2O3FA

Structural genomics, the crystal structure of the n-terminal domain of the putative transcriptional regulator ybbh from bacillus subtilis subsp. subtilis str. 168.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
78
Chain Sequence
MATGGLAIIQSMHLPPSERKLADYILAHPHAIESTVNEISALANSSDAAVIRLCSLGLKGFQDLMRVAGDLAKPTFQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Putative HTH-type transcriptional regulator ybbH
total genus 25
structure length 78
sequence length 83
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01418 HTH_6 Helix-turn-helix domain, rpiR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2o3fA00
2JPBA 2QQ9A 4TV7A 2FBIA 1B6AA 4U7DA 2FMLA 3DQVC 4CGZA 3ZMZA 3E97A 1ZRDA 2BV6A 2MH9A 4UV8A 3CLOA 2JTVA 1OYYA 2XKOA 1Y0UA 1R5GA 3V8LA 1SFUA 4UHTA 2CO5A 3E5UA 5CVUA 3GLXA 1KQ8A 1CF7B 1ZRFA 2V1XA 2X0LA 1WSUA 1O3RA 1H9GA 1ON1A 3WU0A 2CG4A 3KP3A 3WGIA 2ZCWA 3BROA 1H0MA 3RKWA 3LWFA 1K7AA 5KK1A 1FYKA 1P4XA 3TOAA 4HZFA 1FYLA 1IN8A 3ML6A 2EFQA 3LA7A 1RIOH 1EH8A 2EFNA 3VODA 1RI7A 2XROA 2YPRA 3TO7A 4WX9A 2E1CA 5DCMB 3WTVC 1MD0A 2E7WA 4PZJA 2PEXA 3ZMDA 4ZZLA 1HW1A 1IF1A 4MQVA 2PFBA 1ON2A 4OMZA 3L00A 4UVBA 4U0VA 2GIVA 3IKVA 1MZBA 2NAZA 4BXUA 1WWXA 4HX7A 4NB5A 2QBYB 4Q5SF 3L2CA 4GYGA 4RAYA 2UZKA 4UUVA 5HDGA 3GZ5A 2P6SA 5D8KB 2FA5A 4ESBA 3Q9SA 1Z9CA 4EM0B 3HIFA 2DQLA 1UB9A 5EEHA 3JSPA 4DNCA 2RKHA 4MTDA 1YW7A 1ZHFA 2RN7A 3QRFF 1UHWA 5CLSA 2HKXA 1I5ZA 2PI0A 1XD7A 3LA3A 1XMKA 5H6QA 4EV0A 4WK8F 3BJ6A 2K4JA 1YTYA 2XAGA 3CUOA 1HSTA 3I58A 1U8RA 5HDNA 1USTA 2XUBA 1QO0D 4L18B 1YFHA 2IA1A 3K0LA 2RDPA 1E17A 4HLXA 2LF7A 3HRMA 1ZN2A 3MAJA 3IRRA 5DD8A 1GXQA 5FFXA 2P6TA 1XGSA 2IRFG 2ESHA 4EQQA 1SD5A 2H94A 2PMUA 3G73A 1TW3A 2A69F 3CTAA 2O0YA 1XCVA 1PP8F 4RGRA 4M9XA 2KRFA 1L3LA 1KU7A 5E8GA 2BYVE 3BY6A 4WXDA 2HOEA 4RGXA 2JRTA 2MBFA 1JHFA 2G7UA 5L3FA 3JAMK 3HSFA 1KYWA 4ZYGA 2VBZA 5K5OA 3K1MA 2QYOA 1RNLA 4D0PA 1ZGJA 2MC3A 4HDVA 4B09A 1R22A 5DDGA 2FNAA 5L3BA 2B0LA 3J81Z 1MKMA 1R1TA 2XAFA 3QPTA 1XGNA 1FLIA 2FXAA 3IWFA 2MH2A 2X4HA 3WODF 2EJRA 2EB7A 1IW7F 1QQIA 1FP2A 2XVCA 4I2OA 3TO9A 5L3CA 2IT0A 4R8HA 1IN4A 3I4PA 4IRHA 3V7CA 4G6QA 5D5WB 2F5DA 4FX0A 3HOTA 3HHHA 1ZYRF 1TQPA 1G4DA 5CYVA 4KYWA 4YIIA 1MJBA 4L0YB 3D5LA 5ICEA 2OQRA 3JW4A 5A2QK 2D1VA 2HDCA 2ETHA 4L9TA 3KLNA 2DO7A 2HYFA 4HLYA 4F7ZA 3U9GA 4IXAA 1XCBA 3BJOA 2OA4A 3R6SA 2L4MA 1HBXG 5HS7A 4OIPF 3I59B 4OU0A 1G3YA 2O61A 1YQAA 4LLNA 4RB0A 1BIBA 2RQPA 3NQOA 1YO5C 4BHBA 2DQRA 1S6LA 4LD5A 1ZLKA 3KZZA 1HKTA 2H6CA 3GFMA 5LHIA 2OQGA 1FPQA 1ZG5A 2J5OA 4Y13A 4N9IA 1G3SA 2W85A 4H0EA 4MHGA 3I54A 1JHHA 1Z6TA 4WXHA 1WKMA 4A5NA 1J0RA 1SMYF 2A6HF 2M30A 2VBXA 3GYHX 5AONA 2XAJA 5D5XB 3N4MA 5LHGA 4KDPA 3KP2A 3QU3A 2WC2A 1EV7A 2NNNA 4HV5A 3O3KA 1AOYA 1FWZA 1QPMA 3ELKA 3LAPA 5CVJA 4HW0A 2P5LC 3VEPA 3E6CC 1SD4A 1MDMB 4UXNA 2PBIA 2ZMEB 3EQLF 4NQWA 3V4GA 1QNTA 1ZG3A 2UWMA 3R0JA 2K02A 2JZYA 5DYMA 1WQ2A 3WG9A 2ZO4A 2PG4A 2DK8A 5JVTA 2HTJA 1D5VA 5F64A 4AWXB 2OAZA 1O3TA 1FSHA 5E1XA 1F5TA 3HTUA 4M71A 4BAYA 1ZGAA 3ULQB 4M73A 3RYRA 3TDUC 1Z1DA 2R7DA 3GZ6A 3EUHA 2NNYA 4YFNF 4K2EA 2OD5A 4NHJA 2Z99A 5HVQC 2GXBA 2ACJA 3RKYA 3FXRA 5FFZA 4G7HF 1LNWA 3RYPA 2A61A 5L3DA 5HLGA 3H3ZA 5LEJA 1BM9A 3E6BA 1IN7A 3RJPA 1STZA 2FE3A 5LLQA 3DF8A 4WWCA 2NYXA 3ECOA 2DAOA 5ED4A 2PN6A 3FZVA 1IRFA 1K78A 2VOOA 3KP4A 2VBWA 1QZYA 5LRRA 1LEAA 3KP7A 4M9ZA 1ULYA 5CVVA 4I02A 2Q8KA 4XSZF 1TQMA 2RGVA 1Q1HA 4IJAA 3WE2A 3MQ0A 3R0AA 4L5JA 4LJZF 2Z3YA 4QWQA 4S04A 3F8CA 3I71A 1OYIA 4XSXF 2XGXA 4ENNA 1HSJA 2HFHA 4AIHA 3ECHA 4PDKA 5FLXK 1CF7A 3WTSC 1IN6A 1I27A 3CO7C 1JGSA 4MQ9F 4OIRF 4RGUA 2A68F 1FYMA 3TO6A 4A0YA 1FC3A 2XKPA 2KJBA 4PCQA 3ZMUA 4RB3C 4LFUA 3GXOA 3BJAA 1FBSA 1O3QA 4AIKA 3RPUA 3V8KA 4YIFA 3M1EA 2ZBKA 4HF0A 1SAXA 4KNYA 3WU1B 2O8XA 4P9FA 1BN5A 4IPAA 3BPXA 2GAUA 4RS8A 5HLIA 2VONA 3WGGA 1YW9A 2FBHA 3GW2A 1HKSA 3LSTA 2COMA 3OV8A 3FXUA 3R60A 1NHAA 4FT8A 3I0TA 3VB2A 3FM3A 4KN4X 3K9TA 2L01A 1ZARA 5J8FA 3E3VA 5F1RA 1FBUA 1HW2A 1QZZA 5CVIA 5E8IA 2GWRA 3M8EA 4JK1X 2FRHA 2OBPA 1T38A 2QZ8A 2TDXA 4ESFA 2KIFA 1U3EM 2W57A 4P5OA 4MEXF 3FMQA 4L5IA 3K69A 3SZTA 5FGMA 3CUQA 4CO8A 1Z7UA 3T8TA 2VODA 1HKQA 5K1YA 1O7FA 3FHZA 4IVNA 1XGMA 3MZHA 4LB6B 3HUGA 2GQQA 4G7OF 3F8FA 4M9SA 5TRDA 2M5WA 4KT5C 3P9IA 3F8BA 2E1NA 4P96A 2IA2A 1W4MA 2D2WA 1K78B 4GXOA 5JHUA 2JSCA 3DP7A 2FEZA 2FQ3A 4U88A 1KYZA 2DPUA 3ERED 4CDGA 3I64A 2W84A 5D6FA 2P7CB 5BQTA 2CFXA 2G7HA 1P4AA 1UHMA 4O5VA 4ENKA 3ZPLA 2VE9A 4ZYEA 1BC7C 3K2ZA 1B4AA 1EH6A 4MGRA 4IRGA 3KEOA 5ICCA 5LBQA 4OMYA 1PP7U 1B59A 2ZXJA 5DV5A 3N97A 3RTRA 2A5YB 3F3XA 1XGOA 2RNJA 1KQ9A 2YX4A 2NS0A 5DD4A 1FT9A 2VC0A 5AIPA 1ZH5A 5ILSA 3IHUA 3D0SA 2M8EA 4JQFA 2OU2A 1T98A 3NEUA 1J75A 3ZMSA 2ZMEA 1U5TB 4M6XA 5ICFA 3GVAA 3P9CA 1KU2A 5FD5A 3BPVA 1B1BA 3TKYA 2QQBA 5E1ZB 3QOPA 2J5PA 2HTSA 2UXXA 2G9WA 1CGPA 3TOBA 3HOSA 4QLCU 2AXLA 5CVRA 3B02A 2GZWA 1OYWA 5BPDA 2K4BA 1GVJA 2V79A 4LG0A 3T5XA 1I6XA 2CGPA 4WCGA 2IVMA 3GX4X 2H6BA 4I98B 2MLKA 2YX7A 2EA4A 1XDSA 2Y75A 3GFJA 3CDHA 2IP2A 2M87A 1SD7A 2LSOA 4GYIA 1W7PD 5J8CA 5D6EA 4BHCA 3F6VA 3COAC 2JPCA 5HLHA 3KEQA 5LGTA 3GFLA 2ESNA 2HR3A 1OMIA 2L02A 3KETA 3WTXC 3ZQ7A 1X3UA 3ZP5A 1HQCA 2VC1A 5E20A 5FLXZ 3LQRA 3ABTA 3P7NA 3J80Z 2WV0A 1R23A 2A6EF 3HRUA 2KIUA 1KGSA 2QENA 4GCVA 3MEXA 1Z91A 1IXCA 1J59A 1IZ1A 2MA3A 2XHKA 4YFXF 4R1HA 3ISPA 4HAMA 2DFIA 4IF4A 4BHPA 5D8LB 1BBYA 3QU6A 1S8NA 2CYYA 3BWGA 4E70A 4EJWA 1FNNA 2RVCA 1JXSA 5K5QA 3F72A 2BE5F 3V7RA 3DFGA 4A6EA 4G94A 4Q48A 4IHSA 2VE8A 2Q0OA 4LK0F 2QVOA 5HOOA 2F5CA 2STWA 3C3WA 6PAXA 3FX3A 3BP8A 1FP1D 1U6GA 4MTEA 1BI1A 1VTNC 1YS7A 4KIGA 3GF2A 1G6NA 1BIAA 2GA2A 1XN7A 2CQKA 1MJAA 3KP5A 1KQ0A 2WTEA 1FX7A 1XSXA 5TJJA 1W5SA 2P5KA 3LQQA 4ETSA 2L54A 2C6YA 1RUOA 3EETA 5IT9Z 1ZRCA 3SFZA 4RB1A 3SHFA 3M8FA 2F2EA 4Q47A 1XDUA 1TTYA 3EDPA 4KN7X 3RDIA 2HYGD 4A12A 4OOIA 2DK5A 3MFKA 4KMUX 1SMTA 5ERIA 1BI3A 1QGPA 4HOBA 5H20A 2WWYA 2EFPA 2IW5A 2V1DA 1G3WA 2ISYA 1XSVA 2PLYA 3CUQB 4ZH4F 1W7PA 4FX4A 3I59A 1S29A 4U0YA 3PQKA 2O03A 4XBFA 2RV8A 4AIJA 1KU3A 5E1WA 1P92A 2MLGA 1IAWA 1YIOA 3WE3A 1WI9A 4KICA 2HS5A 2CW0F 4L0ZB 1R5HA 3IC7A 1XMAA 2DTRA 2V1UA 1R36A 1F4KA 4I0AA 3T0YA 5JR3A 1I1SA 2DU9A 3BZ6A 4AVPA 2ZFWA 3M7GA 2Z33A 3FMRA 2W25A 4GO1A 2VT2A 3U1DA 2EV0A 4HQMA 4G8XA 1LVAA 4IHTA 5D5VB 4KIFA 5D5UB 1E2XA 2P8TA 5H6RA 1J9IA 5FO5A 3K1PA 1SFEA 2NRAC 1OKRA 1R58A 5JFRA 1UFMA 2IA0A 1MDMA 3MCZA 3GWZA 4P55A 4XLNF 3WTWC 1DPUA 1F9NA 1RUNA 1G3TA 2LDUA 3IL2A 3F6OA 2FU4A 5E17F 4ENJA 3R61A 4A2UA 1D3YA 4HX4A 3GUDA 4P9UA 2OZ6A 1U2WA 4HDUA 4LK1F 4ESJA 4CZZA 4UNOA 1U5TA 2P7VB 3SXYA 3AAFA 3CJNA 3Q9VA 2VN2A 4L9JA 3F22A 4ZYDA 4BNCA 4RB2C 3PQJA 1OR7A 3FF5A 3LFKA 3KFWX 3G3ZA 3M9AA 1S3JA 2FMYA 5A2QZ 2ISZA 2MD5A 1YW8A 2KIMA 5BMZA 1KU9A 2VBYA 2OZUA 5EEGA 4A0XA 4A0ZA 3EYYA 2LKPA 4N9HA 3OOPA 3J80K 2A07F 4I0BA 4LLLA 2P4WA 2DT5A 5HS9A 1P6RA 3V8JA 1ONVA 1P4WA 1TNTA 3HSEA 2ADUA 4EGZA 1W7PB 1YS6A 1ZREA 4EM2A 3K1NA 1LDJA 2H27A 3W6KB 3KLOA 1F1ZA 2BGCA 4YG2F 1BJAA 5K5RA 5HS8A 1DPRA 5ICGA 3FWEA 4ZYHA 1IRGA 4HF1A 4Y17A 4UVCA 2QM3A 3C18A 4ASNA 4KMFA 4L9VA 1T39A 3B73A 2XAHA 1UCRA 3F8NA 3H3UA 2D1HA 4OIQF 2GXGA 4PGGA 3FXQA 4UVAA 1BI0A 4BH9A 1S7OA 1LJ9A 1YYVA 4EGYA 4CXFA 3HYIA 4Z2YA 4N0BA 1P2FA 1R00A 1U78A 2YU3A 4L9NA 3IKTA 2AS5F 2QUFA 1MJ9A 2XIGA 1J7KA 3ABUA 5D4RA 3EYIA 2Z5UA 4Y15A 4MEYF 2XV4S 3TGNA 3DKWA 1W5TA 2FOKA 5J6XA 3E5QA 5HDKA 1FY7A 3E6DA 1ZLJA 2XRNA 1O57A 1FSEA 2ZJ2A 3I5UA 3J81K 1I1GA 5DCMA 4EJTA 1DDNA 2V6CA 3KP6A 3HHGA 4JBAA 1IN5A 3E5XA 1LEBA 4G6DA 4M6YA 1USSA 3JTHA 2QWWA 3VFZA 2IPQX 2HEOA 2VT3A 2EA2A 3REOA 2ZNZA 2RC4A 3MZYA 2QBYA 2L4AA 3PFIA 4BQAA 