2O2VB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
total genus 22
structure length 82
sequence length 82
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2o2vB01
5IAAC 4DDGD 3ZNZB 4HVBA 3TIXA 2FIFA 1WM3A 2XEWA 4II3B 5C23A 5IA7A 3N30A 1VCBA 2DYOA 4EFOA 3ML9A 3R7QA 2RR9A 1I35A 4MGIE 5DPSA 3ZIMA 2MBEA 1LXDA 2EMSA 2JXXA 4NJ6A 1LFDA 1Q5WB 4EZJA 3APFA 5JHAA 3I3TB 2BWES 2JRHA 5J18A 4DHZB 2BWFA 2KWVB 2O2VA 2D11A 2NBVB 4XX5A 2XBBC 3RULA 4E3CA 2M17A 3WAOA 1JRUA 3O65B 4K7UA 4BKGA 2K6DB 4HDQA 4BBNC 3DQVA 3OLMD 2L7RA 2DX5B 3L17A 3KYCD 1WR6E 1YIWA 2JT4B 5D94A 4ZRJA 5TR5A 4B9KA 4RM8A 5J17A 3PRPB 1RAXA 1IPGA 3PPAA 4KDLB 2N9PC 3L08A 4AJWA 2KNBA 2LGYA 3PLVA 2CHXA 4E74A 2MSED 1WI0A 2BYFA 2MBOA 2AL6A 4GDLA 3VQIA 4E71A 3ONSA 1YD8U 1TZ1A 2IO0B 2JZZA 4LJOB 4DHZE 2D3GA 1GG3A 3A9KA 4ANVA 2PE9A 4DBGA 3V62A 1D3ZA 1SIFA 2LVPA 3AU5A 3JW0X 3AI5A 2KX0A 4W9IA 2OJRA 4JQWC 2BYVE 2REXA 3QX1A 2AWTA 2MX2A 2LZ6A 1GUAB 2N9XA 2GBMA 2MWSB 4BKSD 2L00B 4AUQC 3QARA 4EOYA 2LRWA 1UGMA 4BOZB 1Q0WB 1QZEA 3PS6A 4P7IA 3ZO5B 2O2VB 1MG8A 3UIOB 2BGFA 2GBKA 1UELA 2KO3A 3GZNI 1WXMA 1P1AA 3OAWA 1RFAA 2GMIC 2JZ3B 2KVRA 3M62B 1WJUA 3QWZB 5AEKB 2IYDB 1BT0A 2BKRB 4K1RB 4TQ0A 4KSKC 2Z59B 1V9JA 4OVUA 2OOBB 4LDTB 3VFKA 1OQYA 5FR6A 3VHTC 5EDSA 4EKUA 5J2RA 1WF9A 2AYOB 2L3ZA 3VUYA 3DPDA 3QA8A 2KFJA 2KMAA 4JGHB 1GC6A 1Q1OA 2LWPA 2Z0EB 1K8RB 1E5WA 1V5TA 1KJTA 1H4RA 1L7YA 3QJZA 1V2YA 4GB9A 3SD5A 2RSUA 4KZCA 2DYMA 3BY4B 3A9KB 1A5RA 4DWFA 2HD5B 3R66C 5E6PA 2N9EB 3K9PB 2GBNA 1P9DU 3N32A 3JSVB 3KVFB 5HKHA 4M8MA 3VAWA 3U30A 2NR2A 3A4RA 2KDEB 2KC2A 5BO4B 3DVGX 4EZLA 4HWIB 3KUDB 1E8WA 4HCNB 2R2QA 1ISNA 3UQAA 1IYFA 2N4FA 5LLIA 2L0FA 1WRDB 1WM2A 3NOBA 2FUHB 4MELA 5D7GA 3IVFA 2ZVOA 3LDZE 4NQLB 1S3SG 4B6WA 3VUWA 3SDLC 2KANA 5JZEB 2ZPYA 4MJSB 4MM3A 3PGEA 2D2QA 5E6OA 4GMVA 3S2AA 4ZRIA 3V6CB 1H8CA 2M0XA 2V3SA 3B0AA 4G3XB 4K7SA 4AJYB 3LJ3A 4N9F4 4WJNA 2UWQA 4F7ZA 2ZZPB 3DVGY 2FAZA 3L13A 3EHVA 4BVUC 4HPMB 4W9HA 3APCA 3AU4A 2PJHA 3H7SA 4FJZA 4GDKB 4HPLB 4WWOA 3KYDD 3ZLZA 2D10A 3DBSA 2IBIB 1YX5B 1YX6B 2JF5A 2JY6A 3PHXB 3VVWB 2IY1B 3WANA 1TGZB 1KOTA 2AL3A 4A20A 5C1ZA 4FBJB 1WIAA 4KIKA 2KC1A 1R4NI 4IM0A 1WY8A 2KOXA 2KX3A 3UGBB 3RT3B 1R4MI 3PVLA 3DVNU 3W1SC 1J8CA 4ZDVA 1WE7A 3PRZA 4W9JA 4KSLC 2KFKA 3HK0A 1C3TA 1EUVB 3AXCA 4DHJB 2R2OA 4FHJA 4IWPA 3L54A 2A5UA 1S1QB 2NS5A 4NJ7A 3ZUNA 5L95C 1P3QU 2IY0B 2AEHA 4BKTA 4FADA 4GOCA 1EO6A 4ASWC 2J0KA 3H7PA 4PS7A 3JSVA 4KV2A 2ZNVC 4I6PA 3V6EB 4BKSA 2LGDA 1E90A 2LASA 3P2BA 3A1QA 1RRBA 5LXHA 2LI5A 2MP2B 4DDID 5CTRC 3VXWA 1FXTB 3QC8B 1WJNA 2FCQA 4JLCA 4MGYE 4NAWA 4MEMA 4G50A 1RLFA 2QHOA 5DPWA 4CO7A 3CSTA 4K7WA 3W1SA 3GOEA 4W9GA 1V80A 5D6JB 2Y5BB 3OJ4B 3ZTDA 4OVVA 2JPHA 3VH3B 2GBJA 2K6QA 2KDFB 4MJSA 4W9KA 5KHOA 2FCNA 4GSWA 2M1MA 5CHWA 1WGYA 5G2NA 1Z5SB 1TTNA 2L8JA 1P0RA 1V81A 1WX9A 4IG7B 4GGQA 3PLUA 4CHKA 1G6JA 1EF5A 2DAJA 3CSFA 2KMCA 4M0WB 4GDKA 2ZJDA 4AP4C 3RCZA 4NY0A 2RD0A 1WYWB 3B1LX 4NPNA 2WX0A 4GU2A 3NZUA 4EZKA 5DPRA 4FJYA 1WMHB 4AWJA 5DPTA 1LM8B 4II2B 1E7UA 3ZW3A 1P98A 3SU8X 1J0GA 4PS8A 2KTRA 3W1YA 3X23A 3T9LA 1YJ1A 2YVCA 3CMMB 4HLEA 2NPTA 2LD9A 3KH0A 2I1JA 2FCMA 2JVCA 5L83A 2MP2A 2ZCBA 4ZYNA 2KJ6A 4FULA 3Q3JA 3A4SC 2K1FA 2IO2B 2PE6B 3WAMA 1GJZA 4JIOU 4NAWB 2NBUA 1C1YB 2VRRB 1VD2A 2CHWA 3ML8A 1ZKHA 3K9OB 2MCNB 3DDCB 3H7PB 3DBRI 2K8BA 4KDIC 3IHPC 4M8NA 4BOSC 4WJQA 2LJ5A 3KW5B 3EC8A 3L10B 3UINB 3WIMA 3HHMA 4IWOA 3AULA 3EFUA 1XQQA 2FIDA 4IUMB 1WXSA 3ZVVA 1WE6A 1WXVA 4WAAA 3PRMB 1E8YA 2LVQA 3QK0A 4J6IA 2KQSA 3V61A 1XD3B 1GC7A 2MA9B 2G3QB 4ZRKA 1U4AA 3QHTA 1NBFC 2KLGA 1WJ4A 4WQOB 3IFWB 1UBQA 5CHVC 2MBHA 1F9JA 1PQSA 4ICVA 3TCAA 2NBWB 2I1KA 2C7HA 4HXDA 3NHEB 2K25A 2EKEC 2KTRB 4FLHA 2LRUA 4LDTD 3U7DA 3ZKJC 2KJRA 2RPQA 2IZVB 3SHQA 3WALA 3DOWA 2G45B 3JYUA 1X1MA 1SE9A 2KTFA 1L2NA 3A9JB 4HK2A 3RZWC 3UQBA 4DXAB 4F8CB 4MGKE 2PEAA 1WMHA 1YQBA 2KN5A 2CU1A 1OEYJ 2C7NB 3QAQA 4F1SA 3QIJA 4A3OA 4URKA 4FJVB 4WWNA 3QQ8B 4LJPB 2ASQA 2LXAA 4BBNF 4CYEA 2LXCA 1UZXB 1E8XA 2D07B 3L16A 1ZW7A 2DHZA 2L76A 2DZKA 3ENEA 2MBQA 2MW5A 4PYUA 2C7MB 2DZMA 2HTHA 2KHWB 1OTRB 2K39A 1WGRA 1E7VA 5JH5C 4IM3A 4I6LB 4MH0E 1CMXB 3VTUA 2DENB 1GNUA 1Y8RC 3L0WB 2O6VD 3PT2B 3H9DA 2XK5B 4G11A 2M8SA 1WX7A 2NVUI 3RZFA 2KWUB 5AZHA 4AOFA 3ZDTA 3A9JA 4NQKE 5AZGA 4YL8A 2J7QB 3RUIB 5JHBA 3ALBA 3IG3A 1T0YA 2G4SA 3WA0A 3NS8A 4FA6A 4HDOA 3ZRFA 2NCNA 4IM2A 3DCGA 2LVOA 2ZPNA 3Q3FA 4LCDE 4TV3A 4DK5A 2C60A 1WFYA 3A1QB 3ZNGC 5CX3A 1OEYA 2JUOA 3PHWB 4EEWA 1KM7A 2UYZB 2ZCCA 3HM6X 2N7DA 2CHZA 1M94A 1SGHA 2BF8B 5AZFA 4WJPA 2ZNVB 3RYTA 1KLVA 2C5LC 3U8ZA 2FCSA 4I6NB 2KDIA 3WAPA 2KD0A 3TMPB 1Z2MA 2G4DB 2O6VB 3APDA 3N3KB 4MDKE 2DZJA 3QCAA 5LXIB 1WGHA 4PYZA 2XK5A 3PREA 1V5OA 2MRPA 3MHSD 3ZNID 4XC2A 1WH3A 3VUXA 2WDTB 1WZ3A 3ZNHB 2LGXA 2LUEA 4MSMB 2GBRA 3PSEB 2WYQA 4FHKA 3UIPB 4WJOA 1XT9B 4ICUA 1V86A 2KWCA 2PPHA 4W9EA 2A4ZA 3HIZA 2J0JA 5KHQA 2MLBA 1V49A 4NNJB 1UBIA 3PTFC 1J19A 3M95A 1WJ6A 2MQJA 2KDBA 2L05A 2GOWA 3R7RA 4TQ1A 1TBEA 3BINA 3IBEA 2WWZA 1AARA 1EF1A 3RD2A 3H1UA 3CF6E 4MSQB 3DVNV 3VH4B 3V60A 1ZGUB 4KVGB 2V4LA 3DBHI 4K81A 2KK8A 3JVZX 2KLCA 2WX1A 5CHFA 2KQ7A 4XZ4A 2HJ8A 5G55A 3PZDA 2IO1B 3TL5A 5D2MB 1UH6A 2MBBB 2ZEQA 4ANUA 3D32A 4B95A 4FN2A 4HCPB 2V1YA 4HJKA 4ANXA 2NPTB 3OJ3A 2N7EA 1E8ZA 4X57B 4IW0A 3UF8A 3KUZA 2Z0DB 2BPSA 3KUCB 4MGZE 2CS4A 4TUUA 5E6NA 3C0RB 1I42A 1OGWA 1WXAA 2CKHB 2CR5A 2N1WA 4A3PA 1WGGA 3MTNB 2DZIA 2KXJA 4WWPA 2BYEA 2DYBA 4GXBA 1UD7A 1WZ0A 2HE7A 3NZSA 4RMAA 5GMVA 1WGDA 2O6VA 3X0WA 1WX8A 2L0TA 1IP9A 2EMTA 3ZTCA 2ZVNA 5DCNA 3T8MA 3H6NA 4JL9A 1NDDA 2KZRA 3ZDMC 2RGFA 3VTVA 2KKCA 2BKFA 2FNJB 4IC7B 3DBLI 4W9DA 4W9CA 3VDZA 2IO3B 4EUTA 4DHJD 3NY5A 4TKNA 3TJPA 4BFRA 2K8HA 3M63B 2KJHB 4W9LA 4GN1A 3M3JA 4ANWA 2K8CA 4KIKB 3TBLD 2N1VA 3B08A 2W9NA 3ECIA 1NI2A 4PS3A 2YLMA 4GIVA 2M4NA 3PV1A 3R3MA 4W9FA 2JRIB 2JWZA 2DAFA 4KZ0A 1LQBA 3HM3A 2B3AA 3A33B 3ZRCA 3EECA 1WR1A 4G0NB 4IWQA 3MJWA 4RM9A 1HE8A 1V6EA 2C9WB 4GDLB 2KFKB 3VTWA 2J0MA
chains in the Genus database with same CATH superfamily
3ZNZB 1ZDXA 2FIFA 2XEWA 1VCBA 1ZXHA 2QILA 2W55A 4AS1A 2EMSA 2JXXA 1UWXA 1ZUD2 1FM0D 1YN4A 2Z8LA 4S0RA 1OQRA 2NBVB 2M17A 4ACFA 3O65B 4CQNA 4BKGA 4HDQA 1WR6E 5TR5A 3PLVA 2CHXA 1SIJA 4E74A 2MSED 1SJED 2MBOA 2KVZA 1IBXB 3VQIA 1ESFA 1VZ8A 1TZ1A 3DWGC 4H2AA 3V62A 1D3ZA 2V3PA 1WSPA 2LVPA 3JW0X 2BYVE 2Y5PA 4HRSA 3ZJTA 4LK0M 2MX2A 1GUAB 4BKSD 4EOYA 1I4RA 2LRWA 3ZO5B 4P7IA 1MG8A 1AW7A 2KO3A 1UELA 1WXMA 3KLSX 3PZ8A 2GMIC 3IAM1 1WJUA 3P4SB 1JROA 4TQ0A 1EWYC 3AE6B 1OQYA 3W2DA 5J2RA 2M0AA 3VUYA 4C4VB 3V3XA 3DPDA 2KFJA 1GC6A 1Q1OA 4NPNA 1L7YA 1H4RA 1V2YA 4NZLB 1GB4A 2RSUA 5G5HA 4KZCA 3U7ZA 4DWFA 1E0ZA 2GBNA 3KWLA 3NJTA 3Q3OC 3VAWA 3U30A 1PYWD 3RN9C 1EU3A 2KC2A 1PGAA 2BBCA 2R2QA 1IYFA 2N4FA 4R3DA 3NOBA 1GOZA 3P4PB 2VZKD 4B6WA 1S3SG 2WP9B 2ZPYA 2QDFA 1H8CA 2D2QA 3S2AA 4G3XB 4K7SA 2JSVX 2UWQA 1ET6A 2LJIA 4BVUC 5GXGB 4HPMB 4W9HA 1TKYA 3APCA 4USAA 3TEWA 4WWOA 1ZE3D 3ZLZA 2D10A 3DBSA 2IBIB 2JY6A 2JF5A 3PHXB 2IY1B 1TGZB 1J7AA 1P7FA 4FBJB 4P1CC 3RT3B 3PVLA 3W1SC 1T6BX 2WU2B 2ACZB 4W9JA 4KSLC 1C3TA 2GB1A 4DHJB 4FHJA 2A5UA 1KFYB 3P63A 4FADA 4GOCA 4KV2A 4RFBA 2MJ3A 3A1QA 3R8BA 5CTRC 