2O39C

Human adenovirus type 11 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
126
structure length
126
Chain Sequence
CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fiber protein
publication title Adenovirus type 11 binding alters the conformation of its receptor CD46.
pubmed doi rcsb
source organism Human adenovirus 11p
molecule tags Viral protein/immune system
total genus 20
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2o39C02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2o39C01
3RJ3D 2CG7A 3IX0A 2G7IA 4FXGG 2CG6A 1MD8A 5JPMG 3GXEA 3NFPI 3MQLA 4AYDA 1VVCA 1G4GA 1QUBA 2W80A 4J38B 1TPMA 1ELVA 2IZ4A 1VVDA 2EHFA 2RLPA 2KRIA 1GKNA 1FBRA 3CALA 1UOTP 2O39C 2RKZA 1LY2A 4ONTD 2W81A 1QGBA 4DJZA 1OK1A 1U5MA 2UWNA 4PZ5A 2MCZA 1OJVA 2MCYA 1HFIA 3ZD2A 2XWJI 3T5OA 2XWBF 4KKDA 2YRAA 4B2RA 4F4OC 2JRAA 3ZRZA 1H2PP 1E88A 1Z92B 5HYTB 1TPGA 1E8BA 2WIIC 3INBC 4CSYA 2XRDA 4K12A 4ZH1D 3R62A 3L89M 1C1ZA 1OK2A 1HCCA 2JGWA 2V8EA 1Q3XA 2A55A 4LOSA 2QY0A 3KZJA 5HYUB 4AYMA 2B5ID 5HZPB 1E5GA 4B2SA 3ERBA 4WJG2 5FO8C 2ERJA 1NWVA 1ZJKA 1MD7A 4JHSA 4LOTA 3ZD1A 3GOVA 2RL0A 4YNXA 4IGDA 3KXVA 2BZMA 1SRZA 5I0QB 1OK3A 2KMSA 1H03P 2EC3A 5HYPA 2XRBA 1TPNA 1O9AA 1H2QP 1H04P 3OXUD 1SS2A 1HFHA 3OP8A 4AYIA 1QO6A 4A5WB 4AYEA 2RKYA 3EJHA 3SW0X 3O8EB 1OJYA 1GKGA 2XQWC 2CKUA 2IZ3A 1CKLA 4MUCA 3M7PA 1OK9A 3IU3I 2LOJA 1G4FA 2YBYA 1OJWA 2JGXA 2RLQA 3TVJA 3OEDC 1PPQA 4C16A 1GPZA 1GHQB
chains in the Genus database with same CATH superfamily
3WSXA 3FGRA 3RJ3D 2CG7A 3IX0A 2G7IA 4FXGG 2CG6A 1MD8A 5JPMG 3GXEA 3NFPI 3MQLA 4AYDA 1VVCA 3F6KA 1G4GA 1QUBA 2W80A 2Y8RA 4J38B 5DN4A 2Y8SA 1TPMA 1ELVA 2IZ4A 1VVDA 2EHFA 2RLPA 2KRIA 4YIZA 1GKNA 1FBRA 3CALA 1UOTP 2O39C 2X2ZA 2RKZA 1LY2A 4ONTD 2W81A 1QGBA 4DJZA 1OK1A 1U5MA 2UWNA 4PZ5A 2MCZA 4PO7A 1OJVA 2MCYA 1HFIA 3ZD2A 2XWJI 3T5OA 2XWBF 4KKDA 2YRAA 4B2RA 4F4OC 2JRAA 3ZRZA 4N7EA 1H2PP 4APLA 1E88A 1Z92B 5HYTB 1TPGA 1E8BA 2WIIC 3INBC 4CSYA 2XRDA 4MSLA 4K12A 4BWCA 4ZH1D 3K3TA 3R62A 3L89M 1C1ZA 