3S2WA 1TNSA 2HWVA 4UV9A 1FZPB 3C1DA 3QP6A 2O6GE 4CHUA 1U5TC 4GGGA 3SZPA 2XAQA 1XB4A 4HYEA 1R1UA 4KUMA 1TBXA 3QAHA 4XLPF 3DV8A 4KA4A 4EJOA 3L9FA 3DXJF 4ON0A 2HKOA 4KFCA 3L09A 2EFWA 4I09A 3DPLC 2XASA 5BS6A 2DW4A 2Y48A 1O3SA 3E6MA 3LAJA 4M74A 4RAZA 1KA8A 1S7AA 1AWCA 4LMYA 3IWZA 3GO5A 4YFKF 5F6FA 2VOPA 1A04A 1T6SA 1ZAOA 2DBBA 3WTTC 4FHTA 3RKXA 1D8KA 2R3SA 2FNPA 3JAMZ 3KCCA 1T0FA 2ZNYA 2HZTA 3TDZC 4U0WA 3ZMVA 3F8MA 1ZG1A 1IXSB 1V3FA 2EWNA 1LB2A 1YLFA 3RPQA 3WTZA 3ZN0A 2ZKZA 1GHCA 2FBKA 2F5FA 3SQNA 3JTGA 1V4RA 1R1VA 3F21A 3HRTA 4HV6A 1O7LA 3WTYC 1PDNC 1OPCA 3TQNA 5D4SA 4DQ2A 5BOXA 2ELHA 2HQRA 3GEZA 1FOKA 4PGHA 1EH7A 1HXDA 5BPIA 2H09A 2BBYA 2W24A 4LGWA 1L0OC 5LGUA 5LHHA 5L3EA 4HF2A 2V9VA 1D8JA 3DPTA 2QLZA 2L3DA 2YSRA 3QP5A 3O2PE 3Q5FA 4HQEA 4O6JA 1TQIA 2DLLA 3C7JA 4LG0B 2R7FA 1REPC 4EM1A 3H92A 2K27A 5CJ9A 2DPDA 4HBLA 1QBJA 3HRSA 4KIBA 4HX8A 1RZ4A 4EMSA 3CUQC 4O3MA 3GFIA 3KZYA 2EK5A 2Y0MA 4WXCA 2PMHA 4EJUA 5AIQA 2IJLA 3NRVA 3P9KA 1DP7P 3U2RA 3ROUA 4BYYA 1K79A 4R79A 4CICA 2GA1A 2PJPA 1TLHB 3HSRA 1IUYA 3FM5A 4XRFA 3VOEA 1SD6A 2HGCA 4EJVA 3IRQA 5L3GA 4U7BA 3DEUA 2E7XA 5FD6A 1Z05A 4EVIA 3J7AO 3I53A 3RI4A 4A5MA 2KJCA 1XSDA 1GXPA 3LA2A 3WTUC 3R4KA 5IT9K 3F23A 2A3SA 2KKOA 1WRJA 4Q4ZF 1T2KA 3BOQA 2M45A 1BI2A 1FBQA 4ZZDA 1TW2A 4I01A 1H9TA 1LQ1A 2LNBA 2PQ8A 1K6OA 3ZN1A 2CSOA 3L7WA 3WGHA 2D45A 1LDDA 4HA8A 3T1BA 3RIRA 1BOAA 4OIOF 5DCFA 1IXRC 2K7LA 2Z9OA 4CYDA 2UXNA 4AD9A 1J5YA 5DUIA 2F5EA 5ILUA 5FB2A 2BEOA 1BC8C 4MNUA 3V7SA 4OINF 2M1BA 4G9YA 4WF2A 4G7ZF 5LGNA 4IRIA 2Q2EA 2LF8A 1JE8A 4B8XA 3ZMTA 1LDKB 1B9NA 4LB5A 3W6JB 3FMSA 5JI6A 2HQNA 2STTA 3JSOA 1J2XA 2EV6A 3QPHA 1DUXC 5LEKA 2FSWA 3MWMA 2QQAA 5E18F 5ILVA 2CWEA 2FF4A 3KE2A 1Z6RA 1HW5A 2YR2A 4S05A 3CO6C 1ODDA 2EV5A 5DUKA 5LRSA 5IT3A 2DI3A 2O3FA 3T8RA 3BDDA 5KVRA 4A6DA 2K86A 3HTSB 1PUEE 4RGSA 1R7JA 1YG2A 2EFOA 1C0WA 4ENMA 5DEQA 2JT1A 2P5VA 1MGTA 3O6BB 2VXZA 1SFXA 4M72A 4I7HA 1B9MA 4LLGF
chains in the Genus database with same CATH superfamily
2JPBA 4PJ0C 1Y1VJ 2QQ9A 4TV7A 3H9GA 4Y52J 2FBIA 1B6AA 4U7DA 2LTPA 2FMLA 4Z6YA 3DQVC 4CGZA 3ZMZA 3DTIA 3E97A 1ZRDA 1OQYA 2BV6A 2MH9A 4UV8A 3CLOA 2JTVA 1OYYA 2XKOA 3E0JB 1Y0UA 1R5GA 2V9PA 3V8LA 5KAFC 1SFUA 1U9OA 2X6XA 4UHTA 2CO5A 4XM3A 5K7HA 3E5UA 2LY1A 5CVUA 3KYCB 3GLXA 3GTLJ 2JJ7A 1KQ8A 4OAZA 3N05A 2DYSH 1CF7B 1ZRFA 2V1XA 4ZYAA 4AVZA 3MKLA 3JRFA 2W7NA 2I5UA 3EUAA 5B3SH 2X0LA 1WSUA 2LRDA 2Q1ZB 2ZXIA 1O3RA 4A3FJ 1H9GA 1ON1A 2XAUA 3K6GA 3PUBA 2JA6J 3WU0A 3M8JA 2CG4A 3PUFA 1BL0A 3KP3A 5H2FC 2AQFA 3MN2A 3WGIA 2AXTC 2ZCWA 3BROA 1H0MA 3PSFA 4C2UA 1WJEA 4HG2A 3RKWA 3KYDB 3TW7A 3CMEI 2LKXA 2K3FA 3LWFA 2Y0SA 3M1CA 5GPCA 3A01B 2IGNA 3CMYA 1K7AA 3ABLH 5KK1A 1FYKA 1D1CA 2JVHA 1P4XA 4BUPA 1SEUA 4FETA 3BTIA 3TOAA 4RBOA 1MMDA 4HZFA 3IUOA 4BJTA 1FYLA 1IN8A 3ML6A 1LVKA 2EFQA 3BTLA 2M3AA 1YX5A 4NQWB 3VSKA 3LA7A 1RIOH 1EH8A 2XSDC 2EFNA 4JX4A 3MKWB 5FKMA 2KZVA 4UY8I 3VODA 2IS2A 5J1RA 4X0GA 4XICA 1RI7A 1MBGA 2XROA 2BY0A 1WCMJ 3RZOJ 2YPRA 2EBIA 1T08B 3NARA 3TO7A 4WX9A 2E1CA 5HNFA 3K4LA 4II2A 1ETYA 2TRTA 2OJED 1WGXA 1Z67A 4AIDA 2IXSA 5DCMB 3FBNB 3WTVC 1MD0A 4IHWA 4DZPA 2E7WA 2I10A 2EZIA 2R7OA 5E3OA 4PZJA 2PEXA 4KJZA 3ZMDA 4LLGF 4ZZLA 3M07A 5E3MA 4XL9A 2QKMB 2LG4A 1JKQC 2DJNA 1HW1A 1IF1A 4A3MJ 2L9RA 4PFOA 4MQVA 3CF5F 1ITYA 1D5YA 2PFBA 1ON2A 4OMZA 2QSGX 4C2TA 4DZJA 1YRNB 2XGCA 3L00A 3G4SI 4UVBA 2CV0A 4U0VA 3ABMH 3M3YJ 2GIVA 2ZB9A 5K7ZA 1TWHJ 3IKVA 2JA7J 2RREA 1MZBA 2P81A 2NAZA 4BXUA 1WWXA 3G1OA 4HX7A 4NB5A 2QBYB 2IS4A 2A05A 4Q5SF 3L2CA 4GYGA 2GIZA 4GRIA 4N4NB 4RAYA 2RQQA 1WJFA 1QHHD 2UZKA 4UUVA 5HDGA 3GZ5A 2P6SA 4NBQA 5LD2C 5FROA 5D8KB 2FA5A 5KCMA 2W00A 1IV8A 3Q9SA 4ESBA 1Z9CA 2E5ZA 4EM0B 1TWCJ 3HIFA 2DQLA 3I4MJ 1UB9A 5EEHA 3OYJA 1SVLA 3JSPA 2VASA 4DNCA 3KYLA 2RKHA 4MTDA 1YW7A 1ZHFA 2RN7A 3QRFF 1UHWA 1MBJA 5CLSA 4XRSA 2XC7A 5IYDJ 2HKXA 3HKZN 1I5ZA 2PI0A 1XD7A 3LSHA 5LFAA 3LA3A 4ITVA 1XMKA 5H6QA 1GT0C 4EV0A 4WK8F 3BJ6A 2K4JA 3GMEA 1YTYA 2XAGA 3CUOA 3CCJI 2R7TA 2R7RA 4B1RA 1PUFA 1HSTA 3L2UA 2DFFA 3I58A 1U8RA 4GDFA 5HDNA 1USTA 3PNVA 2XUBA 1JKPC 3HOYJ 1OLTA 3PNYA 1QO0D 4E7IA 2NVYJ 3SFIA 3FXJA 3OYLA 1QRYA 1X2MA 4L18B 1YFHA 4XRMA 2IGOA 2IA1A 4CCOA 5FKLA 3DWLE 3K0LA 3DKXA 1LE8B 2RDPA 4KITB 1E17A 2ZFUA 4HLXA 2KPMA 1GLNA 3DBHB 2LF7A 3ZQCA 3HRMA 1ZN2A 3VYTB 3J7ZI 4W1UA 1Y6IA 1S72I 2MABA 4J19A 3AL0C 3MAJA 3IRRA 3L1PA 5DD8A 1GXQA 4XONA 5FFXA 1OCTC 3V42A 2XPWA 4BEHA 2P6TA 4V2GA 1XGSA 2IRFG 2ESHA 4NC7A 3DU6A 2HOSA 1IRZA 2EINH 4C3JJ 2E5NA 4EQQA 1SD5A 2H94A 4M3BA 2PMUA 3G73A 1TW3A 2A69F 3CTAA 2O0YA 2DYRH 5IP6A 1D1AA 1XCVA 4MIMA 4YIRX 1PP8F 1VQ7I 4RGRA 4M9XA 2KRFA 1L3LA 1KU7A 2GXAA 3K4MA 3A2KA 5EZHA 5E8GA 2BYVE 3BY6A 4WXDA 2LFBA 2HOEA 2BZTA 5GTIC 3I9V2 3RQ4A 4RGXA 2E35A 1TP4A 2F4IA 2JRTA 2MBFA 1JHFA 2G7UA 5L3FA 2VPRA 3JAMK 3HSFA 1KYWA 1QVUA 2DMTA 3SYTA 4ZYGA 5GP9A 2ZC2A 2VBZA 1JUSA 5K5OA 3K1MA 2QYOA 1MBEA 4BY1J 3MKYB 3FXMA 4XKVA 1RNLA 4D0PA 3JRDA 1ZGJA 3HDDA 2MC3A 4HDVA 4B09A 2DMUA 2ECCA 2WY8Q 1R22A 2EZHA 2HZDA 4XK4A 5DDGA 2FNAA 1APLC 5L3BA 4I6ZA 2B0LA 3J81Z 1MKMA 1R1TA 1QA6A 2XAFA 3RPUD 1I3AA 3QPTA 3H3VK 1Z77A 1LFUP 1RESA 1V5EA 1XGNA 2FXAA 4XLHA 1FLIA 1WJBA 3D5SC 3IWFA 2I8DA 5EG0B 4PSXA 1TWAJ 2A6TA 2BHZA 2JVGA 2MH2A 2X4HA 3LSIA 3O8GA 3WODF 4BL0B 3GTGJ 4NDLA 2EJRA 2EB7A 1IW7F 2VB6A 3B6AA 4Y4RA 3TMOA 1QQIA 1FP2A 5KNLA 2XVCA 5EGOA 2E36A 3ZRGA 3H0DA 4I2OA 3TO9A 5L3CA 2IT0A 4R8HA 3QPSA 1IN4A 2WAFA 3I4PA 4IRHA 3V7CA 3ASNH 4G6QA 5D5WB 2F5DA 4FX0A 3HOTA 3HHHA 1ZYRF 1TQPA 3A02A 4BQQA 2CU7A 5CYVA 1G4DA 4KYWA 3A4CA 2JA2A 2Y69H 4YIIA 1MJBA 2LKSA 3FXKA 4L0YB 4NUBA 1ZK8A 3K4KA 2E19A 3D5LA 5ICEA 3PO2J 2ZJRF 2OQRA 3JW4A 5A2QK 3S3NA 2D1VA 3OYAA 1VQMI 2VPLA 2HDCA 1ETKA 1E3PA 2ETHA 4L9TA 2XSJC 3G2BA 3KLNA 2DO7A 3HPHA 2KL4A 1SAUA 3ZOBA 2HYFA 4HLYA 3ZR8X 4F7ZA 3U9GA 4IXAA 3NAUA 3QYEA 2E2HJ 2FD5A 2FJ1A 1XCBA 4M3EA 3BJOA 2Y2ZA 1VQPI 2X6OA 2OA4A 3R6SA 2L4MA 1HBXG 2R7QA 2GBYA 5HS7A 4OIPF 3I59B 4OU0A 1G3YA 2O61A 4I99C 2L9SA 1YQAA 2DDBA 3BQYA 4DBQA 2F4MB 3HM5A 4LLNA 1Z7LA 4RLQA 3L2RA 4XLFA 4RB0A 4AUXA 3SDBA 2LYCA 3FDYA 1BIBA 2RQPA 3NQOA 1YO5C 4BHBA 2DQRA 1S6LA 2DTZA 4LD5A 1ZLKA 5C4JJ 2NOGA 2XRLA 3KZZA 1WVRA 1HKTA 5HODA 2H6CA 3GFMA 2XDVA 5LHIA 1YITI 2CFOA 3DLAA 4E7JA 4BBSJ 2DN0A 5J1UA 4XLEA 2OQGA 2LD5A 1FPQA 3GTJJ 1ZG5A 2J5OA 4Y13A 4N9IA 1G3SA 2Y9ZA 1WH5A 2W85A 1ETWA 4H0EA 4MHGA 1W0UA 3I54A 5F1JA 2QSFX 3CCLI 4RM3A 1JHHA 1Z6TA 4WXHA 1WKMA 4A5NA 1J0RA 1AKHA 1X4OA 1SMYF 2A6HF 2M30A 2L0KA 5GTHC 2VBXA 2VQLA 5AONA 2XAJA 5D5XB 3GYHX 2F6CA 5EZGA 1DGWY 1XX5A 1VQ6I 1OCOH 1X19A 3N4MA 5LHGA 4KDPA 1ZKGA 1ZQ3P 1PJRA 3KP2A 2DA1A 4IQ4A 3QU3A 4FTHA 4CH7A 1V5GA 3FISA 2WC2A 1B72A 1EV7A 2NNNA 4HV5A 3O3KA 1E0EA 4B4CA 4PFPA 1AOYA 1FWZA 1FIPA 4E6KG 3HEFA 1QPMA 3ELKA 3LAPA 5CQEA 3AG2H 5CVJA 4HW0A 1T95A 2AQEA 2NXNB 2P5LC 2LREA 3VEPA 4D1QA 3E6CC 1SD4A 1MDMB 1RC9A 4UXNA 2VI6A 3HPGA 1ETVA 5E3NA 2PBIA 2ZMEB 3EQLF 4NQWA 3CF2A 1QNTA 3V4GA 4X1EA 1ZG3A 2YU9J 2CW7A 2MW8A 1SFOJ 2UWMA 3R0JA 2K02A 2JZYA 5DYMA 1WQ2A 3WG9A 1MMNA 1VI0A 4F93B 2ZO4A 2XB5A 2BVMA 2PG4A 1FJLA 2DK8A 5JVTA 1HLVA 4J00A 2HTJA 3DBLB 3BQZA 2DDAA 1A6QA 1IGNA 1D5VA 5F64A 4AWXB 2OAZA 2KZGA 1O3TA 3QOEA 1FSHA 5E1XA 3S3MA 1F5TA 2CQXA 3HTUA 4M71A 4FASD 3SZGA 1G2HA 4BAYA 4MFDA 3JCUC 1ZGAA 3ULQB 4M73A 1Y39A 3RYRA 3TDUC 2PMZN 1Z1DA 2R7DA 3GZ6A 3EUHA 3W2AA 2NNYA 4YFNF 2JA5J 4K2EA 2CRGA 3S32A 5GAHJ 2OD5A 3OYKA 4NHJA 2X48A 2Z99A 4Y7NJ 1MMGA 5HVQC 2GXBA 2ACJA 3RKYA 4QPOA 3FXRA 5FFZA 3ONQA 1NG7A 3BZCA 4G7HF 1LNWA 3RYPA 2A61A 5L3DA 4MO7A 5HLGA 1TT0A 3LSPA 3H3ZA 5LEJA 2DFEA 1BM9A 3E6BA 1IN7A 3RJPA 4FCYA 3BT9A 4OWRB 1STZA 2FE3A 