3TUOA 1ACCA 4NAWA 4G50A 3MC9A 4K7WA 3ZTDA 4W9GA 1J7CA 2Y5BB 3OJ4B 4OVVA 2JPHA 3VH3B 2GBJA 4IDIA 5EE9A 2FCNA 4GSWA 2M1MA 4OW0A 3RNFC 5CHWA 3MFGA 1XLPA 1TTNA 1P0RA 4IG7B 4YSYB 2KMCA 1IBXA 1I4XA 4GDKA 2ZJDA 2WXLA 3RCZA 4NY0A 1EWCA 1B9RA 4GU2A 5DPRA 4FJYA 1WMHB 5DPTA 1LM8B 1N6ZA 3W1YA 3T9LA 1KRHA 2KJ6A 4FULA 4MT5A 3A4SC 2IO2B 2KT7A 2PE6B 4NAWB 1FXIA 2NBUA 1L0VB 1ZKHA 4IKGA 3DBRI 4KDIC 4M8NA 4BOSC 1L6VA 3EFUA 3ABVB 2YEPB 1XQQA 4UDUC 5EE0A 2WHIA 3MC8A 4WAAA 2KQSA 1XD3B 1D5XC 4M0WA 1TKGA 1U4AA 4WQOB 2B76B 4YT0B 3IFWB 1F9JA 4LLGM 2NBWB 2C7HA 3GP7A 2E3TA 4LDTD 1FCLA 4MH8A 2IJ0A 3Q8CA 1L2NA 3A9JB 2LHEA 3NVWA 4F8CB 2JU6X 1QLBB 2WQYB 4MGKE 1YN5A 1YQBA 2KN5A 1Q10A 3QAQA 2BQQA 3QQ8B 2WXHA 2PW9A 2ASQA 4BBNF 2WU5B 1ZW7A 3CIRB 1EU4A 3DBRB 2C7MB 1JWMD 2DZMA 1OTRB 1E7VA 3R2IA 1ZP0B 4MH0E 1GNUA 2Y3AA 1NYRA 1DOIA 1LO5D 3L0WB 3H9DA 4G11A 1B1ZA 3RZFA 2KWUB 3ZDTA 1QOGA 1VZ7A 5AZGA 2N0SB 1JMLA 1K52A 1T0YA 3WA0A 2Y5CA 3I5JC 1I4PA 3DCGA 3ETRA 2LVOA 3NVVA 1XLQA 4LCDE 4DK5A 1XLOA 2HDEA 3PHWB 4D2KA 2RMMA 2W3RA 1KM7A 1DOXA 4WJPA 5HFYA 2EKIA 3TMPB 2G4DB 2O6VB 2DZJA 1E9MA 2LUMA 3PREA 3MHSD 2OHFA 1QF6A 1K53A 2LGXA 4KGTA 2GBRA 3UIPB 1VR9A 1XT9B 4A55A 2A4ZA 2MLBA 1WJ6A 1D5ZC 2BB6A 1TBEA 3BINA 2WWZA 1EF1A 2JXTA 1XF5L 1ZGUB 4KVGB 1JWUD 3JVZX 2WX1A 3TL5A 4LNKA 2ZEQA 1MHXA 3D32A 1V97A 2D3BA 3SFEB 1I42A 2CKHB 4L1BA 4P1BC 2KXJA 1UD7A 4RMAA 5GMVA 3HUIA 1WX8A 2L0TA 3I57A 3O13A 3ZTCA 3T8MA 3ZDMC 2RGFA 2WDVB 3AE9B 4W9DA 3VDZA 4EUTA 4DHJD 3DBHB 3TJPA 3M63B 4HKQA 3TEZA 2IGHA 2BYTA 2K8CA 1T3QA 3ECIA 4GIVA 4KZ0A 2B3AA 1FPYA 3MJWA 1V6EA 3MHZA 1N63A 2INCC 4HVBA 4OHJA 1WM3A 3R7QA 3ZJUA 2JWUA 1AWDA 3ZIMA 1LXDA 2LEKA 1LFDA 1ROEA 4NJ6A 5JHAA 2BWES 5J18A 2KWVB 1UF0A 2D11A 5IN7A 1SXTA 4E3CA 3WAOA 5D3DA 1JRUA 1BUIC 4BBNC 3DQVA 3OLMD 2L7RA 3L17A 5D94A 2MJDA 1YIWA 3C19A 1JRPA 4B9KA 2JYEA 3PRPB 1IPGA 3PPAA 4BAXA 4KDLB 2N9PC 3L08A 4AJWA 2FBWB 2BYFA 2AL6A 4GDLA 4E71A 3ONSA 1YD8U 4DHZE 1GG3A 4ANVA 1F0ZA 2PE9A 2ICIA 3AU5A 1IGCA 3AM9A 1NI3A 2GBMA 2MWSB 1UGMA 2M56B 2O2VB 3UIOB 2BGFA 2GBKA 3U4EG 5AUKA 5G5GA 3M62B 2IYDB 2Z59B 2OOBB 4LDTB 3VFKA 3VHTC 2AYOB 2L3ZA 3SR6A 4JGHB 2I2YA 2LWPA 1K8RB 1E5WA 4GB9A 3QJZA 4XDCA 2BT6A 2J42A 4P16A 4N59A 1A5RA 3R66C 3W5VB 5E6PA 2N9EB 1QKZA 5H92C 3N32A 3KVFB 1TY2A 2AQ1B 3NVYA 1R4NB 5BO4B 3DVGX 3KUDB 5BYSA 3DHIC 1WRDB 4Q2JA 2CJOA 3E9SA 2JYTA 2VH1A 3IVFA 4JE3B 3TSSA 4NQLB 1SSNA 3VUWA 2KANA 5E6OA 1FRDA 2NMQA 2V3SA 4AJYB 3LJ3A 4N9F4 4WJNA 1HA5A 2J4XA 2FAZA 3FILA 1C78A 4HPLB 3KYDD 1T5XD 1FCCC 1KOTA 3WANA 4WQMA 2AL3A 5C1ZA 1WIAA 2KC1A 1FNWA 1WY8A 3UGBB 1L6UA 4C4VA 4ZDVA 1KF6B 1C79A 3T3OA 1TY0A 2MHJA 4HJGE 1WGKA 3AXCA 3BYTB 2R2OA 4IWPA 2HJ1A 2NS5A 1WXQA 3J9CA 3ZUNA 4YSZB 1MI0A 5T8IA 1C4CA 4C7YA 4I6PA 2LGDA 1RYJA 4ZHOA 1XEEA 3BYYB 5LXHA 2LI5A 3TEYA 1FXTB 1TIFA 3QC8B 4JLCA 4MGYE 4MEMA 5DPWA 5D6JB 1T0RC 5KHOA 1C76A 5G2NA 1Z5SB 3SFDB 1G6JA 2GI9A 3ZJVA 1EF5A 2DAJA 4WAFA 1F2RC 2PTLA 4RGOS 3NZUA 1E6EB 3VR9B 4AWJA 4II2B 1E7UA 1P98A 4YTPB 4PS8A 1TJEA 2KTRA 3X23A 1V1PA 3B9JA 1YJ1A 2FE8A 2LMCA 3CMMB 4HLEA 3KH0A 1EM7A 2FCMA 2JVCA 1YNTE 2K1FA 1GJZA 2L32A 3RNGC 1C1YB 2LGSA 2VRRB 2CHWA 3ML8A 1YMHE 3VR8B 2LJ5A 3SEBA 1IUEA 5D3IB 4IUMB 3ZVVA 1WE6A 1WXVA 3QK0A 1E8YA 3OWEB 3ZXVA 2MA9B 2W82A 1HTOA 1WJ4A 5E6JA 2FUG1 1OFFA 1PQSA 4ICVA 4HXDA 3NHEB 1FD6A 2BS2B 3U7DA 2IZVB 3SHQA 3DOWA 2G45B 4YTNB 1R4MB 4OZBA 4RGTA 1GAQB 4KGRA 1OEYJ 2RDGA 3QIJA 4URKA 2BVCA 4LJPB 3WCQA 1YJIA 2DWQA 1FMAD 4RCOA 2L76A 3ENEA 1K51A 2MW5A 4PYUA 2KHWB 1PGBA 2K39A 2TSSA 4IM3A 1ZDVA 1YJJA 3VTUA 2DENB 2BW2A 3AECB 2JZPA 2D3CA 2WNMA 1I4HA 5H8YE 1OQQA 2G9HD 3W5UB 5AZHA 2K22A 3A9JA 4NQKE 4YL8A 5JHBA 3IG3A 3NS8A 4A8XC 4FA6A 1FRRA 3AN1A 4L2YA 2JX5A 4PT5A 2ZPNA 3ZNGC 5CX3A 1HTQA 1Y56A 2CHZA 2ZNVB 1JQ4A 2FCSA 3E56A 4I6NB 1XLNA 3WAPA 2KD0A 2L83A 1Z2MA 3APDA 3QCAA 1FNUA 5LXIB 5C3JB 1WGHA 4WURA 2XNAC 4XC2A 4WWMA 3VUXA 4XYCA 3ZNHB 3Q3NC 2W54A 4B0MA 4W9EA 1WRIA 3AV8A 1TT5B 1UBIA 1J19A 2MH7A 2MQJA 3R7RA 2GOWA 2KYWA 5BMGA 2IGDA 3IBEA 1AARA 3RD2A 3H1UA 2LGIA 4MSQB 2J52A 4K81A 1PUTA 3AH7A 4XZ4A 5G55A 5D2MB 1UH6A 4B95A 4QAYA 4HCPB 2GLSA 2NPTB 3OJ3A 3Q8EA 2CS4A 5E6NA 1HXYD 1KLUD 4C56C 2CR5A 1CJEA 4A3PA 4WWPA 2WXQA 2BYEA 1WGDA 1IP9A 4XWTA 1T0SC 1N5XA 3Q69A 2WXMA 3VTVA 2BKFA 3DBLI 2IO3B 1L0YB 5AUIA 4TKNA 1FXAA 4OZAA 1RWSA 4HKZE 4GN1A 1JWAD 2ZW0A 3DHHC 3M3JA 5C2TB 1CQVA 3R3MA 3PV1A 3ZRCA 4RF0A 4IWQA 3BVZA 2PLPA 3Q8BA 1HE8A 2WXPA 4GDLB 2KFKB 3TIXA 5C23A 3GZNB 5BYQA 3BK1A 1F52A 4MGIE 3RPFC 1QOAA 1Q5WB 4EZJA 3APFA 1CK1A 1E7PB 3I3TB 2JRHA 4JWSC 4XX5A 1ZOYB 4REZA 1K50A 3AEGB 1TKEA 3UI3A 3Q2AC 2K6DB 3EA6A 5I4DA 5TSSA 1QQRA 2J53A 2DX5B 2QEJC 3KYCD 2JT4B 4JPSA 4ZRJA 2AX5A 1XXGA 3HVZA 4RM8A 5J17A 2DLBA 3AEDB 1RAXA 2XN9C 1SEBD 4XGAB 2KNBA 2MEKA 2V4IB 1HEZE 1WI0A 4MACA 1MJDA 2IO0B 3AE3B 4LJOB 2SEBD 4DBGA 2L52A 2KX0A 4ARCA 4W9IA 4JQWC 2AWTA 2LZ6A 2N9XA 3BZDB 4AUQC 3QARA 1TZOA 1QZEA 1WWTA 3BIID 1MHHE 2QMTA 4ZHPA 5FKAC 2JZ3B 3QWZB 5AEKB 1BT0A 2BKRB 4K1RB 4KSKC 1V9JA 5FR6A 4EKUA 1WF9A 3QA8A 4B0EA 2Z0EB 3GE8C 1A70A 2DYMA 2WDQB 3BY4B 1ZXIA 3K9PB 4RGNA 3U2SC 1P9DU 3JSVB 2H88B 4DQOC 2NR2A 1VJKA 2KDEB 1I4GA 4HWIB 4LNFA 4HCNB 1I4QA 2L0FA 2LFIA 5LLIA 4XDDA 1C77A 4MELA 4ARIA 2ZVOA 2IPKD 3SDLC 4AQ7A 3AEFB 3Q8AA 4LTUA 4MJSB 4MM3A 3PGEA 4GMVA 4ZRIA 3H8HA 3B0AA 4XWWA 3CWIA 4F7ZA 2ZZPB 3DVGY 2N9LA 3EHVA 4YWGG 4FJZA 1PFDA 1YX5B 3VVWB 1QILA 1D6EC 1GPXA 1PDXA 2KX3A 1MVKA 3DVNU 2IGGA 4N58A 2SAKA 4ZRPA 1EUVB 2WXJA 3OG5A 1T0QC 2VZKB 2DBYA 5L95C 1P3QU 2IY0B 2AEHA 5EE3A 4ZOHC 1TS3A 2J0KA 3H7PA 4PS7A 1LGRA 4KKIA 4BKSA 4FXCA 4ZRQA 1E90A 1NEKB 3P2BA 1RRBA 3Q8FA 2QSDA 2PVGC 1WJNA 4O1NA 1UGJA 3U52E 1RLFA 2QHOA 4CO7A 3CSTA 3W1SA 1FNVA 3GOEA 3I9V1 4HPPA 2K6QA 4EE2A 4MJSA 5FK9C 1FIQA 3FAHA 1WX9A 3PLUA 4CHKA 3CSFA 4M0WB 1XCTL 2RD0A 1WYWB 1I7HA 5BYRA 2BS3B 4OVZA 5IO9A 3B2FA 1J0GA 4K3CA 4N6EB 2YVCA 2LHDA 2NPTA 2LD9A 2I1JA 2QCZA 2MP2A 3MP9A 4ZYNA 3Q3JA 2G1EA 2X38A 1KLGD 4JIOU 1XO3A 4PK1A 2K9XA 1N62A 2PIAA 3K9OB 4A9AA 2K8BA 2WLBA 3IHPC 3WIMA 3Q14C 4IWOA 4J6IA 3V61A 1GC7A 3AEEB 2G3QB 2WXGA 1NBFC 4TMAB 2MBHA 2ON8A 1F77A 2I1KA 1YQ3B 2K25A 2EKEC 2LRUA 3ZKJC 2KJRA 3GE3C 2RPQA 3WALA 1V8CA 3JYUA 1X1MA 4DXFA 3NS1A 1SE9A 2KTFA 1J7BA 4NJCA 2KMMA 2PEAA 1N61A 2CU1A 2C7NB 2R61A 4F1SA 3MJ5A 1ENFA 1AN8A 2LXAA 4CYEA 2D07B 1BXTA 3L16A 1JWBD 1SBBB 1C4AA 2DHZA 4KKJA 2DZKA 2KACA 2HTHA 2RDBC 1WGRA 3VRBB 4I6LB 3R2TA 2O6VD 3PT2B 2XK5B 1WX7A 5IKCM 4AOFA 1SJHD 3RI7C 3ALBA 1JWSD 4JX1C 3ZRFA 3B2GA 4IM2A 2IDYA 4TV3A 3AE2B 1JW9D 1SE2A 2JUOA 2N9KA 1TS5A 3N9YC 2UYZB 3HM6X 2N7DA 4LNIA 1M94A 2INDC 3RYTA 3U8ZA 2QC8A 1UUPA 2KDIA 2Q5WD 2QIEB 1NVID 2V3NA 3N3KB 4LNOA 1VDVA 2XK5A 1V5OA 2MRPA 3ZNID 1FFUA 1WZ3A 2LUEA 4MSMB 2WYQA 2WXIA 4ICUA 3VRAB 2KWCA 3DHGC 3W9CB 3DWMA 2I38A 3HIZA 3IT4B 3IAS1 1V49A 3PTFC 3M95A 3L4PA 5BMHA 4TQ1A 1L5PA 4S17A 4YXDB 1ZPSA 3C8YA 3VH4B 3DVNV 2L1AA 1GB1A 3DBHI 2KK8A 2KLCA 5CHFA 2AQ2B 2HJ8A 3PZDA 2IO1B 2MBBB 2D5GA 2INNE 4MM3B 3MC0B 2V1YA 3N1XC 4ANXA 3AE8B 4ZYSA 4X57B 1E8ZA 4IW0A 3UF8A 2Z0DB 4GLSC 2BPSA 4MGZE 3AE4B 1PGXA 3AE5B 3C0RB 5MPOA 2N1WA 2DZIA 4GXBA 1WZ0A 2HE7A 3NZSA 2O6VA 5FR3A 3ZXRA 1QT9A 2EMTA 1V1OA 2ZVNA 