2O3FA

Structural genomics, the crystal structure of the n-terminal domain of the putative transcriptional regulator ybbh from bacillus subtilis subsp. subtilis str. 168.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
78
Chain Sequence
MATGGLAIIQSMHLPPSERKLADYILAHPHAIESTVNEISALANSSDAAVIRLCSLGLKGFQDLMRVAGDLAKPTFQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator ybbH
publication title The crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 25
structure length 78
sequence length 83
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01418 HTH_6 Helix-turn-helix domain, rpiR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2o3fA00
1J5YA 4R1HA 5LRRA 1FWZA 4CO8A 3WODF 3N97A 1L3LA 2XVCA 3T0YA 2E1NA 2W25A 1BI1A 1T6SA 1Z1DA 5L3EA 5H6QA 1USTA 2DAOA 1LNWA 2QWWA 2ESHA 4UXNA 5F1RA 1OYYA 2Z5UA 5L3FA 4I09A 4RS8A 3CUQB 3GVAA 5ILVA 1R1VA 3DXJF 1J9IA 2FEZA 2EWNA 1KU2A 2VBWA 1OYIA 1ZARA 1BN5A 4FT8A 4KN4X 4XLNF 4BHBA 1S6LA 1HSTA 3QAHA 4RAZA 3DPLC 2EK5A 2OAZA 3W6JB 1MJ9A 5CVJA 3BJ6A 4HZFA 3FM3A 4KFCA 5LGTA 2X0LA 4YIIA 3K1NA 4G8XA 1O3SA 2L54A 4FX4A 1DPUA 2NNYA 1T98A 3EYYA 1RIOH 3I53A 2RQPA 4RGRA 1EH7A 1XGOA 2DI3A 1K7AA 3I4PA 2PBIA 1W7PB 2EFNA 5HS9A 4UVAA 3HOTA 1SMYF 2M1BA 4LLGF 3FMSA 3ULQB 2A61A 4KN7X 1KYWA 3GWZA 3ZP5A 4PZJA 4LB5A 1YO5C 4Q4ZF 5DCFA 1J7KA 5DV5A 4G6QA 1DUXC 1CF7B 1P4XA 3ZN1A 5KK1A 2LF8A 2O8XA 1FOKA 1PUEE 1HW1A 2K7LA 4KMUX 1R5HA 1H9TA 3HIFA 2FBKA 1ZHFA 4XRFA 2YX7A 4M9XA 1WRJA 4G7OF 4N9HA 2XGXA 1G3WA 2FMYA 4KT5C 1F4KA 3GF2A 1ZLKA 3R6SA 1XSVA 2C6YA 5ICFA 3TKYA 2O6GE 4FHTA 2YSRA 3C1DA 2CSOA 4KDPA 1HQCA 3CLOA 4Q47A 1PP8F 3LAPA 3DPTA 1Y0UA 1H0MA 1X3UA 3WTTC 3IHUA 4RB3C 3D0SA 2PLYA 3MFKA 2IA2A 6PAXA 3KFWX 4OIPF 2JPBA 5AIPA 5LEJA 5HLGA 4MNUA 4N0BA 4U0WA 4AWXB 4RGUA 3GO5A 4L18B 3KE2A 1HXDA 1OMIA 1XCVA 2HS5A 4CGZA 3RYRA 1XGMA 2VBYA 3U2RA 3LWFA 4ZYHA 4L9TA 1FC3A 5HOOA 1LEAA 3DEUA 3KZZA 3KEQA 1FBQA 1A04A 3LAJA 2GWRA 3BPVA 5F64A 4ON0A 4RAYA 5D6EA 5D5UB 5L3DA 4KYWA 5HS7A 3LA2A 5DCMB 4LG0A 3GXOA 2A5YB 1QZYA 2IW5A 2H6BA 2L4MA 3WG9A 2HEOA 4BAYA 1ZYRF 2A6EF 2IJLA 4RGXA 1FBUA 2RKHA 2HZTA 4M74A 2IA1A 1F1ZA 1XSDA 4UVBA 1TNSA 3ZMUA 5DEQA 2GXBA 1LQ1A 2QQBA 4RB0A 5L3CA 3WTXC 4I2OA 3E97A 2Y0MA 4LLNA 2ZCWA 2R7DA 2NNNA 4EJOA 4P55A 1IN5A 3H92A 5D5WB 4HW0A 3FXRA 2XAGA 4ZYDA 3HRTA 4LG0B 4LK0F 2D1HA 4EM0B 4I0AA 2K86A 3T8RA 1KU3A 3JAMK 2BGCA 5D8LB 3VOEA 2HQRA 2ELHA 4EM2A 4K2EA 2Z9OA 3HSEA 2MLKA 4MQ9F 1I5ZA 3V8LA 3DFGA 1J59A 5DDGA 4IPAA 2Z3YA 2HYGD 2DO7A 1BOAA 1ONVA 5DUIA 5K5RA 3C7JA 3WE3A 3V7SA 4GYIA 4OU0A 3GZ6A 4XSXF 3ZMTA 3IL2A 1TQMA 1F9NA 2EA4A 3L9FA 4EQQA 3DQVC 3BJOA 2J5PA 1Q1HA 1EH6A 1HW5A 4U7DA 4BXUA 4AIKA 3RYPA 3C3WA 1YTYA 1U8RA 2VODA 3WGIA 4OIQF 5D4RA 1RUOA 1U5TA 1UHWA 4LFUA 1IZ1A 2KJBA 3E5XA 2ZMEB 3KP3A 5BS6A 1BM9A 5E8IA 3EUHA 2EFOA 2RNJA 1MD0A 4ZZLA 3SZPA 2OZ6A 2OQRA 4L5JA 4B8XA 3GYHX 3LQQA 1C0WA 4IRHA 2HWVA 1XGNA 2ETHA 2P4WA 3G3ZA 2QVOA 3ZMVA 2PG4A 3P9CA 2GAUA 4G6DA 4UNOA 1ZN2A 3HTUA 2E7XA 3CO6C 2W57A 5CVIA 3OV8A 5LHHA 2XROA 2NAZA 3T8TA 3JSPA 2FMLA 3WGHA 1SAXA 4WX9A 3F8NA 2VC1A 2P6SA 5EEGA 3BY6A 3P9IA 3NQOA 3V4GA 2M5WA 4R8HA 3RJPA 2IA0A 2G7HA 3KCCA 2O3FA 1Z05A 3RKWA 3HUGA 1W4MA 1JE8A 2M45A 1E2XA 2HGCA 3JAMZ 1R23A 1FBSA 4E70A 1XSXA 1O57A 1P92A 5LLQA 1BI3A 3FHZA 5LBQA 2LKPA 5HDNA 2KRFA 3M8EA 3PQKA 3ZN0A 3MWMA 1B59A 3SXYA 2GQQA 3HTSB 5E17F 1ULYA 2X4HA 5JVTA 3J7AO 4Z2YA 1FSEA 3NEUA 3L00A 4LD5A 3RDIA 3MEXA 3TQNA 5TJJA 5TRDA 4F7ZA 5H20A 3IKTA 4O3MA 1QPMA 1LJ9A 1I27A 2FXAA 2FNPA 3FMQA 1XCBA 4IHTA 3U9GA 2P8TA 3SQNA 3HHGA 4HF2A 3QP6A 1LDDA 3CUQA 3VB2A 3KZYA 3DF8A 5J6XA 1LDKB 3P7NA 2OD5A 3ABUA 4FX0A 2XASA 2RDPA 2V1DA 2Y75A 4L9VA 1IN6A 4MTEA 1WWXA 3KP7A 3SZTA 2OBPA 2DW4A 1YG2A 2G7UA 4KIGA 3EETA 5J8CA 5HDGA 3R0AA 2P6TA 5HVQC 4BHPA 1CGPA 2F2EA 3R0JA 1ZG3A 2GA1A 4WXCA 3GEZA 2OA4A 2CWEA 3REOA 4R79A 2M8EA 1S3JA 5ICEA 1BBYA 1QBJA 3ZMSA 4Y17A 1W7PA 3J81K 1JHFA 2F5FA 5LGNA 2FBHA 1UFMA 2LSOA 2ZNYA 4CZZA 2NRAC 4P9FA 4LB6B 4IVNA 4PDKA 5BPIA 3WTVC 1QZZA 4ENNA 4CDGA 4PCQA 2DQRA 2JPCA 4BH9A 2ISYA 4G9YA 1ZRDA 4I7HA 2FRHA 3DP7A 3BROA 1HKTA 1MJBA 3AAFA 2YPRA 5CYVA 1CF7A 4KMFA 3KP6A 2DU9A 4AIJA 2M87A 4HDUA 3FWEA 3I0TA 1UCRA 3M7GA 3TDUC 5HLHA 3J80K 2JZYA 2Z99A 4A5NA 4HX8A 3CDHA 5E1WA 1W7PD 1YIOA 4RB1A 3K1PA 3ERED 2PMHA 4EV0A 2ISZA 4XLPF 4AIHA 5D4SA 3MCZA 4XSZF 3F23A 2QYOA 3I54A 3DKWA 5KVRA 1U3EM 2NYXA 2L02A 4M9ZA 4P5OA 5HLIA 2E1CA 2BEOA 2M30A 2D45A 3RTRA 3E6MA 1OPCA 3BOQA 1BIAA 1OR7A 1UB9A 2QBYB 1KQ8A 2ZO4A 4IJAA 2R3SA 3ZMDA 1Z6TA 2QZ8A 2P7VB 3JTHA 5BOXA 2EB7A 1IN7A 3I5UA 1JGSA 3CO7C 1BJAA 4LLLA 5E8GA 2D1VA 1KQ0A 2VXZA 2XAFA 3KP2A 3B02A 3HRUA 4WF2A 4IXAA 5JR3A 2R7FA 1W5SA 3EYIA 3RI4A 3BWGA 4EJTA 3J81Z 3QP5A 1MDMB 2VBZA 2KIFA 3TGNA 1FP1D 1ZLJA 5E1ZB 2QM3A 4ENJA 1REPC 5DCMA 1P6RA 2UZKA 2ZNZA 2XRNA 4Q5SF 3DV8A 4YIFA 1DP7P 3RPQA 4A2UA 4D0PA 4GYGA 1IAWA 1ZG5A 5L3BA 2P5LC 3F8BA 1ZH5A 4LMYA 1RZ4A 1LVAA 4HA8A 4CXFA 3I71A 1EH8A 2HOEA 2EFQA 3BJAA 1FLIA 2EV0A 3R60A 1BI2A 1R1TA 2A6HF 1T0FA 4KA4A 3J80Z 1FYMA 5FFXA 2Z33A 3F8MA 4G7ZF 4ESFA 4HQEA 2KIMA 2OQGA 1FNNA 2JT1A 1TTYA 1J0RA 2DK8A 1R00A 3HOSA 5D5XB 3TDZC 1MJAA 4KIBA 1IXRC 4BYYA 4IRIA 5CLSA 2FBIA 2HR3A 1OYWA 2GZWA 4MEXF 3RKXA 4I01A 1K6OA 3BP8A 2PN6A 2EFWA 5ICCA 3IWFA 2XKOA 3IWZA 4OOIA 1KU9A 2O61A 2CO5A 1YLFA 1WI9A 1XMAA 3I58A 3WE2A 2RGVA 4GCVA 4CHUA 2EV5A 3TOBA 2FQ3A 3HRMA 5D5VB 3T1BA 1ODDA 3FXUA 4ETSA 4A5MA 2V6CA 1U6GA 1YS7A 2F5CA 2DLLA 1GXPA 2ZMEA 3Q5FA 1LB2A 2A3SA 5E18F 4EJUA 4KIFA 5DUKA 3E5UA 2XKPA 5BPDA 4PGGA 1K78B 4HBLA 4DNCA 4YFKF 1XDUA 2BV6A 2W24A 4LK1F 1O3TA 1T38A 1KA8A 5FFZA 1P4WA 4ENKA 1S8NA 1G3YA 3MQ0A 3S2WA 1G6NA 2L4AA 2FOKA 3O2PE 3E6CC 4S05A 1SFEA 2IT0A 3F22A 3E3VA 1IN4A 2F5DA 3IKVA 2VOPA 3FF5A 2CG4A 1G4DA 3WGGA 2MH2A 3QRFF 1SD6A 2ESNA 1IF1A 4HLYA 1WKMA 3GW2A 1W5TA 3V8JA 1HBXG 1FX7A 3HSFA 5D6FA 4MTDA 1J75A 1BIBA 3F72A 3TO7A 4YG2F 3F8CA 1WQ2A 1ON1A 2DFIA 3IRRA 1FPQA 3F6OA 1AOYA 3VEPA 2UWMA 4EGYA 1KYZA 3NRVA 3HHHA 4L5IA 3QOPA 2B0LA 5JI6A 4CICA 4WXDA 1TLHB 4NHJA 2RC4A 4EJWA 2MA3A 1Z6RA 2HDCA 3CJNA 3I64A 3ZQ7A 2UXXA 5CJ9A 4WK8F 1IXSB 3E5QA 3QPTA 3WTSC 2FA5A 4IHSA 1R7JA 2Q8KA 2Q0OA 2K27A 1LEBA 1YS6A 1MZBA 2LDUA 5FLXK 2J5OA 2PMUA 5LHGA 1PDNC 3SHFA 1FSHA 2D2WA 4M73A 1YFHA 3I59B 1YW7A 1S29A 1JXSA 3WTYC 2BE5F 1R5GA 3ELKA 2QENA 2G9WA 2KJCA 3WTUC 1U5TC 3K2ZA 1QNTA 3Q9SA 2QQAA 1O7LA 2CQKA 4A12A 1JHHA 2K02A 4M71A 3KEOA 3MAJA 3EQLF 5L3GA 2K4BA 3E6DA 2GA2A 5IT9K 5A2QK 4YFXF 1YYVA 1GVJA 2ACJA 3GFLA 4HV5A 3M9AA 2EJRA 3ECHA 1RUNA 3OOPA 2F5EA 1B1BA 2ZKZA 1I6XA 2TDXA 1J2XA 2YX4A 2VE9A 4M72A 2RN7A 2DBBA 4OIOF 5AONA 5JFRA 1S7OA 3GZ5A 2XAQA 3WU1B 1B4AA 3PFIA 3ZMZA 4AD9A 3B73A 2STTA 3L09A 2WC2A 2OU2A 5BQTA 1FY7A 4MEYF 2O03A 1D8JA 2JSCA 1QO0D 1XB4A 2LNBA 1G3TA 2DPUA 4YFNF 5FO5A 2PQ8A 4O6JA 5BMZA 3T5XA 2GXGA 3JSOA 1SFXA 4HF1A 1H9GA 2FF4A 5FLXZ 3GFIA 4HDVA 2HQNA 2HTSA 2XAJA 2P5KA 2XHKA 3LA7A 5ED4A 4Y15A 2A07F 5IT3A 2HKXA 3IC7A 2L01A 2OZUA 4AVPA 2HTJA 1QQIA 2MC3A 3U1DA 1TBXA 3KLOA 2STWA 3CUQC 2K4JA 3C18A 1R58A 2RV8A 2FU4A 2ZJ2A 3ZPLA 3MZYA 4L0ZB 4CYDA 2GIVA 1O3QA 5EEHA 1GHCA 4HQMA 2A68F 1TW3A 3M8FA 2QBYA 5IT9Z 5A2QZ 2ZFWA 3O6BB 3GX4X 1OKRA 2V9VA 1KU7A 4EM1A 3LSTA 1I1SA 5ILSA 1NHAA 2H09A 4I98B 2DPDA 1GXQA 3K0LA 3LFKA 1T2KA 3R4KA 1SFUA 2O0YA 4UHTA 1K79A 4L0YB 4EMSA 4KUMA 4DQ2A 1FZPB 1MDMA 1XGSA 1RI7A 2PJPA 3WU0A 2EA2A 1BC7C 1SD7A 2CGPA 4HF0A 3ABTA 4HX7A 1L0OC 3E6BA 2IPQX 5K1YA 4L9JA 1SD4A 3GFJA 4TV7A 3BZ6A 1D3YA 1UHMA 3V7CA 3V7RA 2DQLA 1HKSA 3SFZA 2CYYA 3LQRA 5K5QA 5CVUA 5JHUA 1FP2A 2LF7A 1V4RA 4GXOA 1KQ9A 4PGHA 4WXHA 2QLZA 5LEKA 4RGSA 1MGTA 4UVCA 3JW4A 3COAC 4A6EA 4EJVA 2ADUA 3PQJA 3G73A 2IVMA 5DD8A 4RB2C 5DD4A 3M1EA 5CVVA 4U0YA 2VBXA 4M6YA 4UV9A 1AWCA 1XN7A 3GLXA 4QWQA 1D8KA 5H6RA 4LGWA 5E1XA 3MZHA 4I02A 1BI0A 3IRQA 2PI0A 1ZRCA 1O7FA 1SD5A 1G3SA 1IRGA 4EGZA 4OMYA 1R1UA 2HFHA 3V8KA 1HW2A 4Y13A 3CTAA 1VTNC 1ZGAA 4U7BA 2P5VA 2UXNA 4U0VA 3ROUA 2DK5A 3QU3A 2ZXJA 2HKOA 2VONA 4P96A 2FNAA 3K9TA 4A0XA 1D5VA 1HKQA 4ENMA 3ISPA 3FMRA 3GUDA 4NB5A 2VE8A 1P4AA 4IRGA 1XD7A 2YR2A 1ZREA 2WTEA 5K5OA 2VN2A 4BNCA 1IUYA 3K69A 3CUOA 4HX4A 5HS8A 4OMZA 2VC0A 2Y48A 2E7WA 1E17A 1XMKA 1K78A 4A0YA 3TO6A 3FXQA 1B6AA 2BBYA 2XAHA 1B9MA 2MH9A 3TO9A 2MBFA 4ZYGA 1U2WA 4ESBA 1XDSA 5FD5A 3H3ZA 3HYIA 2PFBA 4JBAA 1MKMA 5FB2A 2P7CB 4UUVA 1QGPA 4NQWA 3KP4A 2YU3A 4HOBA 1O3RA 5LGUA 1SMTA 2FSWA 3D5LA 3BDDA 4KNYA 5ILUA 3JTGA 2IRFG 1FYLA 4A0ZA 5FD6A 2JTVA 5F6FA 2Q2EA 1YW8A 4I0BA 1Z9CA 1FYKA 1TQPA 3KETA 2CFXA 2H6CA 4HAMA 3RIRA 2KKOA 2H94A 5LRSA 3O3KA 2IP2A 3WTWC 5DYMA 2CW0F 4N9IA 3BPXA 3L7WA 4U88A 1P2FA 4ESJA 3LA3A 2L3DA 4HV6A 3WTZA 3FZVA 3L2CA 1R36A 1ZGJA 4M6XA 1YQAA 1B9NA 2XUBA 4O5VA 1RNLA 1YW9A 1S7AA 1V3FA 3TOAA 1KGSA 4BHCA 4MHGA 1BC8C 2ZBKA 3N4MA 5E20A 2XIGA 5CVRA 5AIQA 4BQAA 2JRTA 1IRFA 2PEXA 2EFPA 1T39A 3I59A 4XBFA 4G94A 1R22A 1ON2A 1WSUA 4IF4A 1U78A 2V79A 5LHIA 4JQFA 4WCGA 4ZYEA 1IXCA 2XV4S 2V1UA 1U5TB 2COMA 4M9SA 1ZG1A 2BYVE 1FT9A 4S04A 4LJZF 3QU6A 2QUFA 4G7HF 2FE3A 2RVCA 3VFZA 1ZRFA 3W6KB 4WWCA 2KIUA 2H27A 1F5TA 4OIRF 3R61A 4MGRA 4OINF 2NS0A 3EDPA 4UV8A 3VODA 3KLNA 4QLCU 3KP5A 5J8FA 2VOOA 3F6VA 3FX3A 4P9UA 4ZH4F 2W85A 2DT5A 1STZA 1IW7F 2VT3A 4EVIA 5FGMA 3P9KA 3RKYA 2AXLA 1DPRA 3ECOA 4ZZDA 1EV7A 2AS5F 3Q9VA 2MLGA 3H3UA 5D8KB 2HYFA 2VT2A 4HLXA 4Q48A 1Z91A 1TW2A 1Z7UA 4ASNA 3FM5A 4HYEA 4A6DA 4H0EA 1HSJA 1ZAOA 5ERIA 2W84A 2WV0A 1LDJA 2QQ9A 1I1GA 4B09A 2MD5A 1USSA 3HRSA 4JK1X 4GO1A 2DTRA 2A69F 4L9NA 2WWYA 3F21A 1IN8A 5HDKA 3RPUA 3QPHA 3GFMA 2V1XA 1DDNA 4MQVA 4KICA 1TNTA 1PP7U 3HSRA 4GGGA 2EV6A 1TQIA 3ML6A 3F8FA 5ICGA 3F3XA 3K1MA
chains in the Genus database with same CATH superfamily
1J5YA 2E19A 2WB1A 3K4JA 4R1HA 5LRRA 4UUSA 3CF5F 2E34A 1FWZA 4CO8A 2DJIA 1QVUA 3WODF 3N97A 1L3LA 2XVCA 5M5YJ 3T0YA 2E1NA 2W25A 1YX3A 1BI1A 1T6SA 3G1MA 1Z1DA 1WJEA 5L3EA 5GTIC 1GLNA 1XG1A 5H6QA 3GTJJ 1USTA 2DAOA 1LNWA 2QWWA 1RR8C 1W1WE 1U9NA 2ESHA 4UXNA 4XN0A 5F1RA 1OYYA 3EUKL 4ZJZA 2R7TA 2Z5UA 4XOTA 3H1CA 3GLLA 3CCMI 3D5RC 1B72B 5L3FA 3DKXA 4I09A 2QSHX 4RS8A 2IGOA 3CUQB 4MIMA 3GVAA 5ILVA 1R1VA 3DXJF 1J9IA 3FXLA 4BS9A 1WJAA 4JX5A 2M2EA 4HRIA 1TZLA 2FEZA 2X9DA 2EWNA 3GTLJ 4ZYAA 3ZXSA 1KU2A 2VBWA 3RCOA 1OCPA 3I3LA 2BW3A 1BJZA 3RPUD 4NDLA 1FOXA 1OYIA 1ZARA 3CCSI 1BN5A 4BE2A 4FT8A 4KN4X 4XLNF 3H35A 4BHBA 2K9SA 1D1CA 1S6LA 2F6CA 2JUGA 1HSTA 1N78A 3QAHA 3MKYB 4RAZA 3DPLC 3M07A 3DBLB 2EK5A 2NS7A 2OAZA 4EATA 2L9VA 3HEFA 3MKZA 3W6JB 1MJ9A 1Z3YA 4BQQA 1H88C 5CVJA 3BJ6A 4HZFA 3FM3A 3SZGA 2LOOA 4KFCA 1WHUA 4D9JA 2MGQA 5LGTA 4A3IJ 2L9NA 2E60A 2X0LA 2M4KA 4YIIA 4ZDPA 2V26A 3K1NA 4G8XA 4XRSG 1O3SA 4X6AJ 3NWSA 3BCAA 2L54A 1HF0A 4FX4A 1DPUA 3CCLI 3Q0WA 2NNYA 3K4MA 3CCVI 1T98A 1RPWA 1TWAJ 2EZHA 4BGDA 4XRMA 4B3AA 3EYYA 1RIOH 1GUUA 3I53A 2RQPA 4RGRA 3I4MJ 5EEAA 1OCCH 1EH7A 4JX4A 4F52A 2BW3B 1XGOA 2B9SA 2DI3A 2CUZA 1K7AA 4PFOA 3I4PA 2PBIA 1W7PB 2EFNA 5J40A 5HS9A 4UVAA 3HOTA 3HOXJ 1Z67A 1SMYF 3KYDB 2M1BA 3OYIA 4LLGF 2GXAA 4XIDA 2V6EA 2CUEA 3FMSA 3ULQB 2A61A 4KN7X 1KYWA 4PJJA 3GWZA 3ZP5A 1A6QA 4PZJA 4LB5A 2Z16A 2HQAA 1YO5C 4Q4ZF 3OL4A 5IP6A 1BL0A 2HVRA 5DCFA 1J7KA 2X6WA 5DV5A 4G6QA 1DUXC 2KHMA 3E1SA 3GTPJ 3H3VK 2PJRA 1CF7B 1P4XA 3ZN1A 1OFCX 5K7HA 3ABLH 2M7BA 5KK1A 4DYRA 2LF8A 2O8XA 2H8WA 4IHXA 1FOKA 3CMAI 2BZTA 1PUEE 1HW1A 2K7LA 4KMUX 1R5HA 3H9QA 1LFUP 1H9TA 3BTIA 3HIFA 1Y0NA 2FBKA 2ZFUA 5C4JJ 3CD6I 5IYDJ 1ZHFA 4XRFA 3ASNH 4OWRB 2IS1A 2EILH 2YX7A 4M9XA 1WRJA 5B1BH 4G7OF 4Y3OA 3PSIA 4N9HA 2IAIA 2XGXA 4BJ6C 1G3WA 2FMYA 4KT5C 4HNTA 1F4KA 4RM3A 4A3EJ 4BDZA 3GF2A 1M1EB 1ZLKA 3R6SA 1XSVA 3CMMA 2C6YA 4G6TB 5ICFA 3TKYA 4C3IJ 3FXMA 4FHTA 2O6GE 3PO3J 2YSRA 3C1DA 2CSOA 4KDPA 2MW8A 1HQCA 3CLOA 4Q47A 1PP8F 