1OK2A 1HCCA 2JGWA 2V8EA 1Q3XA 2A55A 4LOSA 2QY0A 3ZLDA 3KZJA 5HYUB 4AYMA 2B5ID 5HZPB 1E5GA 4B2SA 3VWOA 3CI0J 3ERBA 4WJG2 5FO8C 2ERJA 1NWVA 1ZJKA 1MD7A 4JHSA 4LOTA 3ZD1A 3GOVA 2RL0A 4YNXA 4IGDA 3KXVA 2BZMA 1SRZA 5I0QB 1OK3A 1RLHA 2KMSA 2ZYCA 1H03P 2EC3A 5HYPA 2XRBA 1TPNA 1O9AA 1H2QP 1H04P 3OXUD 1SS2A 1HFHA 3OP8A 4AYIA 1QO6A 3WSYA 4A5WB 4AYEA 3ZLEA 5DN5A 2RKYA 3EJHA 3SW0X 3NJAA 3O8EB 1OJYA 1GKGA 2XQWC 2CKUA 3FGTA 2IZ3A 1CKLA 4MUCA 3M7PA 1OK9A 3IU3I 2LOJA 1G4FA 2YBYA 2Y8TA 1OJWA 2JGXA 2RLQA 3TVJA 3OEDC 1PPQA 2I2LA 4C16A 1GPZA 1GHQB
chains in the Genus database with same CATH topology
3RJ3D 2CG7A 3IX0A 2G7IA 4FXGG 2CG6A 1MD8A 5JPMG 3GXEA 3NFPI 3MQLA 4AYDA 1VVCA 1G4GA 1QUBA 2W80A 4J38B 1TPMA 1ELVA 2IZ4A 1VVDA 2EHFA 2RLPA 2KRIA 1GKNA 1FBRA 3CALA 1UOTP 2O39C 2RKZA 1LY2A 4ONTD 2W81A 1QGBA 4DJZA 1OK1A 1U5MA 2UWNA 4PZ5A 2MCZA 1OJVA 2MCYA 1HFIA 3ZD2A 2XWJI 3T5OA 2XWBF 4KKDA 2YRAA 4B2RA 4F4OC 2JRAA 3ZRZA 1H2PP 1E88A 1Z92B 5HYTB 1TPGA 1E8BA 2WIIC 3INBC 4CSYA 2XRDA 4K12A 4ZH1D 3R62A 3L89M 1C1ZA 1OK2A 1HCCA 2JGWA 2V8EA 1Q3XA 2A55A 4LOSA 2QY0A 3KZJA 5HYUB 4AYMA 2B5ID 5HZPB 1E5GA 4B2SA 3ERBA 4WJG2 5FO8C 2ERJA 1NWVA 1ZJKA 1MD7A 4JHSA 4LOTA 3ZD1A 3GOVA 2RL0A 4YNXA 4IGDA 3KXVA 2BZMA 1SRZA 5I0QB 1OK3A 2KMSA 1H03P 2EC3A 5HYPA 2XRBA 1TPNA 1O9AA 1H2QP 1H04P 3OXUD 1SS2A 1HFHA 3OP8A 4AYIA 1QO6A 4A5WB 4AYEA 2RKYA 3EJHA 3SW0X 3O8EB 1OJYA 1GKGA 2XQWC 2CKUA 2IZ3A 1CKLA 4MUCA 3M7PA 1OK9A 3IU3I 2LOJA 1G4FA 2YBYA 1OJWA 2JGXA 2RLQA 3TVJA 3OEDC 1PPQA 4C16A 1GPZA 1GHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJ3 D;  2CG7 A;  3IX0 A;  2G7I A;  4FXG G;  2CG6 A;  1MD8 A;  5JPM G;  3GXE A;  3NFP I;  3MQL A;  4AYD A;  1VVC A;  1G4G A;  1QUB A;  2W80 A;  4J38 B;  1TPM A;  1ELV A;  2IZ4 A;  1VVD A;  2EHF A;  2RLP A;  2KRI A;  1GKN A;  1FBR A;  3CAL A;  1UOT P;  2O39 C;  2RKZ A;  1LY2 A;  4ONT D;  2W81 A;  1QGB A;  4DJZ A;  1OK1 A;  1U5M A;  2UWN A;  4PZ5 A;  2MCZ A;  1OJV A;  2MCY A;  1HFI A;  3ZD2 A;  2XWJ I;  3T5O A;  2XWB F;  4KKD A;  2YRA