5DCNA 2K0PA 3H6NA 4JL9A 1NDDA 4BZAA 1L4ZB 1NYQA 2KKCA 1STEA 4W9CA 3NY5A 2KJHB 3P1MA 4ANWA 2N1VA 3B08A 2W9NA 1NI2A 4PS3A 1UNSA 4P6VF 2M4NA 1R7SA 2JRIB 2JWZA 1KH0A 1LQBA 3HM3A 3EECA 4G0NB 2PVOD 2J0MA 3BWUD 5IAAC 3KWVA 4DDGD 4II3B 5IA7A 5HG2A 3N30A 2DYOA 4EFOA 3ML9A 1DYQA 2RR9A 2BTEA 1I35A 4TSSA 5DPSA 2MBEA 1DGJA 1YQ4B 1AYFA 4DHZB 2BWFA 2O2VA 2XBBC 3RNBC 3RULA 4HROA 4J3OD 1XCQL 4M01A 4K7UA 3AMZA 1F1HA 2UU7A 1MFWA 3NVZA 2BB5A 3N20C 3ZQ4A 4YTMB 2W3SA 2LGYA 2K5PA 3Q3MC 1D4BA 3KQ4A 2JZZA 1UWMA 2D3GA 3A9KA 2WXNA 3RNEC 1HZ6A 1SIFA 3AI5A 2OJRA 2REXA 3QX1A 2L00B 1L4DB 3NRZA 4BOZB 1Q0WB 2X8XX 3PS6A 3IT6B 2WS3B 3GZNI 1P1AA 3OAWA 1RFAA 2KVRA 2ONQA 3TEXA 2YEPF 1CZPA 2WDRB 4OVUA 2WXRA 5EDSA 4YSXB 4IOIE 2KMAA 1QOBA 1V5TA 1KJTA 5BMIA 3SD5A 2QJLA 4LNNA 1FO4A 4A6QA 3A9KB 3NG0A 1F2RI 2HD5B 3Q6BA 3PO0A 2V9HA 2WXKA 5HKHA 4M8MA 3A4RA 4RGMA 3ZGZA 4EZLA 1E8WA 1ISNA 3UQAA 1WM2A 2FUHB 5D7GA 1TS2A 3LDZE 5JZEB 3V6CB 2M0XA 3L13A 3AU4A 2PJHA 3H7SA 1KTKA 4GDKB 2CJNA 4A90A 3LYYA 1YX6B 2INPE 4A20A 2H89B 4KIKA 1R4NI 5JXVA 1RFKA 2KOXA 4IM0A 1R4MI 1J8CA 1VZ6A 3NZ3A 1WE7A 3PRZA 2KFKA 3HK0A 2CU3A 4C7ZA 4XE0A 3AEAB 3L54A 1S1QB 4NJ7A 3FC4A 4BKTA 1EO6A 4ASWC 2ZW1A 2JQRB 3P42A 3JSVA 2ZNVC 1V1PB 3V6EB 2LASA 4NAMA 4DDID 2MP2B 2RDHA 1N60A 3VXWA 3AEBB 2FCQA 3HVDA 1V80A 4K3BA 4KX6B 2KDFB 1C9FA 1P7EA 3T3NA 4W9KA 1WGYA 2L8JA 1V81A 4GGQA 2OJWA 1FFVA 4AP4C 5IOIA 3B1LX 2WX0A 4EZKA 2VH2A 3ZW3A 3SU8X 3BVGA 1WYGA 4C00A 5L83A 2ZCBA 2KWDA 3N1ZC 1C4PA 3WAMA 3RNAC 1VD2A 3AE1B 2D3AA 2MCNB 3DDCB 3H7PB 2PMVA 2V0GA 4WJQA 3KW5B 1NENB 3EC8A 3L10B 3UINB 2OEDA 3HHMA 3EGRA 3EFCA 3AULA 2FIDA 1M4VA 1WXSA 1HQRD 5HHDG 3PRMB 2LVQA 5LNK1 4ZRKA 3PZ7A 3QHTA 2KLGA 1E10A 2E6XA 1UBQA 5CHVC 3TCAA 2KQ4X 3URYA 2KTRB 3EUB2 4FLHA 3GB1A 4M02A 3HRDD 3NUHB 2NTSA 4JWUC 1RM6C 2GRIA 2PKOA 4HK2A 2MJEA 3RZWC 3UQBA 4DXAB 1TS4A 4HEA1 2KAJA 3P4RB 3LB8C 1WMHA 3IXSA 2WXFA 1IGDA 4A3OA 4FJVB 4KGSA 4WWNA 3N1YC 2LXCA 1UZXB 1E8XA 1BMLC 3I63C 3ZYYX 1SE3A 2MBQA 3LXFA 3RMKC 2N7JA 5JH5C 1CMXB 4US9A 1Y8RC 1VLBA 4DXGA 1SF0A 2M8SA 1D5MC 2NVUI 4RH6A 4US8A 1JALA 3FILB 2J7QB 2EELA 2DNFA 3RUIB 2G4SA 1SE4A 4C80A 4HDOA 2NCNA 3Q3FA 2C60A 1WFYA 3A1QB 2M19A 3BVMA 1OEYA 4ITKA 1JCKB 1FEHA 4EEWA 5IP4D 2ZCCA 1SGHA 2BF8B 5AZFA 1KLVA 2C5LC 3AE7B 1ET9A 1MPEA 3RFZB 4WIPA 4MDKE 2WXOA 4PYZA 2K3UA 4RNAA 1MG4A 3BK2A 1WH3A 2WDTB 2NTTA 3PSEB 4FHKA 2KDMA 2AQ3B 4WJOA 3AB5A 1V86A 2PPHA 1SB3C 2J0JA 3RNCC 5KHQA 4NNJB 2KDBA 2L05A 3V05A 1DOYA 4WH4A 3CF6E 3V60A 5EE1A 2V4LA 2BS4B 2KQ7A 1YN3A 4ANUA 4M00A 4FN2A 5HI1A 4HJKA 1TYGB 3FKYA 2N7EA 3DBLB 3KUZA 3KUCB 4TUUA 1N5WA 1OGWA 1WXAA 1L0XB 1WGGA 3MTNB 2DYBA 3X0WA 1YOVB 4RF1A 2HTME 2KZRA 3GS2A 4OZCA 2FNJB 2KN4A 4IC7B 4BFRA 2K8HA 4W9LA 4KIKB 3TBLD 2YLMA 4L23A 4W9FA 1VRAB 2DAFA 3P4QB 3A33B 2RPVA 1WR1A 1HZ5A 4RM9A 2C9WB 2WGSA 1QOFA 3VTWA
chains in the Genus database with same CATH topology
5IAAC 4DDGD 3ZNZB 4HVBA 3TIXA 2FIFA 1WM3A 2XEWA 4II3B 5C23A 5IA7A 3N30A 1VCBA 2DYOA 4EFOA 3ML9A 3R7QA 2RR9A 1I35A 4MGIE 5DPSA 3ZIMA 2MBEA 1LXDA 2EMSA 2JXXA 4NJ6A 1LFDA 1Q5WB 4EZJA 3APFA 5JHAA 3I3TB 2BWES 2JRHA 5J18A 4DHZB 2BWFA 2KWVB 2O2VA 2D11A 2NBVB 4XX5A 2XBBC 3RULA 4E3CA 2M17A 3WAOA 1JRUA 3O65B 4K7UA 4BKGA 2K6DB 4HDQA 4BBNC 3DQVA 3OLMD 2L7RA 2DX5B 3L17A 3KYCD 1WR6E 1YIWA 2JT4B 5D94A 4ZRJA 5TR5A 4B9KA 4RM8A 5J17A 3PRPB 1RAXA 1IPGA 3PPAA 4KDLB 2N9PC 3L08A 4AJWA 2KNBA 2LGYA 3PLVA 2CHXA 4E74A 2MSED 1WI0A 2BYFA 2MBOA 2AL6A 4GDLA 3VQIA 4E71A 3ONSA 1YD8U 1TZ1A 2IO0B 2JZZA 4LJOB 4DHZE 2D3GA 1GG3A 3A9KA 4ANVA 2PE9A 4DBGA 3V62A 1D3ZA 1SIFA 2LVPA 3AU5A 3JW0X 3AI5A 2KX0A 4W9IA 2OJRA 4JQWC 2BYVE 2REXA 3QX1A 2AWTA 2MX2A 2LZ6A 1GUAB 2N9XA 2GBMA 2MWSB 4BKSD 2L00B 4AUQC 3QARA 4EOYA 2LRWA 1UGMA 4BOZB 1Q0WB 1QZEA 3PS6A 4P7IA 3ZO5B 2O2VB 1MG8A 3UIOB 2BGFA 2GBKA 1UELA 2KO3A 3GZNI 1WXMA 1P1AA 3OAWA 1RFAA 2GMIC 2JZ3B 2KVRA 3M62B 1WJUA 3QWZB 5AEKB 2IYDB 1BT0A 2BKRB 4K1RB 4TQ0A 4KSKC 2Z59B 1V9JA 4OVUA 2OOBB 4LDTB 3VFKA 1OQYA 5FR6A 3VHTC 5EDSA 4EKUA 5J2RA 1WF9A 2AYOB 2L3ZA 3VUYA 3DPDA 3QA8A 2KFJA 2KMAA 4JGHB 1GC6A 1Q1OA 2LWPA 2Z0EB 1K8RB 1E5WA 1V5TA 1KJTA 1H4RA 1L7YA 3QJZA 1V2YA 4GB9A 3SD5A 2RSUA 4KZCA 2DYMA 3BY4B 3A9KB 1A5RA 4DWFA 2HD5B 3R66C 5E6PA 2N9EB 3K9PB 2GBNA 1P9DU 3N32A 3JSVB 3KVFB 5HKHA 4M8MA 3VAWA 3U30A 2NR2A 3A4RA 2KDEB 2KC2A 5BO4B 3DVGX 4EZLA 4HWIB 3KUDB 1E8WA 4HCNB 2R2QA 1ISNA 3UQAA 1IYFA 2N4FA 5LLIA 2L0FA 1WRDB 1WM2A 3NOBA 2FUHB 4MELA 5D7GA 3IVFA 2ZVOA 3LDZE 4NQLB 1S3SG 4B6WA 3VUWA 3SDLC 2KANA 5JZEB 2ZPYA 4MJSB 4MM3A 3PGEA 2D2QA 5E6OA 4GMVA 3S2AA 4ZRIA 3V6CB 1H8CA 2M0XA 2V3SA 3B0AA 4G3XB 4K7SA 4AJYB 3LJ3A 4N9F4 4WJNA 2UWQA 4F7ZA 2ZZPB 3DVGY 2FAZA 3L13A 3EHVA 4BVUC 4HPMB 4W9HA 3APCA 3AU4A 2PJHA 3H7SA 4FJZA 4GDKB 4HPLB 4WWOA 3KYDD 3ZLZA 2D10A 3DBSA 2IBIB 1YX5B 1YX6B 2JF5A 2JY6A 3PHXB 3VVWB 2IY1B 3WANA 1TGZB 1KOTA 2AL3A 4A20A 5C1ZA 4FBJB 1WIAA 4KIKA 2KC1A 1R4NI 4IM0A 1WY8A 2KOXA 2KX3A 3UGBB 3RT3B 1R4MI 3PVLA 3DVNU 3W1SC 1J8CA 4ZDVA 1WE7A 3PRZA 4W9JA 4KSLC 2KFKA 3HK0A 1C3TA 1EUVB 3AXCA 4DHJB 2R2OA 4FHJA 4IWPA 3L54A 2A5UA 1S1QB 2NS5A 4NJ7A 3ZUNA 5L95C 1P3QU 2IY0B 2AEHA 4BKTA 4FADA 4GOCA 1EO6A 4ASWC 2J0KA 3H7PA 4PS7A 3JSVA 4KV2A 2ZNVC 4I6PA 3V6EB 4BKSA 2LGDA 1E90A 2LASA 3P2BA 3A1QA 1RRBA 5LXHA 2LI5A 2MP2B 4DDID 5CTRC 3VXWA 1FXTB 3QC8B 1WJNA 2FCQA 4JLCA 4MGYE 4NAWA 4MEMA 4G50A 1RLFA 2QHOA 5DPWA 4CO7A 3CSTA 4K7WA 3W1SA 3GOEA 4W9GA 1V80A 5D6JB 2Y5BB 3OJ4B 3ZTDA 4OVVA 2JPHA 3VH3B 2GBJA 2K6QA 2KDFB 4MJSA 4W9KA 5KHOA 2FCNA 4GSWA 2M1MA 5CHWA 1WGYA 5G2NA 1Z5SB 1TTNA 2L8JA 1P0RA 1V81A 1WX9A 4IG7B 4GGQA 3PLUA 4CHKA 1G6JA 1EF5A 2DAJA 3CSFA 2KMCA 4M0WB 4GDKA 2ZJDA 4AP4C 3RCZA 4NY0A 2RD0A 1WYWB 3B1LX 4NPNA 2WX0A 4GU2A 3NZUA 4EZKA 5DPRA 4FJYA 1WMHB 4AWJA 5DPTA 1LM8B 4II2B 1E7UA 3ZW3A 1P98A 3SU8X 1J0GA 4PS8A 2KTRA 3W1YA 3X23A 3T9LA 1YJ1A 2YVCA 3CMMB 4HLEA 2NPTA 2LD9A 3KH0A 2I1JA 2FCMA 2JVCA 5L83A 2MP2A 2ZCBA 4ZYNA 2KJ6A 4FULA 3Q3JA 3A4SC 2K1FA 2IO2B 2PE6B 3WAMA 1GJZA 4JIOU 4NAWB 2NBUA 1C1YB 2VRRB 1VD2A 2CHWA 3ML8A 1ZKHA 3K9OB 2MCNB 3DDCB 3H7PB 3DBRI 2K8BA 4KDIC 3IHPC 4M8NA 4BOSC 4WJQA 2LJ5A 3KW5B 3EC8A 3L10B 3UINB 3WIMA 3HHMA 4IWOA 3AULA 3EFUA 1XQQA 2FIDA 4IUMB 1WXSA 3ZVVA 1WE6A 1WXVA 4WAAA 3PRMB 1E8YA 2LVQA 3QK0A 4J6IA 2KQSA 3V61A 1XD3B 1GC7A 2MA9B 2G3QB 4ZRKA 1U4AA 3QHTA 1NBFC 2KLGA 1WJ4A 4WQOB 3IFWB 1UBQA 5CHVC 2MBHA 1F9JA 1PQSA 4ICVA 3TCAA 2NBWB 2I1KA 2C7HA 4HXDA 3NHEB 2K25A 2EKEC 2KTRB 4FLHA 2LRUA 4LDTD 3U7DA 3ZKJC 2KJRA 2RPQA 2IZVB 3SHQA 3WALA 3DOWA 2G45B 3JYUA 1X1MA 1SE9A 2KTFA 1L2NA 3A9JB 4HK2A 3RZWC 3UQBA 4DXAB 4F8CB 4MGKE 2PEAA 1WMHA 1YQBA 2KN5A 2CU1A 1OEYJ 2C7NB 3QAQA 4F1SA 3QIJA 4A3OA 4URKA 4FJVB 4WWNA 3QQ8B 4LJPB 2ASQA 2LXAA 4BBNF 4CYEA 2LXCA 1UZXB 1E8XA 2D07B 3L16A 1ZW7A 2DHZA 2L76A 2DZKA 3ENEA 2MBQA 2MW5A 4PYUA 2C7MB 2DZMA 2HTHA 2KHWB 1OTRB 2K39A 1WGRA 1E7VA 5JH5C 4IM3A 4I6LB 4MH0E 1CMXB 3VTUA 2DENB 1GNUA 1Y8RC 3L0WB 2O6VD 3PT2B 3H9DA 2XK5B 4G11A 2M8SA 1WX7A 2NVUI 3RZFA 2KWUB 5AZHA 4AOFA 3ZDTA 3A9JA 4NQKE 5AZGA 4YL8A 2J7QB 3RUIB 5JHBA 3ALBA 3IG3A 1T0YA 2G4SA 3WA0A 3NS8A 4FA6A 4HDOA 3ZRFA 2NCNA 4IM2A 3DCGA 2LVOA 2ZPNA 3Q3FA 4LCDE 4TV3A 4DK5A 2C60A 1WFYA 3A1QB 