3MN2A 3LAPA 3DPTA 1UJ8A 1Y0UA 2DA2A 3G6EI 1H0MA 1X3UA 3WTTC 2JA2A 3AG4H 3IHUA 4RB3C 4ZDLA 1QU3A 3FKIJ 2DJNA 2B7EA 3D0SA 2PLYA 3MFKA 4LIUA 5EDNA 2MYSA 2IA2A 6PAXA 3GZNB 4CCMA 5IOYA 5J47A 2QEXI 3KFWX 3OS2A 2JPBA 4OIPF 2BY2A 2ZC2A 1MH4A 5AIPA 5LEJA 5HLGA 4MNUA 1W36D 4N0BA 4U0WA 4AWXB 4A3GJ 4BL0B 4RGUA 3GO5A 5F1JA 4L18B 3KE2A 1FOYA 2GLOA 1HXDA 2XPUA 3L2QA 1OMIA 1XCVA 2HS5A 2HU9A 1AA7A 4CGZA 3RYRA 1R4NB 3IV5A 1XGMA 4CA0A 2VBYA 2LYCA 3U2RA 3LWFA 1MBFA 1QRYA 2FOWA 2F48A 4ZYHA 4L9TA 1FC3A 5HOOA 4QPOA 1RKWA 2O7OA 1LEAA 3DEUA 2R7UA 4E7HA 3KZZA 3KEQA 1FBQA 3PNVA 4OAZA 1A04A 1JJ8C 3TMOA 2DMTA 3PJRA 2E36A 3LAJA 2HDWA 2KT0A 2GWRA 3BPVA 5F64A 1VQKI 3QPSA 3U21A 3TW7A 1VF9A 3NARA 2E1OA 2IGKA 4ON0A 3FHNA 2RREA 4RAYA 4CCLA 4A93J 5F04A 5D6EA 1BR1A 1JGGA 1VQOI 4QIWN 5D5UB 3FIWA 3SDBA 5L3DA 4KYWA 5FLVA 5IOZA 1G8XA 5JVGF 5HS7A 2GIZA 1H8AC 3CP8A 3LA2A 2WAFA 5DCMB 4LG0A 3GXOA 2A5YB 1QZYA 3RZOJ 2IW5A 2H6BA 2L4MA 3OWTA 2W48A 3WG9A 2R7SA 2HEOA 4BAYA 3WG7H 1YOVB 3J7YJ 1ZYRF 5HODA 1S7EA 1VNDA 2A6EF 4PJLA 2IJLA 4DBQA 4RGXA 1FBUA 2RKHA 1Z3XA 3E0JB 2HZTA 4M74A 2IA1A 2LVSA 1F1ZA 2ZJQF 1XSDA 4UVBA 1VQ4I 1TNSA 2XPVA 3ZMUA 5DEQA 2GXBA 1MBHA 3TP0A 1LQ1A 2KZGA 2QQBA 4RB0A 1X3ZB 5L3CA 3WTXC 4I2OA 3E97A 2Y0MA 1RKTA 3BG6A 2PX9A 4AU7A 4LLNA 2IS2A 1S5LC 2ZCWA 1WJDA 2R7DA 2NNNA 4EJOA 3S17J 1VQPI 4P55A 1IN5A 3H92A 4PJMA 3RSNA 4BJTA 5D5WB 2L5QA 3KYCB 2HOTA 4H4KC 4HW0A 2MABA 5K7ZA 3FXRA 2XAGA 1UAAA 1X4PA 1NK3P 4ZYDA 4MLOA 3HRTA 4LG0B 5CQGA 3QYBA 1QA6A 2OJED 3I9V2 4LK0F 2D1HA 3QQAA 4BQNA 4AC0A 4EM0B 3OMYA 5BNGA 3J7ZI 2NVXJ 4I0AA 3FXOA 3DEEA 2K86A 2CV0A 2IS4A 2MFZA 2ICWG 5J1RA 3T8RA 1KU3A 3JAMK 2BGCA 3B6CA 5D8LB 3VOEA 1ZQ3P 2HQRA 3TW6A 2ELHA 2LH9A 5JLWA 4EM2A 4K2EA 2Z9OA 3HSEA 2MLKA 4MQ9F 1YIJI 5GAEJ 2KIQA 1I5ZA 2R5YA 2XF6A 1LFBA 1X1AA 3V8LA 3DFGA 3BR1A 1J59A 5DDGA 4IPAA 5EZHA 2Z3YA 2HYGD 3FKJA 2DO7A 3HOVJ 5LD2C 1BOAA 1ONVA 5DUIA 2TRTA 5K5RA 4CZCA 3C7JA 3WE3A 3V7SA 1MSEC 2WAQN 5FKMA 4GYIA 4OU0A 3GZ6A 4XSXF 3ZMTA 4BUPA 4A3MJ 4XONA 4RM2A 3IL2A 1TQMA 1F9NA 2EA4A 3L9FA 2IEKA 4EQQA 3DQVC 2BY1A 2J5PA 2CQQA 3BJOA 1SVOA 1Q1HA 1EH6A 1G59A 1HW5A 5M3FJ 4U7DA 3HOZJ 2CUJA 4BXUA 3CC4I 4E4HA 4LIVA 2XGDA 4AIKA 3RYPA 3C3WA 2XRLA 2MSYA 1LE8A 3OYCA 3ZQFA 3GCMA 1YTYA 1U8RA 2VODA 3IAM2 1X2MA 3WGIA 4OIQF 4DW6A 5D4RA 3FDYA 3PL8A 1OISA 1RUOA 1U5TA 1V55H 2LK2A 2UV1A 2R5ZB 1UHWA 4NC8A 3OYEA 2R7XA 4LFUA 1IZ1A 2KJBA 1JKPC 1JJ6C 1OCZH 2YUSA 2HPIA 2ZMEB 3E5XA 1AKHB 3CCYA 3KP3A 5IP9J 1VQ8I 5BS6A 2VQHA 1JI8A 1BM9A 3KIOA 1IRXA 5E8IA 3EUHA 2EFOA 2RNJA 1MD0A 1HA8A 4ZZLA 4W1UA 3SZPA 2OZ6A 2OQRA 4L5JA 3MVPA 4B8XA 2DXIA 3DEWA 3LQQA 3GYHX 1C0WA 4IRHA 1JUMA 3BR3A 2DYRH 2VL8A 2HWVA 1X1DA 2ZSIB 5CQEA 3GTMJ 3ZQHA 4XLEA 1ETYA 1SEUA 1XGNA 3VDXA 3W2VA 2ETHA 4KJZA 2P4WA 3G3ZA 2QVOA 3ZMVA 2PG4A 2K85A 2GAUA 3P5JA 3P9CA 4G6DA 4UNOA 3A2KA 4FQGA 1ZN2A 5FKOA 3HTUA 3ZQQA 2X1DA 3G71I 2JSPA 2E7XA 5F0FA 1IDYA 1BR2A 2DA7A 3C2HA 5IY5H 3OY9A 1N25A 4LOCA 3CO6C 2W57A 5CVIA 3OV8A 5LHHA 2XROA 3C2BA 2QCOA 1WH5A 2JN6A 4HPQA 4E7LA 4E7JA 3DLAA 3A03A 4RAGA 1Q1VA 2NAZA 3T8TA 1WVRA 2AXTC 3JSPA 2X1EA 2FMLA 3IH4A 3WGHA 3A01B 2CV2A 1SAXA 2ID6A 4F55A 2VJ5A 4WX9A 3OYFA 4IX7A 2E2JJ 3F8NA 3L1PA 3L2VA 2VC1A 3A0BC 2P6SA 2OUMA 5EEGA 3BY6A 3P9IA 1TT0A 3NQOA 2BXZA 3V4GA 1D1BA 2LREA 2M5WA 4R8HA 3ABMH 3RJPA 2IA0A 2G7HA 4KITB 3KCCA 2O3FA 1Z05A 4JX6A 3RKWA 4A3BJ 3HUGA 1W4MA 1JE8A 3EPZA 2M45A 1E2XA 2HGCA 3CZ6A 3JAMZ 1R23A 4AVZA 1FBSA 1APLC 2L7MP 3QPLA 4IKFA 4E70A 2GOXB 1XSXA 1O57A 3NAUA 3FXKA 3HM5A 5B5EC 1P92A 2PMZN 2NXNB 3OR1C 3ZGKA 5LLQA 1BI3A 3FHZA 5LBQA 2A5WA 2LKPA 3AG2H 5HDNA 1SVLA 2KRFA 3M8EA 3PQKA 4NC6A 4XORA 3ZN0A 1X1BA 1VQ7I 3MWMA 1B59A 4DYQA 3S93A 1P7JA 3AKZA 4YIRX 3SXYA 2GQQA 3MKWB 3JRIA 4RDUA 3IUOA 3HTSB 5E17F 1ULYA 3K7AJ 4B4CA 3LNQA 2X4HA 2LRDA 5JVTA 4D5CA 3J7AO 4Z2YA 1FSEA 4F92B 3NEUA 4RBOA 3RQIA 3L00A 4LD5A 2EIMH 3RDIA 3MEXA 3TQNA 1X19A 3PO2J 5TJJA 4CYCB 1LUJB 4E7ZA 5TRDA 1ETWA 2XPWA 4F7ZA 1TT5B 5H20A 3IKTA 3HJEA 3BQYA 3FK7A 1PUFB 1CQTA 4O3MA 1QPMA 1LJ9A 2VQLA 1I27A 4UUTA 1J09A 2FXAA 1NG6A 2FNPA 2DTZA 1X2NA 1JUSA 1B72A 3FMQA 1XCBA 4IHTA 2TCTA 2OC6A 2P8TA 3HHGA 3SQNA 3U9GA 4HF2A 3QP6A 1W0TA 1LDDA 3CUQA 3VB2A 3KZYA 4Y33A 4XNFA 4II3A 5E3LA 3DF8A 3OOUA 1P9QC 5J6XA 1LDKB 3A02A 3P7NA 2OD5A 3ABUA 4FX0A 1H89C 2XASA 2RDPA 2DFFA 2V1DA 3BTJA 2DYSH 2G0EA 2Y75A 4YEJA 4L9VA 4A3DJ 2LMDA 1IN6A 4MTEA 2XGCA 3Q0UA 3HDDA 1WWXA 2E1MB 1JKOC 5J3LA 5IPAA 3KP7A 3SZTA 2OBPA 1MBJA 2DW4A 1YG2A 2BHYA 2I10A 2G7UA 4KIGA 1ZR4A 3EETA 2HXOA 5KCMA 5J8CA 5HDGA 1WJCA 1VI0A 3R0AA 5FLMJ 3RKQA 2DMNA 2NVYJ 2P6TA 5HVQC 3K4CA 4BHPA 4C3JJ 1BOBA 1CGPA 2CH0A 2F2EA 4AIDA 3R0JA 1ZG3A 2GA1A 4WXCA 3OS1A 3GEZA 2DCEA 1Z77A 1JUPA 2OA4A 3OIOA 4Y7NJ 2IXSA 2CWEA 3REOA 4R79A 3VYTB 3BG9A 1NK2P 4CCKA 3KX2A 2M8EA 1S3JA 5ICEA 1BBYA 2CW7A 3OYLA 1QBJA 3ZMSA 1ZK8A 4Y17A 1ETXA 1VQ6I 2KFDA 1W7PA 3J81K 1JHFA 2F5FA 5LGNA 2XF5A 1XX5A 1N75A 2NVQJ 2FBHA 1UFMA 2OTJI 2K40A 2LSOA 2ZNYA 4CZZA 1DQUA 2NRAC 4P9FA 4LB6B 4IVNA 4PDKA 5BPIA 3WTVC 4A3LJ 1QZZA 4ENNA 4CDGA 4PCQA 2DQRA 2JPCA 4FE4A 1NH3A 4BH9A 2V4JC 2ISYA 4G9YA 4E7IA 1ZRDA 2V9PA 1SVMA 4I7HA 1FMWA 1MNDA 3LFUA 2FRHA 3DP7A 4YRVA 2XF7A 3KPHA 3BROA 1HKTA 4BE0A 3CQZJ 1MJBA 2IGMA 2ECBA 3AAFA 1BR4A 2O5RA 2W82A 2YPRA 1VQ9I 5CYVA 4XOPA 1CF7A 4KMFA 4JOMA 1A6IA 2DA1A 2F5VA 3KP6A 1YX5A 2DU9A 2ME0A 3WHCA 5EGOB 3CCJI 4AIJA 2M87A 4HDUA 3FWEA 2P81A 3I0TA 4MO7A 3L2RA 2OPTA 1UCRA 2E35A 3M7GA 4BXXJ 2WAQA 5HNFA 5EG0B 3TDUC 5HLHA 3J80K 4M3DA 2JZYA 5J1UA 2Z99A 1OCRH 4A5NA 4HX8A 2H1LA 2ME6A 3CDHA 2CV1A 3Q3SA 5E1WA 1W7PD 1YIOA 2DMQA 4RB1A 2JA7J 1ZTRA 3LOCA 4A3KJ 2M0CA 3K1PA 3HOUJ 3DTIA 2L7ZA 3ERED 2PMHA 3W2WA 2OV7A 4EV0A 5M5XJ 3NWTA 2ISZA 4XLPF 1RRJA 3BCBA 4EEFG 4AIHA 5D4SA 3VWBA 3AL0C 3MCZA 2Y2ZA 4XSZF 3F23A 2KL4A 2QYOA 3I54A 2JJ7A 2JVGA 3DKWA 2H8RA 5KVRA 1U3EM 1SFKA 2NYXA 2L02A 4M9ZA 1DP3A 4P5OA 3F0CA 3I56I 5HLIA 2Y9ZA 2E1CA 2BEOA 5GPAA 2M30A 2D45A 3CDIA 3JRDA 3RTRA 2V1NA 3E6MA 5F0HA 1S72I 4B48A 2WADA 1Y6IA 1OPCA 3QOEA 3BOQA 4M3GA 3OYAA 1BIAA 1OR7A 2X48A 1FOWA 1UB9A 4FISA 3S32A 3OYBA 2QBYB 4ITVA 1KQ8A 2ZO4A 4IJAA 1HC8A 4XN3A 2R3SA 4QPQA 2VKHA 3ZMDA 1Z6TA 1ORKA 2QZ8A 4BXFA 1YRNB 2P7VB 3JTHA 5BOXA 2EB7A 1IN7A 3I5UA 4C2TA 4BBSJ 1JGSA 3CO7C 1BJAA 4LLLA 4IHVA 5E8GA 2D1VA 1KQ0A 2VXZA 2XAFA 3KP2A 3B02A 3HRUA 4PSXA 4WF2A 2XB0X 4IXAA 3AG1H 5JR3A 1MMSA 5FKNA 2R7FA 1W5SA 2XB5A 3EYIA 4V19K 3RI4A 5M5WJ 3BWGA 4EJTA 3J81Z 3VSLA 3QP5A 3BR2A 1WJFA 1EA3A 1OJLA 1MDMB 2VBZA 2JA5J 2KIFA 3HL2A 3TGNA 1FP1D 1AU7A 1ZLJA 2R93J 4IOCF 4N4OB 4ZTFA 5E1ZB 2QM3A 4CCOA 4M3EA 3HC7A 4DZJA 4ENJA 1REPC 5DCMA 1P6RA 2UZKA 3JR9A 2ZNZA 2XRNA 4Q5SF 3DV8A 4YIFA 1DP7P 3RPQA 2DDBA 4A2UA 2K3PA 4D0PA 3D5SC 1R71A 1MBKA 2LC2A 2CQXA 4GYGA 5FRNA 1IAWA 1ZG5A 5L3BA 2P5LC 3F8BA 2K9NA 4LITA 2PMZA 1ZH5A 3GBGA 4LMYA 1RZ4A 4DOZA 1LVAA 4HA8A 3JRGA 2FX0A 4CXFA 1D0YA 3I71A 3BJAA 1EH8A 2EFQA 2HOEA 3S1RJ 1FLIA 2WA0A 2JUCA 2EV0A 3R60A 2HVSA 1BI2A 1R1TA 2A6HF 2B63J 4B1RA 1T0FA 4KA4A 4OAYA 2EH3A 3WHBA 3J80Z 1W36C 2CRGA 5FFXA 4BU2A 1FYMA 4BE1A 3ZQCA 3GTOJ 2Z33A 4X0GA 1MW7A 4PUSA 3F8MA 4XLFA 4G7ZF 3OIPA 4AUXA 3HZJA 4ESFA 1V5FA 2KPMA 4HQEA 3BC8A 2KIMA 2OQGA 2CMPA 1FNNA 1X3WB 2JT1A 4D7NA 1OR7C 3ZCOA 1TTYA 1J0RA 2BXYA 2DK8A 1R00A 4XICA 3HOSA 5D5XB 2LTPA 3TDZC 3L2UA 4C2MJ 1MJAA 4KIBA 4PJ0C 3LSJA 2M8GX 3H5NA 1IXRC 3MMYB 4BYYA 2V9KA 3TBIA 4IRIA 4XMYA 5CLSA 3M1CA 1B8IB 2BY0A 2FBIA 1X1CA 5TGTA 2EZKA 2HR3A 2WY8Q 1OYWA 3PSFA 2Y0SN 2GZWA 2NVTJ 4MEXF 2KQRA 2VUMJ 3RKXA 1Y8RB 4I01A 1K6OA 4N4NB 3K70D 2JA6J 3BP8A 1WI3A 2PN6A 2F4OB 3DTKA 2EFWA 2VASA 5ICCA 1LFPA 3GTKJ 2R7OA 2Y30A 3IWFA 4U87A 1QVTA 5GPCA 2XKOA 3IWZA 4OOIA 1GVDA 2CQ7A 2D5VA 1KU9A 3SJMA 4XRSA 1DU0A 4F3QA 2LKXA 2O61A 2N8GA 1IG7A 1E3PA 3I4NJ 2CO5A 4DBRA 3W3CA 2VIXA 4RLQA 1YLFA 1W5CC 3S14J 1WI9A 1XMAA 3I58A 4HG2A 4B47A 1GV2A 3WE2A 5IP7J 2OTLI 2RGVA 5KAIC 4GCVA 4CHUA 2K5CA 2EV5A 3TOBA 4CH7A 2FQ3A 3HRMA 3ONQA 4B44A 5D5VB 3T1BA 1ODDA 3FXUA 4GFBA 1MMDA 4ETSA 4A5MA 1K6YA 1RESA 2BVLA 4GRIA 1NG7A 2V6CA 1D0XA 3CDLA 3OIQA 1U6GA 3PNYA 1YS7A 2F5CA 2R5ZA 2K3FA 2DLLA 1GXPA 2ZMEA 3Q5FA 4IQJA 1AKHA 1LB2A 1E3HA 3CCEI 1JKRC 2A3SA 3QODA 2CQNA 5E18F 1MMGA 1T0FC 2QF7A 4EJUA 5EF6A 4KIFA 5DUKA 3E5UA 2XKPA 5BPDA 1IV6A 4PGGA 1K78B 4HBLA 4DNCA 4YFKF 1XDUA 1X58A 2BV6A 3S15J 2W24A 4LK1F 2R7RA 1O3TA 5JLXA 3A4CA 1T38A 1KA8A 5CKTA 5FFZA 1I50J 1P4WA 1R4MB 1UG0A 4ENKA 1S8NA 1G3YA 1K4SA 3MQ0A 4X1EA 1T33A 3S2WA 3K6GA 1G6NA 2L4AA 3JREA 2FOKA 3O2PE 3E6CC 2FQ4A 3IH2A 5GTHC 3D1NI 4S05A 1SFEA 2IT0A 5H2FC 3F22A 2UUZA 3E3VA 2KRCA 2XSJC 3BTLA 3E7LA 3OL3A 1IN4A 2F5DA 3IKVA 4II2A 3VSKA 2VOPA 3BTCA 4NQWB 1SC7A 1A36A 3FF5A 2CG4A 4J00A 1G4DA 3WGGA 2QKMB 2MH2A 2L0KA 3QRFF 1SD6A 1VQLI 2ESNA 3A01A 1V5EA 4CSWA 3OYNA 1IF1A 3KZIC 4HLYA 2LY2A 2A6TA 2GBYA 1NTCA 1WKMA 3DPUA 5LFAA 4FE7A 3GW2A 1W5TA 3V8JA 2Q2EB 1FX7A 2R7WA 3HSFA 5D6FA 4MTDA 2JRMA 1HBXG 1FTTA 3BQZA 1J75A 5DTDA 3LSRA 1BIBA 3F72A 3TO7A 3S2DJ 4YG2F 3F8CA 1WQ2A 3PIOF 1XTAA 1ON1A 1XS9A 2ID3A 2LG4A 1ZKGA 2DFIA 3IRRA 1IV8A 3ZRGA 2DT7B 5B66C 1FPQA 2GOMA 2VKVA 1YI2I 2JMWA 2ZJPF 3F6OA 5C44J 1AOYA 3VEPA 2UWMA 4GDFA 4EGYA 1KYZA 3S1QJ 2QSFX 4E6KG 3NRVA 1A35A 1IC8A 5GAGJ 3HHHA 4L5IA 3QOPA 2B0LA 3PNTA 5JI6A 1BW6A 4CICA 4WXDA 3H9JA 1TLHB 5GADJ 4NHJA 2RC4A 4EJWA 3VYRB 3SFIA 2MA3A 1Z6RA 2HDCA 3CJNA 3I64A 3ZQ7A 2K9MA 3CJTB 2UXXA 2VPLA 5CJ9A 2ZMEC 3S8PA 4WK8F 1IXSB 3E5QA 3S1NJ 3QPTA 3WTSC 2FA5A 4IHSA 3DCFA 1R7JA 2Q8KA 1DGWY 2Q0OA 3FBIB 3BT9A 2XAUA 2K27A 1LEBA 1YS6A 5E3NA 2LY9A 4CYCA 5J4VA 1N77A 1MZBA 3OR2C 2LDUA 2HNHA 5FLXK 2MC4A 4HSRA 3HG9A 5J1YA 4XL9A 3G2BA 3OYMA 1PUFA 2J5OA 2LD5A 3HKZA 2PMUA 5LHGA 1JKQC 1PDNC 4CCJA 3DTEA 3SHFA 2YU9J 1F43A 1FSHA 4XKVA 4D1QA 2D2WA 3CLQA 4M73A 2E71A 1YFHA 2L2OA 4ZTJA 3I59B 2HDDA 1YW7A 1S29A 1UZCA 1E3OC 1JXSA 3WTYC 2BE5F 3Q0VA 1R5GA 3ELKA 2MG4A 2ZXWH 4XKWA 2QENA 2G9WA 2KJCA 3GMEA 1YE9A 3WTUC 1QHHD 1K4TA 1U5TC 3K2ZA 1QNTA 5HLTA 3Q9SA 2QQAA 1O7LA 2CQKA 2Q1ZB 4A12A 3HBLA 5F0CA 3ZR8X 1MNMC 1JHHA 2Y69H 2K02A 4XQFA 2F4IA 2EINH 1ENHA 3H36A 4M71A 2W4SA 3EUHC 1FMVA 2X6XA 3KEOA 1U0JA 3MAJA 1IO2A 4J19A 3EQLF 3KEYA 2DFHA 5L3GA 2HQ5A 2K4BA 3E6DA 2BOLA 2GA2A 2KDZA 2DMUA 3W6VA 5GAHJ 5IT9K 5A2QK 4DYCA 1RC9A 4RMNA 1TWGJ 4PSWA 4YFXF 4MFEA 1QHGA 1YYVA 1GVJA 2ACJA 2I5UA 3GFLA 2VKDA 3OYGA 3GTQJ 4HV5A 5F08A 3M9AA 3HPHA 4XLAA 2R0QC 1F36A 2HI3A 1RETA 2EJRA 2F4MB 3CJQB 3TL4X 3ECHA 3HPGA 3I55I 1VQMI 1RUNA 1ZGWA 3OOPA 2F5EA 1B1BA 2ZKZA 1I6XA 3CESA 3AG3H 2TDXA 1J2XA 2YX4A 2VE9A 4M72A 5JHFA 2LBFB 2RN7A 1VQNI 2DBBA 1LVKA 4OIOF 2QA4I 2HXIA 2Y9YA 5AONA 5JFRA 1S7OA 3GZ5A 5IYBJ 4XLCA 2DFEA 2M9HA 3K2AA 2XAQA 2E5NA 3WU1B 1FJLA 3N05A 3ZOBA 1B4AA 3ERMA 3PFIA 1TC3C 2VXDA 3CCQI 3DU6A 3ZMZA 4AD9A 3PFYA 3B73A 5M3MJ 2STTA 3L09A 2IGNA 1MH3A 5FKLA 1OCOH 1LKXA 1R9TJ 2WC2A 2L9SA 2JK3A 2OU2A 4HSTA 1MIJA 5BQTA 4BDYA 1FY7A 4MEYF 2W00A 2O03A 1D8JA 4JP0A 1LPQA 1XPXA 2BVMA 2JSCA 1ETKA 4IHYA 1YJ9I 4IEJA 3ZQIA 1QO0D 1XB4A 3A0HC 3ZQLA 2L7KA 2EPFA 2VKEA 2Y0SA 2LNBA 2NOGA 2VB6A 5IYCJ 1VQ5I 4NNJA 1FIAA 1G3TA 1HOMA 5KNLA 5EGOA 2QSGX 3HOWJ 2AO9A 2DPUA 4YFNF 2P0WA 5FO5A 2DOAA 3QYFA 3DBRB 2PQ8A 4F93B 4O6JA 3ESWB 3QYEA 4PK4A 3T5XA 4B43A 5EG0A 5BMZA 3M3YJ 2GXGA 4C2UA 3JSOA 2LKSA 9ANTA 2KP6A 1SFXA 3MD2A 4HF1A 1H9GA 4BEHA 2FF4A 5FLXZ 3GFIA 4ANJA 5EJCA 4HDVA 3H9GA 2HQNA 2HTSA 4IL6C 2XAJA 1DGRM 4F91B 3SEZA 2E1MC 1ETQA 3G1OA 4C3HJ 3RZDJ 2P5KA 1BW5A 3W2AA 1K61A 2NVUB 2XHKA 3BZCA 3LA7A 4FASD 5ED4A 1JT6A 4Y15A 2A07F 1PJRA 4UUSB 4QSHA 5IT3A 2HKXA 3IC7A 2L01A 1E0EA 3HGYA 4RAFA 3CC7I 2KZVA 4FCYA 2OZUA 3BR0A 3H5RA 2HTJA 1QQIA 1U9OA 4AVPA 4ZDOA 2MC3A 3U1DA 2EZLA 2X51A 1TBXA 5E3OA 3L2WA 3HXLA 3KLOA 4KT6A 2STWA 3CUQC 3AL0B 3A1YA 2K4JA 2RQQA 