5LLQA 1MNEA 2O7OA 3DF8A 2KDZA 2DA6A 4WWCA 2NYXA 3ECOA 2DAOA 2XPUA 5ED4A 2PN6A 3FZVA 2R7ZJ 1IRFA 1K78A 2VOOA 1FMWA 3KP4A 5E79C 2VBWA 2EIJH 3OYDA 1QZYA 5LRRA 4KT6A 1LEAA 1UJ8A 3C2BA 5F27A 3KP7A 4M9ZA 2HPIA 1U0JA 1ULYA 2M4GA 5CVVA 1YIJI 1WFXA 4I02A 2Q8KA 2HVRA 5J47A 4XSZF 1TQMA 2VKDA 2RGVA 2PJRA 4D7NA 1Q1HA 5J3LA 4F91B 2JMWA 4IJAA 3WE2A 4ZTFA 2VUMJ 3MQ0A 3R0AA 3CJTB 4L5JA 3PL8A 4LJZF 2Z3YA 4QWQA 4D5FA 3OS2A 3SDGA 4S04A 5FKNA 3PO3J 3F8CA 3I71A 1OYIA 2EH3A 2EZKA 4XSXF 4BU2A 2XGXA 4PJJA 1ETXA 5HLTA 4ENNA 1HSJA 2HU9A 2HFHA 4AIHA 3KIOA 3ECHA 4PDKA 5FLXK 1CF7A 4NC6A 3WTSC 1IN6A 1I27A 1DP3A 2ZJQF 2LVSA 1MMAA 4M3DA 4CCJA 1WJAA 3H36A 3CO7C 1W36C 1JGSA 4MQ9F 4OIRF 4QPQA 4ABZA 1MMSA 4QSHA 3IH2A 3RCOA 4RGUA 1U8BA 2A68F 1FYMA 1WZ2A 2CJJA 3TO6A 4XIDA 4A0YA 1FC3A 2XKPA 2P0WA 3A0HC 2KJBA 4PCQA 2FOWA 3ZMUA 2CUEA 4RB3C 4LFUA 1AU7A 2E1MC 1YE9A 3GXOA 4ZDOA 3BJAA 1FBSA 1O3QA 2HDWA 3RPUA 4F92B 4AIKA 5EYRA 3V8KA 5JLXA 3M1EA 4YIFA 1GDTA 2ZBKA 2MSYA 3BCAA 1PVEA 4XORA 4HF0A 1SAXA 1BW5A 4KNYA 3WU1B 2O8XA 4P9FA 1BN5A 2Y9YA 1IDZA 4IPAA 4BDYA 4KISA 3BPXA 2HYJA 2GAUA 4RS8A 3IAM2 3ESWB 2LC2A 5HLIA 2KLOA 3S93A 2VONA 2V7FA 3WGGA 1RKWA 1YW9A 3CCVI 5J40A 2FBHA 3DCFA 3GW2A 1HKSA 3LSTA 2COMA 3OV8A 2V9KA 3ZQGA 3FXUA 3R60A 1FOYA 1NHAA 2CUFA 4DYRA 2K85A 3F9KA 4FT8A 4C3HJ 1Q1VA 3I0TA 3VB2A 2XF6A 1FTZA 4QTRA 2X51A 3FM3A 1JKOC 4KN4X 3K9TA 3CJQB 4PUSA 2HVSA 1VZ0A 2G0EA 4ZC3A 2L01A 1ZARA 1EF4A 1T33A 2UUZA 1XTAA 3I55I 3S2HJ 2WB1A 5J8FA 1UHSA 3E3VA 3L2QA 3A1YA 4HSTA 5F1RA 2WB1N 1FBUA 1HW2A 1QZZA 3K4NA 5CVIA 4BY7J 3VPRA 5E8IA 2GWRA 3M8EA 4JK1X 2FRHA 4H4KC 2OBPA 1VQ9I 5IOYA 1T38A 1OFCX 2QZ8A 2TDXA 4ESFA 2IBDA 2KIFA 1U3EM 2R4GA 5IYBJ 2W57A 4P5OA 4MEXF 1A6IA 3FMQA 4MFEA 2XPVA 4L5IA 2R7SA 3K69A 3SZTA 1I50J 5FGMA 1B8IA 3AG3H 4XN3A 4XR6A 3CUQA 4CO8A 3HOZJ 1Z7UA 2KRHA 3T8TA 2VODA 1HKQA 2FQ4A 1K4TA 2ZSIB 3KPHA 5K1YA 1O7FA 1W1WE 4E7ZA 3FHZA 4IVNA 4C3IJ 1XGMA 2V26A 4LB6B 3HUGA 3MZHA 2GQQA 4G7OF 3CJRB 5CPRB 1Y0NA 3F8FA 1H89C 4M9SA 5TRDA 3MMYB 2ZXHA 2K9LA 2M5WA 4DW6A 1JI8A 1OCPA 1AA7A 4KT5C 1GVDA 3F8BA 3P9IA 2E1NA 4RLFA 4P96A 3GLLA 1H8AC 3DLLF 2IA2A 4M3GA 4CA0A 1W4MA 2D2WA 5KHDA 2HXOA 1VQLI 1HDPA 1K78B 4GXOA 5JHUA 5DTDA 2JSCA 3CLQA 3BG5A 3DP7A 2FEZA 2L9NA 2FQ3A 3PM1A 4U88A 5F0CA 2XGEA 2ZSHB 1KYZA 1W0TA 4MLOA 1UMQA 1OCZH 2DPUA 3PFYA 3ERED 2L7ZA 3ZQIA 2CS3A 1FMVA 1X2NA 4CDGA 3I64A 5FKOA 3VYUB 1R71A 5E3LA 2JUCA 2W84A 2F48A 4P1WA 5D6FA 2P7CB 2BW3B 5BQTA 2LH9A 3HL2A 2CFXA 2G7HA 2X1CA 2H8RA 1P4AA 1UHMA 4O5VA 4ENKA 3ZPLA 4A93J 2VE9A 4C30A 4ZYEA 1BC7C 3OYIA 3K2ZA 1B4AA 1EH6A 4MGRA 4IRGA 3KEOA 5ICCA 2DA5A 5LBQA 4OMYA 2JSPA 1HC8A 4DIQA 1PP7U 1B59A 2ZXJA 5DV5A 3N97A 4BDZA 3RTRA 1GV5A 2A5YB 3F3XA 5FLMJ 3CDIA 2HQAA 1XGOA 1LUJB 2EPFA 2RNJA 1N77A 1KQ9A 2YX4A 3CESA 2ID6A 1MNMC 3AKZA 2NS0A 2H1LA 3HC7A 3OS0A 5DD4A 4Y33A 3CC7I 2R5ZB 1AHDP 3BCBA 4EEFG 1FT9A 2VC0A 4DGWB 3BG3A 1G59A 1R5ID 3MD2A 5AIPA 1ZH5A 1YHQI 4IHXA 5ILSA 2L5QA 2HOTA 3IHUA 3D0SA 2M8EA 2WBMA 1V5FA 4JQFA 2OU2A 3FIWA 4IEJA 1IUFA 1T98A 4XMYA 3NEUA 1P9QC 2VQGA 4ZTJA 3HJEA 1FOWA 1JTXA 1J75A 1VQNI 5F08A 2X6YA 3ZMSA 3JRGA 2ZMEA 4XLAA 1U5TB 4M6XA 1KZHA 4IZZA 3SEZA 5ICFA 2Y30A 4LOCA 2WAEA 3D5RC 3GVAA 2ELJA 3P9CA 2QCOA 1KU2A 5FD5A 3BPVA 1B1BA 3TKYA 4ZJZA 4B43A 3W3CA 5C44J 2KIQA 3OS1A 2QQBA 5E1ZB 3QOPA 2J5PA 2HTSA 2UXXA 2G9WA 2D5VA 3CCSI 1CGPA 3H35A 2R5YB 3TOBA 3ZXSA 3HZJA 3HOSA 1R6RA 2M7BA 4QLCU 2AXLA 1I6HJ 5CVRA 2R93J 3B02A 2GZWA 1OYWA 5BPDA 2K4BA 1IG7A 1D0YA 2YS9A 4LITA 1GVJA 1H88C 1A35A 3UKGA 1A31A 1TL8A 3TEDA 4V2FA 1MBFA 3KX2A 2V79A 3RSNA 5BNGA 1X3ZB 5IOZA 4LG0A 5KAIC 3I56I 1J09A 3HG9A 3T5XA 3VWBA 1I6XA 2CGPA 4WCGA 2IVMA 3GX4X 4FE7A 1R49A 1BJZA 2H6BA 4I98B 1ENHA 2MLKA 2XF7A 5CQGA 2ZJPF 1ERDA 3DTKA 2VKEA 1XS9A 2BY3A 2YX7A 2DMNA 2EA4A 1XDSA 2Y75A 3GFJA 3CDHA 4E7KA 1OCCH 2IP2A 4A3BJ 2M87A 1SD7A 2LSOA 4GYIA 5TGTA 3TW6A 3ZQLA 4II3A 3QQAA 1W7PD 3BZKA 2X6WA 5CKTA 5J8CA 4RDUA 2KQRA 5D6EA 4C9YA 1MSFC 4BHCA 2DA2A 3CC2I 3F6VA 1X4PA 2M2EA 3BR0A 3COAC 2K9SA 2JPCA 4BE1A 1HOMA 1DGRM 5HLHA 3KEQA 2DMPA 1S7EA 3LL7A 3FXLA 5LGTA 3GFLA 3IV5A 3HKZA 4IQJA 2ESNA 2CV2A 2HR3A 1LE8A 1OMIA 1IC8A 3S8PA 1MW7A 3DKYA 2L02A 3I3LA 3BG6A 4HEA2 2HDDA 4AM3A 1XC5A 3K4CA 4IKFA 3KETA 3WTXC 3ZQ7A 1X3UA 4UB6C 3ZP5A 1HQCA 2IAIA 2HVQA 2VC1A 3K10A 5E20A 1QHGA 5FLXZ 3LQRA 3ABTA 3P7NA 5DM6F 3J80Z 2WV0A 2L7MP 4N4OB 2W1OA 1R23A 2NVXJ 3GTQJ 4HNVA 2A6EF 3HRUA 3GZNB 2KIUA 1UG2A 2DA3A 1KGSA 3TP0A 4IX7A 2QENA 4GCVA 3MEXA 1Z91A 4BQOA 1IXCA 2BW3A 4RAFA 1J59A 2HOAA 1IZ1A 2MA3A 1WI3A 5M3MJ 2XHKA 5J4VA 4YFXF 2LLKA 4R1HA 5F0FA 1A36A 3ISPA 3CMAI 4HAMA 2DFIA 4CSWA 5JVGF 1IV6A 4IF4A 4BHPA 5D8LB 2NVTJ 1M1EB 2OCCH 2W82A 1BBYA 3QU6A 1W36D 1D1BA 1S8NA 3CD6I 3HGYA 1TC3C 2CYYA 3BWGA 3AL0B 4E70A 3OYEA 4EJWA 3ZQHA 1JGGA 1JKRC 3OYBA 1BR2A 1FNNA 2RVCA 4FQGA 1JXSA 5K5QA 1NTCA 3F72A 2BE5F 3V7RA 3DFGA 1Y8QB 2LY9A 4G94A 4Q48A 4A6EA 1NG6A 2KMUA 4IHSA 2NVQJ 2VE8A 2Q0OA 3LSJA 4LK0F 3DPUA 5EG0A 2QVOA 5HOOA 2IS1A 2F5CA 2STWA 3ZGKA 3C3WA 6PAXA 3S14J 3FX3A 3BP8A 1FP1D 1U6GA 4MTEA 1BI1A 1XG1A 2MD0A 1E3HA 1VTNC 4PJNA 1MIJA 1YS7A 3FBIB 3FXOA 4KIGA 1F36A 3GF2A 4RAGA 1G6NA 2VJ4A 1BIAA 1T56A 1XN7A 2GA2A 2CQKA 3G71I 5C3EJ 4BGDA 2WV1A 1MJAA 3KP5A 2DJIA 1KQ0A 3IAS2 2WTEA 1FX7A 1XSXA 3QYBA 4Y3OA 5TJJA 4IOAF 1W5SA 2P5KA 2CW8A 3LQQA 4ETSA 2L54A 3HOWJ 2Y31A 2C6YA 1RUOA 1P7IA 3EETA 3VDXA 3CQZJ 2KRCA 5IT9Z 1ZRCA 4BBRJ 4CYCA 3SFZA 3SHFA 4RB1A 3M8FA 2F2EA 2VJ5A 4Q47A 1XDUA 1TTYA 1ZR4A 4UUSA 3EDPA 1NK2P 4LIVA 3KEYA 4KN7X 3RDIA 1MH4A 2HYGD 2M4KA 4HPQA 2KT0A 4A12A 4OOIA 2DK5A 2IGKA 1Y1WJ 4LG3A 3MFKA 4KMUX 1SMTA 2XF5A 1BI3A 3LFUA 5ERIA 2HXIA 1QGPA 1BR4A 4HOBA 5H20A 4G6TB 2WWYA 2EFPA 5F0HA 2IW5A 2Z16A 2V1DA 5IY5H 1G3WA 1B8IB 2ISYA 1XSVA 1MBKA 2VKHA 3BG7A 4DOZA 2PLYA 3CUQB 4ZH4F 1W7PA 3LSMA 2AO9A 3I59A 1S29A 4UUTA 3PQKA 4U0YA 4FX4A 2O03A 4XBFA 3JRHA 2V1NA 4RA2A 2RV8A 2VLAA 4AIJA 2L7KA 1KU3A 1QZEA 2W4SA 5E1WA 1P92A 1X1BA 3NWTA 4JOMA 2MLGA 2R7VA 1N25A 2VJIA 3ERMA 3QODA 1IRXA 4BKXA 1IAWA 3ZQFA 3GTOJ 4CZCA 1YIOA 2LY2A 3JRCA 3WE3A 1WI9A 1VFCA 4KICA 2HS5A 2CW0F 1QPIA 3CCYA 4L0ZB 5EJCA 1R5HA 3EUKL 3IC7A 1POGA 1XMAA 3OYGA 2DTRA 2V1UA 1R36A 3C2HA 4CCKA 1F4KA 1N78A 4I0AA 3T0YA 5JR3A 1NK3P 1I3QJ 1I1SA 2DU9A 3BZ6A 3P5JA 4AVPA 2ZFWA 3F0CA 2OTLI 2MYSA 3M7GA 2Z33A 2QEXI 3FMRA 2W25A 2ICWG 2L9VA 4GO1A 2VT2A 3U1DA 2EV0A 4HQMA 1LFPA 1EJ9A 4G8XA 1BA5A 1G8XA 1LVAA 5GPAA 4IHTA 5D5VB 1JJ6C 4KIFA 4CUGA 2DOFA 5D5UB 3OOUA 3KZIC 1E2XA 2P8TA 5H6RA 1J9IA 3W2WA 5FO5A 3K1PA 1SFEA 5GADJ 3BR6A 2NRAC 2OC6A 4ZDLA 1FIAA 1OKRA 1R58A 4D7MA 1JTYA 4G12A 5JFRA 2WY7Q 5M5XJ 1UFMA 2IA0A 1MDMA 4F55A 3MCZA 4YRVA 3GWZA 3PIOF 2E2JJ 4P55A 4XLNF 3WTWC 3EPZA 1D0XA 2BY2A 1F9NA 1DPUA 1RUNA 1G3TA 2LDUA 3IL2A 2MG4A 3JRAA 3OWTA 4GFBA 5GAEJ 4A3DJ 3GTKJ 1TZLA 2BOLA 2O5RA 2FU4A 3F6OA 5JHFA 5E17F 4ENJA 2MGQA 3R61A 2NVUB 4A2UA 4FE4A 1D3YA 5M3FJ 2KDOA 4HX4A 3GUDA 4P9UA 2OZ6A 1U2WA 4HDUA 3RZDJ 4LK1F 2WAQN 1YOVB 4ESJA 3HOVJ 4CZZA 2R7XA 2E60A 4UNOA 3S15J 4U87A 1U5TA 2P7VB 5B1BH 2OPTA 3SXYA 1IDYA 5EEAA 3CJNA 3Q9VA 3AAFA 4A3IJ 2VN2A 3CMMA 4L9JA 1XPXA 2KP6A 3F22A 4A3LJ 4ZYDA 3VSLA 2DA4A 3BC8A 1VF9A 4BNCA 2CUJA 4YEJA 4C2MJ 3OIPA 4RB2C 2QSHX 1P7JA 3OR2C 3PQJA 1JJ8C 3IH3A 5M5WJ 1OR7A 3FF5A 3LFKA 2W48A 3KFWX 3CCEI 3G3ZA 3M9AA 1S3JA 2FMYA 5A2QZ 2ISZA 2MD5A 2ZMEC 1LKXA 1YW8A 4IO9F 2KIMA 2F5VA 5BMZA 2EIKH 1KU9A 3K7AJ 2VBYA 3FKIJ 4E4HA 2H8WA 1EA3A 2X1DA 3TBIA 2OZUA 5EEGA 1K6YA 1U9NA 4CYCB 1WJCA 1HF0A 4A0XA 4A0ZA 3EYYA 2LKPA 4N9HA 1JT6A 5DS9A 1YJNI 5FRNA 4NNJA 3OOPA 4UUSB 1E3OC 3J80K 3E7LA 3BG9A 2M0CA 3OSFA 3CC4I 3JREA 2A07F 4I0BA 4LLLA 4EATA 