3ZNGC 5CX3A 1OEYA 2JUOA 3PHWB 4EEWA 1KM7A 2UYZB 2ZCCA 3HM6X 2N7DA 2CHZA 1M94A 1SGHA 2BF8B 5AZFA 4WJPA 2ZNVB 3RYTA 1KLVA 2C5LC 3U8ZA 2FCSA 4I6NB 2KDIA 3WAPA 2KD0A 3TMPB 1Z2MA 2G4DB 2O6VB 3APDA 3N3KB 4MDKE 2DZJA 3QCAA 5LXIB 1WGHA 4PYZA 2XK5A 3PREA 1V5OA 2MRPA 3MHSD 3ZNID 4XC2A 1WH3A 3VUXA 2WDTB 1WZ3A 3ZNHB 2LGXA 2LUEA 4MSMB 2GBRA 3PSEB 2WYQA 4FHKA 3UIPB 4WJOA 1XT9B 4ICUA 1V86A 2KWCA 2PPHA 4W9EA 2A4ZA 3HIZA 2J0JA 5KHQA 2MLBA 1V49A 4NNJB 1UBIA 3PTFC 1J19A 3M95A 1WJ6A 2MQJA 2KDBA 2L05A 2GOWA 3R7RA 4TQ1A 1TBEA 3BINA 3IBEA 2WWZA 1AARA 1EF1A 3RD2A 3H1UA 3CF6E 4MSQB 3DVNV 3VH4B 3V60A 1ZGUB 4KVGB 2V4LA 3DBHI 4K81A 2KK8A 3JVZX 2KLCA 2WX1A 5CHFA 2KQ7A 4XZ4A 2HJ8A 5G55A 3PZDA 2IO1B 3TL5A 5D2MB 1UH6A 2MBBB 2ZEQA 4ANUA 3D32A 4B95A 4FN2A 4HCPB 2V1YA 4HJKA 4ANXA 2NPTB 3OJ3A 2N7EA 1E8ZA 4X57B 4IW0A 3UF8A 3KUZA 2Z0DB 2BPSA 3KUCB 4MGZE 2CS4A 4TUUA 5E6NA 3C0RB 1I42A 1OGWA 1WXAA 2CKHB 2CR5A 2N1WA 4A3PA 1WGGA 3MTNB 2DZIA 2KXJA 4WWPA 2BYEA 2DYBA 4GXBA 1UD7A 1WZ0A 2HE7A 3NZSA 4RMAA 5GMVA 1WGDA 2O6VA 3X0WA 1WX8A 2L0TA 1IP9A 2EMTA 3ZTCA 2ZVNA 5DCNA 3T8MA 3H6NA 4JL9A 1NDDA 2KZRA 3ZDMC 2RGFA 3VTVA 2KKCA 2BKFA 2FNJB 4IC7B 3DBLI 4W9DA 4W9CA 3VDZA 2IO3B 4EUTA 4DHJD 3NY5A 4TKNA 3TJPA 4BFRA 2K8HA 3M63B 2KJHB 4W9LA 4GN1A 3M3JA 4ANWA 2K8CA 4KIKB 3TBLD 2N1VA 3B08A 2W9NA 3ECIA 1NI2A 4PS3A 2YLMA 4GIVA 2M4NA 3PV1A 3R3MA 4W9FA 2JRIB 2JWZA 2DAFA 4KZ0A 1LQBA 3HM3A 2B3AA 3A33B 3ZRCA 3EECA 1WR1A 4G0NB 4IWQA 3MJWA 4RM9A 1HE8A 1V6EA 2C9WB 4GDLB 2KFKB 3VTWA 2J0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAA C;  4DDG D;  3ZNZ B;  4HVB A;  3TIX A;  2FIF A;  1WM3 A;  2XEW A;  4II3 B;  5C23 A;  5IA7 A;  3N30 A;  1VCB A;  2DYO A;  4EFO A;  3ML9 A;  3R7Q A;  2RR9 A;  1I35 A;  4MGI E;  5DPS A;  3ZIM A;  2MBE A;  1LXD A;  2EMS A;  2JXX A;  4NJ6 A;  1LFD A;  1Q5W B;  4EZJ A;  3APF A;  5JHA A;  3I3T B;  2BWE S;  2JRH A;  5J18 A;  4DHZ B;  2BWF A;  2KWV B;  2O2V A;  2D11 A;  2NBV B;  4XX5 A;  2XBB C;  3RUL A;  4E3C A;  2M17 A;  3WAO A;  1JRU A;  3O65 B;  4K7U A;  4BKG A;  2K6D B;  4HDQ A;  4BBN C;  3DQV A;  3OLM D;  2L7R A;  2DX5 B;  3L17 A;  3KYC D;  1WR6 E;  1YIW A;  2JT4 B;  5D94 A;  4ZRJ A;  5TR5 A;  4B9K A;  4RM8 A;  5J17 A;  3PRP B;  1RAX A;  1IPG A;  3PPA A;  4KDL B;  2N9P C;  3L08 A;  4AJW A;  2KNB A;  2LGY A;  3PLV A;  2CHX A;  4E74 A;  2MSE D;  1WI0 A;  2BYF A;  2MBO A;  2AL6 A;  4GDL A;  3VQI A;  4E71 A;  3ONS A;  1YD8 U;  1TZ1 A;  2IO0 B;  2JZZ A;  4LJO B;  4DHZ E;  2D3G A;  1GG3 A;  3A9K A;  4ANV A;  2PE9 A;  4DBG A;  3V62 A;  1D3Z A;  1SIF A;  2LVP A;  3AU5 A;  3JW0 X;  3AI5 A;  2KX0 A;  4W9I A;  2OJR A;  4JQW C;  2BYV E;  2REX A;  3QX1 A;  2AWT A;  2MX2 A;  2LZ6 A;  1GUA B;  2N9X A;  2GBM A;  2MWS B;  4BKS D;  2L00 B;  4AUQ C;  3QAR A;  4EOY A;  2LRW A;  1UGM A;  4BOZ B;  1Q0W B;  1QZE A;  3PS6 A;  4P7I A;  3ZO5 B;  2O2V B;  1MG8 A;  3UIO B;  2BGF A;  2GBK A;  1UEL A;  2KO3 A;  3GZN I;  1WXM A;  1P1A A;  3OAW A;  1RFA A;  2GMI C;  2JZ3 B;  2KVR A;  3M62 B;  1WJU A;  3QWZ B;  5AEK B;  2IYD B;  1BT0 A;  2BKR B;  4K1R B;  4TQ0 A;  4KSK C;  2Z59 B;  1V9J A;  4OVU A;  2OOB B;  4LDT B;  3VFK A;  1OQY A;  5FR6 A;  3VHT C;  5EDS A;  4EKU A;  5J2R A;  1WF9 A;  2AYO B;  2L3Z A;  3VUY A;  3DPD A;  3QA8 A;  2KFJ A;  2KMA A;  4JGH B;  1GC6 A;  1Q1O A;  2LWP A;  2Z0E B;  1K8R B;  1E5W A;  1V5T A;  1KJT A;  1H4R A;  1L7Y A;  3QJZ A;  1V2Y A;  4GB9 A;  3SD5 A;  2RSU A;  4KZC A;  2DYM A;  3BY4 B;  3A9K B;  1A5R A;  4DWF A;  2HD5 B;  3R66 C;  5E6P A;  2N9E B;  3K9P B;  2GBN A;  1P9D U;  3N32 A;  3JSV B;  3KVF B;  5HKH A;  4M8M A;  3VAW A;  3U30 A;  2NR2 A;  3A4R A;  2KDE B;  2KC2 A;  5BO4 B;  3DVG X;  4EZL A;  4HWI B;  3KUD B;  1E8W A;  4HCN B;  2R2Q A;  1ISN A;  3UQA A;  1IYF A;  2N4F A;  5LLI A;  2L0F A;  1WRD B;  1WM2 A;  3NOB A;  2FUH B;  4MEL A;  5D7G A;  3IVF A;  2ZVO A;  3LDZ E;  4NQL B;  1S3S G;  4B6W A;  3VUW A;  3SDL C;  2KAN A;  5JZE B;  2ZPY A;  4MJS B;  4MM3 A;  3PGE A;  2D2Q A;  5E6O A;  4GMV A;  3S2A A;  4ZRI A;  3V6C B;  1H8C A;  2M0X A;  2V3S A;  3B0A A;  4G3X B;  4K7S A;  4AJY B;  3LJ3 A;  4N9F 4;  4WJN A;  2UWQ A;  4F7Z A;  2ZZP B;  3DVG Y;  2FAZ A;  3L13 A;  3EHV A;  4BVU C;  4HPM B;  4W9H A;  3APC A;  3AU4 A;  2PJH A;  3H7S A;  4FJZ A;  4GDK B;  4HPL B;  4WWO A;  3KYD D;  3ZLZ A;  2D10 A;  3DBS A;  2IBI B;  1YX5 B;  1YX6 B;  2JF5 A;  2JY6 A;  3PHX B;  3VVW B;  2IY1 B;  3WAN A;  1TGZ B;  1KOT A;  2AL3 A;  4A20 A;  5C1Z A;  4FBJ B;  1WIA A;  4KIK A;  2KC1 A;  1R4N I;  4IM0 A;  1WY8 A;  2KOX A;  2KX3 A;  3UGB B;  3RT3 B;  1R4M I;  3PVL A;  3DVN U;  3W1S C;  1J8C A;  4ZDV A;  1WE7 A;  3PRZ A;  4W9J A;  4KSL C;  2KFK A;  3HK0 A;  1C3T A;  1EUV B;  3AXC A;  4DHJ B;  2R2O A;  4FHJ A;  4IWP A;  3L54 A;  2A5U A;  1S1Q B;  2NS5 A;  4NJ7 A;  3ZUN A;  5L95 C;  1P3Q U;  2IY0 B;  2AEH A;  4BKT A;  4FAD A;  4GOC A;  1EO6 A;  4ASW C;  2J0K A;  3H7P A;  4PS7 A;  3JSV A;  4KV2 A;  2ZNV C;  4I6P A;  3V6E B;  4BKS A;  2LGD A;  1E90 A;  2LAS A;  3P2B A;  3A1Q A;  1RRB A;  5LXH A;  2LI5 A;  2MP2 B;  4DDI D;  5CTR C;  3VXW A;  1FXT B;  3QC8 B;  1WJN A;  2FCQ A;  4JLC A;  4MGY E;  4NAW A;  4MEM A;  4G50 A;  1RLF A;  2QHO A;  5DPW A;  4CO7 A;  3CST A;  4K7W A;  3W1S A;  3GOE A;  4W9G A;  1V80 A;  5D6J B;  2Y5B B;  3OJ4 B;  3ZTD A;  4OVV A;  2JPH A;  3VH3 B;  2GBJ A;  2K6Q A;  2KDF B;  4MJS A;  4W9K A;  5KHO A;  2FCN A;  4GSW A;  2M1M A;  5CHW A;  1WGY A;  5G2N A;  1Z5S B;  1TTN A;  2L8J A;  1P0R A;  1V81 A;  1WX9 A;  4IG7 B;  4GGQ A;  3PLU A;  4CHK A;  1G6J A;  1EF5 A;  2DAJ A;  3CSF A;  2KMC A;  4M0W B;  4GDK A;  2ZJD A;  4AP4 C;  3RCZ A;  4NY0 A;  2RD0 A;  1WYW B;  3B1L X;  4NPN A;  2WX0 A;  4GU2 A;  3NZU A;  4EZK A;  5DPR A;  4FJY A;  1WMH B;  4AWJ A;  5DPT A;  1LM8 B;  4II2 B;  1E7U A;  3ZW3 A;  1P98 A;  3SU8 X;  1J0G A;  4PS8 A;  2KTR A;  3W1Y A;  3X23 A;  3T9L A;  1YJ1 A;  2YVC A;  3CMM B;  4HLE A;  2NPT A;  2LD9 A;  3KH0 A;  2I1J A;  2FCM A;  2JVC A;  5L83 A;  2MP2 A;  2ZCB A;  4ZYN A;  2KJ6 A;  4FUL A;  3Q3J A;  3A4S C;  2K1F A;  2IO2 B;  2PE6 B;  3WAM A;  1GJZ A;  4JIO U;  4NAW B;  2NBU A;  1C1Y B;  2VRR B;  1VD2 A;  2CHW A;  3ML8 A;  1ZKH A;  3K9O B;  2MCN B;  3DDC B;  3H7P B;  3DBR I;  2K8B A;  4KDI C;  3IHP C;  4M8N A;  4BOS C;  4WJQ A;  2LJ5 A;  3KW5 B;  3EC8 A;  3L10 B;  3UIN B;  3WIM A;  3HHM A;  4IWO A;  3AUL A;  3EFU A;  1XQQ A;  2FID A;  4IUM B;  1WXS A;  3ZVV A;  1WE6 A;  1WXV A;  4WAA A;  3PRM B;  1E8Y A;  2LVQ A;  3QK0 A;  4J6I A;  2KQS A;  3V61 A;  1XD3 B;  1GC7 A;  2MA9 B;  2G3Q B;  4ZRK A;  1U4A A;  3QHT A;  1NBF C;  2KLG A;  1WJ4 A;  4WQO B;  3IFW B;  1UBQ A;  5CHV C;  2MBH A;  1F9J A;  1PQS A;  4ICV A;  3TCA A;  2NBW B;  2I1K A;  2C7H A;  4HXD A;  3NHE B;  2K25 A;  2EKE C;  2KTR B;  4FLH A;  2LRU A;  4LDT D;  3U7D A;  3ZKJ C;  2KJR A;  2RPQ A;  2IZV B;  3SHQ A;  3WAL A;  3DOW A;  2G45 B;  3JYU A;  1X1M A;  1SE9 A;  2KTF A;  1L2N A;  3A9J B;  4HK2 A;  3RZW C;  3UQB A;  4DXA B;  4F8C B;  4MGK E;  2PEA A;  1WMH A;  1YQB A;  2KN5 A;  2CU1 A;  1OEY J;  2C7N B;  3QAQ A;  