3S3MA 5TISC 3C18A 1R58A 2RV8A 2FU4A 2ZJ2A 3ZPLA 3MZYA 4A69C 4L0ZB 4CYDA 2M7AA 2GIVA 2FJ1A 2M4GA 5FROA 2K9QA 5FJ8J 5EZGA 1O3QA 5EEHA 1GHCA 4HQMA 2IS6A 2A68F 1TW3A 4BEHB 3M8FA 2H1KA 2QBYA 4E7KA 5IT9Z 5A2QZ 2ZFWA 3O6BB 3GX4X 2JQ7A 1OKRA 3BLYA 2V9VA 1KU7A 4EM1A 3LSIA 3LSTA 4C9YA 3LSHA 1KZHA 1I1SA 1YRNA 1QPIA 2QKLB 4LG3A 5ILSA 4C30A 1SAUA 4HEA2 3C2GA 1NHAA 5K7FA 2DMPA 1TP4A 2H09A 4NBQA 1HLVA 3CC2I 4D5FA 4I98B 2DPDA 1GXQA 3K0LA 2EBIA 3WU2C 4J01A 3U1KA 5C3EJ 3LFKA 3LSKA 1T2KA 2L9RA 3R4KA 4HNUA 1SFUA 2O0YA 2VLAA 4UHTA 4DJAA 4I76A 1K79A 1DU6A 5GP9A 3JRHA 2CU7A 4L5EA 3X2QH 4BKXA 4L0YB 4EMSA 3JCUC 4KUMA 4DQ2A 5J4YA 2CUFA 1JT0A 1FZPB 1MDMA 5FKKA 1XGSA 1RI7A 1HDDC 3LSPA 1SANA 2PJPA 3WU0A 2EA2A 2X6YA 1BC7C 1SD7A 2CGPA 4HF0A 3ABTA 1R6RA 4HX7A 1ZELA 1L0OC 1IUFA 1X4OA 3E6BA 3DLLF 2IPQX 5K1YA 3TEDA 4L9JA 4XKBA 1SD4A 3GFJA 4E7SA 4TV7A 4CUGA 3HKZN 1UMQA 5HNHA 3BZ6A 1D3YA 1UHMA 3V7CA 3V7RA 1I3QJ 2WAEA 2DQLA 2HOSA 1HKSA 4NUBA 3CMYA 1TWCJ 3CP2A 3PUFA 3SFZA 2CYYA 3SDGA 3LQRA 5K5QA 5CVUA 5JHUA 2E2IJ 1FP2A 1MBGA 1TWHJ 2LF7A 1MBEA 1WCMJ 4M3BA 4XR6A 1V4RA 2X85A 3HOYJ 4GXOA 1KQ9A 2CS3A 4PGHA 4WXHA 1T56A 4FTHA 2WBMA 4FETA 2QLZA 2QQ8A 5LEKA 2EIJH 2PJRB 4RGSA 1MGTA 4UVCA 3IH3A 1WH7A 2JA8J 2Z2SB 3JW4A 3HB9A 3COAC 4UB8C 4A6EA 2EZIA 4EJVA 2ADUA 3KYLA 3PQJA 4ABZA 3G73A 2R7VA 3V42A 2IVMA 2BY3A 3G4SI 5DD8A 4RB2C 5DD4A 3M1EA 5CVVA 1D0ZA 4DZPA 2HOAA 5E3MA 4Z6YA 4U0YA 2VBXA 4M6YA 2WY7Q 4UV9A 1FTZA 4P1WA 2YS9A 1XN7A 1AWCA 1D5YA 3JRFA 3GLXA 2DT6A 1YJWI 2KISA 4QWQA 1D8KA 5H6RA 4LGWA 2LY1A 2K9LA 5E1XA 1WGXA 4AYBN 3MZHA 1B8IA 3GTGJ 3F9KA 1A31A 3ABKH 4IHWA 4UY8I 1WPKA 4RLFA 2W1OA 1BI0A 4I02A 3IRQA 2PI0A 3DKYA 1TL8A 1IDZA 1YJNI 3MKLA 1O7FA 1ZRCA 3G1LA 2VQCA 3OSFA 1SD5A 3QWLA 1G3SA 1IRGA 4V2FA 2M34A 4EGZA 4OMYA 1Y1WJ 3S3OA 1R1UA 2HFHA 3BR6A 3V8KA 1KONA 1HW2A 4W97A 4Y13A 1IGNA 1WFXA 1T8IA 3CTAA 3BG5A 1VTNC 2M0MA 2AQFA 2M3AA 1ZGAA 1WJBA 2LR8A 2KDOA 2ZSHB 4U7BA 2P5VA 2UXNA 4U0VA 3ROUA 2DK5A 3QU3A 3LMMA 1A5JA 2ZXJA 1YHQI 2HKOA 2KLOA 2VONA 3H0DA 4P96A 2E2HJ 4Y52J 2DDAA 2FNAA 3K9TA 4A0XA 1D5VA 1HKQA 1XC5A 4ENMA 3ISPA 3FMRA 3O8GA 3GUDA 1BA5A 2WB1N 2VJJA 4NB5A 2VE8A 1P4AA 4G12A 4IRGA 5CPRB 1XD7A 4D7MA 5B1AH 2YR2A 1OCTC 2R7ZJ 2X1CA 1ZREA 3CCRI 2WTEA 5K5OA 1V54H 4CCNA 4DGWB 2VN2A 1T08B 4BNCA 1IUYA 3K69A 3CUOA 3DWLE 4MFDA 1OQYA 4I6ZA 3TP3A 3ASOH 4HX4A 3JRAA 5HS8A 4AM3A 4OMZA 3K4BA 2VC0A 2Y48A 4XK4A 3CMEI 2E7WA 1Z21A 1E17A 1XMKA 1K78A 3K10A 2R7QA 1EF4A 1MMNA 4A0YA 3CCUI 3TO6A 4HNVA 3DU5A 3FXQA 1B6AA 4A3JJ 2BBYA 2XAHA 3VYSB 3M8JA 1B9MA 2MH9A 2NS8A 1T95A 4A3FJ 2CJJA 1YITI 3TO9A 2MBFA 4ZYGA 1U2WA 4ESBA 4Y4RA 1XDSA 5FD5A 3BZKA 3H3ZA 3HYIA 2DA3A 2PFBA 3J7AY 3IP4B 4JBAA 3H0GJ 1Y39A 4IO9F 1MKMA 1POGA 2MD0A 5FB2A 3H5AA 3DBHB 2P7CB 3CJRB 2I8DA 4UUVA 1QGPA 3AFHA 1R5ID 4NQWA 3K70C 3KP4A 2YU3A 4HOBA 1O3RA 5LGUA 1SMTA 2FSWA 3D5LA 2R92J 3BDDA 4KNYA 5ILUA 3JTGA 2AQEA 2IRFG 1FYLA 4A0ZA 5FD6A 2JTVA 4YELA 5F6FA 1K83J 5FRMA 2BHZA 3SEQA 2Q2EA 1YW8A 3UR3C 4I0BA 1Z9CA 1FYKA 1TQPA 3KETA 2CFXA 2OCCH 2H6CA 2ZJRF 1RR7A 4XKCA 4B3XA 1GT0C 4HAMA 1ETVA 3RIRA 4BACA 2KKOA 2H94A 2GM4A 1V5GA 2V7FA 2A05A 5LRSA 2NOJB 3FXJA 3O3KA 2IP2A 2DOEA 2XSDC 3LSMA 3WTWC 3LL7A 3K4KA 5DYMA 5E79C 2CW0F 4N9IA 3BPXA 2XGEA 5B3SH 3L7WA 4U88A 1P2FA 2ZB9A 2JWTA 3FK6A 5KAFC 4ESJA 4BQOA 2HPMA 1FEXA 1I39A 2CW8A 1ITYA 3LA3A 2L3DA 4HV6A 2Z1DA 3WTZA 3O8HA 2DA5A 3VYUB 3OYDA 2EQRA 3VPRA 1AHDP 3FZVA 3L2CA 1I3AA 4QTRA 1R36A 2R5YB 1ZGJA 4M6XA 1YQAA 1B9NA 2XUBA 4O5VA 4BY1J 4IZZA 1RNLA 1YW9A 2HVQA 1S7AA 1V3FA 3TOAA 3EUAA 1KGSA 4BHCA 4MHGA 1SFOJ 1BC8C 2ZBKA 3N4MA 5E20A 1MSFC 1Z0XA 2XIGA 1ACIA 1QZEA 5CVRA 5AIQA 2OCEA 3ZQGA 2E5ZA 1X1PA 4BQAA 2JRTA 1O4XA 2VI6A 1IRFA 2KRHA 2PEXA 2LLKA 2EFPA 1T39A 3I59A 4XBFA 2VJ4A 2IBDA 4G94A 1R22A 1ON2A 3K4LA 5DS9A 3S1MJ 1WSUA 4IF4A 3UNGC 2QGUA 2LFBA 3IAS2 1FIPA 2XC7A 1U78A 1G2HA 2V79A 5LHIA 4JQFA 2DN0A 3JRCA 3S3NA 1WZ2A 1LE8B 5F27A 4WCGA 4ZYEA 2ECCA 1IXCA 4XLHA 2XV4S 1Y56A 2V1UA 2VPRA 1U5TB 2O9LA 2COMA 4M9SA 1ZG1A 2BYVE 2ELJA 1FT9A 3S2HJ 4S04A 1EJ9A 3S16J 4LJZF 3QU6A 2ELKA 1UHSA 2QUFA 2RNGA 5KHDA 4G7HF 1PYVA 2XDVA 2FE3A 2RVCA 3VFZA 1ZRFA 2VQGA 1GDTA 3W6KB 1HDPA 1IRZA 1VZ0A 1EKEA 4WWCA 2R4GA 1HCRA 4JYKA 3OS0A 2KIUA 2H27A 3BG7A 1F5TA 2AHQA 4A3CJ 4OIRF 4M3FA 3R61A 4MGRA 4OINF 4PFPA 1S9HA 2NS0A 3HGGA 3EDPA 2WV1A 4UV8A 1JTYA 3VODA 3SYTA 4S0HB 4XM3A 3OYHA 2DA6A 1ETOA 2LBFA 3KLNA 4QLCU 1ERDA 3KP5A 4M6VA 5J8FA 2W7NA 1P7IA 2COBA 4UB6C 4BBRJ 2VOOA 3LSGA 3F6VA 3FX3A 4P9UA 4ZH4F 3PM1A 1WJ5A 2W85A 2DT5A 1STZA 4IQ4A 4KISA 3MZ8A 2JVHA 3K4NA 1PVEA 1XMXA 1IW7F 1MMAA 2VT3A 4EVIA 1MNEA 2O8KA 4BY7J 2HZDA 3PUBA 2KMUA 5FGMA 5DM6F 3P9KA 1R49A 3RKYA 4ZC3A 1U8BA 2VJIA 2AXLA 4NC7A 3RQ4A 3FBNB 1DPRA 2DA4A 2OF7A 3ECOA 4ZZDA 1EV7A 1GV5A 2X6OA 2AS5F 3Q9VA 3UKGA 2MLGA 3H3UA 5D8KB 3BR5A 2HYFA 2VT2A 4HLXA 4Q48A 1D1AA 1Z91A 1TW2A 1Y1VJ 1Z7UA 4AYBA 4I99C 5EYRA 1UG2A 4ASNA 2Y31A 3FM5A 3HUGB 4HYEA 3FISA 4A6DA 4H0EA 1HSJA 3OYKA 1ZAOA 1W0UA 5ERIA 2W84A 2WV0A 1LDJA 4DIQA 3BG3A 3OYJA 1JTXA 2HYJA 2ZXHA 2LP0A 2QQ9A 1I1GA 1ZR2A 4IOAF 3JRBA 3CF2A 4B09A 2CFOA 2FD5A 2MD5A 1USSA 1Z7LA 2EIKH 3HRSA 4GO1A 4JK1X 3OSGA 1IJWC 2DTRA 2A69F 4L9NA 3M4OJ 2RAEA 4PJNA 2FUG2 1Y8QB 2DODA 2WWYA 3F21A 1VFCA 4RA2A 1UELB 1IN8A 5HDKA 3RPUA 2L7FP 3QPHA 2ZXIA 3GFMA 2V1XA 1DDNA 4MQVA 4BJ5C 4KICA 1TNTA 3PIPF 4V2GA 1PP7U 1I6HJ 3HSRA 4GGGA 2DOFA 2EV6A 1TQIA 1OLTA 3B6AA 5DM7F 3ML6A 3F8FA 5ICGA 5C4XJ 3F3XA 1TWFJ 3K1MA
chains in the Genus database with same CATH topology
1J5YA 4R1HA 5LRRA 1FWZA 4CO8A 3WODF 3N97A 1L3LA 2XVCA 3T0YA 2E1NA 2W25A 1BI1A 1T6SA 1Z1DA 5L3EA 5H6QA 1USTA 2DAOA 1LNWA 2QWWA 2ESHA 4UXNA 5F1RA 1OYYA 2Z5UA 5L3FA 4I09A 4RS8A 3CUQB 3GVAA 5ILVA 1R1VA 3DXJF 1J9IA 2FEZA 2EWNA 1KU2A 2VBWA 1OYIA 1ZARA 1BN5A 4FT8A 4KN4X 4XLNF 4BHBA 1S6LA 1HSTA 3QAHA 4RAZA 3DPLC 2EK5A 2OAZA 3W6JB 1MJ9A 5CVJA 3BJ6A 4HZFA 3FM3A 4KFCA 5LGTA 2X0LA 4YIIA 3K1NA 4G8XA 1O3SA 2L54A 4FX4A 1DPUA 2NNYA 1T98A 3EYYA 1RIOH 3I53A 2RQPA 4RGRA 1EH7A 1XGOA 2DI3A 1K7AA 3I4PA 2PBIA 1W7PB 2EFNA 5HS9A 4UVAA 3HOTA 1SMYF 2M1BA 4LLGF 3FMSA 3ULQB 2A61A 4KN7X 1KYWA 3GWZA 3ZP5A 4PZJA 4LB5A 1YO5C 4Q4ZF 5DCFA 1J7KA 5DV5A 4G6QA 1DUXC 1CF7B 1P4XA 3ZN1A 5KK1A 2LF8A 2O8XA 1FOKA 1PUEE 1HW1A 2K7LA 4KMUX 1R5HA 1H9TA 3HIFA 2FBKA 1ZHFA 4XRFA 2YX7A 4M9XA 1WRJA 4G7OF 4N9HA 2XGXA 1G3WA 2FMYA 4KT5C 1F4KA 3GF2A 1ZLKA 3R6SA 1XSVA 2C6YA 5ICFA 3TKYA 2O6GE 4FHTA 2YSRA 3C1DA 2CSOA 4KDPA 1HQCA 3CLOA 4Q47A 1PP8F 3LAPA 3DPTA 1Y0UA 1H0MA 1X3UA 3WTTC 3IHUA 4RB3C 3D0SA 2PLYA 3MFKA 2IA2A 6PAXA 3KFWX 4OIPF 2JPBA 5AIPA 5LEJA 5HLGA 4MNUA 4N0BA 4U0WA 4AWXB 4RGUA 3GO5A 4L18B 3KE2A 1HXDA 1OMIA 1XCVA 2HS5A 4CGZA 3RYRA 1XGMA 2VBYA 3U2RA 3LWFA 4ZYHA 4L9TA 1FC3A 5HOOA 1LEAA 3DEUA 3KZZA 3KEQA 1FBQA 1A04A 3LAJA 2GWRA 3BPVA 5F64A 4ON0A 4RAYA 5D6EA 5D5UB 5L3DA 4KYWA 5HS7A 3LA2A 5DCMB 4LG0A 3GXOA 2A5YB 1QZYA 2IW5A 2H6BA 2L4MA 3WG9A 2HEOA 4BAYA 1ZYRF 2A6EF 2IJLA 4RGXA 1FBUA 2RKHA 2HZTA 4M74A 2IA1A 1F1ZA 1XSDA 4UVBA 1TNSA 3ZMUA 5DEQA 2GXBA 1LQ1A 2QQBA 4RB0A 5L3CA 3WTXC 4I2OA 3E97A 2Y0MA 4LLNA 2ZCWA 2R7DA 2NNNA 4EJOA 4P55A 1IN5A 3H92A 5D5WB 4HW0A 3FXRA 2XAGA 4ZYDA 3HRTA 4LG0B 4LK0F 2D1HA 4EM0B 4I0AA 2K86A 3T8RA 1KU3A 3JAMK 2BGCA 5D8LB 3VOEA 2HQRA 2ELHA 4EM2A 4K2EA 2Z9OA 3HSEA 2MLKA 4MQ9F 1I5ZA 3V8LA 3DFGA 1J59A 5DDGA 4IPAA 2Z3YA 2HYGD 2DO7A 1BOAA 1ONVA 5DUIA 5K5RA 3C7JA 3WE3A 3V7SA 4GYIA 4OU0A 3GZ6A 4XSXF 3ZMTA 3IL2A 1TQMA 1F9NA 2EA4A 3L9FA 4EQQA 3DQVC 3BJOA 2J5PA 1Q1HA 1EH6A 1HW5A 4U7DA 4BXUA 4AIKA 3RYPA 3C3WA 1YTYA 1U8RA 2VODA 3WGIA 4OIQF 5D4RA 1RUOA 1U5TA 1UHWA 4LFUA 1IZ1A 2KJBA 3E5XA 2ZMEB 3KP3A 5BS6A 1BM9A 5E8IA 3EUHA 2EFOA 2RNJA 1MD0A 4ZZLA 3SZPA 2OZ6A 2OQRA 4L5JA 4B8XA 3GYHX 3LQQA 1C0WA 4IRHA 2HWVA 1XGNA 2ETHA 2P4WA 3G3ZA 2QVOA 3ZMVA 2PG4A 3P9CA 2GAUA 4G6DA 4UNOA 1ZN2A 3HTUA 2E7XA 3CO6C 2W57A 5CVIA 3OV8A 5LHHA 2XROA 2NAZA 3T8TA 3JSPA 2FMLA 3WGHA 1SAXA 4WX9A 3F8NA 2VC1A 2P6SA 5EEGA 3BY6A 3P9IA 3NQOA 3V4GA 2M5WA 4R8HA 3RJPA 2IA0A 2G7HA 3KCCA 2O3FA 1Z05A 3RKWA 3HUGA 1W4MA 1JE8A 2M45A 1E2XA 2HGCA 3JAMZ 1R23A 1FBSA 4E70A 1XSXA 1O57A 1P92A 5LLQA 1BI3A 3FHZA 5LBQA 2LKPA 5HDNA 2KRFA 3M8EA 3PQKA 3ZN0A 3MWMA 1B59A 3SXYA 2GQQA 3HTSB 5E17F 1ULYA 2X4HA 5JVTA 3J7AO 4Z2YA 1FSEA 3NEUA 3L00A 4LD5A 3RDIA 3MEXA 3TQNA 5TJJA 5TRDA 4F7ZA 5H20A 3IKTA 4O3MA 1QPMA 1LJ9A 1I27A 2FXAA 2FNPA 3FMQA 1XCBA 4IHTA 3U9GA 2P8TA 3SQNA 3HHGA 4HF2A 3QP6A 1LDDA 3CUQA 3VB2A 3KZYA 3DF8A 5J6XA 1LDKB 3P7NA 2OD5A 3ABUA 4FX0A 2XASA 2RDPA 2V1DA 2Y75A 4L9VA 1IN6A 4MTEA 1WWXA 3KP7A 3SZTA 2OBPA 2DW4A 1YG2A 2G7UA 4KIGA 3EETA 5J8CA 5HDGA 3R0AA 2P6TA 5HVQC 4BHPA 1CGPA 2F2EA 3R0JA 1ZG3A 2GA1A 4WXCA 3GEZA 2OA4A 2CWEA 3REOA 4R79A 2M8EA 1S3JA 5ICEA 1BBYA 1QBJA 3ZMSA 4Y17A 1W7PA 3J81K 1JHFA 2F5FA 5LGNA 2FBHA 1UFMA 2LSOA 2ZNYA 4CZZA 2NRAC 4P9FA 4LB6B 4IVNA 4PDKA 5BPIA 3WTVC 1QZZA 4ENNA 4CDGA 4PCQA 2DQRA 2JPCA 4BH9A 2ISYA 4G9YA 1ZRDA 4I7HA 2FRHA 3DP7A 3BROA 1HKTA 1MJBA 3AAFA 2YPRA 5CYVA 1CF7A 4KMFA 3KP6A 2DU9A 4AIJA 2M87A 4HDUA 3FWEA 3I0TA 1UCRA 3M7GA 3TDUC 5HLHA 3J80K 2JZYA 2Z99A 4A5NA 4HX8A 3CDHA 5E1WA 1W7PD 1YIOA 4RB1A 3K1PA 3ERED 2PMHA 4EV0A 2ISZA 4XLPF 4AIHA 5D4SA 3MCZA 4XSZF 3F23A 2QYOA 3I54A 3DKWA 5KVRA 1U3EM 2NYXA 2L02A 4M9ZA 4P5OA 5HLIA 2E1CA 2BEOA 2M30A 2D45A 3RTRA 3E6MA 1OPCA 3BOQA 1BIAA 1OR7A 1UB9A 2QBYB 1KQ8A 2ZO4A 4IJAA 2R3SA 3ZMDA 1Z6TA 2QZ8A 2P7VB 3JTHA 5BOXA 2EB7A 1IN7A 3I5UA 1JGSA 3CO7C 1BJAA 4LLLA 5E8GA 2D1VA 1KQ0A 2VXZA 2XAFA 3KP2A 3B02A 3HRUA 4WF2A 4IXAA 5JR3A 2R7FA 1W5SA 3EYIA 3RI4A 3BWGA 4EJTA 3J81Z 3QP5A 1MDMB 2VBZA 2KIFA 3TGNA 1FP1D 1ZLJA 5E1ZB 2QM3A 4ENJA 1REPC 5DCMA 1P6RA 2UZKA 2ZNZA 2XRNA 4Q5SF 3DV8A 4YIFA 1DP7P 3RPQA 4A2UA 4D0PA 4GYGA 1IAWA 1ZG5A 5L3BA 2P5LC 3F8BA 1ZH5A 4LMYA 1RZ4A 1LVAA 4HA8A 4CXFA 3I71A 1EH8A 2HOEA 2EFQA 3BJAA 1FLIA 2EV0A 3R60A 1BI2A 1R1TA 2A6HF 1T0FA 4KA4A 3J80Z 1FYMA 5FFXA 2Z33A 3F8MA 4G7ZF 4ESFA 4HQEA 2KIMA 2OQGA 1FNNA 2JT1A 1TTYA 1J0RA 2DK8A 1R00A 3HOSA 5D5XB 3TDZC 1MJAA 4KIBA 1IXRC 4BYYA 4IRIA 5CLSA 2FBIA 2HR3A 1OYWA 2GZWA 4MEXF 3RKXA 4I01A 1K6OA 3BP8A 2PN6A 2EFWA 5ICCA 3IWFA 2XKOA 3IWZA 4OOIA 1KU9A 2O61A 2CO5A 1YLFA 1WI9A 1XMAA 3I58A 3WE2A 2RGVA 4GCVA 4CHUA 2EV5A 3TOBA 2FQ3A 3HRMA 5D5VB 3T1BA 1ODDA 3FXUA 4ETSA 4A5MA 2V6CA 1U6GA 1YS7A 2F5CA 2DLLA 1GXPA 2ZMEA 3Q5FA 1LB2A 2A3SA 5E18F 4EJUA 4KIFA 5DUKA 3E5UA 2XKPA 5BPDA 4PGGA 1K78B 4HBLA 4DNCA 4YFKF 1XDUA 2BV6A 2W24A 4LK1F 1O3TA 1T38A 1KA8A 5FFZA 1P4WA 4ENKA 1S8NA 1G3YA 3MQ0A 3S2WA 1G6NA 2L4AA 2FOKA 3O2PE 3E6CC 4S05A 1SFEA 2IT0A 3F22A 3E3VA 1IN4A 2F5DA 3IKVA 2VOPA 3FF5A 2CG4A 1G4DA 3WGGA 2MH2A 3QRFF 1SD6A 2ESNA 1IF1A 4HLYA 1WKMA 3GW2A 1W5TA 3V8JA 1HBXG 1FX7A 3HSFA 5D6FA 4MTDA 1J75A 1BIBA 3F72A 3TO7A 4YG2F 3F8CA 1WQ2A 1ON1A 2DFIA 3IRRA 1FPQA 3F6OA 1AOYA 3VEPA 2UWMA 4EGYA 1KYZA 3NRVA 3HHHA 4L5IA 3QOPA 2B0LA 5JI6A 4CICA 4WXDA 1TLHB 4NHJA 2RC4A 4EJWA 2MA3A 1Z6RA 2HDCA 3CJNA 3I64A 3ZQ7A 2UXXA 5CJ9A 4WK8F 1IXSB 3E5QA 3QPTA 3WTSC 2FA5A 4IHSA 1R7JA 2Q8KA 2Q0OA 2K27A 1LEBA 1YS6A 1MZBA 2LDUA 5FLXK 2J5OA 2PMUA 5LHGA 1PDNC 3SHFA 1FSHA 2D2WA 4M73A 1YFHA 3I59B 1YW7A 1S29A 1JXSA 3WTYC 2BE5F 1R5GA 3ELKA 2QENA 2G9WA 2KJCA 3WTUC 1U5TC 3K2ZA 1QNTA 3Q9SA 2QQAA 1O7LA 2CQKA 4A12A 1JHHA 2K02A 4M71A 3KEOA 3MAJA 3EQLF 5L3GA 2K4BA 3E6DA 2GA2A 5IT9K 5A2QK 4YFXF 1YYVA 1GVJA 2ACJA 3GFLA 4HV5A 3M9AA 2EJRA 3ECHA 1RUNA 3OOPA 2F5EA 1B1BA 2ZKZA 1I6XA 2TDXA 1J2XA 2YX4A 2VE9A 4M72A 2RN7A 2DBBA 4OIOF 5AONA 5JFRA 1S7OA 3GZ5A 2XAQA 3WU1B 1B4AA 3PFIA 3ZMZA 4AD9A 3B73A 2STTA 3L09A 2WC2A 2OU2A 5BQTA 1FY7A 4MEYF 2O03A 1D8JA 2JSCA 1QO0D 1XB4A 2LNBA 1G3TA 2DPUA 4YFNF 5FO5A 2PQ8A 4O6JA 5BMZA 3T5XA 2GXGA 3JSOA 1SFXA 4HF1A 1H9GA 2FF4A 5FLXZ 3GFIA 4HDVA 