WWZ A;  1GC6 A;  4NPN A;  2G3Q B;  2NBU A;  3RT3 B;  3IG3 A;  1V81 A;  1L2N A;  4ZYN A;  5JHB A;  1NI2 A;  3A9J B;  4GDK B;  1ZKH A;  1UZX B;  2ZCB A;  1OEY J;  2DYB A;  3SD5 A;  4ZDV A;  3CF6 E;  3ONS A;  4IWP A;  1RFA A;  3IFW B;  4II3 B;  3W1S A;  2BF8 B;  2IO0 B;  2LXC A;  3SDL C;  1EUV B;  2G4S A;  2KNB A;  3N3K B;  4GSW A;  4HJK A;  3PGE A;  3X0W A;  3AXC A;  1WXS A;  3ZRF A;  3DBL I;  4F8C B;  2ZPY A;  4G50 A;  3ZIM A;  4HDQ A;  4IUM B;  5HKH A;  2D10 A;  2LRU A;  3AU4 A;  2IY1 B;  4WJQ A;  4KZC A;  2KQ7 A;  3DVN V;  1P1A A;  3U7D A;  2NPT A;  2FAZ A;  2KDE B;  4I6L B;  4CO7 A;  4GMV A;  1UEL A;  1KJT A;  2C60 A;  2V4L A;  2HTH A;  4G0N B;  4WWO A;  3QAR A;  4WJO A;  4KDI C;  4W9L A;  5CHV C;  5D2M B;  1ZW7 A;  4HDO A;  4M8N A;  1PQS A;  2NCN A;  2KVR A;  3M63 B;  4GXB A;  1GUA B;  4K7S A;  3WAP A;  5G2N A;  5AEK B;  1SIF A;  1WXV A;  3PZD A;  3RUI B;  2FCQ A;  1V80 A;  2LGD A;  3PRP B;  3DQV A;  2MX2 A;  1LXD A;  4W9E A;  3RZW C;  1WR1 A;  2KWC A;  3KUD B;  1WJ4 A;  3A1Q A;  4LCD E;  3ZNI D;  3LJ3 A;  2IO2 B;  4WJN A;  3UGB B;  1V6E A;  1WM3 A;  2KJ6 A;  1BT0 A;  1WGY A;  1Z2M A;  2NS5 A;  3L10 B;  4MEL A;  1WX7 A;  2DEN B;  3EFU A;  3NZU A;  3DPD A;  4GGQ A;  4BKS D;  5DPW A;  2KOX A;  3VTV A;  2KFK A;  2KMA A;  1WR6 E;  1F9J A;  3W1Y A;  1V49 A;  2KC2 A;  2J0M A;  3RD2 A;  4XX5 A;  3A9J A;  4GDK A;  2MW5 A;  3VUX A;  5C23 A;  2EMS A;  3V6E B;  2N7E A;  1P9D U;  2OOB B;  2C7N B;  3QCA A;  4W9J A;  3PV1 A;  4F7Z A;  2MLB A;  2JWZ A;  1WYW B;  1H8C A;  2WDT B;  4OVV A;  2MA9 B;  2Z59 B;  3O65 B;  3OJ3 A;  2KWU B;  5IAA C;  2KJH B;  4EUT A;  1XQQ A;  3B0A A;  2LGX A;  4FJY A;  3PVL A;  4K7U A;  5AZH A;  3L08 A;  5D6J B;  1WH3 A;  2KLC A;  3HM6 X;  5LXH A;  5BO4 B;  4W9I A;  2N1W A;  2VRR B;  4AJY B;  3S2A A;  2KDI A;  3AU5 A;  4B95 A;  2FCM A;  2MBQ A;  1SGH A;  2DZJ A;  2G4D B;  3IBE A;  3QIJ A;  3ZDT A;  2GBJ A;  3WAM A;  3CMM B;  4MSQ B;  3U8Z A;  4ANW A;  1P0R A;  2NPT B;  3OAW A;  4IW0 A;  1D3Z A;  1WFY A;  3KUC B;  4LJO B;  4HCN B;  2CHZ A;  3CST A;  5DCN A;  1TZ1 A;  2GBR A;  3BIN A;  1NBF C;  2DX5 B;  2L0T A;  2O6V A;  3IHP C;  3PRE A;  1J8C A;  1LFD A;  3ML9 A;  5L95 C;  3M3J A;  4AP4 C;  2LUE A;  1WMH B;  3MHS D;  5D94 A;  4BBN F;  1RRB A;  2AYO B;  5EDS A;  4AOF A;  2KFJ A;  3L0W B;  2C7H A;  2PE9 A;  2JRI B;  2ZNV B;  4FBJ B;  2ZCC A;  3L16 A;  3SU8 X;  2LZ6 A;  3UIO B;  2OJR A;  2KO3 A;  2JXX A;  3ZUN A;  1R4M I;  4I6N B;  5E6O A;  1TBE A;  4F1S A;  2PJH A;  5LXI B;  3B08 A;  1WZ3 A;  1YQB A;  2IO1 B;  1P98 A;  5D7G A;  4MSM B;  4P7I A;  4ANU A;  1WE7 A;  3H9D A;  2MQJ A;  4EOY A;  4WQO B;  1A5R A;  1S3S G;  2MBO A;  4NQL B;  2CU1 A;  4BOS C;  4ANX A;  1V9J A;  4FN2 A;  2KTR B;  4KIK B;  4WWN A;  3TCA A;  1V86 A;  3A1Q B;  5J2R A;  2JVC A;  1VD2 A;  2FIF A;  3LDZ E;  5KHO A;  2RSU A;  2CHW A;  3AUL A;  2LVO A;  2N9E B;  1UBQ A;  3KH0 A;  3WA0 A;  3VAW A;  3OJ4 B;  4TUU A;  5L83 A;  1YX6 B;  5C1Z A;  4PS7 A;  1YIW A;  2EMT A;  2KQS A;  4IWQ A;  1Q5W B;  3P2B A;  4LDT B;  3D32 A;  3A33 B;  1GNU A;  4BBN C;  2G45 B;  2M4N A;  1E5W A;  5GMV A;  4FLH A;  3ZTC A;  4MGY E;  3Q3J A;  3TJP A;  3NS8 A;  2D2Q A;  3PPA A;  4MDK E;  3ECI A;  2ZJD A;  2LVP A;  2N4F A;  3PHX B;  3VTU A;  1K8R B;  4AJW A;  2NBV B;  3APF A;  1AAR A;  1E8X A;  1MG8 A;  4NNJ B;  2KWV B;  5AZG A;  3VH3 B;  4XZ4 A;  3ZO5 B;  4ANV A;  5CHF A;  3ENE A;  4EZL A;  3TL5 A;  4W9H A;  1L7Y A;  1XT9 B;  2LD9 A;  1NDD A;  2DZK A;  3RUL A;  2K1F A;  4K7W A;  3H6N A;  1I42 A;  3VHT C;  2C5L C;  4NY0 A;  2L0F A;  2W9N A;  3UF8 A;  1Z5S B;  4DHZ E;  2UWQ A;  1WMH A;  3QA8 A;  2JF5 A;  3RZF A;  4MGI E;  4E74 A;  2LAS A;  2AWT A;  2NVU I;  2O6V B;  2PPH A;  1TTN A;  4HLE A;  2ZEQ A;  4GDL A;  2N9P C;  3PT2 B;  3PRM B;  4DK5 A;  2YLM A;  4ICV A;  1Q1O A;  1HE8 A;  4W9G A;  4XC2 A;  3W1S C;  3ZNH B;  4BKT A;  4EEW A;  4EZK A;  2KKC A;  2NBW B;  3HIZ A;  1J19 A;  1U4A A;  3QQ8 B;  3VXW A;  3A4R A;  4EFO