1ORKA 2P4WA 2DT5A 5HS9A 1P6RA 3Q0UA 1VNDA 3V8JA 1ONVA 1K83J 1P4WA 1TNTA 2PJRB 3HSEA 3H5RA 2X1EA 2M0MA 3PIPF 2ADUA 2WAQA 4EGZA 1W7PB 1YS6A 3GTMJ 2K3PA 4EM2A 1ZREA 2Y0SN 1VQ5I 1RR8C 3K1NA 1LDJA 1Z3XA 2IGMA 2H27A 3W6KB 3KLOA 1F1ZA 5IPAA 3FK6A 2BGCA 4YG2F 1BJAA 5K5RA 2KISA 1FTTA 3SJMA 2IEKA 5HS8A 1DPRA 5ICGA 2HPMA 1EKEA 3PNTA 1SANA 3FWEA 4ZYHA 1IRGA 1WH7A 4HF1A 4QIWN 2HQ5A 4Y17A 4UVCA 4X6AJ 5FJ8J 2QM3A 3C18A 2PMZA 3GCMA 4ASNA 4KMFA 2Z1DA 4L9VA 1T39A 3BR2A 3B73A 2XAHA 4XNFA 1UCRA 3F8NA 3H3UA 2D1HA 3BR1A 3G6EI 2QQ8A 4OIQF 2GXGA 4PGGA 3K2AA 3FXQA 5F04A 3BR5A 4UB8C 3HXLA 2QGUA 4AC0A 2YUSA 4UVAA 1BI0A 1V54H 3LOCA 4BH9A 1S7OA 1LJ9A 1YYVA 4AYBA 4EGYA 4XOTA 4CXFA 3HYIA 4Z2YA 4N0BA 4BEHB 2ID3A 1P2FA 2E71A 2K9MA 1R00A 4DYCA 3OSGA 1U78A 2EQRA 4ANJA 2YU3A 3IP4B 5FLVA 2XB0X 4L9NA 2ELKA 3IKTA 3ASOH 2AS5F 2QUFA 1MJ9A 2OTJI 5B1AH 2XIGA 1J7KA 2DA7A 3Q0WA 2VQHA 3ABUA 4E7SA 2NS8A 2LP0A 5D4RA 3EYIA 3D1NI 2ME0A 3H0GJ 1WJDA 2Z5UA 4MEYF 4Y15A 2BY1A 2XV4S 3TP3A 1HA8A 3TGNA 3DKWA 1W5TA 2FOKA 2X9DA 5J6XA 3E5QA 5HDKA 2Q2EB 4M6VA 2KFDA 4B3XA 4ZDPA 1FY7A 4PK4A 2M9HA 3E6DA 2BXZA 1ZLJA 1QVTA 2XRNA 1O57A 1UZCA 1FSEA 2ZJ2A 4E7HA 3I5UA 3J81K 3JRIA 1I1GA 3BLYA 1HDDC 4B47A 1DQUA 1N75A 5DCMA 4EJTA 2DXIA 2R5YA 3OL4A 1VQOI 1DDNA 2V6CA 4IHVA 2M34A 3KP6A 1ZR2A 2V4JC 3HHGA 4JBAA 2PX9A 1IN5A 3E5XA 2CV1A 5B66C 1LEBA 4G6DA 5B5EC 4M6YA 1USSA 3JTHA 2QWWA 2VJJA 2VKVA 4B3AA 2OF7A 4V19K 2FX0A 3VFZA 2IPQX 4F3QA 3J7YJ 1MH3A 1GV2A 2VT3A 1YRNA 2HEOA 2EA2A 4B48A 4JX5A 1SFKA 1UAAA 1SC7A 3REOA 5EGOB 2ZNZA 1ZGWA 2RC4A 3L2VA 3MZYA 2QBYA 2L4AA 4JX6A 3PFIA 4A3JJ 4BQAA 3S2WA 2XGDA 1TNSA 2HWVA 5EF6A 3OYMA 4UV9A 3RKQA 2QA4I 1FZPB 3C1DA 5HNHA 9ANTA 2ZXWH 3QP6A 2O6GE 3S17J 1BR1A 4CHUA 3HGGA 3GTPJ 3LSGA 1U5TC 3AFHA 4GGGA 2O8KA 1UELB 3CZ6A 3K4JA 1ZTRA 3SZPA 2XAQA 1XB4A 4HYEA 1R1UA 2BXYA 2JQ7A 4XN0A 2LBFB 2CH0A 4KUMA 1V55H 1TBXA 3QAHA 1X1DA 1LFBA 4XLPF 4BS9A 3DV8A 4NC8A 4KA4A 4EJOA 1MNDA 3L9FA 5J1YA 3DXJF 1MSEC 4ON0A 2HKOA 3CCMI 2VXDA 2F4OB 2E2IJ 3L09A 4KFCA 2EFWA 3PSIA 4I09A 2DOEA 3DEEA 3DPLC 1VQ8I 4XQFA 2XASA 4YELA 1VQ4I 2BVLA 5BS6A 2DW4A 2Y48A 1O3SA 3E6MA 3LAJA 1BW6A 4M74A 3BTJA 3JR9A 4XKBA 4RAZA 3TL4X 2JA8J 3DU5A 1DU6A 2GLOA 1KA8A 2FUG2 1S7AA 1AWCA 4LMYA 4XKCA 1PUFB 3IWZA 5FKKA 5FRMA 3GO5A 1UG0A 3HOXJ 4YFKF 5F6FA 1Y56A 2CQNA 2VOPA 1A04A 1T6SA 1ZAOA 4IL6C 2DBBA 3H9JA 4FHTA 3RKXA 3WTTC 2B9SA 5DM7F 1D8KA 2R3SA 2NOJB 3OR1C 2FNPA 3JAMZ 2K9QA 3A03A 3KCCA 1T0FA 2ZNYA 2HZTA 3TDZC 1T8IA 4U0WA 2CQ7A 3F8MA 3ZMVA 1ZG1A 3H1CA 1IXSB 4L5EA 1OISA 1V3FA 4LIUA 3J7AY 2EWNA 1LB2A 2QF7A 4XKWA 2R5ZA 2K9NA 3CP2A 2R7UA 1YLFA 4I76A 3BTCA 3RPQA 3WTZA 1Y8RB 2CQQA 4A3CJ 2JK3A 3ZN0A 2ZKZA 1GHCA 1R4NB 3OYFA 2FBKA 2F5FA 3OL3A 3SQNA 3JTGA 3UR3C 1V4RA 4AU7A 1CQTA 1R1VA 3F21A 1RKTA 1AKHB 3HRTA 2JUGA 2R0QC 3OIQA 2LR8A 4HV6A 1O7LA 2JN6A 3OYCA 3QWLA 2Z2SB 4B44A 2E1OA 3WTYC 1PDNC 1OPCA 3TQNA 4S0HB 1SVOA 5D4SA 4DQ2A 2RAEA 1QU3A 3DBRB 5BOXA 2ELHA 1FEXA 3Q3SA 2E1MB 4CCNA 2HQRA 3GEZA 1FOKA 1RR7A 4BACA 2LK2A 2COBA 1EH7A 4PGHA 1HXDA 1R9TJ 5BPIA 2H09A 1X58A 2BBYA 2W24A 4LGWA 1L0OC 2E34A 2EILH 3W6VA 5LGUA 5LHHA 1OJLA 5L3EA 4HF2A 1RPWA 3OY9A 4A3KJ 3A0BC 3AG1H 3RQIA 2V9VA 3Q0VA 1D8JA 3DPTA 3FK7A 2B63J 2QLZA 2L3DA 3WHCA 1YJ9I 2YSRA 4DJAA 3QP5A 3O2PE 3Q5FA 4HQEA 4FISA 4O6JA 4BQNA 2MC4A 1TQIA 2DLLA 3C7JA 2L2OA 3S1MJ 4LG0B 2R7FA 1REPC 4EM1A 3H92A 2K27A 4AYBN 5CJ9A 2IS6A 3H5AA 4XOPA 4HBLA 1QBJA 2DPDA 3HRSA 4KIBA 4HX8A 1RZ4A 1F43A 4EMSA 3LSRA 3DTEA 1NH3A 1PYVA 1ETOA 3CUQC 2JRMA 2X85A 4O3MA 2DCEA 3K4BA 3GFIA 3KZYA 3MKZA 3DEWA 5K7FA 2V6EA 2OUMA 2EK5A 3W2VA 3LSKA 2DOAA 3VYRB 1WHUA 2Y0MA 3S3OA 4WXCA 4HNTA 2PMHA 4EJUA 1YI2I 5AIQA 1Z21A 1RETA 4F52A 3I4NJ 1X3WB 3ABKH 2IJLA 3NRVA 4J01A 3P9KA 2RNGA 3VYSB 1DP7P 3U2RA 3ROUA 1O4XA 4BYYA 1K79A 2OV7A 4R79A 3OYHA 1KONA 4CICA 2GA1A 3NWSA 4PJMA 2PJPA 1TLHB 1W5CC 2LBFA 3HSRA 1IUYA 3FM5A 4XRFA 3VOEA 2VIXA 1SD6A 2HGCA 2KHMA 2AHQA 4JP0A 1JUMA 4A3EJ 4EJVA 4BE2A 3IRQA 5GAGJ 2R7WA 5L3GA 4U7BA 3DEUA 1S5LC 2E7XA 5FD6A 1YJWI 1Z05A 2M7AA 4EVIA 3J7AO 1OR7C 4BJ6C 1MBHA 1A5JA 3IH4A 3JRBA 3I53A 2DFHA 3RI4A 2MFZA 4A5MA 2KJCA 1XSDA 1WJ5A 1GXPA 3LA2A 3WTUC 4CCLA 3R4KA 2CMPA 5IT9K 4RM2A 3L2WA 3F23A 2A3SA 2KKOA 1WRJA 4Q4ZF 1T2KA 4PSWA 3HOUJ 5J4YA 1IJWC 3BOQA 1Z0XA 5IYCJ 3B6CA 2M45A 3QYFA 3OYNA 1BI2A 2EZLA 1FBQA 1TW2A 4ZZDA 1YX3A 4I01A 1H9TA 5JLWA 4IOCF 2OCEA 3U1KA 2K5CA 2N8GA 1LQ1A 1VQKI 3S1QJ 2LNBA 4RMNA 4DBRA 1SVMA 2PQ8A 2HI3A 2DODA 1K6OA 2DT6A 3U21A 3ZN1A 3A01A 2CSOA 3L7WA 2GOXB 3AG4H 5EDNA 3WGHA 2O9LA 2D45A 1X1CA 1LDDA 1Z3YA 3MZ8A 2ME6A 3OMYA 4HA8A 3T1BA 3RIRA 5C4XJ 4BE0A 4OAYA 3UNGC 2H1KA 1BOAA 4OIOF 2B7EA 5DCFA 1R4MB 2VQCA 1IXRC 2K7LA 2Z9OA 2GOMA 4CYDA 2UXNA 3FHNA 3S16J 1ETQA 4AD9A 4XLCA 1J5YA 4W97A 5DUIA 1B72B 1HCRA 2F5EA 5ILUA 5FB2A 2BEOA 3H5NA 4BJ5C 1BC8C 4XRSG 4MNUA 3V7SA 4OINF 1K61A 1X1AA 3X2QH 3LNQA 2A5WA 2M1BA 1GUUA 4HRIA 4G9YA 4WF2A 4G7ZF 2CUZA 2DMQA 4D5CA 1T0FC 3H9QA 5LGNA 3WU2C 2GM4A 3HB9A 4IRIA 2Q2EA 4A69C 2EIMH 1OCRH 2LF8A 5M5YJ 3WG7H 1JE8A 4B8XA 1ZELA 4E7LA 4HNUA 3C2GA 2LMDA 2TCTA 1TT5B 1XMXA 3ZMTA 1LDKB 3G1MA 3OIOA 3S1RJ 3BR3A 4HSRA 3LMMA 3PJRA 1B9NA 2JWTA 4LB5A 3W6JB 3FMSA 5JI6A 3ZCOA 2HQNA 2STTA 4PJLA 1J2XA 2EV6A 3QPHA 3JSOA 3CCQI 4A3GJ 1DUXC 1BOBA 3ZQQA 5LEKA 2FSWA 3GBGA 1JUPA 3MWMA 2QQAA 4DYQA 3CCRI 1FOXA 5E18F 3K70C 2CWEA 2FF4A 5ILVA 3KE2A 1Z6RA 4BXFA 1HW5A 2YR2A 4S05A 3CO6C 5IP9J 1WPKA 1ODDA 2EV5A 2WADA 5DUKA 1I39A 5LRSA 5IT3A 3FKJA 3CCUI 1S9HA 2DI3A 3S1NJ 3O8HA 5TISC 4CCMA 2O3FA 1TWGJ 3T8RA 3BDDA 1RRJA 2NS7A 3HBLA 2ECBA 5KVRA 4A6DA 2DT7B 2K40A 3SEQA 2K86A 4M3FA 3HTSB 3K70D 1JT0A 4IHYA 1PUEE 4RGSA 2L7FP 3G1LA 1R7JA 4D9JA 3MVPA 2WA0A 1YG2A 2EFOA 2M8GX 1C0WA 2HNHA 5IP7J 1TWFJ 1D0ZA 4ENMA 5DEQA 3S2DJ 4BXXJ 1LPQA 3QPLA 3EUHC 2JT1A 2UV1A 1K4SA 3WHBA 3CP8A 2P5VA 1MGTA 1DU0A 3M4OJ 3O6BB 2R92J 2VL8A 1X1PA 2VXZA 2QKLB 1ACIA 2LOOA 3CDLA 4JYKA 2BHYA 1IO2A 1SFXA 4M72A 4I7HA 1B9MA 3E1SA 3HUGB
chains in the Genus database with same CATH topology
2JPBA 2QQ9A 4TV7A 2FBIA 1B6AA 4U7DA 2FMLA 3DQVC 4CGZA 3ZMZA 3E97A 1ZRDA 2BV6A 2MH9A 4UV8A 3CLOA 2JTVA 1OYYA 2XKOA 1Y0UA 1R5GA 3V8LA 1SFUA 4UHTA 2CO5A 3E5UA 5CVUA 3GLXA 1KQ8A 1CF7B 1ZRFA 2V1XA 2X0LA 1WSUA 1O3RA 1H9GA 1ON1A 3WU0A 2CG4A 3KP3A 3WGIA 2ZCWA 3BROA 1H0MA 3RKWA 3LWFA 1K7AA 5KK1A 1FYKA 1P4XA 3TOAA 4HZFA 1FYLA 1IN8A 3ML6A 2EFQA 3LA7A 1RIOH 1EH8A 2EFNA 3VODA 1RI7A 2XROA 2YPRA 3TO7A 4WX9A 2E1CA 5DCMB 3WTVC 1MD0A 2E7WA 4PZJA 2PEXA 3ZMDA 4ZZLA 1HW1A 1IF1A 4MQVA 2PFBA 1ON2A 4OMZA 3L00A 4UVBA 4U0VA 2GIVA 3IKVA 1MZBA 2NAZA 4BXUA 1WWXA 4HX7A 4NB5A 2QBYB 4Q5SF 3L2CA 4GYGA 4RAYA 2UZKA 4UUVA 5HDGA 3GZ5A 2P6SA 5D8KB 2FA5A 4ESBA 3Q9SA 1Z9CA 4EM0B 3HIFA 2DQLA 1UB9A 5EEHA 3JSPA 4DNCA 2RKHA 4MTDA 1YW7A 1ZHFA 2RN7A 3QRFF 1UHWA 5CLSA 2HKXA 1I5ZA 2PI0A 1XD7A 3LA3A 1XMKA 5H6QA 4EV0A 4WK8F 3BJ6A 2K4JA 1YTYA 2XAGA 3CUOA 1HSTA 3I58A 1U8RA 5HDNA 1USTA 2XUBA 1QO0D 4L18B 1YFHA 2IA1A 3K0LA 2RDPA 1E17A 4HLXA 2LF7A 3HRMA 1ZN2A 3MAJA 3IRRA 5DD8A 1GXQA 5FFXA 2P6TA 1XGSA 2IRFG 2ESHA 4EQQA 1SD5A 2H94A 2PMUA 3G73A 1TW3A 2A69F 3CTAA 2O0YA 1XCVA 1PP8F 4RGRA 4M9XA 2KRFA 1L3LA 1KU7A 5E8GA 2BYVE 3BY6A 4WXDA 2HOEA 4RGXA 2JRTA 2MBFA 1JHFA 2G7UA 5L3FA 3JAMK 3HSFA 1KYWA 4ZYGA 2VBZA 5K5OA 3K1MA 2QYOA 1RNLA 4D0PA 1ZGJA 2MC3A 4HDVA 4B09A 1R22A 5DDGA 2FNAA 5L3BA 2B0LA 3J81Z 1MKMA 1R1TA 2XAFA 3QPTA 1XGNA 1FLIA 2FXAA 3IWFA 2MH2A 2X4HA 3WODF 2EJRA 2EB7A 1IW7F 1QQIA 1FP2A 2XVCA 4I2OA 3TO9A 5L3CA 2IT0A 4R8HA 1IN4A 3I4PA 4IRHA 3V7CA 4G6QA 5D5WB 2F5DA 4FX0A 3HOTA 3HHHA 1ZYRF 1TQPA 1G4DA 5CYVA 4KYWA 4YIIA 1MJBA 4L0YB 3D5LA 5ICEA 2OQRA 3JW4A 