2HQNA 2HTSA 2XAJA 2P5KA 2XHKA 3LA7A 5ED4A 4Y15A 2A07F 5IT3A 2HKXA 3IC7A 2L01A 2OZUA 4AVPA 2HTJA 1QQIA 2MC3A 3U1DA 1TBXA 3KLOA 2STWA 3CUQC 2K4JA 3C18A 1R58A 2RV8A 2FU4A 2ZJ2A 3ZPLA 3MZYA 4L0ZB 4CYDA 2GIVA 1O3QA 5EEHA 1GHCA 4HQMA 2A68F 1TW3A 3M8FA 2QBYA 5IT9Z 5A2QZ 2ZFWA 3O6BB 3GX4X 1OKRA 2V9VA 1KU7A 4EM1A 3LSTA 1I1SA 5ILSA 1NHAA 2H09A 4I98B 2DPDA 1GXQA 3K0LA 3LFKA 1T2KA 3R4KA 1SFUA 2O0YA 4UHTA 1K79A 4L0YB 4EMSA 4KUMA 4DQ2A 1FZPB 1MDMA 1XGSA 1RI7A 2PJPA 3WU0A 2EA2A 1BC7C 1SD7A 2CGPA 4HF0A 3ABTA 4HX7A 1L0OC 3E6BA 2IPQX 5K1YA 4L9JA 1SD4A 3GFJA 4TV7A 3BZ6A 1D3YA 1UHMA 3V7CA 3V7RA 2DQLA 1HKSA 3SFZA 2CYYA 3LQRA 5K5QA 5CVUA 5JHUA 1FP2A 2LF7A 1V4RA 4GXOA 1KQ9A 4PGHA 4WXHA 2QLZA 5LEKA 4RGSA 1MGTA 4UVCA 3JW4A 3COAC 4A6EA 4EJVA 2ADUA 3PQJA 3G73A 2IVMA 5DD8A 4RB2C 5DD4A 3M1EA 5CVVA 4U0YA 2VBXA 4M6YA 4UV9A 1AWCA 1XN7A 3GLXA 4QWQA 1D8KA 5H6RA 4LGWA 5E1XA 3MZHA 4I02A 1BI0A 3IRQA 2PI0A 1ZRCA 1O7FA 1SD5A 1G3SA 1IRGA 4EGZA 4OMYA 1R1UA 2HFHA 3V8KA 1HW2A 4Y13A 3CTAA 1VTNC 1ZGAA 4U7BA 2P5VA 2UXNA 4U0VA 3ROUA 2DK5A 3QU3A 2ZXJA 2HKOA 2VONA 4P96A 2FNAA 3K9TA 4A0XA 1D5VA 1HKQA 4ENMA 3ISPA 3FMRA 3GUDA 4NB5A 2VE8A 1P4AA 4IRGA 1XD7A 2YR2A 1ZREA 2WTEA 5K5OA 2VN2A 4BNCA 1IUYA 3K69A 3CUOA 4HX4A 5HS8A 4OMZA 2VC0A 2Y48A 2E7WA 1E17A 1XMKA 1K78A 4A0YA 3TO6A 3FXQA 1B6AA 2BBYA 2XAHA 1B9MA 2MH9A 3TO9A 2MBFA 4ZYGA 1U2WA 4ESBA 1XDSA 5FD5A 3H3ZA 3HYIA 2PFBA 4JBAA 1MKMA 5FB2A 2P7CB 4UUVA 1QGPA 4NQWA 3KP4A 2YU3A 4HOBA 1O3RA 5LGUA 1SMTA 2FSWA 3D5LA 3BDDA 4KNYA 5ILUA 3JTGA 2IRFG 1FYLA 4A0ZA 5FD6A 2JTVA 5F6FA 2Q2EA 1YW8A 4I0BA 1Z9CA 1FYKA 1TQPA 3KETA 2CFXA 2H6CA 4HAMA 3RIRA 2KKOA 2H94A 5LRSA 3O3KA 2IP2A 3WTWC 5DYMA 2CW0F 4N9IA 3BPXA 3L7WA 4U88A 1P2FA 4ESJA 3LA3A 2L3DA 4HV6A 3WTZA 3FZVA 3L2CA 1R36A 1ZGJA 4M6XA 1YQAA 1B9NA 2XUBA 4O5VA 1RNLA 1YW9A 1S7AA 1V3FA 3TOAA 1KGSA 4BHCA 4MHGA 1BC8C 2ZBKA 3N4MA 5E20A 2XIGA 5CVRA 5AIQA 4BQAA 2JRTA 1IRFA 2PEXA 2EFPA 1T39A 3I59A 4XBFA 4G94A 1R22A 1ON2A 1WSUA 4IF4A 1U78A 2V79A 5LHIA 4JQFA 4WCGA 4ZYEA 1IXCA 2XV4S 2V1UA 1U5TB 2COMA 4M9SA 1ZG1A 2BYVE 1FT9A 4S04A 4LJZF 3QU6A 2QUFA 4G7HF 2FE3A 2RVCA 3VFZA 1ZRFA 3W6KB 4WWCA 2KIUA 2H27A 1F5TA 4OIRF 3R61A 4MGRA 4OINF 2NS0A 3EDPA 4UV8A 3VODA 3KLNA 4QLCU 3KP5A 5J8FA 2VOOA 3F6VA 3FX3A 4P9UA 4ZH4F 2W85A 2DT5A 1STZA 1IW7F 2VT3A 4EVIA 5FGMA 3P9KA 3RKYA 2AXLA 1DPRA 3ECOA 4ZZDA 1EV7A 2AS5F 3Q9VA 2MLGA 3H3UA 5D8KB 2HYFA 2VT2A 4HLXA 4Q48A 1Z91A 1TW2A 1Z7UA 4ASNA 3FM5A 4HYEA 4A6DA 4H0EA 1HSJA 1ZAOA 5ERIA 2W84A 2WV0A 1LDJA 2QQ9A 1I1GA 4B09A 2MD5A 1USSA 3HRSA 4JK1X 4GO1A 2DTRA 2A69F 4L9NA 2WWYA 3F21A 1IN8A 5HDKA 3RPUA 3QPHA 3GFMA 2V1XA 1DDNA 4MQVA 4KICA 1TNTA 1PP7U 3HSRA 4GGGA 2EV6A 1TQIA 3ML6A 3F8FA 5ICGA 3F3XA 3K1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5Y A;  4R1H A;  5LRR A;  1FWZ A;  4CO8 A;  3WOD F;  3N97 A;  1L3L A;  2XVC A;  3T0Y A;  2E1N A;  2W25 A;  1BI1 A;  1T6S A;  1Z1D A;  5L3E A;  5H6Q A;  1UST A;  2DAO A;  1LNW A;  2QWW A;  2ESH A;  4UXN A;  5F1R A;  1OYY A;  2Z5U A;  5L3F A;  4I09 A;  4RS8 A;  3CUQ B;  3GVA A;  5ILV A;  1R1V A;  3DXJ F;  1J9I A;  2FEZ A;  2EWN A;  1KU2 A;  2VBW A;  1OYI A;  1ZAR A;  1BN5 A;  4FT8 A;  4KN4 X;  4XLN F;  4BHB A;  1S6L A;  1HST A;  3QAH A;  4RAZ A;  3DPL C;  2EK5 A;  2OAZ A;  3W6J B;  1MJ9 A;  5CVJ A;  3BJ6 A;  4HZF A;  3FM3 A;  4KFC A;  5LGT A;  2X0L A;  4YII A;  3K1N A;  4G8X A;  1O3S A;  2L54 A;  4FX4 A;  1DPU A;  2NNY A;  1T98 A;  3EYY A;  1RIO H;  3I53 A;  2RQP A;  4RGR A;  1EH7 A;  1XGO A;  2DI3 A;  1K7A A;  3I4P A;  2PBI A;  1W7P B;  2EFN A;  5HS9 A;  4UVA A;  3HOT A;  1SMY F;  2M1B A;  4LLG F;  3FMS A;  3ULQ B;  2A61 A;  4KN7 X;  1KYW A;  3GWZ A;  3ZP5 A;  4PZJ A;  4LB5 A;  1YO5 C;  4Q4Z F;  5DCF A;  1J7K A;  5DV5 A;  4G6Q A;  1DUX C;  1CF7 B;  1P4X A;  3ZN1 A;  5KK1 A;  2LF8 A;  2O8X A;  1FOK A;  1PUE E;  1HW1 A;  2K7L A;  4KMU X;  1R5H A;  1H9T A;  3HIF A;  2FBK A;  1ZHF A;  4XRF A;  2YX7 A;  4M9X A;  1WRJ A;  4G7O F;  4N9H A;  2XGX A;  1G3W A;  2FMY A;  4KT5 C;  1F4K A;  3GF2 A;  1ZLK A;  3R6S A;  1XSV A;  2C6Y A;  5ICF A;  3TKY A;  2O6G E;  4FHT A;  2YSR A;  3C1D A;  2CSO A;  4KDP A;  1HQC A;  3CLO A;  4Q47 A;  1PP8 F;  3LAP A;  3DPT A;  1Y0U A;  1H0M A;  1X3U A;  3WTT C;  3IHU A;  4RB3 C;  3D0S A;  2PLY A;  3MFK A;  2IA2 A;  6PAX A;  3KFW X;  4OIP F;  2JPB A;  5AIP A;  5LEJ A;  5HLG A;  4MNU A;  4N0B A;  4U0W A;  4AWX B;  4RGU A;  3GO5 A;  4L18 B;  3KE2 A;  1HXD A;  1OMI A;  1XCV A;  2HS5 A;  4CGZ A;  3RYR A;  1XGM A;  2VBY A;  3U2R A;  3LWF A;  4ZYH A;  4L9T A;  1FC3 A;  5HOO A;  1LEA A;  3DEU A;  3KZZ A;  3KEQ A;  1FBQ A;  1A04 A;  3LAJ A;  2GWR A;  3BPV A;  5F64 A;  4ON0 A;  4RAY A;  5D6E A;  5D5U B;  5L3D A;  4KYW A;  5HS7 A;  3LA2 A;  5DCM B;  4LG0 A;  3GXO A;  2A5Y B;  1QZY A;  2IW5 A;  2H6B A;  2L4M A;  3WG9 A;  2HEO A;  4BAY A;  1ZYR F;  2A6E F;  2IJL A;  4RGX A;  1FBU A;  2RKH A;  2HZT A;  4M74 A;  2IA1 A;  1F1Z A;  1XSD A;  4UVB A;  1TNS A;  3ZMU A;  5DEQ A;  2GXB A;  1LQ1 A;  2QQB A;  4RB0 A;  5L3C A;  3WTX C;  4I2O A;  3E97 A;  2Y0M A;  4LLN A;  2ZCW A;  2R7D A;  2NNN A;  4EJO A;  4P55 A;  1IN5 A;  3H92 A;  5D5W B;  4HW0 A;  3FXR A;  2XAG A;  4ZYD A;  3HRT A;  4LG0 B;  4LK0 F;  2D1H A;  4EM0 B;  4I0A A;  2K86 A;  3T8R A;  1KU3 A;  3JAM K;  2BGC A;  5D8L B;  3VOE A;  2HQR A;  2ELH A;  4EM2 A;  4K2E A;  2Z9O A;  3HSE A;  2MLK A;  4MQ9 F;  1I5Z A;  3V8L A;  3DFG A;  1J59 A;  5DDG A;  4IPA A;  2Z3Y A;  2HYG D;  2DO7 A;  1BOA A;  1ONV A;  5DUI A;  5K5R A;  3C7J A;  3WE3 A;  3V7S A;  4GYI A;  4OU0 A;  3GZ6 A;  4XSX F;  3ZMT A;  3IL2 A;  1TQM A;  1F9N A;  2EA4 A;  3L9F A;  4EQQ A;  3DQV C;  3BJO A;  2J5P A;  1Q1H A;  1EH6 A;  1HW5 A;  4U7D A;  4BXU A;  4AIK A;  3RYP A;  3C3W A;  1YTY A;  1U8R A;  2VOD A;  3WGI A;  4OIQ F;  5D4R A;  1RUO A;  1U5T A;  1UHW A;  4LFU A;  1IZ1 A;  2KJB A;  3E5X A;  2ZME B;  3KP3 A;  5BS6 A;  1BM9 A;  5E8I A;  3EUH A;  2EFO A;  2RNJ A;  1MD0 A;  4ZZL A;  3SZP A;  2OZ6 A;  2OQR A;  4L5J A;  4B8X A;  3GYH X;  3LQQ A;  1C0W A;  4IRH A;  2HWV A;  1XGN A;  2ETH A;  2P4W A;  3G3Z A;  2QVO A;  3ZMV A;  2PG4 A;  3P9C A;  2GAU A;  4G6D A;  4UNO A;  1ZN2 A;  3HTU A;  2E7X A;  3CO6 C;  2W57 A;  5CVI A;  3OV8 A;  5LHH A;  2XRO A;  2NAZ A;  3T8T A;  3JSP A;  2FML A;  3WGH A;  1SAX A;  4WX9 A;  3F8N A;  2VC1 A;  2P6S A;  5EEG A;  3BY6 A;  3P9I A;  3NQO A;  3V4G A;  2M5W A;  4R8H A;  3RJP A;  2IA0 A;  2G7H A;  3KCC A;  2O3F A;  1Z05 A;  3RKW A;  3HUG A;  1W4M A;  1JE8 A;  2M45 A;  1E2X A;  2HGC A;  3JAM Z;  1R23 A;  1FBS A;  4E70 A;  1XSX A;  1O57 A;  1P92 A;  5LLQ A;  1BI3 A;  3FHZ A;  5LBQ A;  2LKP A;  5HDN A;  2KRF A;  3M8E A;  3PQK A;  3ZN0 A;  3MWM A;  1B59 A;  3SXY A;  2GQQ A;  3HTS B;  5E17 F;  1ULY A;  2X4H A;  5JVT A;  3J7A O;  4Z2Y A;  1FSE A;  3NEU A;  3L00 A;  4LD5 A;  3RDI A;  3MEX A;  3TQN A;  5TJJ A;  5TRD A;  4F7Z A;  5H20 A;  3IKT A;  4O3M A;  1QPM A;  1LJ9 A;  1I27 A;  2FXA A;  2FNP A;  3FMQ A;  1XCB A;  4IHT A;  3U9G A;  2P8T A;  3SQN A;  3HHG A;  4HF2 A;  3QP6 A;  1LDD A;  3CUQ A;  3VB2 A;  3KZY A;  3DF8 A;  5J6X A;  1LDK B;  3P7N A;  2OD5 A;  3ABU A;  4FX0 A;  2XAS A;  2RDP A;  2V1D A;  2Y75 A;  4L9V A;  1IN6 A;  4MTE A;  1WWX A;  3KP7 A;  3SZT A;  2OBP A;  2DW4 A;  1YG2 A;  2G7U A;  4KIG A;  3EET A;  5J8C A;  5HDG A;  3R0A A;  2P6T A;  5HVQ C;  4BHP A;  1CGP A;  2F2E A;  3R0J A;  1ZG3 A;  2GA1 A;  4WXC A;  3GEZ A;  2OA4 A;  2CWE A;  3REO A;  4R79 A;  2M8E A;  1S3J A;  5ICE A;  1BBY A;  1QBJ A;  3ZMS A;  4Y17 A;  1W7P A;  3J81 K;  1JHF A;  2F5F A;  5LGN A;  2FBH A;  1UFM A;  2LSO A;  2ZNY A;  4CZZ A;  2NRA C;  4P9F A;  4LB6 B;  4IVN A;  4PDK A;  5BPI A;  3WTV C;  1QZZ A;  4ENN A;  4CDG A;  4PCQ A;  2DQR A;  2JPC A;  4BH9 A;  2ISY A;  4G9Y A;  1ZRD A;  4I7H A;  2FRH A;  3DP7 A;  3BRO A;  1HKT A;  1MJB A;  3AAF A;  2YPR A;  5CYV A;  1CF7 A;  4KMF A;  3KP6 A;  2DU9 A;  4AIJ A;  2M87 A;  4HDU A;  3FWE A;  3I0T A;  1UCR A;  3M7G A;  3TDU C;  5HLH A;  3J80 K;  2JZY A;  2Z99 A;  4A5N A;  4HX8 A;  3CDH A;  5E1W A;  1W7P D;  1YIO A;  4RB1 A;  3K1P A;  3ERE D;  2PMH A;  4EV0 A;  2ISZ A;  4XLP F;  4AIH A;  5D4S A;  3MCZ A;  4XSZ F;  3F23 A;  2QYO A;  3I54 A;  3DKW A;  5KVR A;  1U3E M;  2NYX A;  2L02 A;  4M9Z A;  4P5O A;  5HLI A;  2E1C A;  2BEO A;  2M30 A;  2D45 A;  3RTR A;  3E6M A;  1OPC A;  3BOQ A;  1BIA A;  1OR7 A;  1UB9 A;  2QBY B;  1KQ8 A;  2ZO4 A;  4IJA A;  2R3S A;  3ZMD A;  1Z6T A;  2QZ8 A;  2P7V B;  3JTH A;  5BOX A;  2EB7 A;  1IN7 A;  3I5U A;  1JGS A;  3CO7 C;  1BJA A;  4LLL A;  5E8G A;  2D1V A;  1KQ0 A;  2VXZ A;  2XAF A;  3KP2 A;  3B02 A;  3HRU A;  4WF2 A;  4IXA A;  5JR3 A;  2R7F A;  1W5S A;  3EYI A;  3RI4 A;  3BWG A;  4EJT A;  3J81 Z;  3QP5 A;  1MDM B;  2VBZ A;  2KIF A;  3TGN A;  1FP1 D;  1ZLJ A;  5E1Z B;  2QM3 A;  4ENJ A;  1REP C;  5DCM A;  1P6R A;  2UZK A;  2ZNZ A;  2XRN A;  4Q5S F;  3DV8 A;  4YIF A;  1DP7 P;  3RPQ A;  4A2U A;  4D0P A;  4GYG A;  1IAW A;  1ZG5 A;  5L3B A;  2P5L C;  3F8B A;  1ZH5 A;  4LMY A;  1RZ4 A;  1LVA A;  4HA8 A;  4CXF A;  3I71 A;  1EH8 A;  2HOE A;  2EFQ A;  3BJA A;  1FLI A;  2EV0 A;  3R60 A;  1BI2 A;  1R1T A;  2A6H F;  1T0F A;  4KA4 A;  3J80 Z;  1FYM A;  5FFX A;  2Z33 A;  3F8M A;  4G7Z F;  4ESF A;  4HQE A;  2KIM A;  2OQG A;  1FNN A;  2JT1 A;  1TTY A;  1J0R A;  2DK8 A;  1R00 A;  3HOS A;  5D5X B;  3TDZ C;  1MJA A;  4KIB A;  1IXR C;  4BYY A;  4IRI A;  5CLS A;  2FBI A;  2HR3 A;  1OYW A;  2GZW A;  4MEX F;  3RKX A;  4I01 A;  1K6O A;  3BP8 A;  2PN6 A;  2EFW A;  5ICC A;  3IWF A;  2XKO A;  3IWZ A;  4OOI A;  1KU9 A;  2O61 A;  2CO5 A;  1YLF A;  1WI9 A;  1XMA A;  3I58 A;  3WE2 A;  2RGV A;  4GCV A;  4CHU A;  2EV5 A;  3TOB A;  2FQ3 A;  3HRM A;  5D5V B;  3T1B A;  1ODD A;  3FXU A;  4ETS A;  4A5M A;  2V6C A;  1U6G A;  1YS7 A;  2F5C A;  2DLL A;  1GXP A;  2ZME A;  3Q5F A;  1LB2 A;  2A3S A;  5E18 F;  4EJU A;  4KIF A;  5DUK A;  3E5U A;  2XKP A;  5BPD A;  4PGG A;  1K78 B;  4HBL A;  4DNC A;  4YFK F;  1XDU A;  2BV6 A;  2W24 A;  4LK1 F;  1O3T A;  1T38 A;  1KA8 A;  5FFZ A;  1P4W A;  4ENK A;  1S8N A;  1G3Y A;  3MQ0 A;  3S2W A;  1G6N A;  2L4A A;  2FOK A;  3O2P E;  3E6C C;  4S05 A;  1SFE A;  2IT0 A;  3F22 A;  3E3V A;  1IN4 A;  2F5D A;  3IKV A;  2VOP A;  3FF5 A;  2CG4 A;  1G4D A;  3WGG A;  2MH2 A;  3QRF F;  1SD6 A;  2ESN A;  1IF1 A;  4HLY A;  1WKM A;  3GW2 A;  1W5T A;  3V8J A;  1HBX G;  1FX7 A;  3HSF A;  5D6F A;  4MTD A;  1J75 A;  1BIB A;  3F72 A;  3TO7 A;  4YG2 F;  3F8C A;  1WQ2 A;  1ON1 A;  2DFI A;  3IRR A;  1FPQ A;  3F6O A;  1AOY A;  3VEP A;  2UWM A;  4EGY A;  1KYZ A;  3NRV A;  3HHH A;  4L5I A;  3QOP A;  2B0L A;  5JI6 A;  4CIC A;  4WXD A;  1TLH B;  4NHJ A;  2RC4 A;  4EJW A;  2MA3 A;  1Z6R A;  2HDC A;  3CJN A;  3I64 A;  3ZQ7 A;  2UXX A;  5CJ9 A;  4WK8 F;  1IXS B;  3E5Q A;  3QPT A;  3WTS C;  2FA5 A;  4IHS A;  1R7J A;  2Q8K A;  2Q0O A;  2K27 A;  1LEB A;  1YS6 A;  1MZB A;  2LDU A;  5FLX K;  2J5O A;  2PMU A;  5LHG A;  1PDN C;  3SHF A;  1FSH A;  2D2W A;  4M73 A;  1YFH A;  3I59 B;  1YW7 A;  1S29 A;  1JXS A;  3WTY C;  2BE5 F;  1R5G A;  3ELK A;  2QEN A;  2G9W A;  2KJC A;  3WTU C;  1U5T C;  3K2Z A;  1QNT A;  3Q9S A;  2QQA A;  1O7L A;  2CQK A;  4A12 A;  1JHH A;  2K02 A;  4M71 A;  3KEO A;  3MAJ A;  3EQL F;  5L3G A;  2K4B A;  3E6D A;  2GA2 A;  5IT9 K;  5A2Q K;  4YFX F;  1YYV A;  1GVJ A;  2ACJ A;  3GFL A;  4HV5 A;  3M9A A;  2EJR A;  3ECH A;  1RUN A;  3OOP A;  2F5E A;  1B1B A;  2ZKZ A;  1I6X A;  2TDX A;  1J2X A;  2YX4 A;  2VE9 A;  4M72 A;  2RN7 A;  2DBB A;  4OIO F;  5AON A;  5JFR A;  1S7O A;  3GZ5 