A;  4WJP A;  3WAO A;  4HWI B;  2BYF A;  2CKH B;  2GBN A;  4KVG B;  3V60 A;  4RMA A;  4KIK A;  2KTR A;  2ASQ A;  2Z0D B;  4DHJ B;  1OQY A;  1P3Q U;  4KZ0 A;  2GBM A;  1WXM A;  2WX1 A;  3PTF C;  3R66 C;  4I6P A;  5CTR C;  4DDG D;  2L7R A;  2KC1 A;  3L54 A;  2R2O A;  2Y5B B;  5TR5 A;  1JRU A;  2HE7 A;  2MWS B;  3PRZ A;  3PSE B;  2FNJ B;  2L8J A;  5J17 A;  4RM9 A;  3PLV A;  4RM8 A;  4W9K A;  5G55 A;  2DHZ A;  2WYQ A;  4OVU A;  2CS4 A;  1SE9 A;  1UGM A;  3A9K A;  4GN1 A;  1XD3 B;  4B9K A;  1WM2 A;  3H7P B;  2XK5 B;  2IZV B;  2D07 B;  2FUH B;  1H4R A;  2ZNV C;  4G11 A;  3PLU A;  2BYV E;  2HD5 B;  5FR6 A;  3WIM A;  2AL3 A;  3K9P B;  1EF5 A;  2KD0 A;  2O6V D;  4GOC A;  4B6W A;  1IPG A;  1V2Y A;  1WF9 A;  1Q0W B;  2LWP A;  1YJ1 A;  2I1K A;  1WI0 A;  5KHQ A;  2LRW A;  3A4S C;  3VH4 B;  5AZF A;  3VTW A;  2BGF A;  2ZZP B;  4HVB A;  4W9C A;  5CX3 A;  3T9L A;  3ML8 A;  4CHK A;  3UQA A;  1E7U A;  3APD A;  3M95 A;  5DPT A;  2DAJ A;  2RGF A;  3ALB A;  4K1R B;  3VUY A;  2WX0 A;  4K81 A;  5DPR A;  4ZRJ A;  3JVZ X;  3CSF A;  4ASW C;  1IYF A;  3RCZ A;  2K25 A;  1YX5 B;  2K8H A;  3VVW B;  4A20 A;  4IC7 B;  2NR2 A;  1EO6 A;  3WAN A;  2V3S A;  2DYO A;  4GU2 A;  4PS3 A;  4JL9 A;  2A5U A;  4AUQ C;  1CMX B;  4TKN A;  1S1Q B;  4AWJ A;  1GC7 A;  4E3C A;  2L00 B;  3DVG Y;  1J0G A;  2M17 A;  4GDL B;  3HK0 A;  5JH5 C;  3VFK A;  1WGG A;  1WGH A;  1WJ6 A;  3I3T B;  1RLF A;  4IM3 A;  4WWP A;  3OLM D;  3UQB A;  4X57 B;  1GG3 A;  1E90 A;  3DVN U;  2JRH A;  4ZRI A;  3UIN B;  3PS6 A;  4WAA A;  2JZZ A;  1KM7 A;  4GB9 A;  3TBL D;  4N9F 4;  2KLG A;  1LQB A;  2KJR A;  2JPH A;  3APC A;  2L3Z A;  4KSL C;  4IM0 A;  1YD8 U;  2GOW A;  4TQ0 A;  3HHM A;  2QHO A;  3TIX A;  1FXT B;  4KV2 A;  3TMP B;  2MP2 A;  3NHE B;  3H7P A;  2XK5 A;  4E71 A;  4BKG A;  2JZ3 B;  3DCG A;  4DWF A;  1E7V A;  2M8S A;  3A9K B;  2GBK A;  2O2V A;  4FHJ A;  1WGD A;  4DDI D;  3RYT A;  3QC8 B;  2R2Q A;  2REX A;  3QK0 A;  1ZGU B;  4FJZ A;  4BOZ B;  2N9X A;  3M62 B;  2K8B A;  4PS8 A;  3WAL A;  4MEM A;  1RAX A;  2K8C A;  3N32 A;  3GZN I;  4MJS A;  3KVF B;  1M94 A;  1WRD B;  3KW5 B;  3ZNG C;  3JSV A;  3VDZ A;  2FCN A;  2KXJ A;  2CHX A;  2V1Y A;  4JLC A;  4DXA B;  2RD0 A;  3K9O B;  3DDC B;  2ZVO A;  1V5O A;  4M0W B;  4DHZ B;  1WZ0 A;  2B3A A;  2IO3 B;  1WJU A;  4G3X B;  3V6C B;  3MTN B;  2DZI A;  3ZRC A;  2L05 A;  3QWZ B;  2JUO A;  3NZS A;  1WXA A;  3X23 A;  2BKR B;  2DYM A;  4FUL A;  3R7Q A;  2RR9 A;  2XEW A;  2AEH A;  4HK2 A;  1TGZ B;  1G6J A;  3V61 A;  1KLV A;  2BWF A;  4MM3 A;  3NOB A;  4PYZ A;  1UBI A;  2MSE D;  3KYC D;  2K6Q A;  3R7R A;  5IA7 A;  4NQK E;  2D3G A;  4LDT D;  2KDB A;  2DAF A;  2FID A;  2J7Q B;  3R3M A;  5J18 A;  2N1V A;  4FAD A;  4FA6 A;  2Z0E B;  3U30 A;  4A3O A;  3MJW A;  2KDF B;  3DOW A;  4TV3 A;  2DZM A;  2JY6 A;  4JGH B;  4MGK E; 
#chains in the Genus database with same CATH topology
 3JYU A;  4A3P A;  3PZ8 A;  4FHK A;  3ZVV A;  1C77 A;  3VQI A;  1E8Y A;  1WX8 A;  2HJ8 A;  4J6I A;  3ZTD A;  2MBH A;  4FJV B;  1TY2 A;  5D3D A;  2J4X A;  5IP4 D;  2IBI B;  4PYU A;  1PGX A;  4NAW A;  3DVG X;  3NY5 A;  2CR5 A;  4MJS B;  2L32 A;  2C9W B;  3H7S A;  4LJP B;  3VUW A;  1AWD A;  4RGM A;  2KVZ A;  3I57 A;  2XBB C;  4GIV A;  3TSS A;  3TEW A;  2IY0 B;  2KAN A;  1ZPS A;  2WGS A;  3B2F A;  2PKO A;  1YNT E;  1GOZ A;  3AEF B;  1GJZ A;  1JWM D;  2JXT A;  4EZJ A;  1SJE D;  4C80 A;  1EF1 A;  1D5Z C;  3B1L X;  3U52 E;  4CYE A;  2WQY B;  5HI1 A;  3P4Q B;  2KK8 A;  1E8W A;  3T8M A;  4PK1 A;  4URK A;  1YMH E;  2M0X A;  1C1Y B;  1X1M A;  3NG0 A;  3RN9 C;  1R4N I;  2W55 A;  1MVK A;  3QAQ A;  1R4N B;  3ZW3 A;  1UD7 A;  2IYD B;  2L1A A;  2MHJ A;  3BY4 B;  2RPQ A;  4EKU A;  1DOY A;  2YEP B;  2BWE S;  2UYZ B;  3P63 A;  2WWZ A;  3AE9 B;  3VR9 B;  1L2N A;  1FFU A;  2G3Q B;  3RT3 B;  3IG3 A;  4A8X C;  4GDK B;  3T3O A;  4ZDV A;  3CF6 E;  4IWP A;  1RFA A;  2J42 A;  2IO0 B;  2LXC A;  1EUV B;  3X0W A;  3AXC A;  1WXS A;  4NAM A;  3DBL I;  4G50 A;  1L0X B;  2D10 