A;  4B2R A;  4F4O C;  2JRA A;  3ZRZ A;  1H2P P;  1E88 A;  1Z92 B;  5HYT B;  1TPG A;  1E8B A;  2WII C;  3INB C;  4CSY A;  2XRD A;  4K12 A;  4ZH1 D;  3R62 A;  3L89 M;  1C1Z A;  1OK2 A;  1HCC A;  2JGW A;  2V8E A;  1Q3X A;  2A55 A;  4LOS A;  2QY0 A;  3KZJ A;  5HYU B;  4AYM A;  2B5I D;  5HZP B;  1E5G A;  4B2S A;  3ERB A;  4WJG 2;  5FO8 C;  2ERJ A;  1NWV A;  1ZJK A;  1MD7 A;  4JHS A;  4LOT A;  3ZD1 A;  3GOV A;  2RL0 A;  4YNX A;  4IGD A;  3KXV A;  2BZM A;  1SRZ A;  5I0Q B;  1OK3 A;  2KMS A;  1H03 P;  2EC3 A;  5HYP A;  2XRB A;  1TPN A;  1O9A A;  1H2Q P;  1H04 P;  3OXU D;  1SS2 A;  1HFH A;  3OP8 A;  4AYI A;  1QO6 A;  4A5W B;  4AYE A;  2RKY A;  3EJH A;  3SW0 X;  3O8E B;  1OJY A;  1GKG A;  2XQW C;  2CKU A;  2IZ3 A;  1CKL A;  4MUC A;  3M7P A;  1OK9 A;  3IU3 I;  2LOJ A;  1G4F A;  2YBY A;  1OJW A;  2JGX A;  2RLQ A;  3TVJ A;  3OED C;  1PPQ A;  4C16 A;  1GPZ A;  1GHQ B; 
#chains in the Genus database with same CATH topology
 3WSX A;  3FGR A;  3RJ3 D;  2CG7 A;  3IX0 A;  2G7I A;  4FXG G;  2CG6 A;  1MD8 A;  5JPM G;  3GXE A;  3NFP I;  3MQL A;  4AYD A;  1VVC A;  3F6K A;  1G4G A;  1QUB A;  2W80 A;  2Y8R A;  4J38 B;  5DN4 A;  2Y8S A;  1TPM A;  1ELV A;  2IZ4 A;  1VVD A;  2EHF A;  2RLP A;  2KRI A;  4YIZ A;  1GKN A;  1FBR A;  3CAL A;  1UOT P;  2O39 C;  2X2Z A;  2RKZ A;  1LY2 A;  4ONT D;  2W81 A;  1QGB A;  4DJZ A;  1OK1 A;  1U5M A;  2UWN A;  4PZ5 A;  2MCZ A;  4PO7 A;  1OJV A;  2MCY A;  1HFI A;  3ZD2 A;  2XWJ I;  3T5O A;  2XWB F;  4KKD A;  2YRA A;  4B2R A;  4F4O C;  2JRA A;  3ZRZ A;  4N7E A;  1H2P P;  4APL A;  1E88 A;  1Z92 B;  5HYT B;  1TPG A;  1E8B A;  2WII C;  3INB C;  4CSY A;  2XRD A;  4MSL A;  4K12 A;  4BWC A;  4ZH1 D;  3K3T A;  3R62 A;  3L89 M;  1C1Z A;  1OK2 A;  1HCC A;  2JGW A;  2V8E A;  1Q3X A;  2A55 A;  4LOS A;  2QY0 A;  3ZLD A;  3KZJ A;  5HYU B;  4AYM A;  2B5I D;  5HZP B;  1E5G A;  4B2S A;  3VWO A;  3CI0 J;  3ERB A;  4WJG 2;  5FO8 C;  2ERJ A;  1NWV A;  1ZJK A;  1MD7 A;  4JHS A;  4LOT A;  3ZD1 A;  3GOV A;  2RL0 A;  4YNX