5A2QK 2D1VA 2HDCA 2ETHA 4L9TA 3KLNA 2DO7A 2HYFA 4HLYA 4F7ZA 3U9GA 4IXAA 1XCBA 3BJOA 2OA4A 3R6SA 2L4MA 1HBXG 5HS7A 4OIPF 3I59B 4OU0A 1G3YA 2O61A 1YQAA 4LLNA 4RB0A 1BIBA 2RQPA 3NQOA 1YO5C 4BHBA 2DQRA 1S6LA 4LD5A 1ZLKA 3KZZA 1HKTA 2H6CA 3GFMA 5LHIA 2OQGA 1FPQA 1ZG5A 2J5OA 4Y13A 4N9IA 1G3SA 2W85A 4H0EA 4MHGA 3I54A 1JHHA 1Z6TA 4WXHA 1WKMA 4A5NA 1J0RA 1SMYF 2A6HF 2M30A 2VBXA 3GYHX 5AONA 2XAJA 5D5XB 3N4MA 5LHGA 4KDPA 3KP2A 3QU3A 2WC2A 1EV7A 2NNNA 4HV5A 3O3KA 1AOYA 1FWZA 1QPMA 3ELKA 3LAPA 5CVJA 4HW0A 2P5LC 3VEPA 3E6CC 1SD4A 1MDMB 4UXNA 2PBIA 2ZMEB 3EQLF 4NQWA 3V4GA 1QNTA 1ZG3A 2UWMA 3R0JA 2K02A 2JZYA 5DYMA 1WQ2A 3WG9A 2ZO4A 2PG4A 2DK8A 5JVTA 2HTJA 1D5VA 5F64A 4AWXB 2OAZA 1O3TA 1FSHA 5E1XA 1F5TA 3HTUA 4M71A 4BAYA 1ZGAA 3ULQB 4M73A 3RYRA 3TDUC 1Z1DA 2R7DA 3GZ6A 3EUHA 2NNYA 4YFNF 4K2EA 2OD5A 4NHJA 2Z99A 5HVQC 2GXBA 2ACJA 3RKYA 3FXRA 5FFZA 4G7HF 1LNWA 3RYPA 2A61A 5L3DA 5HLGA 3H3ZA 5LEJA 1BM9A 3E6BA 1IN7A 3RJPA 1STZA 2FE3A 5LLQA 3DF8A 4WWCA 2NYXA 3ECOA 2DAOA 5ED4A 2PN6A 3FZVA 1IRFA 1K78A 2VOOA 3KP4A 2VBWA 1QZYA 5LRRA 1LEAA 3KP7A 4M9ZA 1ULYA 5CVVA 4I02A 2Q8KA 4XSZF 1TQMA 2RGVA 1Q1HA 4IJAA 3WE2A 3MQ0A 3R0AA 4L5JA 4LJZF 2Z3YA 4QWQA 4S04A 3F8CA 3I71A 1OYIA 4XSXF 2XGXA 4ENNA 1HSJA 2HFHA 4AIHA 3ECHA 4PDKA 5FLXK 1CF7A 3WTSC 1IN6A 1I27A 3CO7C 1JGSA 4MQ9F 4OIRF 4RGUA 2A68F 1FYMA 3TO6A 4A0YA 1FC3A 2XKPA 2KJBA 4PCQA 3ZMUA 4RB3C 4LFUA 3GXOA 3BJAA 1FBSA 1O3QA 4AIKA 3RPUA 3V8KA 4YIFA 3M1EA 2ZBKA 4HF0A 1SAXA 4KNYA 3WU1B 2O8XA 4P9FA 1BN5A 4IPAA 3BPXA 2GAUA 4RS8A 5HLIA 2VONA 3WGGA 1YW9A 2FBHA 3GW2A 1HKSA 3LSTA 2COMA 3OV8A 3FXUA 3R60A 1NHAA 4FT8A 3I0TA 3VB2A 3FM3A 4KN4X 3K9TA 2L01A 1ZARA 5J8FA 3E3VA 5F1RA 1FBUA 1HW2A 1QZZA 5CVIA 5E8IA 2GWRA 3M8EA 4JK1X 2FRHA 2OBPA 1T38A 2QZ8A 2TDXA 4ESFA 2KIFA 1U3EM 2W57A 4P5OA 4MEXF 3FMQA 4L5IA 3K69A 3SZTA 5FGMA 3CUQA 4CO8A 1Z7UA 3T8TA 2VODA 1HKQA 5K1YA 1O7FA 3FHZA 4IVNA 1XGMA 3MZHA 4LB6B 3HUGA 2GQQA 4G7OF 3F8FA 4M9SA 5TRDA 2M5WA 4KT5C 3P9IA 3F8BA 2E1NA 4P96A 2IA2A 1W4MA 2D2WA 1K78B 4GXOA 5JHUA 2JSCA 3DP7A 2FEZA 2FQ3A 4U88A 1KYZA 2DPUA 3ERED 4CDGA 3I64A 2W84A 5D6FA 2P7CB 5BQTA 2CFXA 2G7HA 1P4AA 1UHMA 4O5VA 4ENKA 3ZPLA 2VE9A 4ZYEA 1BC7C 3K2ZA 1B4AA 1EH6A 4MGRA 4IRGA 3KEOA 5ICCA 5LBQA 4OMYA 1PP7U 1B59A 2ZXJA 5DV5A 3N97A 3RTRA 2A5YB 3F3XA 1XGOA 2RNJA 1KQ9A 2YX4A 2NS0A 5DD4A 1FT9A 2VC0A 5AIPA 1ZH5A 5ILSA 3IHUA 3D0SA 2M8EA 4JQFA 2OU2A 1T98A 3NEUA 1J75A 3ZMSA 2ZMEA 1U5TB 4M6XA 5ICFA 3GVAA 3P9CA 1KU2A 5FD5A 3BPVA 1B1BA 3TKYA 2QQBA 5E1ZB 3QOPA 2J5PA 2HTSA 2UXXA 2G9WA 1CGPA 3TOBA 3HOSA 4QLCU 2AXLA 5CVRA 3B02A 2GZWA 1OYWA 5BPDA 2K4BA 1GVJA 2V79A 4LG0A 3T5XA 1I6XA 2CGPA 4WCGA 2IVMA 3GX4X 2H6BA 4I98B 2MLKA 2YX7A 2EA4A 1XDSA 2Y75A 3GFJA 3CDHA 2IP2A 2M87A 1SD7A 2LSOA 4GYIA 1W7PD 5J8CA 5D6EA 4BHCA 3F6VA 3COAC 2JPCA 5HLHA 3KEQA 5LGTA 3GFLA 2ESNA 2HR3A 1OMIA 2L02A 3KETA 3WTXC 3ZQ7A 1X3UA 3ZP5A 1HQCA 2VC1A 5E20A 5FLXZ 3LQRA 3ABTA 3P7NA 3J80Z 2WV0A 1R23A 2A6EF 3HRUA 2KIUA 1KGSA 2QENA 4GCVA 3MEXA 1Z91A 1IXCA 1J59A 1IZ1A 2MA3A 2XHKA 4YFXF 4R1HA 3ISPA 4HAMA 2DFIA 4IF4A 4BHPA 5D8LB 1BBYA 3QU6A 1S8NA 2CYYA 3BWGA 4E70A 4EJWA 1FNNA 2RVCA 1JXSA 5K5QA 3F72A 2BE5F 3V7RA 3DFGA 4A6EA 4G94A 4Q48A 4IHSA 2VE8A 2Q0OA 4LK0F 2QVOA 5HOOA 2F5CA 2STWA 3C3WA 6PAXA 3FX3A 3BP8A 1FP1D 1U6GA 4MTEA 1BI1A 1VTNC 1YS7A 4KIGA 3GF2A 1G6NA 1BIAA 2GA2A 1XN7A 2CQKA 1MJAA 3KP5A 1KQ0A 2WTEA 1FX7A 1XSXA 5TJJA 1W5SA 2P5KA 3LQQA 4ETSA 2L54A 2C6YA 1RUOA 3EETA 5IT9Z 1ZRCA 3SFZA 4RB1A 3SHFA 3M8FA 2F2EA 4Q47A 1XDUA 1TTYA 3EDPA 4KN7X 3RDIA 2HYGD 4A12A 4OOIA 2DK5A 3MFKA 4KMUX 1SMTA 5ERIA 1BI3A 1QGPA 4HOBA 5H20A 2WWYA 2EFPA 2IW5A 2V1DA 1G3WA 2ISYA 1XSVA 2PLYA 3CUQB 4ZH4F 1W7PA 4FX4A 3I59A 1S29A 4U0YA 3PQKA 2O03A 4XBFA 2RV8A 4AIJA 1KU3A 5E1WA 1P92A 2MLGA 1IAWA 1YIOA 3WE3A 1WI9A 4KICA 2HS5A 2CW0F 4L0ZB 1R5HA 3IC7A 1XMAA 2DTRA 2V1UA 1R36A 1F4KA 4I0AA 3T0YA 5JR3A 1I1SA 2DU9A 3BZ6A 4AVPA 2ZFWA 3M7GA 2Z33A 3FMRA 2W25A 4GO1A 2VT2A 3U1DA 2EV0A 4HQMA 4G8XA 1LVAA 4IHTA 5D5VB 4KIFA 5D5UB 1E2XA 2P8TA 5H6RA 1J9IA 5FO5A 3K1PA 1SFEA 2NRAC 1OKRA 1R58A 5JFRA 1UFMA 2IA0A 1MDMA 3MCZA 3GWZA 4P55A 4XLNF 3WTWC 1DPUA 1F9NA 1RUNA 1G3TA 2LDUA 3IL2A 3F6OA 2FU4A 5E17F 4ENJA 3R61A 4A2UA 1D3YA 4HX4A 3GUDA 4P9UA 2OZ6A 1U2WA 4HDUA 4LK1F 4ESJA 4CZZA 4UNOA 1U5TA 2P7VB 3SXYA 3AAFA 3CJNA 3Q9VA 2VN2A 4L9JA 3F22A 4ZYDA 4BNCA 4RB2C 3PQJA 1OR7A 3FF5A 3LFKA 3KFWX 3G3ZA 3M9AA 1S3JA 2FMYA 5A2QZ 2ISZA 2MD5A 1YW8A 2KIMA 5BMZA 1KU9A 2VBYA 2OZUA 5EEGA 4A0XA 4A0ZA 3EYYA 2LKPA 4N9HA 3OOPA 3J80K 2A07F 4I0BA 4LLLA 2P4WA 2DT5A 5HS9A 1P6RA 3V8JA 1ONVA 1P4WA 1TNTA 3HSEA 2ADUA 4EGZA 1W7PB 1YS6A 1ZREA 4EM2A 3K1NA 1LDJA 2H27A 3W6KB 3KLOA 1F1ZA 2BGCA 4YG2F 1BJAA 5K5RA 5HS8A 1DPRA 5ICGA 3FWEA 4ZYHA 1IRGA 4HF1A 4Y17A 4UVCA 2QM3A 3C18A 4ASNA 4KMFA 4L9VA 1T39A 3B73A 2XAHA 1UCRA 3F8NA 3H3UA 2D1HA 4OIQF 2GXGA 4PGGA 3FXQA 4UVAA 1BI0A 4BH9A 1S7OA 1LJ9A 1YYVA 4EGYA 4CXFA 3HYIA 4Z2YA 4N0BA 1P2FA 1R00A 1U78A 2YU3A 4L9NA 3IKTA 2AS5F 2QUFA 1MJ9A 2XIGA 1J7KA 3ABUA 5D4RA 3EYIA 2Z5UA 4Y15A 4MEYF 2XV4S 3TGNA 3DKWA 1W5TA 2FOKA 5J6XA 3E5QA 5HDKA 1FY7A 3E6DA 1ZLJA 2XRNA 1O57A 1FSEA 2ZJ2A 3I5UA 3J81K 1I1GA 5DCMA 4EJTA 1DDNA 2V6CA 3KP6A 3HHGA 4JBAA 1IN5A 3E5XA 1LEBA 4G6DA 4M6YA 1USSA 3JTHA 2QWWA 3VFZA 2IPQX 2HEOA 2VT3A 2EA2A 3REOA 2ZNZA 2RC4A 3MZYA 2QBYA 2L4AA 3PFIA 4BQAA 3S2WA 1TNSA 2HWVA 4UV9A 1FZPB 3C1DA 3QP6A 2O6GE 4CHUA 1U5TC 4GGGA 3SZPA 2XAQA 1XB4A 4HYEA 1R1UA 4KUMA 1TBXA 3QAHA 4XLPF 3DV8A 4KA4A 4EJOA 3L9FA 3DXJF 4ON0A 2HKOA 4KFCA 3L09A 2EFWA 4I09A 3DPLC 2XASA 5BS6A 2DW4A 2Y48A 1O3SA 3E6MA 3LAJA 4M74A 4RAZA 1KA8A 1S7AA 1AWCA 4LMYA 3IWZA 3GO5A 4YFKF 5F6FA 2VOPA 1A04A 1T6SA 1ZAOA 2DBBA 3WTTC 4FHTA 3RKXA 1D8KA 2R3SA 2FNPA 3JAMZ 3KCCA 1T0FA 2ZNYA 2HZTA 3TDZC 4U0WA 3ZMVA 3F8MA 1ZG1A 1IXSB 1V3FA 2EWNA 1LB2A 1YLFA 3RPQA 3WTZA 3ZN0A 2ZKZA 1GHCA 2FBKA 2F5FA 3SQNA 3JTGA 1V4RA 1R1VA 3F21A 3HRTA 4HV6A 1O7LA 3WTYC 1PDNC 1OPCA 3TQNA 5D4SA 4DQ2A 5BOXA 2ELHA 2HQRA 3GEZA 1FOKA 4PGHA 1EH7A 1HXDA 5BPIA 2H09A 2BBYA 2W24A 4LGWA 1L0OC 5LGUA 5LHHA 5L3EA 4HF2A 2V9VA 1D8JA 3DPTA 2QLZA 2L3DA 2YSRA 3QP5A 3O2PE 3Q5FA 4HQEA 4O6JA 1TQIA 2DLLA 3C7JA 4LG0B 2R7FA 1REPC 4EM1A 3H92A 2K27A 5CJ9A 2DPDA 4HBLA 1QBJA 3HRSA 4KIBA 4HX8A 1RZ4A 4EMSA 3CUQC 4O3MA 3GFIA 3KZYA 2EK5A 2Y0MA 4WXCA 2PMHA 4EJUA 5AIQA 2IJLA 3NRVA 3P9KA 1DP7P 3U2RA 3ROUA 4BYYA 1K79A 4R79A 4CICA 2GA1A 2PJPA 1TLHB 3HSRA 1IUYA 3FM5A 4XRFA 3VOEA 1SD6A 2HGCA 4EJVA 3IRQA 5L3GA 4U7BA 3DEUA 2E7XA 5FD6A 1Z05A 4EVIA 3J7AO 3I53A 3RI4A 4A5MA 2KJCA 1XSDA 1GXPA 3LA2A 3WTUC 3R4KA 5IT9K 3F23A 2A3SA 2KKOA 1WRJA 4Q4ZF 1T2KA 3BOQA 2M45A 1BI2A 1FBQA 4ZZDA 1TW2A 4I01A 1H9TA 1LQ1A 2LNBA 2PQ8A 1K6OA 3ZN1A 2CSOA 3L7WA 3WGHA 2D45A 1LDDA 4HA8A 3T1BA 3RIRA 1BOAA 4OIOF 5DCFA 1IXRC 2K7LA 2Z9OA 4CYDA 2UXNA 4AD9A 1J5YA 5DUIA 2F5EA 5ILUA 5FB2A 2BEOA 1BC8C 4MNUA 3V7SA 4OINF 2M1BA 4G9YA 4WF2A 4G7ZF 5LGNA 4IRIA 2Q2EA 2LF8A 1JE8A 4B8XA 3ZMTA 1LDKB 1B9NA 4LB5A 3W6JB 3FMSA 5JI6A 2HQNA 2STTA 3JSOA 1J2XA 2EV6A 3QPHA 1DUXC 5LEKA 2FSWA 3MWMA 2QQAA 5E18F 5ILVA 2CWEA 2FF4A 3KE2A 1Z6RA 1HW5A 2YR2A 4S05A 3CO6C 1ODDA 2EV5A 5DUKA 5LRSA 5IT3A 2DI3A 2O3FA 3T8RA 3BDDA 5KVRA 4A6DA 2K86A 3HTSB 1PUEE 4RGSA 1R7JA 1YG2A 2EFOA 1C0WA 4ENMA 5DEQA 2JT1A 2P5VA 1MGTA 3O6BB 2VXZA 1SFXA 4M72A 4I7HA 1B9MA 4LLGF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPB A;  2QQ9 A;  4TV7 A;  2FBI A;  1B6A A;  4U7D A;  2FML A;  3DQV C;  4CGZ A;  3ZMZ A;  3E97 A;  1ZRD A;  2BV6 A;  2MH9 A;  4UV8 A;  3CLO A;  2JTV A;  1OYY A;  2XKO A;  1Y0U A;  1R5G A;  3V8L A;  1SFU A;  4UHT A;  2CO5 A;  3E5U A;  5CVU A;  3GLX A;  