4F1S A;  3QIJ A;  4A3O A;  4URK A;  4FJV B;  4WWN A;  3QQ8 B;  4LJP B;  2ASQ A;  2LXA A;  4BBN F;  4CYE A;  2LXC A;  1UZX B;  1E8X A;  2D07 B;  3L16 A;  1ZW7 A;  2DHZ A;  2L76 A;  2DZK A;  3ENE A;  2MBQ A;  2MW5 A;  4PYU A;  2C7M B;  2DZM A;  2HTH A;  2KHW B;  1OTR B;  2K39 A;  1WGR A;  1E7V A;  5JH5 C;  4IM3 A;  4I6L B;  4MH0 E;  1CMX B;  3VTU A;  2DEN B;  1GNU A;  1Y8R C;  3L0W B;  2O6V D;  3PT2 B;  3H9D A;  2XK5 B;  4G11 A;  2M8S A;  1WX7 A;  2NVU I;  3RZF A;  2KWU B;  5AZH A;  4AOF A;  3ZDT A;  3A9J A;  4NQK E;  5AZG A;  4YL8 A;  2J7Q B;  3RUI B;  5JHB A;  3ALB A;  3IG3 A;  1T0Y A;  2G4S A;  3WA0 A;  3NS8 A;  4FA6 A;  4HDO A;  3ZRF A;  2NCN A;  4IM2 A;  3DCG A;  2LVO A;  2ZPN A;  3Q3F A;  4LCD E;  4TV3 A;  4DK5 A;  2C60 A;  1WFY A;  3A1Q B;  3ZNG C;  5CX3 A;  1OEY A;  2JUO A;  3PHW B;  4EEW A;  1KM7 A;  2UYZ B;  2ZCC A;  3HM6 X;  2N7D A;  2CHZ A;  1M94 A;  1SGH A;  2BF8 B;  5AZF A;  4WJP A;  2ZNV B;  3RYT A;  1KLV A;  2C5L C;  3U8Z A;  2FCS A;  4I6N B;  2KDI A;  3WAP A;  2KD0 A;  3TMP B;  1Z2M A;  2G4D B;  2O6V B;  3APD A;  3N3K B;  4MDK E;  2DZJ A;  3QCA A;  5LXI B;  1WGH A;  4PYZ A;  2XK5 A;  3PRE A;  1V5O A;  2MRP A;  3MHS D;  3ZNI D;  4XC2 A;  1WH3 A;  3VUX A;  2WDT B;  1WZ3 A;  3ZNH B;  2LGX A;  2LUE A;  4MSM B;  2GBR A;  3PSE B;  2WYQ A;  4FHK A;  3UIP B;  4WJO A;  1XT9 B;  4ICU A;  1V86 A;  2KWC A;  2PPH A;  4W9E A;  2A4Z A;  3HIZ A;  2J0J A;  5KHQ A;  2MLB A;  1V49 A;  4NNJ B;  1UBI A;  3PTF C;  1J19 A;  3M95 A;  1WJ6 A;  2MQJ A;  2KDB A;  2L05 A;  2GOW A;  3R7R A;  4TQ1 A;  1TBE A;  3BIN A;  3IBE A;  2WWZ A;  1AAR A;  1EF1 A;  3RD2 A;  3H1U A;  3CF6 E;  4MSQ B;  3DVN V;  3VH4 B;  3V60 A;  1ZGU B;  4KVG B;  2V4L A;  3DBH I;  4K81 A;  2KK8 A;  3JVZ X;  2KLC A;  2WX1 A;  5CHF A;  2KQ7 A;  4XZ4 A;  2HJ8 A;  5G55 A;  3PZD A;  2IO1 B;  3TL5 A;  5D2M B;  1UH6 A;  2MBB B;  2ZEQ A;  4ANU A;  3D32 A;  4B95 A;  4FN2 A;  4HCP B;  2V1Y A;  4HJK A;  4ANX A;  2NPT B;  3OJ3 A;  2N7E A;  1E8Z A;  4X57 B;  4IW0 A;  3UF8 A;  3KUZ A;  2Z0D B;  2BPS A;  3KUC B;  4MGZ E;  2CS4 A;  4TUU A;  5E6N A;  3C0R B;  1I42 A;  1OGW A;  1WXA A;  2CKH B;  2CR5 A;  2N1W A;  4A3P A;  1WGG A;  3MTN B;  2DZI A;  2KXJ A;  4WWP A;  2BYE A;  2DYB A;  4GXB A;  1UD7 A;  1WZ0 A;  2HE7 A;  3NZS A;  4RMA A;  5GMV A;  1WGD A;  2O6V A;  3X0W A;  1WX8 A;  2L0T A;  1IP9 A;  2EMT A;  3ZTC A;  2ZVN A;  5DCN A;  3T8M A;  3H6N A;  4JL9 A;  1NDD A;  2KZR A;  3ZDM C;  2RGF A;  3VTV A;  2KKC A;  2BKF A;  2FNJ B;  4IC7 B;  3DBL I;  4W9D A;  4W9C A;  3VDZ A;  2IO3 B;  4EUT A;  4DHJ D;  3NY5 A;  4TKN A;  3TJP A;  4BFR A;  2K8H A;  3M63 B;  2KJH B;  4W9L A;  4GN1 A;  3M3J A;  4ANW A;  2K8C A;  4KIK B;  3TBL D;  2N1V A;  3B08 A;  2W9N A;  3ECI A;  1NI2 A;  4PS3 A;  2YLM A;  4GIV A;  2M4N A;  3PV1 A;  3R3M A;  4W9F A;  2JRI B;  2JWZ A;  2DAF A;  4KZ0 A;  1LQB A;  3HM3 A;  2B3A A;  3A33 B;  3ZRC A;  3EEC A;  1WR1 A;  4G0N B;  4IWQ A;  3MJW A;  4RM9 A;  1HE8 A;  1V6E A;  2C9W B;  4GDL B;  2KFK B;  3VTW A;  2J0M A; 
#chains in the Genus database with same CATH topology
 3ZNZ B;  1ZDX A;  2FIF A;  2XEW A;  1VCB A;  1ZXH A;  2QIL A;  2W55 A;  4AS1 A;  2EMS A;  2JXX A;  1UWX A;  1ZUD 2;  1FM0 D;  1YN4 A;  2Z8L A;  4S0R A;  1OQR A;  2NBV B;  2M17 A;  4ACF A;  3O65 B;  4CQN A;  4BKG A;  4HDQ A;  1WR6 E;  5TR5 A;  3PLV A;  2CHX A;  1SIJ A;  4E74 A;  2MSE D;  1SJE D;  2MBO A;  2KVZ A;  1IBX B;  3VQI A;  1ESF A;  1VZ8 A;  1TZ1 A;  3DWG C;  4H2A A;  3V62 A;  1D3Z A;  2V3P A;  1WSP A;  2LVP A;  3JW0 X;  2BYV E;  2Y5P A;  4HRS A;  3ZJT A;  4LK0 M;  2MX2 A;  1GUA B;  4BKS D;  4EOY A;  1I4R A;  2LRW A;  3ZO5 B;  4P7I A;  1MG8 A;  1AW7 A;  2KO3 A;  1UEL A;  1WXM A;  3KLS X;  3PZ8 A;  2GMI C;  3IAM 1;  1WJU A;  3P4S B;  1JRO A;  4TQ0 A;  1EWY C;  3AE6 B;  1OQY A;  3W2D A;  5J2R A;  2M0A A;  3VUY A;  4C4V B;  3V3X A;  3DPD A;  2KFJ A;  1GC6 A;  1Q1O A;  4NPN A;  1L7Y A;  1H4R A;  1V2Y A;  4NZL B;  1GB4 A;  2RSU A;  5G5H A;  4KZC A;  3U7Z A;  4DWF A;  1E0Z A;  2GBN A;  3KWL A;  3NJT A;  3Q3O C;  3VAW A;  3U30 A;  1PYW D;  3RN9 C;  1EU3 A;  2KC2 A;  1PGA A;  2BBC A;  2R2Q A;  1IYF A;  2N4F A;  4R3D A;  3NOB A;  1GOZ A;  3P4P B;  2VZK D;  4B6W A;  1S3S G;  2WP9 B;  2ZPY A;  2QDF A;  1H8C A;  2D2Q A;  3S2A A;  4G3X B;  4K7S A;  2JSV X;  2UWQ A;  1ET6 A;  2LJI A;  4BVU C;  5GXG B;  4HPM B;  4W9H A;  1TKY A;  3APC A;  4USA A;  3TEW A;  4WWO A;  1ZE3 D;  3ZLZ A;  2D10 A;  3DBS A;  2IBI B;  2JY6 A;  2JF5 A;  3PHX B;  2IY1 B;  1TGZ B;  1J7A A;  1P7F A;  4FBJ B;  4P1C C;  3RT3 B;  3PVL A;  3W1S C;  1T6B X;  2WU2 B;  2ACZ B;  4W9J A;  4KSL C;  1C3T A;  2GB1 A;  4DHJ B;  4FHJ A;  2A5U A;  1KFY B;  3P63 A;  4FAD A;  4GOC A;  4KV2 A;  4RFB A;  2MJ3 A;  3A1Q A;  3R8B A;  5CTR C;  3TUO A;  1ACC A;  4NAW A;  4G50 A;  3MC9 A;  4K7W A;  3ZTD A;  4W9G A;  1J7C A;  2Y5B B;  3OJ4 B;  4OVV A;  2JPH A;  3VH3 B;  2GBJ A;  4IDI A;  5EE9 A;  2FCN A;  4GSW A;  2M1M A;  4OW0 A;  3RNF C;  5CHW A;  3MFG A;  1XLP A;  1TTN A;  1P0R A;  4IG7 B;  4YSY B;  2KMC A;  1IBX A;  1I4X A;  4GDK A;  2ZJD A;  2WXL A;  3RCZ A;  4NY0 A;  1EWC A;  1B9R A;  4GU2 A;  5DPR A;  4FJY A;  1WMH B;  5DPT A;  1LM8 B;  1N6Z A;  3W1Y A;  3T9L A;  1KRH A;  2KJ6 A;  4FUL A;  4MT5 A;  3A4S C;  2IO2 B;  2KT7 A;  2PE6 B;  4NAW B;  1FXI A;  2NBU A;  1L0V B;  1ZKH A;  4IKG A;  3DBR I;  4KDI C;  4M8N A;  4BOS C;  1L6V A;  3EFU A;  3ABV B;  2YEP B;  1XQQ A;  4UDU C;  5EE0 A;  2WHI A;  3MC8 A;  4WAA A;  2KQS A;  1XD3 B;  1D5X C;  4M0W A;  1TKG A;  1U4A A;  4WQO B;  2B76 B;  4YT0 B;  3IFW B;  1F9J A;  4LLG M;  2NBW B;  2C7H A;  3GP7 A;  2E3T A;  4LDT D;  1FCL A;  4MH8 A;  2IJ0 A;  3Q8C A;  1L2N A;  3A9J B;  2LHE A;  3NVW A;  4F8C B;  2JU6 X;  1QLB B;  2WQY B;  4MGK E;  1YN5 A;  1YQB A;  2KN5 A;  1Q10 A;  3QAQ A;  2BQQ A;  3QQ8 B;  2WXH A;  2PW9 A;  2ASQ A;  4BBN F;  2WU5 B;  1ZW7 A;  3CIR B;  1EU4 A;  3DBR B;  2C7M B;  1JWM D;  2DZM A;  1OTR B;  1E7V A;  3R2I A;  1ZP0 B;  4MH0 E;  1GNU A;  2Y3A A;  1NYR A;  1DOI A;  1LO5 D;  3L0W B;  3H9D A;  4G11 A;  1B1Z A;  3RZF A;  2KWU B;  3ZDT A;  1QOG A;  1VZ7 A;  5AZG A;  2N0S B;  1JML A;  1K52 A;  1T0Y A;  3WA0 A;  2Y5C A;  3I5J C;  1I4P A;  3DCG A;  3ETR A;  2LVO A;  3NVV A;  1XLQ A;  4LCD E;  4DK5 A;  1XLO A;  2HDE A;  3PHW B;  4D2K A;  2RMM A;  2W3R A;  1KM7 A;  1DOX A;  4WJP A;  5HFY A;  2EKI A;  3TMP B;  2G4D B;  2O6V B;  2DZJ A;  1E9M A;  2LUM A;  3PRE A;  3MHS D;  2OHF A;  1QF6 A;  1K53 A;  2LGX A;  4KGT A;  2GBR A;  3UIP B;  1VR9 A;  1XT9 B;  4A55 A;  2A4Z A;  2MLB A;  1WJ6 A;  1D5Z C;  2BB6 A;  1TBE A;  3BIN A;  2WWZ A;  1EF1 A;  2JXT A;  1XF5 L;  1ZGU B;  4KVG B;  1JWU D;  3JVZ X;  2WX1 A;  3TL5 A;  4LNK A;  2ZEQ A;  1MHX A;  3D32 A;  1V97 A;  2D3B A;  3SFE B;  1I42 A;  2CKH B;  4L1B A;  4P1B C;  2KXJ A;  1UD7 A;  4RMA A;  5GMV A;  3HUI A;  1WX8 A;  2L0T A;  3I57 A;  3O13 A;  3ZTC A;  3T8M A;  3ZDM C;  2RGF A;  2WDV B;  3AE9 B;  4W9D A;  3VDZ A;  4EUT A;  4DHJ D;  3DBH B;  3TJP A;  3M63 B;  4HKQ A;  3TEZ A;  2IGH A;  2BYT