A;  2XAQ A;  3WU1 B;  1B4A A;  3PFI A;  3ZMZ A;  4AD9 A;  3B73 A;  2STT A;  3L09 A;  2WC2 A;  2OU2 A;  5BQT A;  1FY7 A;  4MEY F;  2O03 A;  1D8J A;  2JSC A;  1QO0 D;  1XB4 A;  2LNB A;  1G3T A;  2DPU A;  4YFN F;  5FO5 A;  2PQ8 A;  4O6J A;  5BMZ A;  3T5X A;  2GXG A;  3JSO A;  1SFX A;  4HF1 A;  1H9G A;  2FF4 A;  5FLX Z;  3GFI A;  4HDV A;  2HQN A;  2HTS A;  2XAJ A;  2P5K A;  2XHK A;  3LA7 A;  5ED4 A;  4Y15 A;  2A07 F;  5IT3 A;  2HKX A;  3IC7 A;  2L01 A;  2OZU A;  4AVP A;  2HTJ A;  1QQI A;  2MC3 A;  3U1D A;  1TBX A;  3KLO A;  2STW A;  3CUQ C;  2K4J A;  3C18 A;  1R58 A;  2RV8 A;  2FU4 A;  2ZJ2 A;  3ZPL A;  3MZY A;  4L0Z B;  4CYD A;  2GIV A;  1O3Q A;  5EEH A;  1GHC A;  4HQM A;  2A68 F;  1TW3 A;  3M8F A;  2QBY A;  5IT9 Z;  5A2Q Z;  2ZFW A;  3O6B B;  3GX4 X;  1OKR A;  2V9V A;  1KU7 A;  4EM1 A;  3LST A;  1I1S A;  5ILS A;  1NHA A;  2H09 A;  4I98 B;  2DPD A;  1GXQ A;  3K0L A;  3LFK A;  1T2K A;  3R4K A;  1SFU A;  2O0Y A;  4UHT A;  1K79 A;  4L0Y B;  4EMS A;  4KUM A;  4DQ2 A;  1FZP B;  1MDM A;  1XGS A;  1RI7 A;  2PJP A;  3WU0 A;  2EA2 A;  1BC7 C;  1SD7 A;  2CGP A;  4HF0 A;  3ABT A;  4HX7 A;  1L0O C;  3E6B A;  2IPQ X;  5K1Y A;  4L9J A;  1SD4 A;  3GFJ A;  4TV7 A;  3BZ6 A;  1D3Y A;  1UHM A;  3V7C A;  3V7R A;  2DQL A;  1HKS A;  3SFZ A;  2CYY A;  3LQR A;  5K5Q A;  5CVU A;  5JHU A;  1FP2 A;  2LF7 A;  1V4R A;  4GXO A;  1KQ9 A;  4PGH A;  4WXH A;  2QLZ A;  5LEK A;  4RGS A;  1MGT A;  4UVC A;  3JW4 A;  3COA C;  4A6E A;  4EJV A;  2ADU A;  3PQJ A;  3G73 A;  2IVM A;  5DD8 A;  4RB2 C;  5DD4 A;  3M1E A;  5CVV A;  4U0Y A;  2VBX A;  4M6Y A;  4UV9 A;  1AWC A;  1XN7 A;  3GLX A;  4QWQ A;  1D8K A;  5H6R A;  4LGW A;  5E1X A;  3MZH A;  4I02 A;  1BI0 A;  3IRQ A;  2PI0 A;  1ZRC A;  1O7F A;  1SD5 A;  1G3S A;  1IRG A;  4EGZ A;  4OMY A;  1R1U A;  2HFH A;  3V8K A;  1HW2 A;  4Y13 A;  3CTA A;  1VTN C;  1ZGA A;  4U7B A;  2P5V A;  2UXN A;  4U0V A;  3ROU A;  2DK5 A;  3QU3 A;  2ZXJ A;  2HKO A;  2VON A;  4P96 A;  2FNA A;  3K9T A;  4A0X A;  1D5V A;  1HKQ A;  4ENM A;  3ISP A;  3FMR A;  3GUD A;  4NB5 A;  2VE8 A;  1P4A A;  4IRG A;  1XD7 A;  2YR2 A;  1ZRE A;  2WTE A;  5K5O A;  2VN2 A;  4BNC A;  1IUY A;  3K69 A;  3CUO A;  4HX4 A;  5HS8 A;  4OMZ A;  2VC0 A;  2Y48 A;  2E7W A;  1E17 A;  1XMK A;  1K78 A;  4A0Y A;  3TO6 A;  3FXQ A;  1B6A A;  2BBY A;  2XAH A;  1B9M A;  2MH9 A;  3TO9 A;  2MBF A;  4ZYG A;  1U2W A;  4ESB A;  1XDS A;  5FD5 A;  3H3Z A;  3HYI A;  2PFB A;  4JBA A;  1MKM A;  5FB2 A;  2P7C B;  4UUV A;  1QGP A;  4NQW A;  3KP4 A;  2YU3 A;  4HOB A;  1O3R A;  5LGU A;  1SMT A;  2FSW A;  3D5L A;  3BDD A;  4KNY A;  5ILU A;  3JTG A;  2IRF G;  1FYL A;  4A0Z A;  5FD6 A;  2JTV A;  5F6F A;  2Q2E A;  1YW8 A;  4I0B A;  1Z9C A;  1FYK A;  1TQP A;  3KET A;  2CFX A;  2H6C A;  4HAM A;  3RIR A;  2KKO A;  2H94 A;  5LRS A;  3O3K A;  2IP2 A;  3WTW C;  5DYM A;  2CW0 F;  4N9I A;  3BPX A;  3L7W A;  4U88 A;  1P2F A;  4ESJ A;  3LA3 A;  2L3D A;  4HV6 A;  3WTZ A;  3FZV A;  3L2C A;  1R36 A;  1ZGJ A;  4M6X A;  1YQA A;  1B9N A;  2XUB A;  4O5V A;  1RNL A;  1YW9 A;  1S7A A;  1V3F A;  3TOA A;  1KGS A;  4BHC A;  4MHG A;  1BC8 C;  2ZBK A;  3N4M A;  5E20 A;  2XIG A;  5CVR A;  5AIQ A;  4BQA A;  2JRT A;  1IRF A;  2PEX A;  2EFP A;  1T39 A;  3I59 A;  4XBF A;  4G94 A;  1R22 A;  1ON2 A;  1WSU A;  4IF4 A;  1U78 A;  2V79 A;  5LHI A;  4JQF A;  4WCG A;  4ZYE A;  1IXC A;  2XV4 S;  2V1U A;  1U5T B;  2COM A;  4M9S A;  1ZG1 A;  2BYV E;  1FT9 A;  4S04 A;  4LJZ F;  3QU6 A;  2QUF A;  4G7H F;  2FE3 A;  2RVC A;  3VFZ A;  1ZRF A;  3W6K B;  4WWC A;  2KIU A;  2H27 A;  1F5T A;  4OIR F;  3R61 A;  4MGR A;  4OIN F;  2NS0 A;  3EDP A;  4UV8 A;  3VOD A;  3KLN A;  4QLC U;  3KP5 A;  5J8F A;  2VOO A;  3F6V A;  3FX3 A;  4P9U A;  4ZH4 F;  2W85 A;  2DT5 A;  1STZ A;  1IW7 F;  2VT3 A;  4EVI A;  5FGM A;  3P9K A;  3RKY A;  2AXL A;  1DPR A;  3ECO A;  4ZZD A;  1EV7 A;  2AS5 F;  3Q9V A;  2MLG A;  3H3U A;  5D8K B;  2HYF A;  2VT2 A;  4HLX A;  4Q48 A;  1Z91 A;  1TW2 A;  1Z7U A;  4ASN A;  3FM5 A;  4HYE A;  4A6D A;  4H0E A;  1HSJ A;  1ZAO A;  5ERI A;  2W84 A;  2WV0 A;  1LDJ A;  2QQ9 A;  1I1G A;  4B09 A;  2MD5 A;  1USS A;  3HRS A;  4JK1 X;  4GO1 A;  2DTR A;  2A69 F;  4L9N A;  2WWY A;  3F21 A;  1IN8 A;  5HDK A;  3RPU A;  3QPH A;  3GFM A;  2V1X A;  1DDN A;  4MQV A;  4KIC A;  1TNT A;  1PP7 U;  3HSR A;  4GGG A;  2EV6 A;  1TQI A;  3ML6 A;  3F8F A;  5ICG A;  3F3X A;  3K1M A; 
#chains in the Genus database with same CATH topology
 1J5Y A;  2E19 A;  2WB1 A;  3K4J A;  4R1H A;  5LRR A;  4UUS A;  3CF5 F;  2E34 A;  1FWZ A;  4CO8 A;  2DJI A;  1QVU A;  3WOD F;  3N97 A;  1L3L A;  2XVC A;  5M5Y J;  3T0Y A;  2E1N A;  2W25 A;  1YX3 A;  1BI1 A;  1T6S A;  3G1M A;  1Z1D A;  1WJE A;  5L3E A;  5GTI C;  1GLN A;  1XG1 A;  5H6Q A;  3GTJ J;  1UST A;  2DAO A;  1LNW A;  2QWW A;  1RR8 C;  1W1W E;  1U9N A;  2ESH A;  4UXN A;  4XN0 A;  5F1R A;  1OYY A;  3EUK L;  4ZJZ A;  2R7T A;  2Z5U A;  4XOT A;  3H1C A;  3GLL A;  3CCM I;  3D5R C;  1B72 B;  5L3F A;  3DKX A;  4I09 A;  2QSH X;  4RS8 A;  2IGO A;  3CUQ B;  4MIM A;  3GVA A;  5ILV A;  1R1V A;  3DXJ F;  1J9I A;  3FXL A;  4BS9 A;  1WJA A;  4JX5 A;  2M2E A;  4HRI A;  1TZL A;  2FEZ A;  2X9D A;  2EWN A;  3GTL J;  4ZYA A;  3ZXS A;  1KU2 A;  2VBW A;  3RCO A;  1OCP A;  3I3L A;  2BW3 A;  1BJZ A;  3RPU D;  4NDL A;  1FOX A;  1OYI A;  1ZAR A;  3CCS I;  1BN5 A;  4BE2 A;  4FT8 A;  4KN4 X;  4XLN F;  3H35 A;  4BHB A;  2K9S A;  1D1C A;  1S6L A;  2F6C A;  2JUG A;  1HST A;  1N78 A;  3QAH A;  3MKY B;  4RAZ A;  3DPL C;  3M07 A;  3DBL B;  2EK5 A;  2NS7 A;  2OAZ A;  4EAT A;  2L9V A;  3HEF A;  3MKZ A;  3W6J B;  1MJ9 A;  1Z3Y A;  4BQQ A;  1H88 C;  5CVJ A;  3BJ6 A;  4HZF A;  3FM3 A;  3SZG A;  2LOO A;  4KFC A;  1WHU A;  4D9J A;  2MGQ A;  5LGT A;  4A3I J;  2L9N A;  2E60 A;  2X0L A;  2M4K A;  4YII A;  4ZDP A;  2V26 A;  3K1N A;  4G8X A;  4XRS G;  1O3S A;  4X6A J;  3NWS A;  3BCA A;  2L54 A;  1HF0 A;  4FX4 A;  1DPU A;  3CCL I;  3Q0W A;  2NNY A;  3K4M A;  3CCV I;  1T98 A;  1RPW A;  1TWA J;  2EZH A;  4BGD A;  4XRM A;  4B3A A;  3EYY A;  1RIO H;  1GUU A;  3I53 A;  2RQP A;  4RGR A;  3I4M J;  5EEA A;  1OCC H;  1EH7 A;  4JX4 A;  4F52 A;  2BW3 B;  1XGO A;  2B9S A;  2DI3 A;  2CUZ A;  1K7A A;  4PFO A;  3I4P A;  2PBI A;  1W7P B;  2EFN A;  5J40 A;  5HS9 A;  4UVA A;  3HOT A;  3HOX J;  1Z67 A;  1SMY F;  3KYD B;  2M1B A;  3OYI A;  4LLG F;  2GXA A;  4XID A;  2V6E A;  2CUE A;  3FMS A;  3ULQ B;  2A61 A;  4KN7 X;  1KYW A;  4PJJ A;  3GWZ A;  3ZP5 A;  1A6Q A;  4PZJ A;  4LB5 A;  2Z16 A;  2HQA A;  1YO5 C;  4Q4Z F;  3OL4 A;  5IP6 A;  1BL0 A;  2HVR A;  5DCF A;  1J7K A;  2X6W A;  5DV5 A;  4G6Q A;  1DUX C;  2KHM A;  3E1S A;  3GTP J;  3H3V K;  2PJR A;  1CF7 B;  1P4X A;  3ZN1 A;  1OFC X;  5K7H A;  3ABL H;  2M7B A;  5KK1 A;  4DYR A;  2LF8 A;  2O8X A;  2H8W A;  4IHX A;  1FOK A;  3CMA I;  2BZT A;  1PUE E;  1HW1 A;  2K7L A;  4KMU X;  1R5H A;  3H9Q A;  1LFU P;  1H9T A;  3BTI A;  3HIF A;  1Y0N A;  2FBK A;  2ZFU A;  5C4J J;  3CD6 I;  5IYD J;  1ZHF A;  4XRF A;  3ASN H;  4OWR B;  2IS1 A;  2EIL H;  2YX7 A;  4M9X A;  1WRJ A;  5B1B H;  4G7O F;  4Y3O A;  3PSI A;  4N9H A;  2IAI A;  2XGX A;  4BJ6 C;  1G3W A;  2FMY A;  4KT5 C;  4HNT A;  1F4K A;  4RM3 A;  4A3E J;  4BDZ A;  3GF2 A;  1M1E B;  1ZLK A;  3R6S A;  1XSV A;  3CMM A;  2C6Y A;  4G6T B;  5ICF A;  3TKY A;  4C3I J;  3FXM A;  4FHT A;  2O6G E;  3PO3 J;  2YSR A;  3C1D A;  2CSO A;  4KDP A;  2MW8 A;  1HQC A;  3CLO A;  4Q47 A;  1PP8 F;  3MN2 A;  3LAP A;  3DPT A;  1UJ8 A;  1Y0U A;  2DA2 A;  3G6E I;  1H0M A;  1X3U A;  3WTT C;  2JA2 A;  3AG4 H;  3IHU A;  4RB3 C;  4ZDL A;  1QU3 A;  3FKI J;  2DJN A;  2B7E A;  3D0S A;  2PLY A;  3MFK A;  4LIU A;  5EDN A;  2MYS A;  2IA2 A;  6PAX A;  3GZN B;  4CCM A;  5IOY A;  5J47 A;  2QEX I;  3KFW X;  3OS2 A;  2JPB A;  4OIP F;  2BY2 A;  2ZC2 A;  1MH4 A;  5AIP A;  5LEJ A;  5HLG A;  4MNU A;  1W36 D;  4N0B A;  4U0W A;  4AWX B;  4A3G J;  4BL0 B;  4RGU A;  3GO5 A;  5F1J A;  4L18 B;  3KE2 A;  1FOY A;  2GLO A;  1HXD A;  2XPU A;  3L2Q A;  1OMI A;  1XCV A;  2HS5 A;  2HU9 A;  1AA7 A;  4CGZ A;  3RYR A;  1R4N B;  3IV5 A;  1XGM A;  4CA0 A;  2VBY A;  2LYC A;  3U2R A;  3LWF A;  1MBF A;  1QRY A;  2FOW A;  2F48 A;  4ZYH A;  4L9T A;  1FC3 A;  5HOO A;  4QPO A;  1RKW A;  2O7O A;  1LEA A;  3DEU A;  2R7U A;  4E7H A;  3KZZ A;  3KEQ A;  1FBQ A;  3PNV A;  4OAZ A;  1A04 A;  1JJ8 C;  3TMO A;  2DMT A;  3PJR A;  2E36 A;  3LAJ A;  2HDW A;  2KT0 A;  2GWR A;  3BPV A;  5F64 A;  1VQK I;  3QPS A;  3U21 A;  3TW7 A;  1VF9 A;  3NAR A;  2E1O A;  2IGK A;  4ON0 A;  3FHN A;  2RRE A;  4RAY A;  4CCL A;  4A93 J;  5F04 A;  5D6E A;  1BR1 A;  1JGG A;  1VQO I;  4QIW N;  5D5U B;  3FIW A;  3SDB A;  5L3D A;  4KYW A;  5FLV A;  5IOZ A;  1G8X A;  5JVG F;  5HS7 A;  2GIZ A;  1H8A C;  3CP8 A;  3LA2 A;  2WAF A;  5DCM B;  4LG0 A;  3GXO A;  2A5Y B;  1QZY A;  3RZO J;  2IW5 A;  2H6B A;  2L4M A;  3OWT A;  2W48 A;  3WG9 A;  2R7S A;  2HEO A;  4BAY A;  3WG7 H;  1YOV B;  3J7Y J;  1ZYR F;  5HOD A;  1S7E A;  1VND A;  2A6E F;  4PJL A;  2IJL A;  4DBQ A;  4RGX A;  1FBU A;  2RKH A;  1Z3X A;  3E0J B;  2HZT A;  4M74 A;  2IA1 A;  2LVS A;  1F1Z A;  2ZJQ F;  1XSD A;  4UVB A;  1VQ4 I;  1TNS A;  2XPV A;  3ZMU A;  5DEQ A;  2GXB A;  1MBH A;  3TP0 A;  1LQ1 A;  2KZG A;  2QQB A;  4RB0 A;  1X3Z B;  5L3C A;  3WTX C;  4I2O A;  3E97 A;  2Y0M A;  1RKT A;  3BG6 A;  2PX9 A;  4AU7 A;  4LLN A;  2IS2 A;  1S5L C;  2ZCW A;  1WJD A;  2R7D A;  2NNN A;  4EJO A;  3S17 J;  1VQP I;  4P55 A;  1IN5 A;  3H92 A;  4PJM A;  3RSN A;  4BJT A;  5D5W B;  2L5Q A;  3KYC B;  2HOT A;  4H4K C;  4HW0 A;  2MAB A;  5K7Z A;  3FXR A;  2XAG A;  1UAA A;  1X4P A;  1NK3 P;  4ZYD A;  4MLO A;  3HRT A;  4LG0 B;  5CQG A;  3QYB A;  1QA6 A;  2OJE D;  3I9V 2;  4LK0 F;  2D1H A;  3QQA A;  4BQN A;  4AC0 A;  4EM0 B;  3OMY A;  5BNG A;  3J7Z I;  2NVX J;  4I0A A;  3FXO A;  3DEE A;  2K86 A;  2CV0 A;  2IS4 A;  2MFZ A;  2ICW G;  5J1R A;  3T8R A;  1KU3 A;  3JAM K;  2BGC A;  3B6C A;  5D8L B;  3VOE A;  1ZQ3 P;  2HQR A;  3TW6 A;  2ELH A;  2LH9 A;  5JLW A;  4EM2 A;  4K2E A;  2Z9O A;  3HSE A;  2MLK A;  4MQ9 F;  1YIJ I;  5GAE J;  2KIQ A;  1I5Z A;  2R5Y A;  2XF6 A;  1LFB A;  1X1A A;  3V8L A;  3DFG A;  3BR1 A;  1J59 A;  5DDG A;  4IPA A;  5EZH A;  2Z3Y A;  2HYG D;  3FKJ A;  2DO7 A;  3HOV J;  5LD2 C;  1BOA A;  1ONV A;  5DUI A;  2TRT A;  5K5R A;  4CZC A;  3C7J A;  3WE3 A;  3V7S A;  1MSE C;  2WAQ N;  5FKM A;  4GYI A;  4OU0 A;  3GZ6 A;  4XSX F;  3ZMT A;  4BUP A;  4A3M J;  4XON A;  4RM2 A;  3IL2 A;  1TQM A;  1F9N A;  2EA4 A;  3L9F A;  2IEK A;  4EQQ A;  3DQV C;  2BY1 A;  2J5P A;  2CQQ A;  3BJO A;  1SVO A;  1Q1H A;  1EH6 A;  1G59 A;  1HW5 A;  5M3F J;  4U7D A;  3HOZ J;  2CUJ A;  4BXU A;  3CC4 I;  4E4H A;  4LIV A;  2XGD A;  4AIK A;  3RYP A;  3C3W A;  2XRL A;  2MSY A;  1LE8 A;  3OYC A;  3ZQF A;  3GCM A;  1YTY A;  1U8R A;  2VOD A;  3IAM 2;  1X2M A;  3WGI A;  4OIQ F;  4DW6 A;  5D4R A;  3FDY A;  3PL8 A;  1OIS A;  1RUO A;  1U5T A;  1V55 H;  2LK2 A;  2UV1 A;  2R5Z B;  1UHW A;  4NC8 A;  3OYE A;  2R7X A;  4LFU A;  1IZ1 A;  2KJB A;  1JKP C;  1JJ6 C;  1OCZ H;  2YUS A;  2HPI A;  2ZME B;  3E5X A;  1AKH B;  3CCY A;  3KP3 A;  5IP9 J;  1VQ8 I;  5BS6 A;  2VQH A;  1JI8 A;  1BM9 A;  3KIO A;  1IRX A;  5E8I A;  3EUH A;  2EFO A;  2RNJ A;  1MD0 A;  1HA8 A;  4ZZL A;  4W1U A;  3SZP A;  2OZ6 A;  2OQR A;  4L5J A;  3MVP A;  4B8X A;  2DXI A;  3DEW A;  3LQQ A;  3GYH X;  1C0W A;  4IRH A;  1JUM A;  3BR3 A;  2DYR H;  2VL8 A;  2HWV A;  1X1D A;  2ZSI B;  5CQE A;  3GTM J;  3ZQH A;  4XLE A;  1ETY A;  1SEU A;  1XGN A;  3VDX