A;  2LRU A;  3DBL B;  2IY1 B;  3MC9 A;  4WJQ A;  4KZC A;  2KQ7 A;  3DVN V;  2FAZ A;  1EM7 A;  2Z8L A;  4CO7 A;  2C60 A;  2G9H D;  4WJO A;  3MP9 A;  5D2M B;  2N7J A;  3WAP A;  1WXV A;  5E6J A;  3PZD A;  3RUI B;  2FCQ A;  4C7Z A;  1LXD A;  4KGS A;  4W9E A;  4HJG E;  1HEZ E;  2KWC A;  2K5P A;  3ZNI D;  1BT0 A;  4B0M A;  2IGD A;  5C3J B;  1WX7 A;  1PGA A;  2KFK A;  1T5X D;  1WR6 E;  2I38 A;  2KC2 A;  2MJD A;  2MW5 A;  4YTP B;  1PGB A;  3V6E B;  3QCA A;  1EWC A;  4S17 A;  3TEZ A;  1D5X C;  1F1H A;  4KGT A;  1H8C A;  2MA9 B;  2J53 A;  3OJ3 A;  5IAA C;  1WSP A;  1C76 A;  3PVL A;  3HM6 X;  1TS2 A;  2N1W A;  2VRR B;  2PMV A;  3IAS 1;  4MSQ B;  3OAW A;  2HJ1 A;  4IW0 A;  1D3Z A;  4LJO B;  4HCN B;  3T3N A;  1SE2 A;  5DCN A;  1NBF C;  1WXQ A;  3PRE A;  2JYE A;  5L95 C;  4MT5 A;  3M3J A;  3NS1 A;  3MHS D;  1RRB A;  5EDS A;  2C7H A;  1SE3 A;  2JRI B;  4JWU C;  2ZNV B;  2ZCC A;  3L16 A;  2LZ6 A;  5E6O A;  3FIL B;  3B08 A;  2IO1 B;  1I7H A;  4P7I A;  1WE7 A;  4XDD A;  2MQJ A;  1A5R A;  4WQO B;  1FM0 D;  4NQL B;  4M01 A;  4BOS C;  4FN2 A;  3CIR B;  2KTR B;  1V86 A;  5J2R A;  2JVC A;  5KHO A;  3TUO A;  1F77 A;  1FRR A;  2CJN A;  1JCK B;  2EMT A;  2KQS A;  1WGK A;  1Q5W B;  3D32 A;  3OWE B;  1GNU A;  4BBN C;  1YN3 A;  2M4N A;  4FLH A;  3Q3J A;  2D2Q A;  3PPA A;  4MDK E;  2VZK B;  3ECI A;  4C56 C;  2LVP A;  1K8R B;  1FXI A;  1TYG B;  1AAR A;  1MG8 A;  1T0R C;  4NNJ B;  3RNB C;  1LO5 D;  5CHF A;  3ENE A;  3H6N A;  1K53 A;  3RNE C;  4LNI A;  2W9N A;  4DHZ E;  5HHD G;  4MGI E;  4E74 A;  2LAS A;  2AWT A;  2PPH A;  2O6V B;  3NVV A;  1TTN A;  3PT2 B;  4DK5 A;  1FNV A;  2D5G A;  1HE8 A;  2KKC A;  3HIZ A;  4EFO A;  4HWI B;  4KVG B;  2ON8 A;  2Z0D B;  1OQY A;  2LJI A;  4RFB A;  4KZ0 A;  2WX1 A;  3PTF C;  2QC8 A;  3PLV A;  2DHZ A;  2EKI A;  1NVI D;  1SE9 A;  3A9K A;  4BAX A;  1VDV A;  3PLU A;  1CJE A;  3K9P B;  1EF5 A;  2W3S A;  1Q0W B;  1WI0 A;  2I1K A;  4XDC A;  1L6V A;  2MEK A;  3ZJV A;  3OG5 A;  3VH4 B;  5AZF A;  3N9Y C;  1B1Z A;  3ML8 A;  3BYT B;  4CHK A;  1XLN A;  5DPT A;  2RGF A;  3ALB A;  2K9X A;  3VUY A;  3HRD D;  4ASW C;  1IYF A;  1YX5 B;  2K8H A;  3AE4 B;  2BW2 A;  4AUQ C;  4TKN A;  3IXS A;  2L00 B;  2M17 A;  3VFK A;  1WGH A;  3I3T B;  3FAH A;  1FCL A;  3DVN U;  4ZRI A;  3UIN B;  3NVW A;  4WAA A;  4N9F 4;  1LQB A;  3TEY A;  4L23 A;  4IM0 A;  2GOW A;  3AE1 B;  3NRZ A;  3HHM A;  3TIX A;  1C9F A;  3NHE B;  2Q5W D;  2XK5 A;  4BKG A;  1M4V A;  4RCO A;  2LGS A;  1T0Q C;  1E7V A;  1VRA B;  2JQR B;  4FJZ A;  3QK0 A;  2REX A;  3QC8 B;  1KLU D;  1ZGU B;  2WU2 B;  3Q8B A;  4ZYS A;  4MJS A;  1M94 A;  3KW5 B;  4DXA B;  1BXT A;  4O1N A;  5AUI A;  4DHZ B;  2B3A A;  3V6C B;  1UWX A;  3NZS A;  3X23 A;  2KT7 A;  1FIQ A;  2RR9 A;  3IT6 B;  3AEG B;  3O13 A;  1KLV A;  2SAK A;  2BWF A;  3KYC D;  1KFY B;  1ZXI A;  4DXG A;  2N1V A;  2FBW B;  3SFD B;  3DOW A;  3N1Y C;  5EE9 A;  3NJT A;  2DZM A;  1UGJ A;  4J3O D;  1MHX A;  3IVF A;  4JIO U;  1JWB D;  1OTR B;  4P1B C;  3E9S A;  1EU4 A;  2K39 A;  2QJL A;  1WY8 A;  1Y56 A;  4HKQ A;  5G5G A;  5JZE B;  4PT5 A;  1LM8 B;  2BQQ A;  1WX9 A;  2MJ3 A;  2A4Z A;  1T0S C;  1SB3 C;  4XWW A;  3EA6 A;  5E6N A;  3EHV A;  1Y8R C;  3KUZ A;  2WXH A;  1E8Z A;  1GB4 A;  4W9D A;  2MCN B;  2WDQ B;  1OEY A;  2LVQ A;  1V8C A;  4ICU A;  4DHJ D;  1B9R A;  2FCS A;  2EKE C;  2KQ4 X;  3QJZ A;  1RWS A;  2ACZ B;  4LLG M;  2KX0 A;  2J0J A;  1WE6 A;  2CJO A;  4JQW C;  1IP9 A;  1K51 A;  1ZE3 D;  3B2G A;  3Q3N C;  2K0P A;  2WXJ A;  2GMI C;  3AI5 A;  3ZYY X;  1WIA A;  3SEB A;  2N7D A;  4YWG G;  1UNS A;  4HPL B;  5JHA A;  3W2D A;  1UWM A;  4YL8 A;  1JRO A;  4P16 A;  2INP E;  1L4Z B;  1MJD A;  1JML A;  5T8I A;  1SEB D;  1I4X A;  1C3T A;  3MFG A;  3EC8 A;  1FPY A;  2KAC A;  3GE8 C;  3LYY A;  2I1J A;  1VZ7 A;  4USA A;  4HPM B;  3L17 A;  4HCP B;  4RGN A;  1YJJ A;  4K3B A;  5HFY A;  3LXF A;  1FO4 A;  1GC6 A;  4NPN A;  2I2Y A;  3RNF C;  1UZX B;  2ZCB A;  1OEY J;  4LNO A;  2BF8 B;  2KNB A;  3N3K B;  4F8C B;  