A;  2K8C A;  1T3Q A;  3ECI A;  4GIV A;  4KZ0 A;  2B3A A;  1FPY A;  3MJW A;  1V6E A;  3MHZ A;  1N63 A;  2INC C;  4HVB A;  4OHJ A;  1WM3 A;  3R7Q A;  3ZJU A;  2JWU A;  1AWD A;  3ZIM A;  1LXD A;  2LEK A;  1LFD A;  1ROE A;  4NJ6 A;  5JHA A;  2BWE S;  5J18 A;  2KWV B;  1UF0 A;  2D11 A;  5IN7 A;  1SXT A;  4E3C A;  3WAO A;  5D3D A;  1JRU A;  1BUI C;  4BBN C;  3DQV A;  3OLM D;  2L7R A;  3L17 A;  5D94 A;  2MJD A;  1YIW A;  3C19 A;  1JRP A;  4B9K A;  2JYE A;  3PRP B;  1IPG A;  3PPA A;  4BAX A;  4KDL B;  2N9P C;  3L08 A;  4AJW A;  2FBW B;  2BYF A;  2AL6 A;  4GDL A;  4E71 A;  3ONS A;  1YD8 U;  4DHZ E;  1GG3 A;  4ANV A;  1F0Z A;  2PE9 A;  2ICI A;  3AU5 A;  1IGC A;  3AM9 A;  1NI3 A;  2GBM A;  2MWS B;  1UGM A;  2M56 B;  2O2V B;  3UIO B;  2BGF A;  2GBK A;  3U4E G;  5AUK A;  5G5G A;  3M62 B;  2IYD B;  2Z59 B;  2OOB B;  4LDT B;  3VFK A;  3VHT C;  2AYO B;  2L3Z A;  3SR6 A;  4JGH B;  2I2Y A;  2LWP A;  1K8R B;  1E5W A;  4GB9 A;  3QJZ A;  4XDC A;  2BT6 A;  2J42 A;  4P16 A;  4N59 A;  1A5R A;  3R66 C;  3W5V B;  5E6P A;  2N9E B;  1QKZ A;  5H92 C;  3N32 A;  3KVF B;  1TY2 A;  2AQ1 B;  3NVY A;  1R4N B;  5BO4 B;  3DVG X;  3KUD B;  5BYS A;  3DHI C;  1WRD B;  4Q2J A;  2CJO A;  3E9S A;  2JYT A;  2VH1 A;  3IVF A;  4JE3 B;  3TSS A;  4NQL B;  1SSN A;  3VUW A;  2KAN A;  5E6O A;  1FRD A;  2NMQ A;  2V3S A;  4AJY B;  3LJ3 A;  4N9F 4;  4WJN A;  1HA5 A;  2J4X A;  2FAZ A;  3FIL A;  1C78 A;  4HPL B;  3KYD D;  1T5X D;  1FCC C;  1KOT A;  3WAN A;  4WQM A;  2AL3 A;  5C1Z A;  1WIA A;  2KC1 A;  1FNW A;  1WY8 A;  3UGB B;  1L6U A;  4C4V A;  4ZDV A;  1KF6 B;  1C79 A;  3T3O A;  1TY0 A;  2MHJ A;  4HJG E;  1WGK A;  3AXC A;  3BYT B;  2R2O A;  4IWP A;  2HJ1 A;  2NS5 A;  1WXQ A;  3J9C A;  3ZUN A;  4YSZ B;  1MI0 A;  5T8I A;  1C4C A;  4C7Y A;  4I6P A;  2LGD A;  1RYJ A;  4ZHO A;  1XEE A;  3BYY B;  5LXH A;  2LI5 A;  3TEY A;  1FXT B;  1TIF A;  3QC8 B;  4JLC A;  4MGY E;  4MEM A;  5DPW A;  5D6J B;  1T0R C;  5KHO A;  1C76 A;  5G2N A;  1Z5S B;  3SFD B;  1G6J A;  2GI9 A;  3ZJV A;  1EF5 A;  2DAJ A;  4WAF A;  1F2R C;  2PTL A;  4RGO S;  3NZU A;  1E6E B;  3VR9 B;  4AWJ A;  4II2 B;  1E7U A;  1P98 A;  4YTP B;  4PS8 A;  1TJE A;  2KTR A;  3X23 A;  1V1P A;  3B9J A;  1YJ1 A;  2FE8 A;  2LMC A;  3CMM B;  4HLE A;  3KH0 A;  1EM7 A;  2FCM A;  2JVC A;  1YNT E;  2K1F A;  1GJZ A;  2L32 A;  3RNG C;  1C1Y B;  2LGS A;  2VRR B;  2CHW A;  3ML8 A;  1YMH E;  3VR8 B;  2LJ5 A;  3SEB A;  1IUE A;  5D3I B;  4IUM B;  3ZVV A;  1WE6 A;  1WXV A;  3QK0 A;  1E8Y A;  3OWE B;  3ZXV A;  2MA9 B;  2W82 A;  1HTO A;  1WJ4 A;  5E6J A;  2FUG 1;  1OFF A;  1PQS A;  4ICV A;  4HXD A;  3NHE B;  1FD6 A;  2BS2 B;  3U7D A;  2IZV B;  3SHQ A;  3DOW A;  2G45 B;  4YTN B;  1R4M B;  4OZB A;  4RGT A;  1GAQ B;  4KGR A;  1OEY J;  2RDG A;  3QIJ A;  4URK A;  2BVC A;  4LJP B;  3WCQ A;  1YJI A;  2DWQ A;  1FMA D;  4RCO A;  2L76 A;  3ENE A;  1K51 A;  2MW5 A;  4PYU A;  2KHW B;  1PGB A;  2K39 A;  2TSS A;  4IM3 A;  1ZDV A;  1YJJ A;  3VTU A;  2DEN B;  2BW2 A;  3AEC B;  2JZP A;  2D3C A;  2WNM A;  1I4H A;  5H8Y E;  1OQQ A;  2G9H D;  3W5U B;  5AZH A;  2K22 A;  3A9J A;  4NQK E;  4YL8 A;  5JHB A;  3IG3 A;  3NS8 A;  4A8X C;  4FA6 A;  1FRR A;  3AN1 A;  4L2Y A;  2JX5 A;  4PT5 A;  2ZPN A;  3ZNG C;  5CX3 A;  1HTQ A;  1Y56 A;  2CHZ A;  2ZNV B;  1JQ4 A;  2FCS A;  3E56 A;  4I6N B;  1XLN A;  3WAP A;  2KD0 A;  2L83 A;  1Z2M A;  3APD A;  3QCA A;  1FNU A;  5LXI B;  5C3J B;  1WGH A;  4WUR A;  2XNA C;  4XC2 A;  4WWM A;  3VUX A;  4XYC A;  3ZNH B;  3Q3N C;  2W54 A;  4B0M A;  4W9E A;  1WRI A;  3AV8 A;  1TT5 B;  1UBI A;  1J19 A;  2MH7 A;  2MQJ A;  3R7R A;  2GOW A;  2KYW A;  5BMG A;  2IGD A;  3IBE A;  1AAR A;  3RD2 A;  3H1U A;  2LGI A;  4MSQ B;  2J52 A;  4K81 A;  1PUT A;  3AH7 A;  4XZ4 A;  5G55 A;  5D2M B;  1UH6 A;  4B95 A;  4QAY A;  4HCP B;  2GLS A;  2NPT B;  3OJ3 A;  3Q8E A;  2CS4 A;  5E6N A;  1HXY D;  1KLU D;  4C56 C;  2CR5 A;  1CJE A;  4A3P A;  4WWP A;  2WXQ A;  2BYE A;  1WGD A;  1IP9 A;  4XWT A;  1T0S C;  1N5X A;  3Q69 A;  2WXM A;  3VTV A;  2BKF A;  3DBL I;  2IO3 B;  1L0Y B;  5AUI A;  4TKN A;  1FXA A;  4OZA A;  1RWS A;  4HKZ E;  4GN1 A;  1JWA D;  2ZW0 A;  3DHH C;  3M3J A;  5C2T B;  1CQV A;  3R3M A;  3PV1 A;  3ZRC A;  4RF0 A;  4IWQ A;  3BVZ A;  2PLP A;  3Q8B A;  1HE8 A;  2WXP A;  4GDL B;  2KFK B;  3TIX A;  5C23 A;  3GZN B;  5BYQ A;  3BK1 A;  1F52 A;  4MGI E;  3RPF C;  1QOA A;  1Q5W B;  4EZJ A;  3APF A;  1CK1 A;  1E7P B;  3I3T B;  2JRH A;  4JWS C;  4XX5 A;  1ZOY B;  4REZ A;  1K50 A;  3AEG B;  1TKE A;  3UI3 A;  3Q2A C;  2K6D B;  3EA6 A;  5I4D A;  5TSS A;  1QQR A;  2J53 A;  2DX5 B;  2QEJ C;  3KYC D;  2JT4 B;  4JPS A;  4ZRJ A;  2AX5 A;  1XXG A;  3HVZ A;  4RM8 A;  5J17 A;  2DLB A;  3AED B;  1RAX A;  2XN9 C;  1SEB D;  4XGA B;  2KNB A;  2MEK A;  2V4I B;  1HEZ E;  1WI0 A;  4MAC A;  1MJD A;  2IO0 B;  3AE3 B;  4LJO B;  2SEB D;  4DBG A;  2L52 A;  2KX0 A;  4ARC A;  4W9I A;  4JQW C;  2AWT A;  2LZ6 A;  2N9X A;  3BZD B;  4AUQ C;  3QAR A;  1TZO A;  1QZE A;  1WWT A;  3BII D;  1MHH E;  2QMT A;  4ZHP A;  5FKA C;  2JZ3 B;  3QWZ B;  5AEK B;  1BT0 A;  2BKR B;  4K1R B;  4KSK C;  1V9J A;  5FR6 A;  4EKU A;  1WF9 A;  3QA8 A;  4B0E A;  2Z0E B;  3GE8 C;  1A70 A;  2DYM A;  2WDQ B;  3BY4 B;  1ZXI A;  3K9P B;  4RGN A;  3U2S C;  1P9D U;  3JSV B;  2H88 B;  4DQO C;  2NR2 A;  1VJK A;  2KDE B;  1I4G A;  4HWI B;  4LNF A;  4HCN B;  1I4Q A;  2L0F A;  2LFI A;  5LLI A;  4XDD A;  1C77 A;  4MEL A;  4ARI A;  2ZVO A;  2IPK D;  3SDL C;  4AQ7 A;  3AEF B;  3Q8A A;  4LTU A;  4MJS B;  4MM3 A;  3PGE A;  4GMV A;  4ZRI A;  3H8H A;  3B0A A;  4XWW A;  3CWI A;  4F7Z A;  2ZZP B;  3DVG Y;  2N9L A;  3EHV A;  4YWG G;  4FJZ A;  1PFD A;  1YX5 B;  3VVW B;  1QIL A;  1D6E C;  1GPX A;  1PDX A;  2KX3 A;  1MVK A;  3DVN U;  2IGG A;  4N58 A;  2SAK A;  4ZRP A;  1EUV B;  2WXJ A;  3OG5 A;  1T0Q C;  2VZK B;  2DBY A;  5L95 C;  1P3Q U;  2IY0 B;  2AEH A;  5EE3 A;  4ZOH C;  1TS3 A;  2J0K A;  3H7P A;  4PS7 A;  1LGR A;  4KKI A;  4BKS A;  4FXC A;  4ZRQ A;  1E90 A;  1NEK B;  3P2B A;  1RRB A;  3Q8F A;  2QSD A;  2PVG C;  1WJN A;  4O1N A;  1UGJ A;  3U52 E;  1RLF A;  2QHO A;  4CO7 A;  3CST A;  3W1S A;  1FNV A;  3GOE A;  3I9V 1;  4HPP A;  2K6Q A;  4EE2 A;  4MJS A;  5FK9 C;  1FIQ A;  3FAH A;  1WX9 A;  3PLU A;  4CHK A;  3CSF A;  4M0W B;  1XCT L;  2RD0 A;  1WYW B;  1I7H A;  5BYR A;  2BS3 B;  4OVZ A;  5IO9 A;  3B2F A;  1J0G A;  4K3C A;  4N6E B;  2YVC A;  2LHD A;  2NPT A;  2LD9 A;  2I1J A;  2QCZ A;  2MP2 A;  3MP9 A;  4ZYN A;  3Q3J A;  2G1E A;  2X38 A;  1KLG D;  4JIO U;  1XO3 A;  4PK1 A;  2K9X A;  1N62 A;  2PIA A;  3K9O B;  4A9A A;  2K8B A;  2WLB A;  3IHP C;  3WIM A;  3Q14 C;  4IWO A;  4J6I A;  3V61 A;  1GC7 A;  3AEE B;  2G3Q B;  2WXG A;  1NBF C;  4TMA B;  2MBH A;  2ON8 A;  1F77 A;  2I1K A;  1YQ3 B;  2K25 A;  2EKE C;  2LRU A;  3ZKJ C;  2KJR A;  3GE3 C;  2RPQ A;  3WAL A;  1V8C A;  3JYU A;  1X1M A;  4DXF A;  3NS1 A;  1SE9 A;  2KTF A;  1J7B A;  4NJC A;  2KMM A;  2PEA A;  1N61 A;  2CU1 A;  2C7N B;  2R61 A;  4F1S A;  3MJ5 A;  1ENF A;  1AN8 A;  2LXA A;  4CYE A;  2D07 B;  1BXT A;  3L16 A;  