1KQ8 A;  1CF7 B;  1ZRF A;  2V1X A;  2X0L A;  1WSU A;  1O3R A;  1H9G A;  1ON1 A;  3WU0 A;  2CG4 A;  3KP3 A;  3WGI A;  2ZCW A;  3BRO A;  1H0M A;  3RKW A;  3LWF A;  1K7A A;  5KK1 A;  1FYK A;  1P4X A;  3TOA A;  4HZF A;  1FYL A;  1IN8 A;  3ML6 A;  2EFQ A;  3LA7 A;  1RIO H;  1EH8 A;  2EFN A;  3VOD A;  1RI7 A;  2XRO A;  2YPR A;  3TO7 A;  4WX9 A;  2E1C A;  5DCM B;  3WTV C;  1MD0 A;  2E7W A;  4PZJ A;  2PEX A;  3ZMD A;  4ZZL A;  1HW1 A;  1IF1 A;  4MQV A;  2PFB A;  1ON2 A;  4OMZ A;  3L00 A;  4UVB A;  4U0V A;  2GIV A;  3IKV A;  1MZB A;  2NAZ A;  4BXU A;  1WWX A;  4HX7 A;  4NB5 A;  2QBY B;  4Q5S F;  3L2C A;  4GYG A;  4RAY A;  2UZK A;  4UUV A;  5HDG A;  3GZ5 A;  2P6S A;  5D8K B;  2FA5 A;  4ESB A;  3Q9S A;  1Z9C A;  4EM0 B;  3HIF A;  2DQL A;  1UB9 A;  5EEH A;  3JSP A;  4DNC A;  2RKH A;  4MTD A;  1YW7 A;  1ZHF A;  2RN7 A;  3QRF F;  1UHW A;  5CLS A;  2HKX A;  1I5Z A;  2PI0 A;  1XD7 A;  3LA3 A;  1XMK A;  5H6Q A;  4EV0 A;  4WK8 F;  3BJ6 A;  2K4J A;  1YTY A;  2XAG A;  3CUO A;  1HST A;  3I58 A;  1U8R A;  5HDN A;  1UST A;  2XUB A;  1QO0 D;  4L18 B;  1YFH A;  2IA1 A;  3K0L A;  2RDP A;  1E17 A;  4HLX A;  2LF7 A;  3HRM A;  1ZN2 A;  3MAJ A;  3IRR A;  5DD8 A;  1GXQ A;  5FFX A;  2P6T A;  1XGS A;  2IRF G;  2ESH A;  4EQQ A;  1SD5 A;  2H94 A;  2PMU A;  3G73 A;  1TW3 A;  2A69 F;  3CTA A;  2O0Y A;  1XCV A;  1PP8 F;  4RGR A;  4M9X A;  2KRF A;  1L3L A;  1KU7 A;  5E8G A;  2BYV E;  3BY6 A;  4WXD A;  2HOE A;  4RGX A;  2JRT A;  2MBF A;  1JHF A;  2G7U A;  5L3F A;  3JAM K;  3HSF A;  1KYW A;  4ZYG A;  2VBZ A;  5K5O A;  3K1M A;  2QYO A;  1RNL A;  4D0P A;  1ZGJ A;  2MC3 A;  4HDV A;  4B09 A;  1R22 A;  5DDG A;  2FNA A;  5L3B A;  2B0L A;  3J81 Z;  1MKM A;  1R1T A;  2XAF A;  3QPT A;  1XGN A;  1FLI A;  2FXA A;  3IWF A;  2MH2 A;  2X4H A;  3WOD F;  2EJR A;  2EB7 A;  1IW7 F;  1QQI A;  1FP2 A;  2XVC A;  4I2O A;  3TO9 A;  5L3C A;  2IT0 A;  4R8H A;  1IN4 A;  3I4P A;  4IRH A;  3V7C A;  4G6Q A;  5D5W B;  2F5D A;  4FX0 A;  3HOT A;  3HHH A;  1ZYR F;  1TQP A;  1G4D A;  5CYV A;  4KYW A;  4YII A;  1MJB A;  4L0Y B;  3D5L A;  5ICE A;  2OQR A;  3JW4 A;  5A2Q K;  2D1V A;  2HDC A;  2ETH A;  4L9T A;  3KLN A;  2DO7 A;  2HYF A;  4HLY A;  4F7Z A;  3U9G A;  4IXA A;  1XCB A;  3BJO A;  2OA4 A;  3R6S A;  2L4M A;  1HBX G;  5HS7 A;  4OIP F;  3I59 B;  4OU0 A;  1G3Y A;  2O61 A;  1YQA A;  4LLN A;  4RB0 A;  1BIB A;  2RQP A;  3NQO A;  1YO5 C;  4BHB A;  2DQR A;  1S6L A;  4LD5 A;  1ZLK A;  3KZZ A;  1HKT A;  2H6C A;  3GFM A;  5LHI A;  2OQG A;  1FPQ A;  1ZG5 A;  2J5O A;  4Y13 A;  4N9I A;  1G3S A;  2W85 A;  4H0E A;  4MHG A;  3I54 A;  1JHH A;  1Z6T A;  4WXH A;  1WKM A;  4A5N A;  1J0R A;  1SMY F;  2A6H F;  2M30 A;  2VBX A;  3GYH X;  5AON A;  2XAJ A;  5D5X B;  3N4M A;  5LHG A;  4KDP A;  3KP2 A;  3QU3 A;  2WC2 A;  1EV7 A;  2NNN A;  4HV5 A;  3O3K A;  1AOY A;  1FWZ A;  1QPM A;  3ELK A;  3LAP A;  5CVJ A;  4HW0 A;  2P5L C;  3VEP A;  3E6C C;  1SD4 A;  1MDM B;  4UXN A;  2PBI A;  2ZME B;  3EQL F;  4NQW A;  3V4G A;  1QNT A;  1ZG3 A;  2UWM A;  3R0J A;  2K02 A;  2JZY A;  5DYM A;  1WQ2 A;  3WG9 A;  2ZO4 A;  2PG4 A;  2DK8 A;  5JVT A;  2HTJ A;  1D5V A;  5F64 A;  4AWX B;  2OAZ A;  1O3T A;  1FSH A;  5E1X A;  1F5T A;  3HTU A;  4M71 A;  4BAY A;  1ZGA A;  3ULQ B;  4M73 A;  3RYR A;  3TDU C;  1Z1D A;  2R7D A;  3GZ6 A;  3EUH A;  2NNY A;  4YFN F;  4K2E A;  2OD5 A;  4NHJ A;  2Z99 A;  5HVQ C;  2GXB A;  2ACJ A;  3RKY A;  3FXR A;  5FFZ A;  4G7H F;  1LNW A;  3RYP A;  2A61 A;  5L3D A;  5HLG A;  3H3Z A;  5LEJ A;  1BM9 A;  3E6B A;  1IN7 A;  3RJP A;  1STZ A;  2FE3 A;  5LLQ A;  3DF8 A;  4WWC A;  2NYX A;  3ECO A;  2DAO A;  5ED4 A;  2PN6 A;  3FZV A;  1IRF A;  1K78 A;  2VOO A;  3KP4 A;  2VBW A;  1QZY A;  5LRR A;  1LEA A;  3KP7 A;  4M9Z A;  1ULY A;  5CVV A;  4I02 A;  2Q8K A;  4XSZ F;  1TQM A;  2RGV A;  1Q1H A;  4IJA A;  3WE2 A;  3MQ0 A;  3R0A A;  4L5J A;  4LJZ F;  2Z3Y A;  4QWQ A;  4S04 A;  3F8C A;  3I71 A;  1OYI A;  4XSX F;  2XGX A;  4ENN A;  1HSJ A;  2HFH A;  4AIH A;  3ECH A;  4PDK A;  5FLX K;  1CF7 A;  3WTS C;  1IN6 A;  1I27 A;  3CO7 C;  1JGS A;  4MQ9 F;  4OIR F;  4RGU A;  2A68 F;  1FYM A;  3TO6 A;  4A0Y A;  1FC3 A;  2XKP A;  2KJB A;  4PCQ A;  3ZMU A;  4RB3 C;  4LFU A;  3GXO A;  3BJA A;  1FBS A;  1O3Q A;  4AIK A;  3RPU A;  3V8K A;  4YIF A;  3M1E A;  2ZBK A;  4HF0 A;  1SAX A;  4KNY A;  3WU1 B;  2O8X A;  4P9F A;  1BN5 A;  4IPA A;  3BPX A;  2GAU A;  4RS8 A;  5HLI A;  2VON A;  3WGG A;  1YW9 A;  2FBH A;  3GW2 A;  1HKS A;  3LST A;  2COM A;  3OV8 A;  3FXU A;  3R60 A;  1NHA A;  4FT8 A;  3I0T A;  3VB2 A;  3FM3 A;  4KN4 X;  3K9T A;  2L01 A;  1ZAR A;  5J8F A;  3E3V A;  5F1R A;  1FBU A;  1HW2 A;  1QZZ A;  5CVI A;  5E8I A;  2GWR A;  3M8E A;  4JK1 X;  2FRH A;  2OBP A;  1T38 A;  2QZ8 A;  2TDX A;  4ESF A;  2KIF A;  1U3E M;  2W57 A;  4P5O A;  4MEX F;  3FMQ A;  4L5I A;  3K69 A;  3SZT A;  5FGM A;  3CUQ A;  4CO8 A;  1Z7U A;  3T8T A;  2VOD A;  1HKQ A;  5K1Y A;  1O7F A;  3FHZ A;  4IVN A;  1XGM A;  3MZH A;  4LB6 B;  3HUG A;  2GQQ A;  4G7O F;  3F8F A;  4M9S A;  5TRD A;  2M5W A;  4KT5 C;  3P9I A;  3F8B A;  2E1N A;  4P96 A;  2IA2 A;  1W4M A;  2D2W A;  1K78 B;  4GXO A;  5JHU A;  2JSC A;  3DP7 A;  2FEZ A;  2FQ3 A;  4U88 A;  1KYZ A;  2DPU A;  3ERE D;  4CDG A;  3I64 A;  2W84 A;  5D6F A;  2P7C B;  5BQT A;  2CFX A;  2G7H A;  1P4A A;  1UHM A;  4O5V A;  4ENK A;  3ZPL A;  2VE9 A;  4ZYE A;  1BC7 C;  3K2Z A;  1B4A A;  1EH6 A;  4MGR A;  4IRG A;  3KEO A;  5ICC A;  5LBQ A;  4OMY A;  1PP7 U;  1B59 A;  2ZXJ A;  5DV5 A;  3N97 A;  3RTR A;  2A5Y B;  3F3X A;  1XGO A;  2RNJ A;  1KQ9 A;  2YX4 A;  2NS0 A;  5DD4 A;  1FT9 A;  2VC0 A;  5AIP A;  1ZH5 A;  5ILS A;  3IHU A;  3D0S A;  2M8E A;  4JQF A;  2OU2 A;  1T98 A;  3NEU A;  1J75 A;  3ZMS A;  2ZME A;  1U5T B;  4M6X A;  5ICF A;  3GVA A;  3P9C A;  1KU2 A;  5FD5 A;  3BPV A;  1B1B A;  3TKY A;  2QQB A;  5E1Z B;  3QOP A;  2J5P A;  2HTS A;  2UXX A;  2G9W A;  1CGP A;  3TOB A;  3HOS A;  4QLC U;  2AXL A;  5CVR A;  3B02 A;  2GZW A;  1OYW A;  5BPD A;  2K4B A;  1GVJ A;  2V79 A;  4LG0 A;  3T5X A;  1I6X A;  2CGP A;  4WCG A;  2IVM A;  3GX4 X;  2H6B A;  4I98 B;  2MLK A;  2YX7 A;  2EA4 A;  1XDS A;  2Y75 A;  3GFJ A;  3CDH A;  2IP2 A;  2M87 A;  1SD7 A;  2LSO A;  4GYI A;  1W7P D;  5J8C A;  5D6E A;  4BHC A;  3F6V A;  3COA C;  2JPC A;  5HLH A;  3KEQ A;  5LGT A;  3GFL A;  2ESN A;  2HR3 A;  1OMI A;  2L02 A;  3KET A;  3WTX C;  3ZQ7 A;  1X3U A;  3ZP5 A;  1HQC A;  2VC1 A;  5E20 A;  5FLX Z;  3LQR A;  3ABT A;  3P7N A;  3J80 Z;  2WV0 A;  1R23 A;  2A6E F;  3HRU A;  2KIU A;  1KGS A;  2QEN A;  4GCV A;  3MEX A;  1Z91 A;  1IXC A;  1J59 A;  1IZ1 A;  2MA3 A;  2XHK A;  4YFX F;  4R1H A;  3ISP A;  4HAM A;  2DFI A;  4IF4 A;  4BHP A;  5D8L B;  1BBY A;  3QU6 A;  1S8N A;  2CYY A;  3BWG A;  4E70 A;  4EJW A;  1FNN A;  2RVC A;  1JXS A;  5K5Q A;  3F72 A;  2BE5 F;  3V7R A;  3DFG A;  4A6E A;  4G94 A;  4Q48 A;  4IHS A;  2VE8 A;  2Q0O A;  4LK0 F;  2QVO A;  5HOO A;  2F5C A;  2STW A;  3C3W A;  6PAX A;  3FX3 A;  3BP8 A;  1FP1 D;  1U6G A;  4MTE A;  1BI1 A;  1VTN C;  1YS7 A;  4KIG A;  3GF2 A;  1G6N A;  1BIA A;  2GA2 A;  1XN7 A;  2CQK A;  1MJA A;  3KP5 A;  1KQ0 A;  2WTE A;  1FX7 A;  1XSX A;  5TJJ A;  1W5S A;  2P5K A;  3LQQ A;  4ETS A;  2L54 A;  2C6Y A;  1RUO A;  3EET A;  5IT9 Z;  1ZRC A;  3SFZ A;  4RB1 A;  3SHF A;  3M8F A;  2F2E A;  4Q47 A;  1XDU A;  1TTY A;  3EDP A;  4KN7 X;  3RDI A;  2HYG D;  4A12 A;  4OOI A;  2DK5 A;  3MFK A;  4KMU X;  1SMT A;  5ERI A;  1BI3 A;  1QGP A;  4HOB A;  5H20 A;  2WWY A;  2EFP A;  2IW5 A;  2V1D