3AU4 A;  1QIL A;  1KRH A;  3U7D A;  2ICI A;  2IJ0 A;  4ZHO A;  4OHJ A;  3QAR A;  3BII D;  5CHV C;  4HDO A;  2NCN A;  5LNK 1;  1GUA B;  4K7S A;  5G2N A;  1SIF A;  3FIL A;  3DWM A;  1XLQ A;  1V80 A;  3PRP B;  3DQV A;  2MX2 A;  4WQM A;  4WAF A;  3RI7 C;  4WJN A;  2IO2 B;  1V6E A;  2KJ6 A;  3L10 B;  1WGY A;  2UU7 A;  3DPD A;  4GGQ A;  5DPW A;  5H8Y E;  1ZP0 B;  2KMA A;  1F9J A;  4HKZ E;  3RD2 A;  4XX5 A;  3A9J A;  1MPE A;  4P1C C;  1P9D U;  2OOB B;  2C7N B;  4F7Z A;  1QQR A;  2MLB A;  2JWZ A;  4KGR A;  2KYW A;  3EFC A;  2GLS A;  2Z59 B;  3O65 B;  4KKI A;  1XQQ A;  2LGX A;  2BS4 B;  1I4R A;  5TSS A;  5BO4 B;  3ETR A;  3S2A A;  2KDI A;  2G4D B;  5FKA C;  3IBE A;  3ZDT A;  3WAM A;  2OED A;  4ANW A;  1P0R A;  2NPT B;  1WFY A;  3R8B A;  3RPF C;  4M00 A;  1TZ1 A;  2GBR A;  3BIN A;  2L0T A;  2O6V A;  4QAY A;  2LUE A;  2MH7 A;  3AV8 A;  1SSN A;  1TKE A;  2PE9 A;  5BYQ A;  2JX5 A;  3AE3 B;  3UIO B;  2OJR A;  2KO3 A;  2JXX A;  4HRS A;  1TBE A;  5LXI B;  1YQB A;  1P98 A;  4ARC A;  4JWS C;  3GB1 A;  4WWN A;  4KIK B;  3A1Q B;  2D3A A;  1TIF A;  3LDZ E;  2RSU A;  2X38 A;  3KH0 A;  2LVO A;  3WA0 A;  1UBQ A;  3KWL A;  3IAM 1;  1YX6 B;  1ET6 A;  2TSS A;  4R3D A;  1KH0 A;  3B9J A;  4MGY E;  1NYR A;  3NS8 A;  2NTT A;  3PHX B;  3VTU A;  4YT0 B;  2KWV B;  1TZO A;  1D5M C;  3ZO5 B;  1DOI A;  4W9H A;  1XT9 B;  4TMA B;  3ZXR A;  4GLS C;  1XXG A;  4YXD B;  1Z5S B;  1WMH A;  3QA8 A;  1JQ4 A;  4N59 A;  4HLE A;  3PO0 A;  2HTM E;  1RM6 C;  4ICV A;  2IGH A;  1Q1O A;  4XC2 A;  2KDM A;  3V60 A;  2CKH B;  2GBN A;  4N58 A;  2WNM A;  4DHJ B;  3IT4 B;  4DDG D;  3R66 C;  2L7R A;  3L54 A;  2Y5B B;  5TR5 A;  1JRU A;  3TEX A;  1JRP A;  1I4Q A;  2M56 B;  3PRZ A;  3PSE B;  4RM9 A;  1TS3 A;  1I4G A;  1T6B X;  1ZDX A;  4GN1 A;  1J7A A;  4B9K A;  2FUH B;  2WXQ A;  2QIE B;  5FR6 A;  1TKY A;  3Q3O C;  3PZ7 A;  4IKG A;  4B6W A;  2QSD A;  2H88 B;  5KHQ A;  3HVD A;  2BBC A;  2ZZP B;  1L0V B;  2DNF A;  4A9A A;  1WRI A;  1FRD A;  2WX0 A;  2V4I B;  3Q14 C;  2L52 A;  3U4E G;  3CSF A;  4A20 A;  2RPV A;  1FXA A;  4GU2 A;  1CMX B;  4AWJ A;  1GC7 A;  3HK0 A;  4YSY B;  1IBX B;  3Q8C A;  1D6E C;  1RLF A;  4IM3 A;  3UQB A;  3OLM D;  3PS6 A;  2AQ2 B;  2JZZ A;  3U7Z A;  1JWS D;  1V1P B;  3RMK C;  2KJR A;  4LK0 M;  2OJW A;  2L3Z A;  2N9L A;  2VH1 A;  4KSL C;  4WIP A;  2WDR B;  1TS4 A;  3J9C A;  3TMP B;  3H7P A;  3DCG A;  2HDE A;  2Y5P A;  1ZOY B;  4FHJ A;  3BVM A;  4DDI D;  1WWT A;  4C4V A;  3M62 B;  2K8C A;  3Q8A A;  3N32 A;  2V0G A;  3GZN I;  1WRD B;  4ZRP A;  3GZN B;  3ZNG C;  2FCN A;  3WCQ A;  4OZC A;  3MC8 A;  2ZVO A;  3MTN B;  2DZI A;  1JWA D;  2JUO A;  2BKR B;  3R7Q A;  2AEH A;  1JAL A;  4HK2 A;  4EE2 A;  3N20 C;  5FR3 A;  2D3C A;  4MM3 A;  4PYZ A;  2BB5 A;  2MSE D;  5IA7 A;  2D3G A;  4LDT D;  5G5H A;  2FID A;  2KDB A;  3R3M A;  2J7Q B;  4FAD A;  2Z0E B;  4TV3 A;  3AEB B;  1FCC C;  2GI9 A;  2RMM A;  3C0R B;  1DOX A;  3RNA C;  1C78 A;  2KHW B;  1ACC A;  2LGY A;  4MH0 E;  4W9F A;  2LGI A;  2PEA A;  3QX1 A;  3BVZ A;  1QF6 A;  2WXN A;  2J52 A;  3KQ4 A;  3QHT A;  4NJ6 A;  1UUP A;  4IOI E;  1FNW A;  2J0K A;  1OGW A;  1ET9 A;  2AQ3 B;  1RYJ A;  3JSV B;  5BMI A;  4Q2J A;  1WJN A;  2PE6 B;  1EU3 A;  2EEL A;  2LUM A;  5IN7 A;  5E6P A;  1KLG D;  5FK9 C;  3ZLZ A;  3ZJT A;  4A55 A;  4BKS A;  2WXG A;  3JW0 X;  2N0S B;  4NJ7 A;  1V5T A;  4JPS A;  2KTF A;  2ZPN A;  2M1M A;  3DBR I;  3PHW B;  4M8M A;  3DBR B;  3DWG C;  4XGA B;  1T0Y A;  3V62 A;  1F2R C;  2FE8 A;  4KDL B;  2MBB B;  2C7M B;  1UH6 A;  3DBS A;  1E7P B;  2KN4 A;  3GOE A;  1FFV A;  2IDY A;  4REZ A;  4BFR A;  3Q3F A;  2KN5 A;  4H2A A;  3N30 A;  2KMC A;  1P7F A;  2ZVN A;  1HQR D;  2LEK A;  4MGZ E;  2JT4 B;  2KZR A;  4DBG A;  2KFK B;  3BYY B;  2W54 A;  1N61 A;  1ZKH A;  1V97 A;  3AE2 B;  2DYB A;  3ONS A;  4II3 B;  1C79 A;  3W1S A;  4B0E A;  1J7B A;  2G4S A;  4GSW A;  4HJK A;  3ZRF A;  1PDX A;  3ZIM A;  4C00 A;  4L2Y A;  1OFF A;  5MPO A;  1P1A A;  2NPT A;  2JSV X;  2RDB C;  1UEL A;  2V4L