1JWB D;  1SBB B;  1C4A A;  2DHZ A;  4KKJ A;  2DZK A;  2KAC A;  2HTH A;  2RDB C;  1WGR A;  3VRB B;  4I6L B;  3R2T A;  2O6V D;  3PT2 B;  2XK5 B;  1WX7 A;  5IKC M;  4AOF A;  1SJH D;  3RI7 C;  3ALB A;  1JWS D;  4JX1 C;  3ZRF A;  3B2G A;  4IM2 A;  2IDY A;  4TV3 A;  3AE2 B;  1JW9 D;  1SE2 A;  2JUO A;  2N9K A;  1TS5 A;  3N9Y C;  2UYZ B;  3HM6 X;  2N7D A;  4LNI A;  1M94 A;  2IND C;  3RYT A;  3U8Z A;  2QC8 A;  1UUP A;  2KDI A;  2Q5W D;  2QIE B;  1NVI D;  2V3N A;  3N3K B;  4LNO A;  1VDV A;  2XK5 A;  1V5O A;  2MRP A;  3ZNI D;  1FFU A;  1WZ3 A;  2LUE A;  4MSM B;  2WYQ A;  2WXI A;  4ICU A;  3VRA B;  2KWC A;  3DHG C;  3W9C B;  3DWM A;  2I38 A;  3HIZ A;  3IT4 B;  3IAS 1;  1V49 A;  3PTF C;  3M95 A;  3L4P A;  5BMH A;  4TQ1 A;  1L5P A;  4S17 A;  4YXD B;  1ZPS A;  3C8Y A;  3VH4 B;  3DVN V;  2L1A A;  1GB1 A;  3DBH I;  2KK8 A;  2KLC A;  5CHF A;  2AQ2 B;  2HJ8 A;  3PZD A;  2IO1 B;  2MBB B;  2D5G A;  2INN E;  4MM3 B;  3MC0 B;  2V1Y A;  3N1X C;  4ANX A;  3AE8 B;  4ZYS A;  4X57 B;  1E8Z A;  4IW0 A;  3UF8 A;  2Z0D B;  4GLS C;  2BPS A;  4MGZ E;  3AE4 B;  1PGX A;  3AE5 B;  3C0R B;  5MPO A;  2N1W A;  2DZI A;  4GXB A;  1WZ0 A;  2HE7 A;  3NZS A;  2O6V A;  5FR3 A;  3ZXR A;  1QT9 A;  2EMT A;  1V1O A;  2ZVN A;  5DCN A;  2K0P A;  3H6N A;  4JL9 A;  1NDD A;  4BZA A;  1L4Z B;  1NYQ A;  2KKC A;  1STE A;  4W9C A;  3NY5 A;  2KJH B;  3P1M A;  4ANW A;  2N1V A;  3B08 A;  2W9N A;  1NI2 A;  4PS3 A;  1UNS A;  4P6V F;  2M4N A;  1R7S A;  2JRI B;  2JWZ A;  1KH0 A;  1LQB A;  3HM3 A;  3EEC A;  4G0N B;  2PVO D;  2J0M A;  3BWU D;  5IAA C;  3KWV A;  4DDG D;  4II3 B;  5IA7 A;  5HG2 A;  3N30 A;  2DYO A;  4EFO A;  3ML9 A;  1DYQ A;  2RR9 A;  2BTE A;  1I35 A;  4TSS A;  5DPS A;  2MBE A;  1DGJ A;  1YQ4 B;  1AYF A;  4DHZ B;  2BWF A;  2O2V A;  2XBB C;  3RNB C;  3RUL A;  4HRO A;  4J3O D;  1XCQ L;  4M01 A;  4K7U A;  3AMZ A;  1F1H A;  2UU7 A;  1MFW A;  3NVZ A;  2BB5 A;  3N20 C;  3ZQ4 A;  4YTM B;  2W3S A;  2LGY A;  2K5P A;  3Q3M C;  1D4B A;  3KQ4 A;  2JZZ A;  1UWM A;  2D3G A;  3A9K A;  2WXN A;  3RNE C;  1HZ6 A;  1SIF A;  3AI5 A;  2OJR A;  2REX A;  3QX1 A;  2L00 B;  1L4D B;  3NRZ A;  4BOZ B;  1Q0W B;  2X8X X;  3PS6 A;  3IT6 B;  2WS3 B;  3GZN I;  1P1A A;  3OAW A;  1RFA A;  2KVR A;  2ONQ A;  3TEX A;  2YEP F;  1CZP A;  2WDR B;  4OVU A;  2WXR A;  5EDS A;  4YSX B;  4IOI E;  2KMA A;  1QOB A;  1V5T A;  1KJT A;  5BMI A;  3SD5 A;  2QJL A;  4LNN A;  1FO4 A;  4A6Q A;  3A9K B;  3NG0 A;  1F2R I;  2HD5 B;  3Q6B A;  3PO0 A;  2V9H A;  2WXK A;  5HKH A;  4M8M A;  3A4R A;  4RGM A;  3ZGZ A;  4EZL A;  1E8W A;  1ISN A;  3UQA A;  1WM2 A;  2FUH B;  5D7G A;  1TS2 A;  3LDZ E;  5JZE B;  3V6C B;  2M0X A;  3L13 A;  3AU4 A;  2PJH A;  3H7S A;  1KTK A;  4GDK B;  2CJN A;  4A90 A;  3LYY A;  1YX6 B;  2INP E;  4A20 A;  2H89 B;  4KIK A;  1R4N I;  5JXV A;  1RFK A;  2KOX A;  4IM0 A;  1R4M I;  1J8C A;  1VZ6 A;  3NZ3 A;  1WE7 A;  3PRZ A;  2KFK A;  3HK0 A;  2CU3 A;  4C7Z A;  4XE0 A;  3AEA B;  3L54 A;  1S1Q B;  4NJ7 A;  3FC4 A;  4BKT A;  1EO6 A;  4ASW C;  2ZW1 A;  2JQR B;  3P42 A;  3JSV A;  2ZNV C;  1V1P B;  3V6E B;  2LAS A;  4NAM A;  4DDI D;  2MP2 B;  2RDH A;  1N60 A;  3VXW A;  3AEB B;  2FCQ A;  3HVD A;  1V80 A;  4K3B A;  4KX6 B;  2KDF B;  1C9F A;  1P7E A;  3T3N A;  4W9K A;  1WGY A;  2L8J A;  1V81 A;  4GGQ A;  2OJW A;  1FFV A;  4AP4 C;  5IOI A;  3B1L X;  2WX0 A;  4EZK A;  2VH2 A;  3ZW3 A;  3SU8 X;  3BVG A;  1WYG A;  4C00 A;  5L83 A;  2ZCB A;  2KWD A;  3N1Z C;  1C4P A;  3WAM A;  3RNA C;  1VD2 A;  3AE1 B;  2D3A A;  2MCN B;  3DDC B;  3H7P B;  2PMV A;  2V0G A;  4WJQ A;  3KW5 B;  1NEN B;  3EC8 A;  3L10 B;  3UIN B;  2OED A;  3HHM A;  3EGR A;  3EFC A;  3AUL A;  2FID A;  1M4V A;  1WXS A;  1HQR D;  5HHD G;  3PRM B;  2LVQ A;  5LNK 1;  4ZRK A;  3PZ7 A;  3QHT A;  2KLG A;  1E10 A;  2E6X A;  1UBQ A;  5CHV C;  3TCA A;  2KQ4 X;  3URY A;  2KTR B;  3EUB 2;  4FLH A;  3GB1 A;  4M02 A;  3HRD D;  3NUH B;  2NTS A;  4JWU C;  1RM6 C;  2GRI A;  2PKO A;  4HK2 A;  2MJE A;  3RZW C;  3UQB A;  4DXA B;  1TS4 A;  4HEA 1;  2KAJ A;  3P4R B;  3LB8 C;  1WMH A;  3IXS A;  2WXF A;  1IGD A;  4A3O A;  4FJV B;  4KGS A;  4WWN A;  3N1Y C;  2LXC A;  1UZX B;  1E8X A;  1BML C;  3I63 C;  3ZYY X;  1SE3 A;  2MBQ A;  3LXF A;  3RMK C;  2N7J A;  5JH5 C;  1CMX B;  4US9 A;  1Y8R C;  1VLB A;  4DXG A;  1SF0 A;  2M8S A;  1D5M C;  2NVU I;  4RH6 A;  4US8 A;  1JAL A;  3FIL B;  2J7Q B;  2EEL A;  2DNF A;  3RUI B;  2G4S A;  1SE4 A;  4C80 A;  4HDO A;  2NCN A;  3Q3F A;  2C60 A;  1WFY A;  3A1Q B;  2M19 A;  3BVM A;  1OEY A;  4ITK A;  1JCK B;  1FEH A;  4EEW A;  5IP4 D;  2ZCC A;  1SGH A;  2BF8 B;  5AZF A;  1KLV A;  2C5L C;  3AE7 B;  1ET9 A;  1MPE A;  3RFZ B;  4WIP A;  4MDK E;  2WXO A;  4PYZ A;  2K3U A;  4RNA A;  1MG4 A;  3BK2 A;  1WH3 A;  2WDT B;  2NTT A;  3PSE B;  4FHK A;  2KDM A;  2AQ3 B;  4WJO A;  3AB5 A;  1V86 A;  2PPH A;  1SB3 C;  2J0J A;  3RNC C;  5KHQ A;  4NNJ B;  2KDB A;  2L05 A;  3V05 A;  1DOY A;  4WH4 A;  3CF6 E;  3V60 A;  5EE1 A;  2V4L A;  2BS4 B;  2KQ7 A;  1YN3 A;  4ANU A;  4M00 A;  4FN2 A;  5HI1 A;  4HJK A;  1TYG B;  3FKY A;  2N7E A;  3DBL B;  3KUZ A;  3KUC B;  4TUU A;  1N5W A;  1OGW A;  1WXA A;  1L0X B;  1WGG A;  3MTN B;  2DYB A;  3X0W A;  1YOV B;  4RF1 A;  2HTM E;  2KZR A;  3GS2 A;  4OZC A;  2FNJ B;  2KN4 A;  4IC7 B;  4BFR A;  2K8H A;  4W9L A;  4KIK B;  3TBL D;  2YLM A;  4L23 A;  4W9F A;  1VRA B;  2DAF A;  3P4Q B;  3A33 B;  2RPV A;  1WR1 A;  1HZ5 A;  4RM9 A;  2C9W B;  2WGS A;  1QOF A;  3VTW A; 
#chains in the Genus database with same CATH homology
 5IAA C;  4DDG D;  3ZNZ B;  4HVB A;  3TIX A;  2FIF A;  1WM3 A;  2XEW A;  4II3 B;  5C23 A;  5IA7 A;  3N30 A;  1VCB A;  2DYO A;  4EFO A;  3ML9 A;  3R7Q A;  2RR9 A;  1I35 A;  4MGI E;  5DPS A;  3ZIM A;  2MBE A;  1LXD A;  2EMS A;  2JXX A;  4NJ6 A;  1LFD A;  1Q5W B;  4EZJ A;  3APF A;  5JHA A;  3I3T B;  2BWE S;  2JRH A;  5J18 A;  4DHZ B;  2BWF A;  2KWV B;  2O2V A;  2D11 A;  2NBV B;  4XX5 A;  2XBB C;  3RUL A;  4E3C A;  2M17 A;  3WAO A;  1JRU A;  3O65 B;  4K7U A;  4BKG A;  2K6D B;  4HDQ A;  4BBN C;  3DQV A;  3OLM D;  2L7R A;  2DX5 B;  3L17 A;  3KYC D;  1WR6 E;  1YIW A;  2JT4 B;  5D94 A;  4ZRJ A;  5TR5 A;  4B9K A;  4RM8 A;  5J17 A;  3PRP B;  1RAX A;  1IPG A;  3PPA A;  4KDL B;  2N9P C;  3L08 A;  4AJW A;  2KNB A;  2LGY A;  3PLV A;  2CHX A;  4E74 A;  2MSE D;  1WI0 A;  2BYF A;  2MBO A;  2AL6 A;  4GDL A;  3VQI A;  4E71 A;  3ONS A;  1YD8 U;  1TZ1 A;  2IO0 B;  2JZZ A;  4LJO B;  4DHZ E;  2D3G A;  1GG3 A;  3A9K A;  4ANV A;  2PE9 A;  4DBG A;  3V62 A;  1D3Z A;  1SIF A;  2LVP A;  3AU5 A;  3JW0 X;  3AI5 A;  2KX0 A;  4W9I A;  2OJR A;  4JQW C;  2BYV E;  2REX A;  3QX1 A;  2AWT A;  2MX2 A;  2LZ6 A;  1GUA B;  2N9X A;  2GBM A;  2MWS B;  4BKS D;  2L00 B;  4AUQ C;  3QAR A;  4EOY A;  2LRW A;  1UGM A;  4BOZ B;  1Q0W B;  1QZE A;  3PS6 A;  4P7I A;  3ZO5 B;  2O2V B;  1MG8 A;  3UIO B;  2BGF A;  2GBK A;  1UEL A;  2KO3 A;  3GZN I;  1WXM A;  1P1A A;  3OAW A;  1RFA A;  2GMI C;  2JZ3 B;  2KVR A;  3M62 B;  1WJU A;  3QWZ B;  5AEK B;  2IYD B;  1BT0 A;  2BKR B;  4K1R B;  4TQ0 A;  4KSK C;  2Z59 B;  