A;  4IGD A;  3KXV A;  2BZM A;  1SRZ A;  5I0Q B;  1OK3 A;  1RLH A;  2KMS A;  2ZYC A;  1H03 P;  2EC3 A;  5HYP A;  2XRB A;  1TPN A;  1O9A A;  1H2Q P;  1H04 P;  3OXU D;  1SS2 A;  1HFH A;  3OP8 A;  4AYI A;  1QO6 A;  3WSY A;  4A5W B;  4AYE A;  3ZLE A;  5DN5 A;  2RKY A;  3EJH A;  3SW0 X;  3NJA A;  3O8E B;  1OJY A;  1GKG A;  2XQW C;  2CKU A;  3FGT A;  2IZ3 A;  1CKL A;  4MUC A;  3M7P A;  1OK9 A;  3IU3 I;  2LOJ A;  1G4F A;  2YBY A;  2Y8T A;  1OJW A;  2JGX A;  2RLQ A;  3TVJ A;  3OED C;  1PPQ A;  2I2L A;  4C16 A;  1GPZ A;  1GHQ B; 
#chains in the Genus database with same CATH homology
 3RJ3 D;  2CG7 A;  3IX0 A;  2G7I A;  4FXG G;  2CG6 A;  1MD8 A;  5JPM G;  3GXE A;  3NFP I;  3MQL A;  4AYD A;  1VVC A;  1G4G A;  1QUB A;  2W80 A;  4J38 B;  1TPM A;  1ELV A;  2IZ4 A;  1VVD A;  2EHF A;  2RLP A;  2KRI A;  1GKN A;  1FBR A;  3CAL A;  1UOT P;  2O39 C;  2RKZ A;  1LY2 A;  4ONT D;  2W81 A;  1QGB A;  4DJZ A;  1OK1 A;  1U5M A;  2UWN A;  4PZ5 A;  2MCZ A;  1OJV A;  2MCY A;  1HFI A;  3ZD2 A;  2XWJ I;  3T5O A;  2XWB F;  4KKD A;  2YRA A;  4B2R A;  4F4O C;  2JRA A;  3ZRZ A;  1H2P P;  1E88 A;  1Z92 B;  5HYT B;  1TPG A;  1E8B A;  2WII C;  3INB C;  4CSY A;  2XRD A;  4K12 A;  4ZH1 D;  3R62 A;  3L89 M;  1C1Z A;  1OK2 A;  1HCC A;  2JGW A;  2V8E A;  1Q3X A;  2A55 A;  4LOS A;  2QY0 A;  3KZJ A;  5HYU B;  4AYM A;  2B5I D;  5HZP B;  1E5G A;  4B2S A;  3ERB A;  4WJG 2;  5FO8 C;  2ERJ A;  1NWV A;  1ZJK A;  1MD7 A;  4JHS A;  4LOT A;  3ZD1 A;  3GOV A;  2RL0 A;  4YNX A;  4IGD A;  3KXV A;  2BZM A;  1SRZ A;  5I0Q B;  1OK3 A;  2KMS A;  1H03 P;  2EC3 A;  5HYP A;  2XRB A;  1TPN A;  1O9A A;  1H2Q P;  1H04 P;  3OXU D;  1SS2 A;  1HFH A;  3OP8 A;  4AYI A;  1QO6 A;  4A5W B;  4AYE A;  2RKY A;  3EJH A;  3SW0 X;  3O8E B;  1OJY A;  1GKG A;  2XQW C;  2CKU A;  2IZ3 A;  1CKL A;  4MUC A;  3M7P A;  1OK9 A;  3IU3 I;  2LOJ A;  1G4F A;  2YBY A;  1OJW A;  2JGX A;  2RLQ A;  3TVJ A;  3OED C;  1PPQ A;  4C16 A;  1GPZ A;  1GHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...