A;  3R2I A;  4WWO A;  2JWU A;  2XNA C;  1C4A A;  2NTS A;  4KDI C;  3RNG C;  1K52 A;  4W9L A;  3RFZ B;  1ZW7 A;  1WYG A;  1PQS A;  1GB1 A;  5AEK B;  3RNC C;  2CU3 A;  2LGD A;  1L4D B;  3A1Q A;  3UGB B;  3MHZ A;  1XCQ L;  1Z2M A;  2OHF A;  3EFU A;  3NZU A;  4JX1 C;  3VTV A;  3W1Y A;  1V49 A;  2J0M A;  2WXF A;  4GDK A;  3VUX A;  5C23 A;  2EMS A;  3PV1 A;  1IGC A;  1WYW B;  3GP7 A;  3P1M A;  1MI0 A;  3B0A A;  4FJY A;  4K7U A;  5AZH A;  3L08 A;  5D6J B;  3AE6 B;  1ZDV A;  4W9I A;  2KAJ A;  3AU5 A;  1SGH A;  1PUT A;  3QIJ A;  2GBJ A;  3CMM B;  3U8Z A;  2B76 B;  1XLP A;  3CST A;  3KWV A;  3IHP C;  1J8C A;  1NYQ A;  5D94 A;  2AYO B;  2KFJ A;  3L0W B;  3Q6B A;  4FBJ B;  2DWQ A;  2E6X A;  3SU8 X;  3ZUN A;  4K3C A;  4F1S A;  3P4P B;  5IOI A;  5D7G A;  4MSM B;  3H9D A;  4EOY A;  1S3S G;  2MBO A;  1TY0 A;  1V9J A;  2WLB A;  1C4P A;  2CHW A;  2N9E B;  2WXO A;  1FEH A;  3OJ4 B;  4TUU A;  2VH2 A;  4PS7 A;  1YIW A;  4IWQ A;  2WXL A;  3P2B A;  4LDT B;  5BMG A;  3A33 B;  1ZUD 2;  5GMV A;  2LMC A;  1E10 A;  3BK1 A;  2INC C;  2N4F A;  1E8X A;  3VH3 B;  2W3R A;  5AZG A;  2PVO D;  4XZ4 A;  4ANV A;  4EZL A;  3TL5 A;  3RUL A;  1HZ6 A;  2DZK A;  2LD9 A;  2RDG A;  1F2R I;  2K1F A;  4K7W A;  3BWU D;  3VHT C;  4TSS A;  4NY0 A;  3UF8 A;  1QT9 A;  3AM9 A;  2UWQ A;  2JF5 A;  1AN8 A;  2BTE A;  2WS3 B;  4LNN A;  1I4H A;  2N9P C;  2YLM A;  5H92 C;  3ZJU A;  4ITK A;  4W9G A;  3ZNH B;  4BKT A;  1U4A A;  4WJP A;  3WAO A;  2BYF A;  1STE A;  3AMZ A;  1V1P A;  2KTR A;  4US8 A;  2GBM A;  1WXM A;  4I6P A;  1YQ4 B;  4LNF A;  2R2O A;  2HE7 A;  2MWS B;  3AED B;  1N6Z A;  2YEP F;  2FNJ B;  2L8J A;  5J17 A;  5G55 A;  2Y3A A;  4ZRQ A;  2WYQ A;  2QCZ A;  1UGM A;  5D3I B;  5C2T B;  1XD3 B;  1WM2 A;  4LTU A;  2XK5 B;  2GRI A;  2IZV B;  2D07 B;  1F0Z A;  1H4R A;  2ZNV C;  3WIM A;  2BYV E;  2AL3 A;  2QEJ C;  2WXM A;  4ZOH C;  2O6V D;  3HUI A;  4GOC A;  1V2Y A;  1WF9 A;  1YJ1 A;  1SBB B;  4OW0 A;  1XF5 L;  1E7U A;  2NMQ A;  3APD A;  4ACF A;  4C7Y A;  1JWU D;  1PYW D;  2DAJ A;  4K1R B;  3JVZ X;  3EGR A;  3RCZ A;  3C8Y A;  2NR2 A;  1EO6 A;  4M02 A;  2V3S A;  3V05 A;  4YSZ B;  4JL9 A;  2A5U A;  1S1Q B;  3LB8 C;  1J0G A;  4GDL B;  1HZ5 A;  1WJ6 A;  2GB1 A;  1ENF A;  1GG3 A;  3P4S B;  1SJH D;  3H8H A;  3BVG A;  3N1Z C;  4GB9 A;  4HEA 1;  1P7E A;  4TQ0 A;  3HVZ A;  2RDH A;  3E56 A;  4KV2 A;  4S0R A;  2LHD A;  3Q8F A;  1VR9 A;  5BMH A;  1BUI C;  4OVZ A;  4RGO S;  1F52 A;  4DWF A;  2JU6 X;  2SEB D;  1WGD A;  3SR6 A;  1E6E B;  1FNU A;  1QLB B;  1CQV A;  2N9X A;  4PS8 A;  3WAL A;  1RAX A;  3NVZ A;  1L5P A;  4RGT A;  3URY A;  3JSV A;  2KXJ A;  1SXT A;  2CHX A;  2V1Y A;  2RD0 A;  3DDC B;  1V5O A;  4M0W B;  4WUR A;  2IO3 B;  4G3X B;  3CWI A;  2DYM A;  4FUL A;  1TGZ B;  1G6J A;  3V61 A;  2BT6 A;  1YOV B;  4UDU C;  4OZB A;  3R7R A;  1HTO A;  3AH7 A;  5J18 A;  4N6E B;  4OZA A;  4A3O A;  3BZD B;  2IND C;  2JY6 A;  3I5J C;  4JGH B;  4MGK E;  1TT5 B;  1EWY C;  2QDF A;  2LJ5 A;  4IG7 B;  3ZGZ A;  3L13 A;  1FMA D;  2LI5 A;  3P42 A;  2KMM A;  3VRB B;  5IO9 A;  1GAQ B;  4MH8 A;  1KOT A;  4WH4 A;  2LXA A;  4BVU C;  1QKZ A;  5I4D A;  2YVC A;  2MP2 B;  3Q8E A;  3C19 A;  5CHW A;  2MBE A;  4DQO C;  2BKF A;  1TS5 A;  4RF1 A;  5JXV A;  2FUG 1;  1E9M A;  1OQR A;  2O2V B;  2BB6 A;  4US9 A;  4ZRK A;  3NVY A;  4KSK C;  3SHQ A;  2ZW0 A;  4IWO A;  3H1U A;  1J7C A;  2LHE A;  3GE3 C;  1NEK B;  2WU5 B;  4HXD A;  4YTM B;  3U2S C;  1HTQ A;  2H89 B;  1TJE A;  2AL6 A;  2BPS A;  2BYE A;  5LLI A;  2KX3 A;  4IM2 A;  3ZNZ B;  1UF0 A;  3SFE B;  4DXF A;  1DGJ A;  2K6D B;  2MRP A;  3UIP B;  1ISN A;  2L76 A;  2D11 A;  1I35 A;  3L4P A;  3ZKJ C;  4II2 B;  5DPS A;  1QOB A;  1QZE A;  3AEE B;  3P4R B;  3EEC A;  1IUE A;  3HM3 A;  1IGD A;  1N63 A;  3DBH I;  3DHI C;  1WGR A;  2X8X X;  1VCB A;  3KYD D;  3DBH B;  3ZDM C;  4TQ1 A;  3AE8 B;  4NAW B;  2E3T A;  2IGG A;  1SF0 A;  1HA5 A;  2D3B A;  2ZW1 A;  2NBU A;  1V81 A;  5BYR A;  4ZYN A;  5JHB A;  1NI2 A;  3A9J B;  3UI3 A;  3GS2 