A;  3W2V A;  2ETH A;  4KJZ A;  2P4W A;  3G3Z A;  2QVO A;  3ZMV A;  2PG4 A;  2K85 A;  2GAU A;  3P5J A;  3P9C A;  4G6D A;  4UNO A;  3A2K A;  4FQG A;  1ZN2 A;  5FKO A;  3HTU A;  3ZQQ A;  2X1D A;  3G71 I;  2JSP A;  2E7X A;  5F0F A;  1IDY A;  1BR2 A;  2DA7 A;  3C2H A;  5IY5 H;  3OY9 A;  1N25 A;  4LOC A;  3CO6 C;  2W57 A;  5CVI A;  3OV8 A;  5LHH A;  2XRO A;  3C2B A;  2QCO A;  1WH5 A;  2JN6 A;  4HPQ A;  4E7L A;  4E7J A;  3DLA A;  3A03 A;  4RAG A;  1Q1V A;  2NAZ A;  3T8T A;  1WVR A;  2AXT C;  3JSP A;  2X1E A;  2FML A;  3IH4 A;  3WGH A;  3A01 B;  2CV2 A;  1SAX A;  2ID6 A;  4F55 A;  2VJ5 A;  4WX9 A;  3OYF A;  4IX7 A;  2E2J J;  3F8N A;  3L1P A;  3L2V A;  2VC1 A;  3A0B C;  2P6S A;  2OUM A;  5EEG A;  3BY6 A;  3P9I A;  1TT0 A;  3NQO A;  2BXZ A;  3V4G A;  1D1B A;  2LRE A;  2M5W A;  4R8H A;  3ABM H;  3RJP A;  2IA0 A;  2G7H A;  4KIT B;  3KCC A;  2O3F A;  1Z05 A;  4JX6 A;  3RKW A;  4A3B J;  3HUG A;  1W4M A;  1JE8 A;  3EPZ A;  2M45 A;  1E2X A;  2HGC A;  3CZ6 A;  3JAM Z;  1R23 A;  4AVZ A;  1FBS A;  1APL C;  2L7M P;  3QPL A;  4IKF A;  4E70 A;  2GOX B;  1XSX A;  1O57 A;  3NAU A;  3FXK A;  3HM5 A;  5B5E C;  1P92 A;  2PMZ N;  2NXN B;  3OR1 C;  3ZGK A;  5LLQ A;  1BI3 A;  3FHZ A;  5LBQ A;  2A5W A;  2LKP A;  3AG2 H;  5HDN A;  1SVL A;  2KRF A;  3M8E A;  3PQK A;  4NC6 A;  4XOR A;  3ZN0 A;  1X1B A;  1VQ7 I;  3MWM A;  1B59 A;  4DYQ A;  3S93 A;  1P7J A;  3AKZ A;  4YIR X;  3SXY A;  2GQQ A;  3MKW B;  3JRI A;  4RDU A;  3IUO A;  3HTS B;  5E17 F;  1ULY A;  3K7A J;  4B4C A;  3LNQ A;  2X4H A;  2LRD A;  5JVT A;  4D5C A;  3J7A O;  4Z2Y A;  1FSE A;  4F92 B;  3NEU A;  4RBO A;  3RQI A;  3L00 A;  4LD5 A;  2EIM H;  3RDI A;  3MEX A;  3TQN A;  1X19 A;  3PO2 J;  5TJJ A;  4CYC B;  1LUJ B;  4E7Z A;  5TRD A;  1ETW A;  2XPW A;  4F7Z A;  1TT5 B;  5H20 A;  3IKT A;  3HJE A;  3BQY A;  3FK7 A;  1PUF B;  1CQT A;  4O3M A;  1QPM A;  1LJ9 A;  2VQL A;  1I27 A;  4UUT A;  1J09 A;  2FXA A;  1NG6 A;  2FNP A;  2DTZ A;  1X2N A;  1JUS A;  1B72 A;  3FMQ A;  1XCB A;  4IHT A;  2TCT A;  2OC6 A;  2P8T A;  3HHG A;  3SQN A;  3U9G A;  4HF2 A;  3QP6 A;  1W0T A;  1LDD A;  3CUQ A;  3VB2 A;  3KZY A;  4Y33 A;  4XNF A;  4II3 A;  5E3L A;  3DF8 A;  3OOU A;  1P9Q C;  5J6X A;  1LDK B;  3A02 A;  3P7N A;  2OD5 A;  3ABU A;  4FX0 A;  1H89 C;  2XAS A;  2RDP A;  2DFF A;  2V1D A;  3BTJ A;  2DYS H;  2G0E A;  2Y75 A;  4YEJ A;  4L9V A;  4A3D J;  2LMD A;  1IN6 A;  4MTE A;  2XGC A;  3Q0U A;  3HDD A;  1WWX A;  2E1M B;  1JKO C;  5J3L A;  5IPA A;  3KP7 A;  3SZT A;  2OBP A;  1MBJ A;  2DW4 A;  1YG2 A;  2BHY A;  2I10 A;  2G7U A;  4KIG A;  1ZR4 A;  3EET A;  2HXO A;  5KCM A;  5J8C A;  5HDG A;  1WJC A;  1VI0 A;  3R0A A;  5FLM J;  3RKQ A;  2DMN A;  2NVY J;  2P6T A;  5HVQ C;  3K4C A;  4BHP A;  4C3J J;  1BOB A;  1CGP A;  2CH0 A;  2F2E A;  4AID A;  3R0J A;  1ZG3 A;  2GA1 A;  4WXC A;  3OS1 A;  3GEZ A;  2DCE A;  1Z77 A;  1JUP A;  2OA4 A;  3OIO A;  4Y7N J;  2IXS A;  2CWE A;  3REO A;  4R79 A;  3VYT B;  3BG9 A;  1NK2 P;  4CCK A;  3KX2 A;  2M8E A;  1S3J A;  5ICE A;  1BBY A;  2CW7 A;  3OYL A;  1QBJ A;  3ZMS A;  1ZK8 A;  4Y17 A;  1ETX A;  1VQ6 I;  2KFD A;  1W7P A;  3J81 K;  1JHF A;  2F5F A;  5LGN A;  2XF5 A;  1XX5 A;  1N75 A;  2NVQ J;  2FBH A;  1UFM A;  2OTJ I;  2K40 A;  2LSO A;  2ZNY A;  4CZZ A;  1DQU A;  2NRA C;  4P9F A;  4LB6 B;  4IVN A;  4PDK A;  5BPI A;  3WTV C;  4A3L J;  1QZZ A;  4ENN A;  4CDG A;  4PCQ A;  2DQR A;  2JPC A;  4FE4 A;  1NH3 A;  4BH9 A;  2V4J C;  2ISY A;  4G9Y A;  4E7I A;  1ZRD A;  2V9P A;  1SVM A;  4I7H A;  1FMW A;  1MND A;  3LFU A;  2FRH A;  3DP7 A;  4YRV A;  2XF7 A;  3KPH A;  3BRO A;  1HKT A;  4BE0 A;  3CQZ J;  1MJB A;  2IGM A;  2ECB A;  3AAF A;  1BR4 A;  2O5R A;  2W82 A;  2YPR A;  1VQ9 I;  5CYV A;  4XOP A;  1CF7 A;  4KMF A;  4JOM A;  1A6I A;  2DA1 A;  2F5V A;  3KP6 A;  1YX5 A;  2DU9 A;  2ME0 A;  3WHC A;  5EGO B;  3CCJ I;  4AIJ A;  2M87 A;  4HDU A;  3FWE A;  2P81 A;  3I0T A;  4MO7 A;  3L2R A;  2OPT A;  1UCR A;  2E35 A;  3M7G A;  4BXX J;  2WAQ A;  5HNF A;  5EG0 B;  3TDU C;  5HLH A;  3J80 K;  4M3D A;  2JZY A;  5J1U A;  2Z99 A;  1OCR H;  4A5N A;  4HX8 A;  2H1L A;  2ME6 A;  3CDH A;  2CV1 A;  3Q3S A;  5E1W A;  1W7P D;  1YIO A;  2DMQ A;  4RB1 A;  2JA7 J;  1ZTR A;  3LOC A;  4A3K J;  2M0C A;  3K1P A;  3HOU J;  3DTI A;  2L7Z A;  3ERE D;  2PMH A;  3W2W A;  2OV7 A;  4EV0 A;  5M5X J;  3NWT A;  2ISZ A;  4XLP F;  1RRJ A;  3BCB A;  4EEF G;  4AIH A;  5D4S A;  3VWB A;  3AL0 C;  3MCZ A;  2Y2Z A;  4XSZ F;  3F23 A;  2KL4 A;  2QYO A;  3I54 A;  2JJ7 A;  2JVG A;  3DKW A;  2H8R A;  5KVR A;  1U3E M;  1SFK A;  2NYX A;  2L02 A;  4M9Z A;  1DP3 A;  4P5O A;  3F0C A;  3I56 I;  5HLI A;  2Y9Z A;  2E1C A;  2BEO A;  5GPA A;  2M30 A;  2D45 A;  3CDI A;  3JRD A;  3RTR A;  2V1N A;  3E6M A;  5F0H A;  1S72 I;  4B48 A;  2WAD A;  1Y6I A;  1OPC A;  3QOE A;  3BOQ A;  4M3G A;  3OYA A;  1BIA A;  1OR7 A;  2X48 A;  1FOW A;  1UB9 A;  4FIS A;  3S32 A;  3OYB A;  2QBY B;  4ITV A;  1KQ8 A;  2ZO4 A;  4IJA A;  1HC8 A;  4XN3 A;  2R3S A;  4QPQ A;  2VKH A;  3ZMD A;  1Z6T A;  1ORK A;  2QZ8 A;  4BXF A;  1YRN B;  2P7V B;  3JTH A;  5BOX A;  2EB7 A;  1IN7 A;  3I5U A;  4C2T A;  4BBS J;  1JGS A;  3CO7 C;  1BJA A;  4LLL A;  4IHV A;  5E8G A;  2D1V A;  1KQ0 A;  2VXZ A;  2XAF A;  3KP2 A;  3B02 A;  3HRU A;  4PSX A;  4WF2 A;  2XB0 X;  4IXA A;  3AG1 H;  5JR3 A;  1MMS A;  5FKN A;  2R7F A;  1W5S A;  2XB5 A;  3EYI A;  4V19 K;  3RI4 A;  5M5W J;  3BWG A;  4EJT A;  3J81 Z;  3VSL A;  3QP5 A;  3BR2 A;  1WJF A;  1EA3 A;  1OJL A;  1MDM B;  2VBZ A;  2JA5 J;  2KIF A;  3HL2 A;  3TGN A;  1FP1 D;  1AU7 A;  1ZLJ A;  2R93 J;  4IOC F;  4N4O B;  4ZTF A;  5E1Z B;  2QM3 A;  4CCO A;  4M3E A;  3HC7 A;  4DZJ A;  4ENJ A;  1REP C;  5DCM A;  1P6R A;  2UZK A;  3JR9 A;  2ZNZ A;  2XRN A;  4Q5S F;  3DV8 A;  4YIF A;  1DP7 P;  3RPQ A;  2DDB A;  4A2U A;  2K3P A;  4D0P A;  3D5S C;  1R71 A;  1MBK A;  2LC2 A;  2CQX A;  4GYG A;  5FRN A;  1IAW A;  1ZG5 A;  5L3B A;  2P5L C;  3F8B A;  2K9N A;  4LIT A;  2PMZ A;  1ZH5 A;  3GBG A;  4LMY A;  1RZ4 A;  4DOZ A;  1LVA A;  4HA8 A;  3JRG A;  2FX0 A;  4CXF A;  1D0Y A;  3I71 A;  3BJA A;  1EH8 A;  2EFQ A;  2HOE A;  3S1R J;  1FLI A;  2WA0 A;  2JUC A;  2EV0 A;  3R60 A;  2HVS A;  1BI2 A;  1R1T A;  2A6H F;  2B63 J;  4B1R A;  1T0F A;  4KA4 A;  4OAY A;  2EH3 A;  3WHB A;  3J80 Z;  1W36 C;  2CRG A;  5FFX A;  4BU2 A;  1FYM A;  4BE1 A;  3ZQC A;  3GTO J;  2Z33 A;  4X0G A;  1MW7 A;  4PUS A;  3F8M A;  4XLF A;  4G7Z F;  3OIP A;  4AUX A;  3HZJ A;  4ESF A;  1V5F A;  2KPM A;  4HQE A;  3BC8 A;  2KIM A;  2OQG A;  2CMP A;  1FNN A;  1X3W B;  2JT1 A;  4D7N A;  1OR7 C;  3ZCO A;  1TTY A;  1J0R A;  2BXY A;  2DK8 A;  1R00 A;  4XIC A;  3HOS A;  5D5X B;  2LTP A;  3TDZ C;  3L2U A;  4C2M J;  1MJA A;  4KIB A;  4PJ0 C;  3LSJ A;  2M8G X;  3H5N A;  1IXR C;  3MMY B;  4BYY A;  2V9K A;  3TBI A;  4IRI A;  4XMY A;  5CLS A;  3M1C A;  1B8I B;  2BY0 A;  2FBI A;  1X1C A;  5TGT A;  2EZK A;  2HR3 A;  2WY8 Q;  1OYW A;  3PSF A;  2Y0S N;  2GZW A;  2NVT J;  4MEX F;  2KQR A;  2VUM J;  3RKX A;  1Y8R B;  4I01 A;  1K6O A;  4N4N B;  3K70 D;  2JA6 J;  3BP8 A;  1WI3 A;  2PN6 A;  2F4O B;  3DTK A;  2EFW A;  2VAS A;  5ICC A;  1LFP A;  3GTK J;  2R7O A;  2Y30 A;  3IWF A;  4U87 A;  1QVT A;  5GPC A;  2XKO A;  3IWZ A;  4OOI A;  1GVD A;  2CQ7 A;  2D5V A;  1KU9 A;  3SJM A;  4XRS A;  1DU0 A;  4F3Q A;  2LKX A;  2O61 A;  2N8G A;  1IG7 A;  1E3P A;  3I4N J;  2CO5 A;  4DBR A;  3W3C A;  2VIX A;  4RLQ A;  1YLF A;  1W5C C;  3S14 J;  1WI9 A;  1XMA A;  3I58 A;  4HG2 A;  4B47 A;  1GV2 A;  3WE2 A;  5IP7 J;  2OTL I;  2RGV A;  5KAI C;  4GCV A;  4CHU A;  2K5C A;  2EV5 A;  3TOB A;  4CH7 A;  2FQ3 A;  3HRM A;  3ONQ A;  4B44 A;  5D5V B;  3T1B A;  1ODD A;  3FXU A;  4GFB A;  1MMD A;  4ETS A;  4A5M A;  1K6Y A;  1RES A;  2BVL A;  4GRI A;  1NG7 A;  2V6C A;  1D0X A;  3CDL A;  3OIQ A;  1U6G A;  3PNY A;  1YS7 A;  2F5C A;  2R5Z A;  2K3F A;  2DLL A;  1GXP A;  2ZME A;  3Q5F A;  4IQJ A;  1AKH A;  1LB2 A;  1E3H A;  3CCE I;  1JKR C;  2A3S A;  3QOD A;  2CQN A;  5E18 F;  1MMG A;  1T0F C;  2QF7 A;  4EJU A;  5EF6 A;  4KIF A;  5DUK A;  3E5U A;  2XKP A;  5BPD A;  1IV6 A;  4PGG A;  1K78 B;  4HBL A;  4DNC A;  4YFK F;  1XDU A;  1X58 A;  2BV6 A;  3S15 J;  2W24 A;  4LK1 F;  2R7R A;  1O3T A;  5JLX A;  3A4C A;  1T38 A;  1KA8 A;  5CKT A;  5FFZ A;  1I50 J;  1P4W A;  1R4M B;  1UG0 A;  4ENK A;  1S8N A;  1G3Y A;  1K4S A;  3MQ0 A;  4X1E A;  1T33 A;  3S2W A;  3K6G A;  1G6N A;  2L4A A;  3JRE A;  2FOK A;  3O2P E;  3E6C C;  2FQ4 A;  3IH2 A;  5GTH C;  3D1N I;  4S05 A;  1SFE A;  2IT0 A;  5H2F C;  3F22 A;  2UUZ A;  3E3V A;  2KRC A;  2XSJ C;  3BTL A;  3E7L A;  3OL3 A;  1IN4 A;  2F5D A;  3IKV A;  4II2 A;  3VSK A;  2VOP A;  3BTC A;  4NQW B;  1SC7 A;  1A36 A;  3FF5 A;  2CG4 A;  4J00 A;  1G4D A;  3WGG A;  2QKM B;  2MH2 A;  2L0K A;  3QRF F;  1SD6 A;  1VQL I;  2ESN A;  3A01 A;  1V5E A;  4CSW A;  3OYN A;  1IF1 A;  3KZI C;  4HLY A;  2LY2 A;  2A6T A;  2GBY A;  1NTC A;  1WKM A;  3DPU A;  5LFA A;  4FE7 A;  3GW2 A;  1W5T A;  3V8J A;  2Q2E B;  1FX7 A;  2R7W A;  3HSF A;  5D6F A;  4MTD A;  2JRM A;  1HBX G;  1FTT A;  3BQZ A;  1J75 A;  5DTD A;  3LSR A;  1BIB A;  3F72 A;  3TO7 A;  3S2D J;  4YG2 F;  3F8C A;  1WQ2 A;  3PIO F;  1XTA A;  1ON1 A;  1XS9 A;  2ID3 A;  2LG4 A;  1ZKG A;  2DFI A;  3IRR A;  1IV8 A;  3ZRG A;  2DT7 B;  5B66 C;  1FPQ A;  2GOM A;  2VKV A;  1YI2 I;  2JMW A;  2ZJP F;  3F6O A;  5C44 J;  1AOY A;  3VEP A;  2UWM A;  4GDF A;  4EGY A;  1KYZ A;  3S1Q J;  2QSF X;  4E6K G;  3NRV A;  1A35 A;  1IC8 A;  5GAG J;  3HHH A;  4L5I A;  3QOP A;  2B0L A;  3PNT A;  5JI6 A;  1BW6 A;  4CIC A;  4WXD A;  3H9J A;  1TLH B;  5GAD J;  4NHJ A;  2RC4 A;  4EJW A;  3VYR B;  3SFI A;  2MA3 A;  1Z6R A;  2HDC A;  3CJN A;  3I64 A;  3ZQ7 A;  2K9M A;  3CJT B;  2UXX A;  2VPL A;  5CJ9 A;  2ZME C;  3S8P A;  4WK8 F;  1IXS B;  3E5Q A;  3S1N J;  3QPT A;  3WTS C;  2FA5 A;  4IHS A;  3DCF A;  1R7J A;  2Q8K A;  1DGW Y;  2Q0O A;  3FBI B;  3BT9 A;  2XAU A;  2K27 A;  1LEB A;  1YS6 A;  5E3N A;  2LY9 A;  4CYC A;  5J4V A;  1N77 A;  1MZB A;  3OR2 C;  2LDU A;  2HNH A;  5FLX K;  2MC4 A;  4HSR A;  3HG9 A;  5J1Y A;  4XL9 A;  3G2B A;  3OYM A;  1PUF A;  2J5O A;  2LD5 A;  3HKZ A;  2PMU A;  5LHG A;  1JKQ C;  1PDN C;  4CCJ A;  3DTE A;  3SHF A;  2YU9 J;  1F43 A;  1FSH A;  4XKV A;  4D1Q A;  2D2W A;  3CLQ A;  4M73 A;  2E71 A;  1YFH A;  2L2O A;  4ZTJ A;  3I59 B;  2HDD A;  1YW7 A;  1S29 A;  1UZC A;  1E3O C;  1JXS A;  3WTY C;  2BE5 F;  3Q0V A;  1R5G A;  3ELK A;  2MG4 A;  2ZXW H;  4XKW A;  2QEN A;  2G9W A;  2KJC A;  3GME A;  1YE9 A;  3WTU C;  1QHH D;  1K4T A;  1U5T C;  3K2Z A;  1QNT A;  5HLT A;  3Q9S A;  2QQA A;  1O7L A;  2CQK A;  2Q1Z B;  4A12 A;  3HBL A;  5F0C A;  3ZR8 X;  1MNM C;  1JHH A;  2Y69 H;  2K02 A;  4XQF A;  2F4I A;  2EIN H;  1ENH A;  3H36 A;  4M71 A;  2W4S A;  3EUH C;  1FMV A;  2X6X A;  3KEO A;  1U0J A;  3MAJ A;  1IO2 A;  4J19 A;  3EQL F;  3KEY A;  2DFH A;  5L3G A;  2HQ5 A;  2K4B A;  3E6D A;  2BOL A;  2GA2 A;  2KDZ A;  2DMU A;  3W6V A;  5GAH J;  5IT9 K;  5A2Q K;  4DYC A;  1RC9 A;  4RMN A;  1TWG J;  4PSW A;  4YFX F;  4MFE A;  1QHG A;  1YYV A;  1GVJ A;  2ACJ A;  2I5U A;  3GFL A;  2VKD A;  3OYG A;  3GTQ J;  4HV5 A;  5F08 A;  3M9A A;  3HPH A;  4XLA A;  2R0Q C;  1F36 A;  2HI3 A;  1RET A;  2EJR A;  2F4M B;  3CJQ B;  3TL4 X;  3ECH A;  3HPG A;  3I55 I;  1VQM I;  1RUN A;  1ZGW A;  3OOP A;  2F5E A;  1B1B A;  2ZKZ A;  1I6X A;  3CES A;  3AG3 H;  2TDX A;  1J2X A;  2YX4 A;  2VE9 A;  4M72 A;  5JHF A;  2LBF B;  2RN7 A;  1VQN I;  2DBB A;  1LVK A;  4OIO F;  2QA4 I;  2HXI A;  