A;  1G3W A;  2ISY A;  1XSV A;  2PLY A;  3CUQ B;  4ZH4 F;  1W7P A;  4FX4 A;  3I59 A;  1S29 A;  4U0Y A;  3PQK A;  2O03 A;  4XBF A;  2RV8 A;  4AIJ A;  1KU3 A;  5E1W A;  1P92 A;  2MLG A;  1IAW A;  1YIO A;  3WE3 A;  1WI9 A;  4KIC A;  2HS5 A;  2CW0 F;  4L0Z B;  1R5H A;  3IC7 A;  1XMA A;  2DTR A;  2V1U A;  1R36 A;  1F4K A;  4I0A A;  3T0Y A;  5JR3 A;  1I1S A;  2DU9 A;  3BZ6 A;  4AVP A;  2ZFW A;  3M7G A;  2Z33 A;  3FMR A;  2W25 A;  4GO1 A;  2VT2 A;  3U1D A;  2EV0 A;  4HQM A;  4G8X A;  1LVA A;  4IHT A;  5D5V B;  4KIF A;  5D5U B;  1E2X A;  2P8T A;  5H6R A;  1J9I A;  5FO5 A;  3K1P A;  1SFE A;  2NRA C;  1OKR A;  1R58 A;  5JFR A;  1UFM A;  2IA0 A;  1MDM A;  3MCZ A;  3GWZ A;  4P55 A;  4XLN F;  3WTW C;  1DPU A;  1F9N A;  1RUN A;  1G3T A;  2LDU A;  3IL2 A;  3F6O A;  2FU4 A;  5E17 F;  4ENJ A;  3R61 A;  4A2U A;  1D3Y A;  4HX4 A;  3GUD A;  4P9U A;  2OZ6 A;  1U2W A;  4HDU A;  4LK1 F;  4ESJ A;  4CZZ A;  4UNO A;  1U5T A;  2P7V B;  3SXY A;  3AAF A;  3CJN A;  3Q9V A;  2VN2 A;  4L9J A;  3F22 A;  4ZYD A;  4BNC A;  4RB2 C;  3PQJ A;  1OR7 A;  3FF5 A;  3LFK A;  3KFW X;  3G3Z A;  3M9A A;  1S3J A;  2FMY A;  5A2Q Z;  2ISZ A;  2MD5 A;  1YW8 A;  2KIM A;  5BMZ A;  1KU9 A;  2VBY A;  2OZU A;  5EEG A;  4A0X A;  4A0Z A;  3EYY A;  2LKP A;  4N9H A;  3OOP A;  3J80 K;  2A07 F;  4I0B A;  4LLL A;  2P4W A;  2DT5 A;  5HS9 A;  1P6R A;  3V8J A;  1ONV A;  1P4W A;  1TNT A;  3HSE A;  2ADU A;  4EGZ A;  1W7P B;  1YS6 A;  1ZRE A;  4EM2 A;  3K1N A;  1LDJ A;  2H27 A;  3W6K B;  3KLO A;  1F1Z A;  2BGC A;  4YG2 F;  1BJA A;  5K5R A;  5HS8 A;  1DPR A;  5ICG A;  3FWE A;  4ZYH A;  1IRG A;  4HF1 A;  4Y17 A;  4UVC A;  2QM3 A;  3C18 A;  4ASN A;  4KMF A;  4L9V A;  1T39 A;  3B73 A;  2XAH A;  1UCR A;  3F8N A;  3H3U A;  2D1H A;  4OIQ F;  2GXG A;  4PGG A;  3FXQ A;  4UVA A;  1BI0 A;  4BH9 A;  1S7O A;  1LJ9 A;  1YYV A;  4EGY A;  4CXF A;  3HYI A;  4Z2Y A;  4N0B A;  1P2F A;  1R00 A;  1U78 A;  2YU3 A;  4L9N A;  3IKT A;  2AS5 F;  2QUF A;  1MJ9 A;  2XIG A;  1J7K A;  3ABU A;  5D4R A;  3EYI A;  2Z5U A;  4Y15 A;  4MEY F;  2XV4 S;  3TGN A;  3DKW A;  1W5T A;  2FOK A;  5J6X A;  3E5Q A;  5HDK A;  1FY7 A;  3E6D A;  1ZLJ A;  2XRN A;  1O57 A;  1FSE A;  2ZJ2 A;  3I5U A;  3J81 K;  1I1G A;  5DCM A;  4EJT A;  1DDN A;  2V6C A;  3KP6 A;  3HHG A;  4JBA A;  1IN5 A;  3E5X A;  1LEB A;  4G6D A;  4M6Y A;  1USS A;  3JTH A;  2QWW A;  3VFZ A;  2IPQ X;  2HEO A;  2VT3 A;  2EA2 A;  3REO A;  2ZNZ A;  2RC4 A;  3MZY A;  2QBY A;  2L4A A;  3PFI A;  4BQA A;  3S2W A;  1TNS A;  2HWV A;  4UV9 A;  1FZP B;  3C1D A;  3QP6 A;  2O6G E;  4CHU A;  1U5T C;  4GGG A;  3SZP A;  2XAQ A;  1XB4 A;  4HYE A;  1R1U A;  4KUM A;  1TBX A;  3QAH A;  4XLP F;  3DV8 A;  4KA4 A;  4EJO A;  3L9F A;  3DXJ F;  4ON0 A;  2HKO A;  4KFC A;  3L09 A;  2EFW A;  4I09 A;  3DPL C;  2XAS A;  5BS6 A;  2DW4 A;  2Y48 A;  1O3S A;  3E6M A;  3LAJ A;  4M74 A;  4RAZ A;  1KA8 A;  1S7A A;  1AWC A;  4LMY A;  3IWZ A;  3GO5 A;  4YFK F;  5F6F A;  2VOP A;  1A04 A;  1T6S A;  1ZAO A;  2DBB A;  3WTT C;  4FHT A;  3RKX A;  1D8K A;  2R3S A;  2FNP A;  3JAM Z;  3KCC A;  1T0F A;  2ZNY A;  2HZT A;  3TDZ C;  4U0W A;  3ZMV A;  3F8M A;  1ZG1 A;  1IXS B;  1V3F A;  2EWN A;  1LB2 A;  1YLF A;  3RPQ A;  3WTZ A;  3ZN0 A;  2ZKZ A;  1GHC A;  2FBK A;  2F5F A;  3SQN A;  3JTG A;  1V4R A;  1R1V A;  3F21 A;  3HRT A;  4HV6 A;  1O7L A;  3WTY C;  1PDN C;  1OPC A;  3TQN A;  5D4S A;  4DQ2 A;  5BOX A;  2ELH A;  2HQR A;  3GEZ A;  1FOK A;  4PGH A;  1EH7 A;  1HXD A;  5BPI A;  2H09 A;  2BBY A;  2W24 A;  4LGW A;  1L0O C;  5LGU A;  5LHH A;  5L3E A;  4HF2 A;  2V9V A;  1D8J A;  3DPT A;  2QLZ A;  2L3D A;  2YSR A;  3QP5 A;  3O2P E;  3Q5F A;  4HQE A;  4O6J A;  1TQI A;  2DLL A;  3C7J A;  4LG0 B;  2R7F A;  1REP C;  4EM1 A;  3H92 A;  2K27 A;  5CJ9 A;  2DPD A;  4HBL A;  1QBJ A;  3HRS A;  4KIB A;  4HX8 A;  1RZ4 A;  4EMS A;  3CUQ C;  4O3M A;  3GFI A;  3KZY A;  2EK5 A;  2Y0M A;  4WXC A;  2PMH A;  4EJU A;  5AIQ A;  2IJL A;  3NRV A;  3P9K A;  1DP7 P;  3U2R A;  3ROU A;  4BYY A;  1K79 A;  4R79 A;  4CIC A;  2GA1 A;  2PJP A;  1TLH B;  3HSR A;  1IUY A;  3FM5 A;  4XRF A;  3VOE A;  1SD6 A;  2HGC A;  4EJV A;  3IRQ A;  5L3G A;  4U7B A;  3DEU A;  2E7X A;  5FD6 A;  1Z05 A;  4EVI A;  3J7A O;  3I53 A;  3RI4 A;  4A5M A;  2KJC A;  1XSD A;  1GXP A;  3LA2 A;  3WTU C;  3R4K A;  5IT9 K;  3F23 A;  2A3S A;  2KKO A;  1WRJ A;  4Q4Z F;  1T2K A;  3BOQ A;  2M45 A;  1BI2 A;  1FBQ A;  4ZZD A;  1TW2 A;  4I01 A;  1H9T A;  1LQ1 A;  2LNB A;  2PQ8 A;  1K6O A;  3ZN1 A;  2CSO A;  3L7W A;  3WGH A;  2D45 A;  1LDD A;  4HA8 A;  3T1B A;  3RIR A;  1BOA A;  4OIO F;  5DCF A;  1IXR C;  2K7L A;  2Z9O A;  4CYD A;  2UXN A;  4AD9 A;  1J5Y A;  5DUI A;  2F5E A;  5ILU A;  5FB2 A;  2BEO A;  1BC8 C;  4MNU A;  3V7S A;  4OIN F;  2M1B A;  4G9Y A;  4WF2 A;  4G7Z F;  5LGN A;  4IRI A;  2Q2E A;  2LF8 A;  1JE8 A;  4B8X A;  3ZMT A;  1LDK B;  1B9N A;  4LB5 A;  3W6J B;  3FMS A;  5JI6 A;  2HQN A;  2STT A;  3JSO A;  1J2X A;  2EV6 A;  3QPH A;  1DUX C;  5LEK A;  2FSW A;  3MWM A;  2QQA A;  5E18 F;  5ILV A;  2CWE A;  2FF4 A;  3KE2 A;  1Z6R A;  1HW5 A;  2YR2 A;  4S05 A;  3CO6 C;  1ODD A;  2EV5 A;  5DUK A;  5LRS A;  5IT3 A;  2DI3 A;  2O3F A;  3T8R A;  3BDD A;  5KVR A;  4A6D A;  2K86 A;  3HTS B;  1PUE E;  4RGS A;  1R7J A;  1YG2 A;  2EFO A;  1C0W A;  4ENM A;  5DEQ A;  2JT1 A;  2P5V A;  1MGT A;  3O6B B;  2VXZ A;  1SFX A;  4M72 A;  4I7H A;  1B9M A;  4LLG F; 
#chains in the Genus database with same CATH topology
 2JPB A;  4PJ0 C;  1Y1V J;  2QQ9 A;  4TV7 A;  3H9G A;  4Y52 J;  2FBI A;  1B6A A;  4U7D A;  2LTP A;  2FML A;  4Z6Y A;  3DQV C;  4CGZ A;  3ZMZ A;  3DTI A;  3E97 A;  1ZRD A;  1OQY A;  2BV6 A;  2MH9 A;  4UV8 A;  3CLO A;  2JTV A;  1OYY A;  2XKO A;  3E0J B;  1Y0U A;  1R5G A;  2V9P A;  3V8L A;  5KAF C;  1SFU A;  1U9O A;  2X6X A;  4UHT A;  2CO5 A;  4XM3 A;  5K7H A;  3E5U A;  2LY1 A;  5CVU A;  3KYC B;  3GLX A;  3GTL J;  2JJ7 A;  1KQ8 A;  4OAZ A;  3N05 A;  2DYS H;  1CF7 B;  1ZRF A;  2V1X A;  4ZYA A;  4AVZ A;  3MKL A;  3JRF A;  2W7N A;  2I5U A;  3EUA A;  5B3S H;  2X0L A;  1WSU A;  2LRD A;  2Q1Z B;  2ZXI A;  1O3R A;  4A3F J;  1H9G A;  1ON1 A;  2XAU A;  3K6G A;  3PUB A;  2JA6 J;  3WU0 A;  3M8J A;  2CG4 A;  3PUF A;  1BL0 A;  3KP3 A;  5H2F C;  2AQF A;  3MN2 A;  3WGI A;  2AXT C;  2ZCW A;  3BRO A;  1H0M A;  3PSF A;  4C2U A;  1WJE A;  4HG2 A;  3RKW A;  3KYD B;  3TW7 A;  3CME I;  2LKX A;  2K3F A;  3LWF A;  2Y0S A;  3M1C A;  5GPC A;  3A01 B;  2IGN A;  3CMY A;  1K7A A;  3ABL H;  5KK1 A;  1FYK A;  1D1C A;  2JVH A;  1P4X A;  4BUP A;  1SEU A;  4FET A;  3BTI A;  3TOA A;  4RBO A;  1MMD A;  4HZF A;  3IUO A;  4BJT A;  1FYL A;  1IN8 A;  3ML6 A;  1LVK A;  2EFQ A;  3BTL A;  2M3A A;  1YX5 A;  4NQW B;  3VSK A;  3LA7 A;  1RIO H;  1EH8 A;  2XSD C;  2EFN A;  4JX4 A;  3MKW B;  5FKM A;  2KZV A;  4UY8 I;  3VOD A;  2IS2 A;  5J1R A;  4X0G A;  4XIC A;  1RI7 A;  1MBG A;  2XRO A;  2BY0 A;  1WCM J;  3RZO J;  2YPR A;  2EBI A;  1T08 B;  3NAR A;  3TO7 A;  4WX9 A;  2E1C A;  5HNF A;  3K4L A;  4II2 A;  1ETY A;  2TRT A;  2OJE D;  1WGX A;  1Z67 A;  4AID A;  2IXS A;  5DCM B;  3FBN B;  3WTV C;  1MD0 A;  4IHW A;  4DZP A;  2E7W A;  2I10 A;  2EZI A;  2R7O A;  5E3O A;  4PZJ A;  2PEX A;  4KJZ A;  3ZMD A;  4LLG F;  4ZZL A;  3M07 A;  5E3M A;  4XL9 A;  2QKM B;  2LG4 A;  1JKQ C;  2DJN A;  1HW1 A;  1IF1 A;  4A3M J;  2L9R A;  4PFO A;  4MQV A;  3CF5 F;  1ITY A;  1D5Y A;  2PFB A;  1ON2 A;  4OMZ A;  2QSG X;  4C2T A;  4DZJ A;  1YRN B;  2XGC A;  3L00 A;  3G4S I;  4UVB A;  2CV0 A;  4U0V A;  3ABM