1V9J A;  4OVU A;  2OOB B;  4LDT B;  3VFK A;  1OQY A;  5FR6 A;  3VHT C;  5EDS A;  4EKU A;  5J2R A;  1WF9 A;  2AYO B;  2L3Z A;  3VUY A;  3DPD A;  3QA8 A;  2KFJ A;  2KMA A;  4JGH B;  1GC6 A;  1Q1O A;  2LWP A;  2Z0E B;  1K8R B;  1E5W A;  1V5T A;  1KJT A;  1H4R A;  1L7Y A;  3QJZ A;  1V2Y A;  4GB9 A;  3SD5 A;  2RSU A;  4KZC A;  2DYM A;  3BY4 B;  3A9K B;  1A5R A;  4DWF A;  2HD5 B;  3R66 C;  5E6P A;  2N9E B;  3K9P B;  2GBN A;  1P9D U;  3N32 A;  3JSV B;  3KVF B;  5HKH A;  4M8M A;  3VAW A;  3U30 A;  2NR2 A;  3A4R A;  2KDE B;  2KC2 A;  5BO4 B;  3DVG X;  4EZL A;  4HWI B;  3KUD B;  1E8W A;  4HCN B;  2R2Q A;  1ISN A;  3UQA A;  1IYF A;  2N4F A;  5LLI A;  2L0F A;  1WRD B;  1WM2 A;  3NOB A;  2FUH B;  4MEL A;  5D7G A;  3IVF A;  2ZVO A;  3LDZ E;  4NQL B;  1S3S G;  4B6W A;  3VUW A;  3SDL C;  2KAN A;  5JZE B;  2ZPY A;  4MJS B;  4MM3 A;  3PGE A;  2D2Q A;  5E6O A;  4GMV A;  3S2A A;  4ZRI A;  3V6C B;  1H8C A;  2M0X A;  2V3S A;  3B0A A;  4G3X B;  4K7S A;  4AJY B;  3LJ3 A;  4N9F 4;  4WJN A;  2UWQ A;  4F7Z A;  2ZZP B;  3DVG Y;  2FAZ A;  3L13 A;  3EHV A;  4BVU C;  4HPM B;  4W9H A;  3APC A;  3AU4 A;  2PJH A;  3H7S A;  4FJZ A;  4GDK B;  4HPL B;  4WWO A;  3KYD D;  3ZLZ A;  2D10 A;  3DBS A;  2IBI B;  1YX5 B;  1YX6 B;  2JF5 A;  2JY6 A;  3PHX B;  3VVW B;  2IY1 B;  3WAN A;  1TGZ B;  1KOT A;  2AL3 A;  4A20 A;  5C1Z A;  4FBJ B;  1WIA A;  4KIK A;  2KC1 A;  1R4N I;  4IM0 A;  1WY8 A;  2KOX A;  2KX3 A;  3UGB B;  3RT3 B;  1R4M I;  3PVL A;  3DVN U;  3W1S C;  1J8C A;  4ZDV A;  1WE7 A;  3PRZ A;  4W9J A;  4KSL C;  2KFK A;  3HK0 A;  1C3T A;  1EUV B;  3AXC A;  4DHJ B;  2R2O A;  4FHJ A;  4IWP A;  3L54 A;  2A5U A;  1S1Q B;  2NS5 A;  4NJ7 A;  3ZUN A;  5L95 C;  1P3Q U;  2IY0 B;  2AEH A;  4BKT A;  4FAD A;  4GOC A;  1EO6 A;  4ASW C;  2J0K A;  3H7P A;  4PS7 A;  3JSV A;  4KV2 A;  2ZNV C;  4I6P A;  3V6E B;  4BKS A;  2LGD A;  1E90 A;  2LAS A;  3P2B A;  3A1Q A;  1RRB A;  5LXH A;  2LI5 A;  2MP2 B;  4DDI D;  5CTR C;  3VXW A;  1FXT B;  3QC8 B;  1WJN A;  2FCQ A;  4JLC A;  4MGY E;  4NAW A;  4MEM A;  4G50 A;  1RLF A;  2QHO A;  5DPW A;  4CO7 A;  3CST A;  4K7W A;  3W1S A;  3GOE A;  4W9G A;  1V80 A;  5D6J B;  2Y5B B;  3OJ4 B;  3ZTD A;  4OVV A;  2JPH A;  3VH3 B;  2GBJ A;  2K6Q A;  2KDF B;  4MJS A;  4W9K A;  5KHO A;  2FCN A;  4GSW A;  2M1M A;  5CHW A;  1WGY A;  5G2N A;  1Z5S B;  1TTN A;  2L8J A;  1P0R A;  1V81 A;  1WX9 A;  4IG7 B;  4GGQ A;  3PLU A;  4CHK A;  1G6J A;  1EF5 A;  2DAJ A;  3CSF A;  2KMC A;  4M0W B;  4GDK A;  2ZJD A;  4AP4 C;  3RCZ A;  4NY0 A;  2RD0 A;  1WYW B;  3B1L X;  4NPN A;  2WX0 A;  4GU2 A;  3NZU A;  4EZK A;  5DPR A;  4FJY A;  1WMH B;  4AWJ A;  5DPT A;  1LM8 B;  4II2 B;  1E7U A;  3ZW3 A;  1P98 A;  3SU8 X;  1J0G A;  4PS8 A;  2KTR A;  3W1Y A;  3X23 A;  3T9L A;  1YJ1 A;  2YVC A;  3CMM B;  4HLE A;  2NPT A;  2LD9 A;  3KH0 A;  2I1J A;  2FCM A;  2JVC A;  5L83 A;  2MP2 A;  2ZCB A;  4ZYN A;  2KJ6 A;  4FUL A;  3Q3J A;  3A4S C;  2K1F A;  2IO2 B;  2PE6 B;  3WAM A;  1GJZ A;  4JIO U;  4NAW B;  2NBU A;  1C1Y B;  2VRR B;  1VD2 A;  2CHW A;  3ML8 A;  1ZKH A;  3K9O B;  2MCN B;  3DDC B;  3H7P B;  3DBR I;  2K8B A;  4KDI C;  3IHP C;  4M8N A;  4BOS C;  4WJQ A;  2LJ5 A;  3KW5 B;  3EC8 A;  3L10 B;  3UIN B;  3WIM A;  3HHM A;  4IWO A;  3AUL A;  3EFU A;  1XQQ A;  2FID A;  4IUM B;  1WXS A;  3ZVV A;  1WE6 A;  1WXV A;  4WAA A;  3PRM B;  1E8Y A;  2LVQ A;  3QK0 A;  4J6I A;  2KQS A;  3V61 A;  1XD3 B;  1GC7 A;  2MA9 B;  2G3Q B;  4ZRK A;  1U4A A;  3QHT A;  1NBF C;  2KLG A;  1WJ4 A;  4WQO B;  3IFW B;  1UBQ A;  5CHV C;  2MBH A;  1F9J A;  1PQS A;  4ICV A;  3TCA A;  2NBW B;  2I1K A;  2C7H A;  4HXD A;  3NHE B;  2K25 A;  2EKE C;  2KTR B;  4FLH A;  2LRU A;  4LDT D;  3U7D A;  3ZKJ C;  2KJR A;  2RPQ A;  2IZV B;  3SHQ A;  3WAL A;  3DOW A;  2G45 B;  3JYU A;  1X1M A;  1SE9 A;  2KTF A;  1L2N A;  3A9J B;  4HK2 A;  3RZW C;  3UQB A;  4DXA B;  4F8C B;  4MGK E;  2PEA A;  1WMH A;  1YQB A;  2KN5 A;  2CU1 A;  1OEY J;  2C7N B;  3QAQ A;  4F1S A;  3QIJ A;  4A3O A;  4URK A;  4FJV B;  4WWN A;  3QQ8 B;  4LJP B;  2ASQ A;  2LXA A;  4BBN F;  4CYE A;  2LXC A;  1UZX B;  1E8X A;  2D07 B;  3L16 A;  1ZW7 A;  2DHZ A;  2L76 A;  2DZK A;  3ENE A;  2MBQ A;  2MW5 A;  4PYU A;  2C7M B;  2DZM A;  2HTH A;  2KHW B;  1OTR B;  2K39 A;  1WGR A;  1E7V A;  5JH5 C;  4IM3 A;  4I6L B;  4MH0 E;  1CMX B;  3VTU A;  2DEN B;  1GNU A;  1Y8R C;  3L0W B;  2O6V D;  3PT2 B;  3H9D A;  2XK5 B;  4G11 A;  2M8S A;  1WX7 A;  2NVU I;  3RZF A;  2KWU B;  5AZH A;  4AOF A;  3ZDT A;  3A9J A;  4NQK E;  5AZG A;  4YL8 A;  2J7Q B;  3RUI B;  5JHB A;  3ALB A;  3IG3 A;  1T0Y A;  2G4S A;  3WA0 A;  3NS8 A;  4FA6 A;  4HDO A;  3ZRF A;  2NCN A;  4IM2 A;  3DCG A;  2LVO A;  2ZPN A;  3Q3F A;  4LCD E;  4TV3 A;  4DK5 A;  2C60 A;  1WFY A;  3A1Q B;  3ZNG C;  5CX3 A;  1OEY A;  2JUO A;  3PHW B;  4EEW A;  1KM7 A;  2UYZ B;  2ZCC A;  3HM6 X;  2N7D A;  2CHZ A;  1M94 A;  1SGH A;  2BF8 B;  5AZF A;  4WJP A;  2ZNV B;  3RYT A;  1KLV A;  2C5L C;  3U8Z A;  2FCS A;  4I6N B;  2KDI A;  3WAP A;  2KD0 A;  3TMP B;  1Z2M A;  2G4D B;  2O6V B;  3APD A;  3N3K B;  4MDK E;  2DZJ A;  3QCA A;  5LXI B;  1WGH A;  4PYZ A;  2XK5 A;  3PRE A;  1V5O A;  2MRP A;  3MHS D;  3ZNI D;  4XC2 A;  1WH3 A;  3VUX A;  2WDT B;  1WZ3 A;  3ZNH B;  2LGX A;  2LUE A;  4MSM B;  2GBR A;  3PSE B;  2WYQ A;  4FHK A;  3UIP B;  4WJO A;  1XT9 B;  4ICU A;  1V86 A;  2KWC A;  2PPH A;  4W9E A;  2A4Z A;  3HIZ A;  2J0J A;  5KHQ A;  2MLB A;  1V49 A;  4NNJ B;  1UBI A;  3PTF C;  1J19 A;  3M95 A;  1WJ6 A;  2MQJ A;  2KDB A;  2L05 A;  2GOW A;  3R7R A;  4TQ1 A;  1TBE A;  3BIN A;  3IBE A;  2WWZ A;  1AAR A;  1EF1 A;  3RD2 A;  3H1U A;  3CF6 E;  4MSQ B;  3DVN V;  3VH4 B;  3V60 A;  1ZGU B;  4KVG B;  2V4L A;  3DBH I;  4K81 A;  2KK8 A;  3JVZ X;  2KLC A;  2WX1 A;  5CHF A;  2KQ7 A;  4XZ4 A;  2HJ8 A;  5G55 A;  3PZD A;  2IO1 B;  3TL5 A;  5D2M B;  1UH6 A;  2MBB B;  2ZEQ A;  4ANU A;  3D32 A;  4B95 A;  4FN2 A;  4HCP B;  2V1Y A;  4HJK A;  4ANX A;  2NPT B;  3OJ3 A;  2N7E A;  1E8Z A;  4X57 B;  4IW0 A;  3UF8 A;  3KUZ A;  2Z0D B;  2BPS A;  3KUC B;  4MGZ E;  2CS4 A;  4TUU A;  5E6N A;  3C0R B;  1I42 A;  1OGW A;  1WXA A;  2CKH B;  2CR5 A;  2N1W A;  4A3P A;  1WGG A;  3MTN B;  2DZI A;  2KXJ A;  4WWP A;  2BYE A;  2DYB A;  4GXB A;  1UD7 A;  1WZ0 A;  2HE7 A;  3NZS A;  4RMA A;  5GMV A;  1WGD A;  2O6V A;  3X0W A;  1WX8 A;  2L0T A;  1IP9 A;  2EMT A;  3ZTC A;  2ZVN A;  5DCN A;  3T8M A;  3H6N A;  4JL9 A;  1NDD A;  2KZR A;  3ZDM C;  2RGF A;  3VTV A;  2KKC A;  2BKF A;  2FNJ B;  4IC7 B;  3DBL I;  4W9D A;  4W9C A;  3VDZ A;  2IO3 B;  4EUT A;  4DHJ D;  3NY5 A;  4TKN A;  3TJP A;  4BFR A;  2K8H A;  3M63 B;  2KJH B;  4W9L A;  4GN1 A;  3M3J A;  4ANW A;  2K8C A;  4KIK B;  3TBL D;  2N1V A;  3B08 A;  2W9N A;  3ECI A;  1NI2 A;  4PS3 A;  2YLM A;  4GIV A;  2M4N A;  3PV1 A;  3R3M A;  4W9F A;  2JRI B;  2JWZ A;  2DAF A;  4KZ0 A;  1LQB A;  3HM3 A;  2B3A A;  3A33 B;  3ZRC A;  3EEC A;  1WR1 A;  4G0N B;  4IWQ A;  3MJW A;  4RM9 A;  1HE8 A;  1V6E A;  2C9W B;  4GDL B;  2KFK B;  3VTW A;  2J0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...