A;  3NZ3 A;  4HRO A;  3SD5 A;  3IFW B;  3MC0 B;  3SDL C;  3PGE A;  2ZPY A;  2WXP A;  4HDQ A;  4IUM B;  5HKH A;  3AEA B;  5GXG B;  4MAC A;  4ARI A;  1N60 A;  2KDE B;  4I6L B;  4GMV A;  1KJT A;  1MFW A;  2HTH A;  4G0N B;  3VRA B;  1CZP A;  1YJI A;  4XE0 A;  4D2K A;  4M8N A;  2KVR A;  3M63 B;  4GXB A;  2V9H A;  2XN9 C;  4HPP A;  4AQ7 A;  2IPK D;  1Q10 A;  5EE1 A;  1WR1 A;  2M0A A;  3RZW C;  1VLB A;  3KUD B;  1WJ4 A;  4LCD E;  1A70 A;  2WXK A;  3LJ3 A;  1WM3 A;  4MEL A;  1QOG A;  2NS5 A;  2DEN B;  3ZQ4 A;  4BKS D;  2KOX A;  1SIJ A;  2WXR A;  3MJ5 A;  4P6V F;  1HXY D;  1ESF A;  4WWM A;  2AQ1 B;  2W82 A;  2ONQ A;  2N7E A;  4W9J A;  3AN1 A;  5IKC M;  4JE3 B;  2WDT B;  4OVV A;  2KWD A;  2PLP A;  2KWU B;  1RFK A;  2KJH B;  2PVG C;  4EUT A;  3AEC B;  1WH3 A;  2KLC A;  5LXH A;  3BK2 A;  4B95 A;  4AJY B;  4IDI A;  3W5U B;  2FCM A;  2L83 A;  2MBQ A;  2DZJ A;  1N5X A;  1AW7 A;  4NZL B;  1XLO A;  1XO3 A;  3KUC B;  4YSX B;  2CHZ A;  2MJE A;  2DX5 B;  1LFD A;  3ML9 A;  5EE0 A;  4AP4 C;  4BBN F;  1WMH B;  4AOF A;  1NEN B;  2BS2 B;  4RNA A;  1KF6 B;  1QOA A;  1R4M I;  4I6N B;  2PJH A;  1R4M B;  1WZ3 A;  2G1E A;  3I63 C;  4ANU A;  1E0Z A;  2QMT A;  4BZA A;  4ANX A;  2CU1 A;  3TCA A;  1VD2 A;  2FIF A;  2JZP A;  1CK1 A;  3AUL A;  1VJK A;  1AYF A;  1I4P A;  3VAW A;  5L83 A;  4A90 A;  5C1Z A;  2K22 A;  1NI3 A;  2M19 A;  2G45 B;  3I9V 1;  1E5W A;  3ZTC A;  3TJP A;  2ZJD A;  4AJW A;  1YN4 A;  2NBV B;  3APF A;  3R2T A;  1TKG A;  2AX5 A;  1PFD A;  1VZ8 A;  2R61 A;  1ZXH A;  1L7Y A;  1NDD A;  5EE3 A;  1DYQ A;  1D4B A;  3AE5 B;  2Y5C A;  1I42 A;  2C5L C;  2L0F A;  2N9K A;  4YTN B;  1OQQ A;  3ABV B;  3RZF A;  2INN E;  2NVU I;  2ZEQ A;  4GDL A;  3ZXV A;  3PRM B;  3W1S C;  4EEW A;  4EZK A;  2NBW B;  3QQ8 B;  1J19 A;  3VXW A;  3A4R A;  2WP9 B;  4RMA A;  4KIK A;  2ASQ A;  1P3Q U;  2PIA A;  1L6U A;  5CTR C;  2KC1 A;  1V1O A;  3NUH B;  4XWT A;  1N5W A;  1GPX A;  2DLB A;  2DBY A;  2PTL A;  4RM8 A;  4L1B A;  4W9K A;  3N1X C;  4OVU A;  2CS4 A;  3AE7 B;  1R7S A;  2PW9 A;  1LGR A;  3H7P B;  4KX6 B;  4G11 A;  2HD5 B;  1L0Y B;  4RF0 A;  1N62 A;  1T3Q A;  2KD0 A;  5HG2 A;  3W9C B;  4A6Q A;  1IPG A;  1YN5 A;  4C4V B;  2LWP A;  2LRW A;  3A4S C;  4KKJ A;  4LNK A;  2BGF A;  3VTW A;  4HVB A;  4FXC A;  4W9C A;  5CX3 A;  3T9L A;  4M0W A;  1SE4 A;  3EUB 2;  3UQA A;  3Q69 A;  3FC4 A;  3M95 A;  4K81 A;  5DPR A;  4ZRJ A;  4RH6 A;  3VVW B;  2K25 A;  4IC7 B;  1MG4 A;  3WAN A;  2WXI A;  2DYO A;  2V3N A;  3W5V B;  4PS3 A;  4MM3 B;  3FKY A;  4E3C A;  3DVG Y;  5JH5 C;  1WGG A;  4WWP A;  2QIL A;  4X57 B;  1E90 A;  1C4C A;  2JRH A;  3DHG C;  1KM7 A;  3TBL D;  5AUK A;  2KLG A;  1BML C;  2JPH A;  3APC A;  1YD8 U;  2BYT A;  1YQ3 B;  2QHO A;  1FXT B;  2WDV B;  1XCT L;  2MP2 A;  4E71 A;  2JZ3 B;  4XYC A;  2M8S A;  3A9K B;  2GBK A;  2O2V A;  3RYT A;  1K50 A;  2V3P A;  2R2Q A;  4BOZ B;  1XEE A;  2K8B A;  2K3U A;  4MEM A;  1MHH E;  1KTK A;  3KVF B;  4ZHP A;  3VDZ A;  4JLC A;  3Q2A C;  3K9O B;  2BVC A;  3DHH C;  1WZ0 A;  1WJU A;  4CQN A;  3ZRC A;  2L05 A;  3QWZ B;  1WXA A;  1VZ6 A;  4AS1 A;  3V3X A;  2XEW A;  1JW9 D;  2WHI A;  4NJC A;  2BS3 B;  2JYT A;  3KLS X;  3NOB A;  1ROE A;  1UBI A;  2K6Q A;  4NQK E;  3Q3M C;  1IBX A;  5BYS A;  2DAF A;  4FA6 A;  3U30 A;  3MJW A;  2KDF B;  2LFI A;  1FD6 A;  1QOF A;  2VZK D;  3VR8 B;  3AB5 A; 
#chains in the Genus database with same CATH homology