2Y9Y A;  5AON A;  5JFR A;  1S7O A;  3GZ5 A;  5IYB J;  4XLC A;  2DFE A;  2M9H A;  3K2A A;  2XAQ A;  2E5N A;  3WU1 B;  1FJL A;  3N05 A;  3ZOB A;  1B4A A;  3ERM A;  3PFI A;  1TC3 C;  2VXD A;  3CCQ I;  3DU6 A;  3ZMZ A;  4AD9 A;  3PFY A;  3B73 A;  5M3M J;  2STT A;  3L09 A;  2IGN A;  1MH3 A;  5FKL A;  1OCO H;  1LKX A;  1R9T J;  2WC2 A;  2L9S A;  2JK3 A;  2OU2 A;  4HST A;  1MIJ A;  5BQT A;  4BDY A;  1FY7 A;  4MEY F;  2W00 A;  2O03 A;  1D8J A;  4JP0 A;  1LPQ A;  1XPX A;  2BVM A;  2JSC A;  1ETK A;  4IHY A;  1YJ9 I;  4IEJ A;  3ZQI A;  1QO0 D;  1XB4 A;  3A0H C;  3ZQL A;  2L7K A;  2EPF A;  2VKE A;  2Y0S A;  2LNB A;  2NOG A;  2VB6 A;  5IYC J;  1VQ5 I;  4NNJ A;  1FIA A;  1G3T A;  1HOM A;  5KNL A;  5EGO A;  2QSG X;  3HOW J;  2AO9 A;  2DPU A;  4YFN F;  2P0W A;  5FO5 A;  2DOA A;  3QYF A;  3DBR B;  2PQ8 A;  4F93 B;  4O6J A;  3ESW B;  3QYE A;  4PK4 A;  3T5X A;  4B43 A;  5EG0 A;  5BMZ A;  3M3Y J;  2GXG A;  4C2U A;  3JSO A;  2LKS A;  9ANT A;  2KP6 A;  1SFX A;  3MD2 A;  4HF1 A;  1H9G A;  4BEH A;  2FF4 A;  5FLX Z;  3GFI A;  4ANJ A;  5EJC A;  4HDV A;  3H9G A;  2HQN A;  2HTS A;  4IL6 C;  2XAJ A;  1DGR M;  4F91 B;  3SEZ A;  2E1M C;  1ETQ A;  3G1O A;  4C3H J;  3RZD J;  2P5K A;  1BW5 A;  3W2A A;  1K61 A;  2NVU B;  2XHK A;  3BZC A;  3LA7 A;  4FAS D;  5ED4 A;  1JT6 A;  4Y15 A;  2A07 F;  1PJR A;  4UUS B;  4QSH A;  5IT3 A;  2HKX A;  3IC7 A;  2L01 A;  1E0E A;  3HGY A;  4RAF A;  3CC7 I;  2KZV A;  4FCY A;  2OZU A;  3BR0 A;  3H5R A;  2HTJ A;  1QQI A;  1U9O A;  4AVP A;  4ZDO A;  2MC3 A;  3U1D A;  2EZL A;  2X51 A;  1TBX A;  5E3O A;  3L2W A;  3HXL A;  3KLO A;  4KT6 A;  2STW A;  3CUQ C;  3AL0 B;  3A1Y A;  2K4J A;  2RQQ A;  3S3M A;  5TIS C;  3C18 A;  1R58 A;  2RV8 A;  2FU4 A;  2ZJ2 A;  3ZPL A;  3MZY A;  4A69 C;  4L0Z B;  4CYD A;  2M7A A;  2GIV A;  2FJ1 A;  2M4G A;  5FRO A;  2K9Q A;  5FJ8 J;  5EZG A;  1O3Q A;  5EEH A;  1GHC A;  4HQM A;  2IS6 A;  2A68 F;  1TW3 A;  4BEH B;  3M8F A;  2H1K A;  2QBY A;  4E7K A;  5IT9 Z;  5A2Q Z;  2ZFW A;  3O6B B;  3GX4 X;  2JQ7 A;  1OKR A;  3BLY A;  2V9V A;  1KU7 A;  4EM1 A;  3LSI A;  3LST A;  4C9Y A;  3LSH A;  1KZH A;  1I1S A;  1YRN A;  1QPI A;  2QKL B;  4LG3 A;  5ILS A;  4C30 A;  1SAU A;  4HEA 2;  3C2G A;  1NHA A;  5K7F A;  2DMP A;  1TP4 A;  2H09 A;  4NBQ A;  1HLV A;  3CC2 I;  4D5F A;  4I98 B;  2DPD A;  1GXQ A;  3K0L A;  2EBI A;  3WU2 C;  4J01 A;  3U1K A;  5C3E J;  3LFK A;  3LSK A;  1T2K A;  2L9R A;  3R4K A;  4HNU A;  1SFU A;  2O0Y A;  2VLA A;  4UHT A;  4DJA A;  4I76 A;  1K79 A;  1DU6 A;  5GP9 A;  3JRH A;  2CU7 A;  4L5E A;  3X2Q H;  4BKX A;  4L0Y B;  4EMS A;  3JCU C;  4KUM A;  4DQ2 A;  5J4Y A;  2CUF A;  1JT0 A;  1FZP B;  1MDM A;  5FKK A;  1XGS A;  1RI7 A;  1HDD C;  3LSP A;  1SAN A;  2PJP A;  3WU0 A;  2EA2 A;  2X6Y A;  1BC7 C;  1SD7 A;  2CGP A;  4HF0 A;  3ABT A;  1R6R A;  4HX7 A;  1ZEL A;  1L0O C;  1IUF A;  1X4O A;  3E6B A;  3DLL F;  2IPQ X;  5K1Y A;  3TED A;  4L9J A;  4XKB A;  1SD4 A;  3GFJ A;  4E7S A;  4TV7 A;  4CUG A;  3HKZ N;  1UMQ A;  5HNH A;  3BZ6 A;  1D3Y A;  1UHM A;  3V7C A;  3V7R A;  1I3Q J;  2WAE A;  2DQL A;  2HOS A;  1HKS A;  4NUB A;  3CMY A;  1TWC J;  3CP2 A;  3PUF A;  3SFZ A;  2CYY A;  3SDG A;  3LQR A;  5K5Q A;  5CVU A;  5JHU A;  2E2I J;  1FP2 A;  1MBG A;  1TWH J;  2LF7 A;  1MBE A;  1WCM J;  4M3B A;  4XR6 A;  1V4R A;  2X85 A;  3HOY J;  4GXO A;  1KQ9 A;  2CS3 A;  4PGH A;  4WXH A;  1T56 A;  4FTH A;  2WBM A;  4FET A;  2QLZ A;  2QQ8 A;  5LEK A;  2EIJ H;  2PJR B;  4RGS A;  1MGT A;  4UVC A;  3IH3 A;  1WH7 A;  2JA8 J;  2Z2S B;  3JW4 A;  3HB9 A;  3COA C;  4UB8 C;  4A6E A;  2EZI A;  4EJV A;  2ADU A;  3KYL A;  3PQJ A;  4ABZ A;  3G73 A;  2R7V A;  3V42 A;  2IVM A;  2BY3 A;  3G4S I;  5DD8 A;  4RB2 C;  5DD4 A;  3M1E A;  5CVV A;  1D0Z A;  4DZP A;  2HOA A;  5E3M A;  4Z6Y A;  4U0Y A;  2VBX A;  4M6Y A;  2WY7 Q;  4UV9 A;  1FTZ A;  4P1W A;  2YS9 A;  1XN7 A;  1AWC A;  1D5Y A;  3JRF A;  3GLX A;  2DT6 A;  1YJW I;  2KIS A;  4QWQ A;  1D8K A;  5H6R A;  4LGW A;  2LY1 A;  2K9L A;  5E1X A;  1WGX A;  4AYB N;  3MZH A;  1B8I A;  3GTG J;  3F9K A;  1A31 A;  3ABK H;  4IHW A;  4UY8 I;  1WPK A;  4RLF A;  2W1O A;  1BI0 A;  4I02 A;  3IRQ A;  2PI0 A;  3DKY A;  1TL8 A;  1IDZ A;  1YJN I;  3MKL A;  1O7F A;  1ZRC A;  3G1L A;  2VQC A;  3OSF A;  1SD5 A;  3QWL A;  1G3S A;  1IRG A;  4V2F A;  2M34 A;  4EGZ A;  4OMY A;  1Y1W J;  3S3O A;  1R1U A;  2HFH A;  3BR6 A;  3V8K A;  1KON A;  1HW2 A;  4W97 A;  4Y13 A;  1IGN A;  1WFX A;  1T8I A;  3CTA A;  3BG5 A;  1VTN C;  2M0M A;  2AQF A;  2M3A A;  1ZGA A;  1WJB A;  2LR8 A;  2KDO A;  2ZSH B;  4U7B A;  2P5V A;  2UXN A;  4U0V A;  3ROU A;  2DK5 A;  3QU3 A;  3LMM A;  1A5J A;  2ZXJ A;  1YHQ I;  2HKO A;  2KLO A;  2VON A;  3H0D A;  4P96 A;  2E2H J;  4Y52 J;  2DDA A;  2FNA A;  3K9T A;  4A0X A;  1D5V A;  1HKQ A;  1XC5 A;  4ENM A;  3ISP A;  3FMR A;  3O8G A;  3GUD A;  1BA5 A;  2WB1 N;  2VJJ A;  4NB5 A;  2VE8 A;  1P4A A;  4G12 A;  4IRG A;  5CPR B;  1XD7 A;  4D7M A;  5B1A H;  2YR2 A;  1OCT C;  2R7Z J;  2X1C A;  1ZRE A;  3CCR I;  2WTE A;  5K5O A;  1V54 H;  4CCN A;  4DGW B;  2VN2 A;  1T08 B;  4BNC A;  1IUY A;  3K69 A;  3CUO A;  3DWL E;  4MFD A;  1OQY A;  4I6Z A;  3TP3 A;  3ASO H;  4HX4 A;  3JRA A;  5HS8 A;  4AM3 A;  4OMZ A;  3K4B A;  2VC0 A;  2Y48 A;  4XK4 A;  3CME I;  2E7W A;  1Z21 A;  1E17 A;  1XMK A;  1K78 A;  3K10 A;  2R7Q A;  1EF4 A;  1MMN A;  4A0Y A;  3CCU I;  3TO6 A;  4HNV A;  3DU5 A;  3FXQ A;  1B6A A;  4A3J J;  2BBY A;  2XAH A;  3VYS B;  3M8J A;  1B9M A;  2MH9 A;  2NS8 A;  1T95 A;  4A3F J;  2CJJ A;  1YIT I;  3TO9 A;  2MBF A;  4ZYG A;  1U2W A;  4ESB A;  4Y4R A;  1XDS A;  5FD5 A;  3BZK A;  3H3Z A;  3HYI A;  2DA3 A;  2PFB A;  3J7A Y;  3IP4 B;  4JBA A;  3H0G J;  1Y39 A;  4IO9 F;  1MKM A;  1POG A;  2MD0 A;  5FB2 A;  3H5A A;  3DBH B;  2P7C B;  3CJR B;  2I8D A;  4UUV A;  1QGP A;  3AFH A;  1R5I D;  4NQW A;  3K70 C;  3KP4 A;  2YU3 A;  4HOB A;  1O3R A;  5LGU A;  1SMT A;  2FSW A;  3D5L A;  2R92 J;  3BDD A;  4KNY A;  5ILU A;  3JTG A;  2AQE A;  2IRF G;  1FYL A;  4A0Z A;  5FD6 A;  2JTV A;  4YEL A;  5F6F A;  1K83 J;  5FRM A;  2BHZ A;  3SEQ A;  2Q2E A;  1YW8 A;  3UR3 C;  4I0B A;  1Z9C A;  1FYK A;  1TQP A;  3KET A;  2CFX A;  2OCC H;  2H6C A;  2ZJR F;  1RR7 A;  4XKC A;  4B3X A;  1GT0 C;  4HAM A;  1ETV A;  3RIR A;  4BAC A;  2KKO A;  2H94 A;  2GM4 A;  1V5G A;  2V7F A;  2A05 A;  5LRS A;  2NOJ B;  3FXJ A;  3O3K A;  2IP2 A;  2DOE A;  2XSD C;  3LSM A;  3WTW C;  3LL7 A;  3K4K A;  5DYM A;  5E79 C;  2CW0 F;  4N9I A;  3BPX A;  2XGE A;  5B3S H;  3L7W A;  4U88 A;  1P2F A;  2ZB9 A;  2JWT A;  3FK6 A;  5KAF C;  4ESJ A;  4BQO A;  2HPM A;  1FEX A;  1I39 A;  2CW8 A;  1ITY A;  3LA3 A;  2L3D A;  4HV6 A;  2Z1D A;  3WTZ A;  3O8H A;  2DA5 A;  3VYU B;  3OYD A;  2EQR A;  3VPR A;  1AHD P;  3FZV A;  3L2C A;  1I3A A;  4QTR A;  1R36 A;  2R5Y B;  1ZGJ A;  4M6X A;  1YQA A;  1B9N A;  2XUB A;  4O5V A;  4BY1 J;  4IZZ A;  1RNL A;  1YW9 A;  2HVQ A;  1S7A A;  1V3F A;  3TOA A;  3EUA A;  1KGS A;  4BHC A;  4MHG A;  1SFO J;  1BC8 C;  2ZBK A;  3N4M A;  5E20 A;  1MSF C;  1Z0X A;  2XIG A;  1ACI A;  1QZE A;  5CVR A;  5AIQ A;  2OCE A;  3ZQG A;  2E5Z A;  1X1P A;  4BQA A;  2JRT A;  1O4X A;  2VI6 A;  1IRF A;  2KRH A;  2PEX A;  2LLK A;  2EFP A;  1T39 A;  3I59 A;  4XBF A;  2VJ4 A;  2IBD A;  4G94 A;  1R22 A;  1ON2 A;  3K4L A;  5DS9 A;  3S1M J;  1WSU A;  4IF4 A;  3UNG C;  2QGU A;  2LFB A;  3IAS 2;  1FIP A;  2XC7 A;  1U78 A;  1G2H A;  2V79 A;  5LHI A;  4JQF A;  2DN0 A;  3JRC A;  3S3N A;  1WZ2 A;  1LE8 B;  5F27 A;  4WCG A;  4ZYE A;  2ECC A;  1IXC A;  4XLH A;  2XV4 S;  1Y56 A;  2V1U A;  2VPR A;  1U5T B;  2O9L A;  2COM A;  4M9S A;  1ZG1 A;  2BYV E;  2ELJ A;  1FT9 A;  3S2H J;  4S04 A;  1EJ9 A;  3S16 J;  4LJZ F;  3QU6 A;  2ELK A;  1UHS A;  2QUF A;  2RNG A;  5KHD A;  4G7H F;  1PYV A;  2XDV A;  2FE3 A;  2RVC A;  3VFZ A;  1ZRF A;  2VQG A;  1GDT A;  3W6K B;  1HDP A;  1IRZ A;  1VZ0 A;  1EKE A;  4WWC A;  2R4G A;  1HCR A;  4JYK A;  3OS0 A;  2KIU A;  2H27 A;  3BG7 A;  1F5T A;  2AHQ A;  4A3C J;  4OIR F;  4M3F A;  3R61 A;  4MGR A;  4OIN F;  4PFP A;  1S9H A;  2NS0 A;  3HGG A;  3EDP A;  2WV1 A;  4UV8 A;  1JTY A;  3VOD A;  3SYT A;  4S0H B;  4XM3 A;  3OYH A;  2DA6 A;  1ETO A;  2LBF A;  3KLN A;  4QLC U;  1ERD A;  3KP5 A;  4M6V A;  5J8F A;  2W7N A;  1P7I A;  2COB A;  4UB6 C;  4BBR J;  2VOO A;  3LSG A;  3F6V A;  3FX3 A;  4P9U A;  4ZH4 F;  3PM1 A;  1WJ5 A;  2W85 A;  2DT5 A;  1STZ A;  4IQ4 A;  4KIS A;  3MZ8 A;  2JVH A;  3K4N A;  1PVE A;  1XMX A;  1IW7 F;  1MMA A;  2VT3 A;  4EVI A;  1MNE A;  2O8K A;  4BY7 J;  2HZD A;  3PUB A;  2KMU A;  5FGM A;  5DM6 F;  3P9K A;  1R49 A;  3RKY A;  4ZC3 A;  1U8B A;  2VJI A;  2AXL A;  4NC7 A;  3RQ4 A;  3FBN B;  1DPR A;  2DA4 A;  2OF7 A;  3ECO A;  4ZZD A;  1EV7 A;  1GV5 A;  2X6O A;  2AS5 F;  3Q9V A;  3UKG A;  2MLG A;  3H3U A;  5D8K B;  3BR5 A;  2HYF A;  2VT2 A;  4HLX A;  4Q48 A;  1D1A A;  1Z91 A;  1TW2 A;  1Y1V J;  1Z7U A;  4AYB A;  4I99 C;  5EYR A;  1UG2 A;  4ASN A;  2Y31 A;  3FM5 A;  3HUG B;  4HYE A;  3FIS A;  4A6D A;  4H0E A;  1HSJ A;  3OYK A;  1ZAO A;  1W0U A;  5ERI A;  2W84 A;  2WV0 A;  1LDJ A;  4DIQ A;  3BG3 A;  3OYJ A;  1JTX A;  2HYJ A;  2ZXH A;  2LP0 A;  2QQ9 A;  1I1G A;  1ZR2 A;  4IOA F;  3JRB A;  3CF2 A;  4B09 A;  2CFO A;  2FD5 A;  2MD5 A;  1USS A;  1Z7L A;  2EIK H;  3HRS A;  4GO1 A;  4JK1 X;  3OSG A;  1IJW C;  2DTR A;  2A69 F;  4L9N A;  3M4O J;  2RAE A;  4PJN A;  2FUG 2;  1Y8Q B;  2DOD A;  2WWY A;  3F21 A;  1VFC A;  4RA2 A;  1UEL B;  1IN8 A;  5HDK A;  3RPU A;  2L7F P;  3QPH A;  2ZXI A;  3GFM A;  2V1X A;  1DDN A;  4MQV A;  4BJ5 C;  4KIC A;  1TNT A;  3PIP F;  4V2G A;  1PP7 U;  1I6H J;  3HSR A;  4GGG A;  2DOF A;  2EV6 A;  1TQI A;  1OLT A;  3B6A A;  5DM7 F;  3ML6 A;  3F8F A;  5ICG A;  5C4X J;  3F3X A;  1TWF J;  3K1M A; 
#chains in the Genus database with same CATH homology