 3JYU A;  4A3P A;  2LJ5 A;  4IG7 B;  3IVF A;  3C0R B;  4JIO U;  3L13 A;  2LI5 A;  4FHK A;  3ZVV A;  1OTR B;  1KOT A;  3VQI A;  2KHW B;  2LXA A;  2K39 A;  4BVU C;  1E8Y A;  1WX8 A;  2HJ8 A;  2LGY A;  4J6I A;  2YVC A;  4MH0 E;  3ZTD A;  2MBH A;  4FJV B;  2MP2 B;  1WY8 A;  4W9F A;  5CHW A;  2MBE A;  5JZE B;  1LM8 B;  2BKF A;  1WX9 A;  2A4Z A;  2PEA A;  3QX1 A;  2IBI B;  2O2V B;  4PYU A;  5E6N A;  3EHV A;  4NAW A;  3DVG X;  1Y8R C;  4ZRK A;  3KUZ A;  3QHT A;  4NJ6 A;  1E8Z A;  3NY5 A;  4KSK C;  2J0K A;  2CR5 A;  1OGW A;  3SHQ A;  4MJS B;  4W9D A;  2MCN B;  4IWO A;  1OEY A;  2C9W B;  3H1U A;  3H7S A;  3JSV B;  4LJP B;  2LVQ A;  3VUW A;  4ICU A;  4DHJ D;  2FCS A;  1WJN A;  2EKE C;  2PE6 B;  3QJZ A;  4HXD A;  2XBB C;  4GIV A;  5E6P A;  2KX0 A;  2J0J A;  2BYE A;  2AL6 A;  2BPS A;  1WE6 A;  2IY0 B;  2KAN A;  5LLI A;  3ZLZ A;  2KX3 A;  4IM2 A;  4JQW C;  4BKS A;  3ZNZ B;  1IP9 A;  3JW0 X;  4NJ7 A;  1GJZ A;  1V5T A;  2GMI C;  2K6D B;  2MRP A;  3AI5 A;  3UIP B;  4EZJ A;  1ISN A;  1WIA A;  2L76 A;  2D11 A;  1I35 A;  1EF1 A;  2KTF A;  2ZPN A;  2M1M A;  3ZKJ C;  2N7D A;  4II2 B;  3B1L X;  3DBR I;  4HPL B;  3PHW B;  5JHA A;  4M8M A;  4YL8 A;  4CYE A;  1T0Y A;  5DPS A;  3V62 A;  1QZE A;  4KDL B;  2MBB B;  2KK8 A;  1E8W A;  2C7M B;  1UH6 A;  3EEC A;  3T8M A;  4URK A;  3DBS A;  2M0X A;  1C3T A;  1C1Y B;  3GOE A;  1X1M A;  3EC8 A;  3HM3 A;  4BFR A;  1R4N I;  3Q3F A;  3DBH I;  2KN5 A;  1WGR A;  3N30 A;  3QAQ A;  1VCB A;  3KYD D;  3ZW3 A;  1UD7 A;  2KMC A;  2IYD B;  4TQ1 A;  3ZDM C;  2I1J A;  2ZVN A;  3BY4 B;  4HPM B;  4NAW B;  2RPQ A;  4EKU A;  3L17 A;  4HCP B;  4MGZ E;  2JT4 B;  2KZR A;  2BWE S;  4DBG A;  2UYZ B;  2KFK B;  2WWZ A;  1GC6 A;  4NPN A;  2G3Q B;  2NBU A;  3RT3 B;  3IG3 A;  1V81 A;  1L2N A;  4ZYN A;  5JHB A;  1NI2 A;  3A9J B;  4GDK B;  1ZKH A;  1UZX B;  2ZCB A;  1OEY J;  2DYB A;  3SD5 A;  4ZDV A;  3CF6 E;  3ONS A;  4IWP A;  1RFA A;  3IFW B;  4II3 B;  3W1S A;  2BF8 B;  2IO0 B;  2LXC A;  3SDL C;  1EUV B;  2G4S A;  2KNB A;  3N3K B;  4GSW A;  4HJK A;  3PGE A;  3X0W A;  3AXC A;  1WXS A;  3ZRF A;  3DBL I;  4F8C B;  2ZPY A;  4G50 A;  3ZIM A;  4HDQ A;  4IUM B;  5HKH A;  2D10 A;  2LRU A;  3AU4 A;  2IY1 B;  4WJQ A;  4KZC A;  2KQ7 A;  3DVN V;  1P1A A;  3U7D A;  2NPT A;  2FAZ A;  2KDE B;  4I6L B;  4CO7 A;  4GMV A;  1UEL A;  1KJT A;  2C60 A;  2V4L A;  2HTH A;  4G0N B;  4WWO A;  3QAR A;  4WJO A;  4KDI C;  4W9L A;  5CHV C;  5D2M B;  1ZW7 A;  4HDO A;  4M8N A;  1PQS A;  2NCN A;  2KVR A;  3M63 B;  4GXB A;  1GUA B;  4K7S A;  3WAP A;  5G2N A;  5AEK B;  1SIF A;  1WXV A;  3PZD A;  3RUI B;  2FCQ A;  1V80 A;  2LGD A;  3PRP B;  3DQV A;  2MX2 A;  1LXD A;  4W9E A;  3RZW C;  1WR1 A;  2KWC A;  3KUD B;  1WJ4 A;  3A1Q A;  4LCD E;  3ZNI D;  3LJ3 A;  2IO2 B;  4WJN A;  3UGB B;  1V6E A;  1WM3 A;  2KJ6 A;  1BT0 A;  1WGY A;  1Z2M A;  2NS5 A;  3L10 B;  4MEL A;  1WX7 A;  2DEN B;  3EFU A;  3NZU A;  3DPD A;  4GGQ A;  4BKS D;  5DPW A;  2KOX A;  3VTV A;  2KFK A;  2KMA A;  1WR6 E;  1F9J A;  3W1Y A;  1V49 A;  2KC2 A;  2J0M A;  3RD2 A;  4XX5 A;  3A9J A;  4GDK A;  2MW5 A;  3VUX A;  5C23 A;  2EMS A;  3V6E B;  2N7E A;  1P9D U;  2OOB B;  2C7N B;  3QCA A;  4W9J A;  3PV1 A;  4F7Z A;  2MLB A;  2JWZ A;  1WYW B;  1H8C A;  2WDT B;  4OVV A;  2MA9 B;  2Z59 B;  3O65 B;  3OJ3 A;  2KWU B;  5IAA C;  2KJH B;  4EUT A;  1XQQ A;  3B0A A;  2LGX A;  4FJY A;  3PVL A;  4K7U A;  5AZH A;  3L08 A;  5D6J B;  1WH3 A;  2KLC A;  3HM6 X;  5LXH A;  5BO4 B;  4W9I A;  2N1W A;  2VRR B;  4AJY B;  3S2A A;  2KDI A;  3AU5 A;  4B95 A;  2FCM A;  2MBQ A;  1SGH A;  2DZJ A;  2G4D B;  3IBE A;  3QIJ A;  3ZDT A;  2GBJ A;  3WAM A;  3CMM B;  4MSQ B;  3U8Z A;  4ANW A;  1P0R A;  2NPT B;  3OAW A;  4IW0 A;  1D3Z A;  1WFY A;  3KUC B;  4LJO B;  4HCN B;  2CHZ A;  3CST A;  5DCN A;  1TZ1 A;  2GBR A;  3BIN A;  1NBF C;  2DX5 B;  2L0T A;  2O6V A;  3IHP C;  3PRE A;  1J8C A;  1LFD A;  3ML9 A;  5L95 C;  3M3J A;  4AP4 C;  2LUE A;  1WMH B;  3MHS D;  5D94 A;  4BBN F;  1RRB A;  2AYO B;  5EDS A;  4AOF A;  2KFJ A;  3L0W B;  2C7H A;  2PE9 A;  2JRI B;  2ZNV B;  4FBJ B;  2ZCC A;  3L16 A;  3SU8 X;  2LZ6 A;  3UIO B;  2OJR A;  2KO3 A;  2JXX A;  3ZUN A;  1R4M I;  4I6N B;  5E6O A;  1TBE A;  4F1S A;  2PJH A;  5LXI B;  3B08 A;  1WZ3 A;  1YQB A;  2IO1 B;  1P98 A;  5D7G A;  4MSM B;  4P7I A;  4ANU A;  1WE7 A;  3H9D A;  2MQJ A;  4EOY A;  4WQO B;  1A5R A;  1S3S G;  2MBO A;  4NQL B;  2CU1 A;  4BOS C;  4ANX A;  1V9J A;  4FN2 A;  2KTR B;  4KIK B;  4WWN A;  3TCA A;  1V86 A;  3A1Q B;  5J2R A;  2JVC A;  1VD2 A;  2FIF A;  3LDZ E;  5KHO A;  2RSU A;  2CHW A;  3AUL A;  2LVO