 1J5Y A;  4R1H A;  5LRR A;  1FWZ A;  4CO8 A;  3WOD F;  3N97 A;  1L3L A;  2XVC A;  3T0Y A;  2E1N A;  2W25 A;  1BI1 A;  1T6S A;  1Z1D A;  5L3E A;  5H6Q A;  1UST A;  2DAO A;  1LNW A;  2QWW A;  2ESH A;  4UXN A;  5F1R A;  1OYY A;  2Z5U A;  5L3F A;  4I09 A;  4RS8 A;  3CUQ B;  3GVA A;  5ILV A;  1R1V A;  3DXJ F;  1J9I A;  2FEZ A;  2EWN A;  1KU2 A;  2VBW A;  1OYI A;  1ZAR A;  1BN5 A;  4FT8 A;  4KN4 X;  4XLN F;  4BHB A;  1S6L A;  1HST A;  3QAH A;  4RAZ A;  3DPL C;  2EK5 A;  2OAZ A;  3W6J B;  1MJ9 A;  5CVJ A;  3BJ6 A;  4HZF A;  3FM3 A;  4KFC A;  5LGT A;  2X0L A;  4YII A;  3K1N A;  4G8X A;  1O3S A;  2L54 A;  4FX4 A;  1DPU A;  2NNY A;  1T98 A;  3EYY A;  1RIO H;  3I53 A;  2RQP A;  4RGR A;  1EH7 A;  1XGO A;  2DI3 A;  1K7A A;  3I4P A;  2PBI A;  1W7P B;  2EFN A;  5HS9 A;  4UVA A;  3HOT A;  1SMY F;  2M1B A;  4LLG F;  3FMS A;  3ULQ B;  2A61 A;  4KN7 X;  1KYW A;  3GWZ A;  3ZP5 A;  4PZJ A;  4LB5 A;  1YO5 C;  4Q4Z F;  5DCF A;  1J7K A;  5DV5 A;  4G6Q A;  1DUX C;  1CF7 B;  1P4X A;  3ZN1 A;  5KK1 A;  2LF8 A;  2O8X A;  1FOK A;  1PUE E;  1HW1 A;  2K7L A;  4KMU X;  1R5H A;  1H9T A;  3HIF A;  2FBK A;  1ZHF A;  4XRF A;  2YX7 A;  4M9X A;  1WRJ A;  4G7O F;  4N9H A;  2XGX A;  1G3W A;  2FMY A;  4KT5 C;  1F4K A;  3GF2 A;  1ZLK A;  3R6S A;  1XSV A;  2C6Y A;  5ICF A;  3TKY A;  2O6G E;  4FHT A;  2YSR A;  3C1D A;  2CSO A;  4KDP A;  1HQC A;  3CLO A;  4Q47 A;  1PP8 F;  3LAP A;  3DPT A;  1Y0U A;  1H0M A;  1X3U A;  3WTT C;  3IHU A;  4RB3 C;  3D0S A;  2PLY A;  3MFK A;  2IA2 A;  6PAX A;  3KFW X;  4OIP F;  2JPB A;  5AIP A;  5LEJ A;  5HLG A;  4MNU A;  4N0B A;  4U0W A;  4AWX B;  4RGU A;  3GO5 A;  4L18 B;  3KE2 A;  1HXD A;  1OMI A;  1XCV A;  2HS5 A;  4CGZ A;  3RYR A;  1XGM A;  2VBY A;  3U2R A;  3LWF A;  4ZYH A;  4L9T A;  1FC3 A;  5HOO A;  1LEA A;  3DEU A;  3KZZ A;  3KEQ A;  1FBQ A;  1A04 A;  3LAJ A;  2GWR A;  3BPV A;  5F64 A;  4ON0 A;  4RAY A;  5D6E A;  5D5U B;  5L3D A;  4KYW A;  5HS7 A;  3LA2 A;  5DCM B;  4LG0 A;  3GXO A;  2A5Y B;  1QZY A;  2IW5 A;  2H6B A;  2L4M A;  3WG9 A;  2HEO A;  4BAY A;  1ZYR F;  2A6E F;  2IJL A;  4RGX A;  1FBU A;  2RKH A;  2HZT A;  4M74 A;  2IA1 A;  1F1Z A;  1XSD A;  4UVB A;  1TNS A;  3ZMU A;  5DEQ A;  2GXB A;  1LQ1 A;  2QQB A;  4RB0 A;  5L3C A;  3WTX C;  4I2O A;  3E97 A;  2Y0M A;  4LLN A;  2ZCW A;  2R7D A;  2NNN A;  4EJO A;  4P55 A;  1IN5 A;  3H92 A;  5D5W B;  4HW0 A;  3FXR A;  2XAG A;  4ZYD A;  3HRT A;  4LG0 B;  4LK0 F;  2D1H A;  4EM0 B;  4I0A A;  2K86 A;  3T8R A;  1KU3 A;  3JAM K;  2BGC A;  5D8L B;  3VOE A;  2HQR A;  2ELH A;  4EM2 A;  4K2E A;  2Z9O A;  3HSE A;  2MLK A;  4MQ9 F;  1I5Z A;  3V8L A;  3DFG A;  1J59 A;  5DDG A;  4IPA A;  2Z3Y A;  2HYG D;  2DO7 A;  1BOA A;  1ONV A;  5DUI A;  5K5R A;  3C7J A;  3WE3 A;  3V7S A;  4GYI A;  4OU0 A;  3GZ6 A;  4XSX F;  3ZMT A;  3IL2 A;  1TQM A;  1F9N A;  2EA4 A;  3L9F A;  4EQQ A;  3DQV C;  3BJO A;  2J5P A;  1Q1H A;  1EH6 A;  1HW5 A;  4U7D A;  4BXU A;  4AIK A;  3RYP A;  3C3W A;  1YTY A;  1U8R A;  2VOD A;  3WGI A;  4OIQ F;  5D4R A;  1RUO A;  1U5T A;  1UHW A;  4LFU A;  1IZ1 A;  2KJB A;  3E5X A;  2ZME B;  3KP3 A;  5BS6 A;  1BM9 A;  5E8I A;  3EUH A;  2EFO A;  2RNJ A;  1MD0 A;  4ZZL A;  3SZP A;  2OZ6 A;  2OQR A;  4L5J A;  4B8X A;  3GYH X;  3LQQ A;  1C0W A;  4IRH A;  2HWV A;  1XGN A;  2ETH A;  2P4W A;  3G3Z A;  2QVO A;  3ZMV A;  2PG4 A;  3P9C A;  2GAU A;  4G6D A;  4UNO A;  1ZN2 A;  3HTU A;  2E7X A;  3CO6 C;  2W57 A;  5CVI A;  3OV8 A;  5LHH A;  2XRO A;  2NAZ A;  3T8T A;  3JSP A;  2FML A;  3WGH A;  1SAX A;  4WX9 A;  3F8N A;  2VC1 A;  2P6S A;  5EEG A;  3BY6 A;  3P9I A;  3NQO A;  3V4G A;  2M5W A;  4R8H A;  3RJP A;  2IA0 A;  2G7H A;  3KCC A;  2O3F A;  1Z05 A;  3RKW A;  3HUG A;  1W4M A;  1JE8 A;  2M45 A;  1E2X A;  2HGC A;  3JAM Z;  1R23 A;  1FBS A;  4E70 A;  1XSX A;  1O57 A;  1P92 A;  5LLQ A;  1BI3 A;  3FHZ A;  5LBQ A;  2LKP A;  5HDN A;  2KRF A;  3M8E A;  3PQK A;  3ZN0 A;  3MWM A;  1B59 A;  3SXY A;  2GQQ A;  3HTS B;  5E17 F;  1ULY A;  2X4H A;  5JVT A;  3J7A O;  4Z2Y A;  1FSE A;  3NEU A;  3L00 A;  4LD5 A;  3RDI A;  3MEX A;  3TQN A;  5TJJ A;  5TRD A;  4F7Z A;  5H20 A;  3IKT A;  4O3M A;  1QPM A;  1LJ9 A;  1I27 A;  2FXA A;  2FNP A;  3FMQ A;  1XCB A;  4IHT A;  3U9G A;  2P8T A;  3SQN A;  3HHG A;  4HF2 A;  3QP6 A;  1LDD A;  3CUQ A;  3VB2 A;  3KZY A;  3DF8 A;  5J6X A;  1LDK B;  3P7N A;  2OD5 A;  3ABU A;  4FX0 A;  2XAS A;  2RDP A;  2V1D A;  2Y75 A;  4L9V A;  1IN6 A;  4MTE A;  1WWX A;  3KP7 A;  3SZT A;  2OBP A;  2DW4 A;  1YG2 A;  2G7U A;  4KIG A;  3EET A;  5J8C A;  5HDG A;  3R0A A;  2P6T A;  5HVQ C;  4BHP A;  1CGP A;  2F2E A;  3R0J A;  1ZG3 A;  2GA1 A;  4WXC A;  3GEZ A;  2OA4 A;  2CWE A;  3REO A;  4R79 A;  2M8E A;  1S3J A;  5ICE A;  1BBY A;  1QBJ A;  3ZMS A;  4Y17 A;  1W7P A;  3J81 K;  1JHF A;  2F5F A;  5LGN A;  2FBH A;  1UFM A;  2LSO A;  2ZNY A;  4CZZ A;  2NRA C;  4P9F A;  4LB6 B;  4IVN A;  4PDK A;  5BPI A;  3WTV C;  1QZZ A;  4ENN A;  4CDG A;  4PCQ A;  2DQR A;  2JPC A;  4BH9 A;  2ISY A;  4G9Y A;  1ZRD A;  4I7H A;  2FRH A;  3DP7 A;  3BRO A;  1HKT A;  1MJB A;  3AAF A;  2YPR A;  5CYV A;  1CF7 A;  4KMF A;  3KP6 A;  2DU9 A;  4AIJ A;  2M87 A;  4HDU A;  3FWE A;  3I0T A;  1UCR A;  3M7G A;  3TDU C;  5HLH A;  3J80 K;  2JZY A;  2Z99 A;  4A5N A;  4HX8 A;  3CDH A;  5E1W A;  1W7P D;  1YIO A;  4RB1 A;  3K1P A;  3ERE D;  2PMH A;  4EV0 A;  2ISZ A;  4XLP F;  4AIH A;  5D4S A;  3MCZ A;  4XSZ F;  3F23 A;  2QYO A;  3I54 A;  3DKW A;  5KVR A;  1U3E M;  2NYX A;  2L02 A;  4M9Z A;  4P5O A;  5HLI A;  2E1C A;  2BEO A;  2M30 A;  2D45 A;  3RTR A;  3E6M A;  1OPC A;  3BOQ A;  1BIA A;  1OR7 A;  1UB9 A;  2QBY B;  1KQ8 A;  2ZO4 A;  4IJA A;  2R3S A;  3ZMD A;  1Z6T A;  2QZ8 A;  2P7V B;  3JTH A;  5BOX A;  2EB7 A;  1IN7 A;  3I5U A;  1JGS A;  3CO7 C;  1BJA A;  4LLL A;  5E8G A;  2D1V A;  1KQ0 A;  2VXZ A;  2XAF A;  3KP2 A;  3B02 A;  3HRU A;  4WF2 A;  4IXA A;  5JR3 A;  2R7F A;  1W5S A;  3EYI A;  3RI4 A;  3BWG A;  4EJT A;  3J81 Z;  3QP5 A;  1MDM B;  2VBZ A;  2KIF A;  3TGN A;  1FP1 D;  1ZLJ A;  5E1Z B;  2QM3 A;  4ENJ A;  1REP C;  5DCM A;  1P6R A;  2UZK A;  2ZNZ A;  2XRN A;  4Q5S F;  3DV8 A;  4YIF A;  1DP7 P;  3RPQ A;  4A2U A;  4D0P A;  4GYG A;  1IAW A;  1ZG5 A;  5L3B A;  2P5L C;  3F8B A;  1ZH5 A;  4LMY A;  1RZ4 A;  1LVA A;  4HA8 A;  4CXF A;  3I71 A;  1EH8 A;  2HOE A;  2EFQ A;  3BJA A;  1FLI A;  2EV0 A;  3R60 A;  1BI2 A;  1R1T A;  2A6H F;  1T0F A;  4KA4 A;  3J80 Z;  1FYM A;  5FFX A;  2Z33 A;  3F8M A;  4G7Z F;  4ESF A;  4HQE A;  2KIM A;  2OQG A;  1FNN A;  2JT1 A;  1TTY A;  1J0R A;  2DK8 A;  1R00 A;  3HOS A;  5D5X B;  3TDZ C;  1MJA A;  4KIB A;  1IXR C;  4BYY A;  4IRI A;  5CLS A;  2FBI A;  2HR3 A;  1OYW A;  2GZW A;  4MEX F;  3RKX A;  4I01 A;  1K6O A;  3BP8 A;  2PN6 A;  2EFW A;  5ICC A;  3IWF A;  2XKO A;  3IWZ A;  4OOI A;  1KU9 A;  2O61 A;  2CO5 A;  1YLF A;  1WI9 A;  1XMA A;  3I58 A;  3WE2 A;  2RGV A;  4GCV A;  4CHU A;  2EV5 A;  3TOB A;  2FQ3 A;  3HRM A;  5D5V B;  3T1B A;  1ODD A;  3FXU A;  4ETS A;  4A5M A;  2V6C A;  1U6G A;  1YS7 A;  2F5C A;  2DLL A;  1GXP A;  2ZME A;  3Q5F A;  1LB2 A;  2A3S A;  5E18 F;  4EJU A;  4KIF A;  5DUK A;  3E5U A;  2XKP A;  5BPD A;  4PGG A;  1K78 B;  4HBL A;  4DNC A;  4YFK F;  1XDU A;  2BV6 A;  2W24 A;  4LK1 F;  1O3T A;  1T38 A;  1KA8 A;  5FFZ A;  1P4W A;  4ENK A;  1S8N A;  1G3Y A;  3MQ0 A;  3S2W A;  1G6N A;  2L4A A;  2FOK A;  3O2P E;  3E6C C;  4S05 A;  1SFE A;  2IT0 A;  3F22 A;  3E3V A;  1IN4 A;  2F5D A;  3IKV A;  2VOP A;  3FF5 A;  2CG4 A;  1G4D A;  3WGG A;  2MH2 A;  3QRF F;  1SD6 A;  2ESN A;  1IF1 A;  4HLY A;  1WKM A;  3GW2 A;  1W5T A;  3V8J A;  1HBX G;  1FX7 A;  3HSF A;  5D6F A;  4MTD A;  1J75 A;  1BIB A;  3F72 A;  3TO7 A;  4YG2 F;  3F8C A;  1WQ2 A;  1ON1 A;  2DFI A;  3IRR A;  1FPQ A;  3F6O A;  1AOY A;  3VEP A;  2UWM A;  4EGY A;  1KYZ A;  3NRV A;  3HHH A;  4L5I A;  3QOP A;  2B0L A;  5JI6 A;  4CIC A;  4WXD A;  1TLH B;  4NHJ A;  2RC4 A;  4EJW A;  2MA3 A;  1Z6R A;  2HDC A;  3CJN A;  3I64 A;  3ZQ7 A;  2UXX A;  5CJ9 A;  4WK8 F;  1IXS B;  3E5Q A;  3QPT A;  3WTS C;  2FA5 A;  4IHS A;  1R7J A;  2Q8K A;  2Q0O A;  2K27 A;  1LEB A;  1YS6 A;  1MZB A;  2LDU A;  5FLX K;  2J5O A;  2PMU A;  5LHG A;  1PDN C;  3SHF A;  1FSH A;  2D2W A;  4M73 A;  1YFH A;  3I59 B;  1YW7 A;  1S29 A;  1JXS A;  3WTY C;  2BE5 F;  1R5G A;  3ELK A;  2QEN A;  2G9W A;  2KJC A;  3WTU C;  1U5T C;  3K2Z A;  1QNT A;  3Q9S A;  2QQA A;  1O7L A;  2CQK A;  4A12 A;  1JHH A;  2K02 A;  4M71 A;  3KEO A;  3MAJ A;  3EQL F;  5L3G A;  2K4B A;  3E6D A;  2GA2 A;  5IT9 K;  5A2Q K;  4YFX F;  1YYV A;  1GVJ A;  2ACJ A;  3GFL A;  4HV5 A;  3M9A A;  2EJR A;  3ECH A;  1RUN A;  3OOP A;  2F5E A;  1B1B A;  2ZKZ A;  1I6X A;  2TDX A;  1J2X A;  2YX4 A;  2VE9 A;  4M72 A;  2RN7 A;  2DBB A;  4OIO F;  5AON A;  5JFR A;  1S7O A;  3GZ5 A;  2XAQ A;  3WU1 B;  1B4A A;  3PFI A;  3ZMZ A;  4AD9 A;  3B73 A;  2STT A;  3L09 A;  2WC2 A;  2OU2 A;  5BQT A;  1FY7 A;  4MEY F;  2O03 A;  1D8J A;  2JSC A;  1QO0 D;  1XB4 A;  2LNB A;  1G3T A;  2DPU A;  4YFN F;  5FO5 A;  2PQ8 A;  4O6J A;  5BMZ A;  3T5X A;  2GXG A;  3JSO A;  1SFX A;  4HF1 A;  1H9G A;  2FF4 A;  5FLX Z;  3GFI A;  4HDV A;  2HQN A;  2HTS A;  2XAJ A;  2P5K A;  2XHK A;  3LA7 A;  5ED4 A;  4Y15 A;  2A07 F;  5IT3 A;  2HKX A;  3IC7 A;  2L01 A;  2OZU A;  4AVP A;  2HTJ A;  1QQI A;  2MC3 A;  3U1D A;  1TBX A;  3KLO A;  2STW A;  3CUQ C;  2K4J A;  3C18 A;  1R58 A;  2RV8 A;  2FU4 A;  2ZJ2 A;  3ZPL A;  3MZY A;  4L0Z B;  4CYD A;  2GIV A;  1O3Q A;  5EEH A;  1GHC A;  4HQM A;  2A68 F;  1TW3 A;  3M8F A;  2QBY A;  5IT9 Z;  5A2Q Z;  2ZFW A;  3O6B B;  3GX4 X;  1OKR A;  2V9V A;  1KU7 A;  4EM1 A;  3LST A;  1I1S A;  5ILS A;  1NHA A;  2H09 A;  4I98 B;  2DPD A;  1GXQ A;  3K0L A;  3LFK A;  1T2K A;  3R4K A;  1SFU A;  2O0Y A;  4UHT A;  1K79 A;  4L0Y B;  4EMS A;  4KUM A;  4DQ2 A;  1FZP B;  1MDM A;  1XGS A;  1RI7 A;  2PJP A;  3WU0 A;  2EA2 A;  1BC7 C;  1SD7 A;  2CGP A;  4HF0 A;  3ABT A;  4HX7 A;  1L0O C;  3E6B A;  2IPQ X;  5K1Y A;  4L9J A;  1SD4 A;  3GFJ A;  4TV7 A;  3BZ6 A;  1D3Y A;  1UHM A;  3V7C A;  3V7R A;  2DQL A;  1HKS A;  3SFZ A;  2CYY A;  3LQR A;  5K5Q A;  5CVU A;  5JHU A;  1FP2 A;  2LF7 A;  1V4R A;  4GXO A;  1KQ9 A;  4PGH A;  4WXH A;  2QLZ A;  5LEK A;  4RGS A;  1MGT A;  4UVC A;  3JW4 A;  3COA C;  4A6E A;  4EJV A;  2ADU A;  3PQJ A;  3G73 A;  2IVM A;  5DD8 A;  4RB2 C;  5DD4 A;  3M1E A;  5CVV A;  4U0Y A;  2VBX A;  4M6Y A;  4UV9 A;  1AWC A;  1XN7 A;  3GLX A;  4QWQ A;  1D8K A;  5H6R A;  4LGW A;  5E1X A;  3MZH A;  4I02 A;  1BI0 A;  3IRQ A;  2PI0 A;  1ZRC A;  1O7F A;  1SD5 A;  1G3S A;  1IRG A;  4EGZ A;  4OMY A;  1R1U A;  2HFH A;  3V8K A;  1HW2 A;  4Y13 A;  3CTA A;  1VTN C;  1ZGA A;  4U7B A;  2P5V A;  2UXN A;  4U0V A;  3ROU A;  2DK5 A;  3QU3 A;  2ZXJ A;  2HKO A;  2VON A;  4P96 A;  2FNA A;  3K9T A;  4A0X A;  1D5V A;  1HKQ A;  4ENM A;  3ISP A;  3FMR A;  3GUD A;  4NB5 A;  2VE8 A;  1P4A A;  4IRG A;  1XD7 A;  2YR2 A;  1ZRE A;  2WTE A;  5K5O A;  2VN2 A;  4BNC A;  1IUY A;  3K69 A;  3CUO A;  4HX4 A;  5HS8 A;  4OMZ A;  2VC0 A;  2Y48 A;  2E7W A;  1E17 A;  1XMK A;  1K78 A;  4A0Y A;  3TO6 A;  3FXQ A;  1B6A A;  2BBY A;  2XAH A;  1B9M A;  2MH9 A;  3TO9 A;  2MBF A;  4ZYG A;  1U2W A;  4ESB A;  1XDS A;  5FD5 A;  3H3Z A;  3HYI A;  2PFB A;  4JBA A;  1MKM A;  5FB2 A;  2P7C B;  4UUV A;  1QGP A;  4NQW A;  3KP4 A;  2YU3 A;  4HOB A;  1O3R A;  5LGU A;  1SMT A;  2FSW A;  3D5L A;  3BDD A;  4KNY A;  5ILU A;  3JTG A;  2IRF G;  1FYL A;  4A0Z A;  5FD6 A;  2JTV A;  5F6F A;  2Q2E A;  1YW8 A;  4I0B A;  1Z9C A;  1FYK A;  1TQP A;  3KET A;  2CFX A;  2H6C A;  4HAM A;  3RIR A;  2KKO A;  2H94 A;  5LRS A;  3O3K A;  2IP2 A;  3WTW C;  5DYM A;  2CW0 F;  4N9I A;  3BPX A;  3L7W A;  4U88 A;  1P2F A;  4ESJ A;  3LA3 A;  2L3D A;  4HV6 A;  3WTZ A;  3FZV A;  3L2C A;  1R36 A;  1ZGJ A;  4M6X A;  1YQA A;  1B9N A;  2XUB A;  4O5V A;  1RNL A;  1YW9 A;  1S7A A;  1V3F A;  3TOA A;  1KGS A;  4BHC A;  4MHG A;  1BC8 C;  2ZBK A;  3N4M A;  5E20 A;  2XIG A;  5CVR A;  5AIQ A;  4BQA A;  2JRT A;  1IRF A;  2PEX A;  2EFP A;  1T39 A;  3I59 A;  4XBF A;  4G94 A;  1R22 A;  1ON2 A;  1WSU A;  4IF4 A;  1U78 A;  2V79 A;  5LHI A;  4JQF A;  4WCG A;  4ZYE A;  1IXC A;  2XV4 S;  2V1U A;  1U5T B;  2COM A;  4M9S A;  1ZG1 A;  2BYV E;  1FT9 A;  4S04 A;  4LJZ F;  3QU6 A;  2QUF A;  4G7H F;  2FE3 A;  2RVC A;  3VFZ A;  1ZRF A;  3W6K B;  4WWC A;  2KIU A;  2H27 A;  1F5T A;  4OIR F;  3R61 A;  4MGR A;  4OIN F;  2NS0 A;  3EDP A;  4UV8 A;  3VOD A;  3KLN A;  4QLC U;  3KP5 A;  5J8F A;  2VOO A;  3F6V A;  3FX3 A;  4P9U A;  4ZH4 F;  2W85 A;  2DT5 A;  1STZ A;  1IW7 F;  2VT3 A;  4EVI A;  5FGM A;  3P9K A;  3RKY A;  2AXL A;  1DPR A;  3ECO A;  4ZZD A;  1EV7 A;  2AS5 F;  3Q9V A;  2MLG A;  3H3U A;  5D8K B;  2HYF A;  2VT2 A;  4HLX A;  4Q48 A;  1Z91 A;  1TW2 A;  1Z7U A;  4ASN A;  3FM5 A;  4HYE A;  4A6D A;  4H0E A;  1HSJ A;  1ZAO A;  5ERI A;  2W84 A;  2WV0 A;  1LDJ A;  2QQ9 A;  1I1G A;  4B09 A;  2MD5 A;  1USS A;  3HRS A;  4JK1 X;  4GO1 A;  2DTR A;  2A69 F;  4L9N A;  2WWY A;  3F21 A;  1IN8 A;  5HDK A;  3RPU A;  3QPH A;  3GFM A;  2V1X A;  1DDN A;  4MQV A;  4KIC A;  1TNT A;  1PP7 U;  3HSR A;  4GGG A;  2EV6 A;  1TQI A;  3ML6 A;  3F8F A;  5ICG A;  3F3X A;  3K1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...