A;  2N9E B;  1UBQ A;  3KH0 A;  3WA0 A;  3VAW A;  3OJ4 B;  4TUU A;  5L83 A;  1YX6 B;  5C1Z A;  4PS7 A;  1YIW A;  2EMT A;  2KQS A;  4IWQ A;  1Q5W B;  3P2B A;  4LDT B;  3D32 A;  3A33 B;  1GNU A;  4BBN C;  2G45 B;  2M4N A;  1E5W A;  5GMV A;  4FLH A;  3ZTC A;  4MGY E;  3Q3J A;  3TJP A;  3NS8 A;  2D2Q A;  3PPA A;  4MDK E;  3ECI A;  2ZJD A;  2LVP A;  2N4F A;  3PHX B;  3VTU A;  1K8R B;  4AJW A;  2NBV B;  3APF A;  1AAR A;  1E8X A;  1MG8 A;  4NNJ B;  2KWV B;  5AZG A;  3VH3 B;  4XZ4 A;  3ZO5 B;  4ANV A;  5CHF A;  3ENE A;  4EZL A;  3TL5 A;  4W9H A;  1L7Y A;  1XT9 B;  2LD9 A;  1NDD A;  2DZK A;  3RUL A;  2K1F A;  4K7W A;  3H6N A;  1I42 A;  3VHT C;  2C5L C;  4NY0 A;  2L0F A;  2W9N A;  3UF8 A;  1Z5S B;  4DHZ E;  2UWQ A;  1WMH A;  3QA8 A;  2JF5 A;  3RZF A;  4MGI E;  4E74 A;  2LAS A;  2AWT A;  2NVU I;  2O6V B;  2PPH A;  1TTN A;  4HLE A;  2ZEQ A;  4GDL A;  2N9P C;  3PT2 B;  3PRM B;  4DK5 A;  2YLM A;  4ICV A;  1Q1O A;  1HE8 A;  4W9G A;  4XC2 A;  3W1S C;  3ZNH B;  4BKT A;  4EEW A;  4EZK A;  2KKC A;  2NBW B;  3HIZ A;  1J19 A;  1U4A A;  3QQ8 B;  3VXW A;  3A4R A;  4EFO A;  4WJP A;  3WAO A;  4HWI B;  2BYF A;  2CKH B;  2GBN A;  4KVG B;  3V60 A;  4RMA A;  4KIK A;  2KTR A;  2ASQ A;  2Z0D B;  4DHJ B;  1OQY A;  1P3Q U;  4KZ0 A;  2GBM A;  1WXM A;  2WX1 A;  3PTF C;  3R66 C;  4I6P A;  5CTR C;  4DDG D;  2L7R A;  2KC1 A;  3L54 A;  2R2O A;  2Y5B B;  5TR5 A;  1JRU A;  2HE7 A;  2MWS B;  3PRZ A;  3PSE B;  2FNJ B;  2L8J A;  5J17 A;  4RM9 A;  3PLV A;  4RM8 A;  4W9K A;  5G55 A;  2DHZ A;  2WYQ A;  4OVU A;  2CS4 A;  1SE9 A;  1UGM A;  3A9K A;  4GN1 A;  1XD3 B;  4B9K A;  1WM2 A;  3H7P B;  2XK5 B;  2IZV B;  2D07 B;  2FUH B;  1H4R A;  2ZNV C;  4G11 A;  3PLU A;  2BYV E;  2HD5 B;  5FR6 A;  3WIM A;  2AL3 A;  3K9P B;  1EF5 A;  2KD0 A;  2O6V D;  4GOC A;  4B6W A;  1IPG A;  1V2Y A;  1WF9 A;  1Q0W B;  2LWP A;  1YJ1 A;  2I1K A;  1WI0 A;  5KHQ A;  2LRW A;  3A4S C;  3VH4 B;  5AZF A;  3VTW A;  2BGF A;  2ZZP B;  4HVB A;  4W9C A;  5CX3 A;  3T9L A;  3ML8 A;  4CHK A;  3UQA A;  1E7U A;  3APD A;  3M95 A;  5DPT A;  2DAJ A;  2RGF A;  3ALB A;  4K1R B;  3VUY A;  2WX0 A;  4K81 A;  5DPR A;  4ZRJ A;  3JVZ X;  3CSF A;  4ASW C;  1IYF A;  3RCZ A;  2K25 A;  1YX5 B;  2K8H A;  3VVW B;  4A20 A;  4IC7 B;  2NR2 A;  1EO6 A;  3WAN A;  2V3S A;  2DYO A;  4GU2 A;  4PS3 A;  4JL9 A;  2A5U A;  4AUQ C;  1CMX B;  4TKN A;  1S1Q B;  4AWJ A;  1GC7 A;  4E3C A;  2L00 B;  3DVG Y;  1J0G A;  2M17 A;  4GDL B;  3HK0 A;  5JH5 C;  3VFK A;  1WGG A;  1WGH A;  1WJ6 A;  3I3T B;  1RLF A;  4IM3 A;  4WWP A;  3OLM D;  3UQB A;  4X57 B;  1GG3 A;  1E90 A;  3DVN U;  2JRH A;  4ZRI A;  3UIN B;  3PS6 A;  4WAA A;  2JZZ A;  1KM7 A;  4GB9 A;  3TBL D;  4N9F 4;  2KLG A;  1LQB A;  2KJR A;  2JPH A;  3APC A;  2L3Z A;  4KSL C;  4IM0 A;  1YD8 U;  2GOW A;  4TQ0 A;  3HHM A;  2QHO A;  3TIX A;  1FXT B;  4KV2 A;  3TMP B;  2MP2 A;  3NHE B;  3H7P A;  2XK5 A;  4E71 A;  4BKG A;  2JZ3 B;  3DCG A;  4DWF A;  1E7V A;  2M8S A;  3A9K B;  2GBK A;  2O2V A;  4FHJ A;  1WGD A;  4DDI D;  3RYT A;  3QC8 B;  2R2Q A;  2REX A;  3QK0 A;  1ZGU B;  4FJZ A;  4BOZ B;  2N9X A;  3M62 B;  2K8B A;  4PS8 A;  3WAL A;  4MEM A;  1RAX A;  2K8C A;  3N32 A;  3GZN I;  4MJS A;  3KVF B;  1M94 A;  1WRD B;  3KW5 B;  3ZNG C;  3JSV A;  3VDZ A;  2FCN A;  2KXJ A;  2CHX A;  2V1Y A;  4JLC A;  4DXA B;  2RD0 A;  3K9O B;  3DDC B;  2ZVO A;  1V5O A;  4M0W B;  4DHZ B;  1WZ0 A;  2B3A A;  2IO3 B;  1WJU A;  4G3X B;  3V6C B;  3MTN B;  2DZI A;  3ZRC A;  2L05 A;  3QWZ B;  2JUO A;  3NZS A;  1WXA A;  3X23 A;  2BKR B;  2DYM A;  4FUL A;  3R7Q A;  2RR9 A;  2XEW A;  2AEH A;  4HK2 A;  1TGZ B;  1G6J A;  3V61 A;  1KLV A;  2BWF A;  4MM3 A;  3NOB A;  4PYZ A;  1UBI A;  2MSE D;  3KYC D;  2K6Q A;  3R7R A;  5IA7 A;  4NQK E;  2D3G A;  4LDT D;  2KDB A;  2DAF A;  2FID A;  2J7Q B;  3R3M A;  5J18 A;  2N1V A;  4FAD A;  4FA6 A;  2Z0E B;  3U30 A;  4A3O A;  3MJW A;  2KDF B;  3DOW A;  4TV3 A;  2DZM A;  2JY6 A;  4JGH B;  4MGK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...