H;  3M3Y J;  2GIV A;  2ZB9 A;  5K7Z A;  1TWH J;  3IKV A;  2JA7 J;  2RRE A;  1MZB A;  2P81 A;  2NAZ A;  4BXU A;  1WWX A;  3G1O A;  4HX7 A;  4NB5 A;  2QBY B;  2IS4 A;  2A05 A;  4Q5S F;  3L2C A;  4GYG A;  2GIZ A;  4GRI A;  4N4N B;  4RAY A;  2RQQ A;  1WJF A;  1QHH D;  2UZK A;  4UUV A;  5HDG A;  3GZ5 A;  2P6S A;  4NBQ A;  5LD2 C;  5FRO A;  5D8K B;  2FA5 A;  5KCM A;  2W00 A;  1IV8 A;  3Q9S A;  4ESB A;  1Z9C A;  2E5Z A;  4EM0 B;  1TWC J;  3HIF A;  2DQL A;  3I4M J;  1UB9 A;  5EEH A;  3OYJ A;  1SVL A;  3JSP A;  2VAS A;  4DNC A;  3KYL A;  2RKH A;  4MTD A;  1YW7 A;  1ZHF A;  2RN7 A;  3QRF F;  1UHW A;  1MBJ A;  5CLS A;  4XRS A;  2XC7 A;  5IYD J;  2HKX A;  3HKZ N;  1I5Z A;  2PI0 A;  1XD7 A;  3LSH A;  5LFA A;  3LA3 A;  4ITV A;  1XMK A;  5H6Q A;  1GT0 C;  4EV0 A;  4WK8 F;  3BJ6 A;  2K4J A;  3GME A;  1YTY A;  2XAG A;  3CUO A;  3CCJ I;  2R7T A;  2R7R A;  4B1R A;  1PUF A;  1HST A;  3L2U A;  2DFF A;  3I58 A;  1U8R A;  4GDF A;  5HDN A;  1UST A;  3PNV A;  2XUB A;  1JKP C;  3HOY J;  1OLT A;  3PNY A;  1QO0 D;  4E7I A;  2NVY J;  3SFI A;  3FXJ A;  3OYL A;  1QRY A;  1X2M A;  4L18 B;  1YFH A;  4XRM A;  2IGO A;  2IA1 A;  4CCO A;  5FKL A;  3DWL E;  3K0L A;  3DKX A;  1LE8 B;  2RDP A;  4KIT B;  1E17 A;  2ZFU A;  4HLX A;  2KPM A;  1GLN A;  3DBH B;  2LF7 A;  3ZQC A;  3HRM A;  1ZN2 A;  3VYT B;  3J7Z I;  4W1U A;  1Y6I A;  1S72 I;  2MAB A;  4J19 A;  3AL0 C;  3MAJ A;  3IRR A;  3L1P A;  5DD8 A;  1GXQ A;  4XON A;  5FFX A;  1OCT C;  3V42 A;  2XPW A;  4BEH A;  2P6T A;  4V2G A;  1XGS A;  2IRF G;  2ESH A;  4NC7 A;  3DU6 A;  2HOS A;  1IRZ A;  2EIN H;  4C3J J;  2E5N A;  4EQQ A;  1SD5 A;  2H94 A;  4M3B A;  2PMU A;  3G73 A;  1TW3 A;  2A69 F;  3CTA A;  2O0Y A;  2DYR H;  5IP6 A;  1D1A A;  1XCV A;  4MIM A;  4YIR X;  1PP8 F;  1VQ7 I;  4RGR A;  4M9X A;  2KRF A;  1L3L A;  1KU7 A;  2GXA A;  3K4M A;  3A2K A;  5EZH A;  5E8G A;  2BYV E;  3BY6 A;  4WXD A;  2LFB A;  2HOE A;  2BZT A;  5GTI C;  3I9V 2;  3RQ4 A;  4RGX A;  2E35 A;  1TP4 A;  2F4I A;  2JRT A;  2MBF A;  1JHF A;  2G7U A;  5L3F A;  2VPR A;  3JAM K;  3HSF A;  1KYW A;  1QVU A;  2DMT A;  3SYT A;  4ZYG A;  5GP9 A;  2ZC2 A;  2VBZ A;  1JUS A;  5K5O A;  3K1M A;  2QYO A;  1MBE A;  4BY1 J;  3MKY B;  3FXM A;  4XKV A;  1RNL A;  4D0P A;  3JRD A;  1ZGJ A;  3HDD A;  2MC3 A;  4HDV A;  4B09 A;  2DMU A;  2ECC A;  2WY8 Q;  1R22 A;  2EZH A;  2HZD A;  4XK4 A;  5DDG A;  2FNA A;  1APL C;  5L3B A;  4I6Z A;  2B0L A;  3J81 Z;  1MKM A;  1R1T A;  1QA6 A;  2XAF A;  3RPU D;  1I3A A;  3QPT A;  3H3V K;  1Z77 A;  1LFU P;  1RES A;  1V5E A;  1XGN A;  2FXA A;  4XLH A;  1FLI A;  1WJB A;  3D5S C;  3IWF A;  2I8D A;  5EG0 B;  4PSX A;  1TWA J;  2A6T A;  2BHZ A;  2JVG A;  2MH2 A;  2X4H A;  3LSI A;  3O8G A;  3WOD F;  4BL0 B;  3GTG J;  4NDL A;  2EJR A;  2EB7 A;  1IW7 F;  2VB6 A;  3B6A A;  4Y4R A;  3TMO A;  1QQI A;  1FP2 A;  5KNL A;  2XVC A;  5EGO A;  2E36 A;  3ZRG A;  3H0D A;  4I2O A;  3TO9 A;  5L3C A;  2IT0 A;  4R8H A;  3QPS A;  1IN4 A;  2WAF A;  3I4P A;  4IRH A;  3V7C A;  3ASN H;  4G6Q A;  5D5W B;  2F5D A;  4FX0 A;  3HOT A;  3HHH A;  1ZYR F;  1TQP A;  3A02 A;  4BQQ A;  2CU7 A;  5CYV A;  1G4D A;  4KYW A;  3A4C A;  2JA2 A;  2Y69 H;  4YII A;  1MJB A;  2LKS A;  3FXK A;  4L0Y B;  4NUB A;  1ZK8 A;  3K4K A;  2E19 A;  3D5L A;  5ICE A;  3PO2 J;  2ZJR F;  2OQR A;  3JW4 A;  5A2Q K;  3S3N A;  2D1V A;  3OYA A;  1VQM I;  2VPL A;  2HDC A;  1ETK A;  1E3P A;  2ETH A;  4L9T A;  2XSJ C;  3G2B A;  3KLN A;  2DO7 A;  3HPH A;  2KL4 A;  1SAU A;  3ZOB A;  2HYF A;  4HLY A;  3ZR8 X;  4F7Z A;  3U9G A;  4IXA A;  3NAU A;  3QYE A;  2E2H J;  2FD5 A;  2FJ1 A;  1XCB A;  4M3E A;  3BJO A;  2Y2Z A;  1VQP I;  2X6O A;  2OA4 A;  3R6S A;  2L4M A;  1HBX G;  2R7Q A;  2GBY A;  5HS7 A;  4OIP F;  3I59 B;  4OU0 A;  1G3Y A;  2O61 A;  4I99 C;  2L9S A;  1YQA A;  2DDB A;  3BQY A;  4DBQ A;  2F4M B;  3HM5 A;  4LLN A;  1Z7L A;  4RLQ A;  3L2R A;  4XLF A;  4RB0 A;  4AUX A;  3SDB A;  2LYC A;  3FDY A;  1BIB A;  2RQP A;  3NQO A;  1YO5 C;  4BHB A;  2DQR A;  1S6L A;  2DTZ A;  4LD5 A;  1ZLK A;  5C4J J;  2NOG A;  2XRL A;  3KZZ A;  1WVR A;  1HKT A;  5HOD A;  2H6C A;  3GFM A;  2XDV A;  5LHI A;  1YIT I;  2CFO A;  3DLA A;  4E7J A;  4BBS J;  2DN0 A;  5J1U A;  4XLE A;  2OQG A;  2LD5 A;  1FPQ A;  3GTJ J;  1ZG5 A;  2J5O A;  4Y13 A;  4N9I A;  1G3S A;  2Y9Z A;  1WH5 A;  2W85 A;  1ETW A;  4H0E A;  4MHG A;  1W0U A;  3I54 A;  5F1J A;  2QSF X;  3CCL I;  4RM3 A;  1JHH A;  1Z6T A;  4WXH A;  1WKM A;  4A5N A;  1J0R A;  1AKH A;  1X4O A;  1SMY F;  2A6H F;  2M30 A;  2L0K A;  5GTH C;  2VBX A;  2VQL A;  5AON A;  2XAJ A;  5D5X B;  3GYH X;  2F6C A;  5EZG A;  1DGW Y;  1XX5 A;  1VQ6 I;  1OCO H;  1X19 A;  3N4M A;  5LHG A;  4KDP A;  1ZKG A;  1ZQ3 P;  1PJR A;  3KP2 A;  2DA1 A;  4IQ4 A;  3QU3 A;  4FTH A;  4CH7 A;  1V5G A;  3FIS A;  2WC2 A;  1B72 A;  1EV7 A;  2NNN A;  4HV5 A;  3O3K A;  1E0E A;  4B4C A;  4PFP A;  1AOY A;  1FWZ A;  1FIP A;  4E6K G;  3HEF A;  1QPM A;  3ELK A;  3LAP A;  5CQE A;  3AG2 H;  5CVJ A;  4HW0 A;  1T95 A;  2AQE A;  2NXN B;  2P5L C;  2LRE A;  3VEP A;  4D1Q A;  3E6C C;  1SD4 A;  1MDM B;  1RC9 A;  4UXN A;  2VI6 A;  3HPG A;  1ETV A;  5E3N A;  2PBI A;  2ZME B;  3EQL F;  4NQW A;  3CF2 A;  1QNT A;  3V4G A;  4X1E A;  1ZG3 A;  2YU9 J;  2CW7 A;  2MW8 A;  1SFO J;  2UWM A;  3R0J A;  2K02 A;  2JZY A;  5DYM A;  1WQ2 A;  3WG9 A;  1MMN A;  1VI0 A;  4F93 B;  2ZO4 A;  2XB5 A;  2BVM A;  2PG4 A;  1FJL A;  2DK8 A;  5JVT A;  1HLV A;  4J00 A;  2HTJ A;  3DBL B;  3BQZ A;  2DDA A;  1A6Q A;  1IGN A;  1D5V A;  5F64 A;  4AWX B;  2OAZ A;  2KZG A;  1O3T A;  3QOE A;  1FSH A;  5E1X A;  3S3M A;  1F5T A;  2CQX A;  3HTU A;  4M71 A;  4FAS D;  3SZG A;  1G2H A;  4BAY A;  4MFD A;  3JCU C;  1ZGA A;  3ULQ B;  4M73 A;  1Y39 A;  3RYR A;  3TDU C;  2PMZ N;  1Z1D A;  2R7D A;  3GZ6 A;  3EUH A;  3W2A A;  2NNY A;  4YFN F;  2JA5 J;  4K2E A;  2CRG A;  3S32 A;  5GAH J;  2OD5 A;  3OYK A;  4NHJ A;  2X48 A;  2Z99 A;  4Y7N J;  1MMG A;  5HVQ C;  2GXB A;  2ACJ A;  3RKY A;  4QPO A;  3FXR A;  5FFZ A;  3ONQ A;  1NG7 A;  3BZC A;  4G7H F;  1LNW A;  3RYP A;  2A61 A;  5L3D A;  4MO7 A;  5HLG A;  1TT0 A;  3LSP A;  3H3Z A;  5LEJ A;  2DFE A;  1BM9 A;  3E6B A;  1IN7 A;  3RJP A;  4FCY A;  3BT9 A;  4OWR B;  1STZ A;  2FE3 A;  5LLQ A;  1MNE A;  2O7O A;  3DF8 A;  2KDZ A;  2DA6 A;  4WWC A;  2NYX A;  3ECO A;  2DAO A;  2XPU A;  5ED4 A;  2PN6 A;  3FZV A;  2R7Z J;  1IRF A;  1K78 A;  2VOO A;  1FMW A;  3KP4 A;  5E79 C;  2VBW A;  2EIJ H;  3OYD A;  1QZY A;  5LRR A;  4KT6 A;  1LEA A;  1UJ8 A;  3C2B A;  5F27 A;  3KP7 A;  4M9Z A;  2HPI A;  1U0J A;  1ULY A;  2M4G A;  5CVV A;  1YIJ I;  1WFX A;  4I02 A;  2Q8K A;  2HVR A;  5J47 A;  4XSZ F;  1TQM A;  2VKD A;  2RGV A;  2PJR A;  4D7N A;  1Q1H A;  5J3L A;  4F91 B;  2JMW A;  4IJA A;  3WE2 A;  4ZTF A;  2VUM J;  3MQ0 A;  3R0A A;  3CJT B;  4L5J A;  3PL8 A;  4LJZ F;  2Z3Y A;  4QWQ A;  4D5F A;  3OS2 A;  3SDG A;  4S04 A;  5FKN A;  3PO3 J;  3F8C A;  3I71 A;  1OYI A;  2EH3 A;  2EZK A;  4XSX F;  4BU2 A;  2XGX A;  4PJJ A;  1ETX A;  5HLT A;  4ENN A;  1HSJ A;  2HU9 A;  2HFH A;  4AIH A;  3KIO A;  3ECH A;  4PDK A;  5FLX K;  1CF7 A;  4NC6 A;  3WTS C;  1IN6 A;  1I27 A;  1DP3 A;  2ZJQ F;  2LVS A;  1MMA A;  4M3D A;  4CCJ A;  1WJA A;  3H36 A;  3CO7 C;  1W36 C;  1JGS A;  4MQ9 F;  4OIR F;  4QPQ A;  4ABZ A;  1MMS A;  4QSH A;  3IH2 A;  3RCO A;  4RGU A;  1U8B A;  2A68 F;  1FYM A;  1WZ2 A;  2CJJ A;  3TO6 A;  4XID A;  4A0Y A;  1FC3 A;  2XKP A;  2P0W A;  3A0H C;  2KJB A;  4PCQ A;  2FOW A;  3ZMU A;  2CUE A;  4RB3 C;  4LFU A;  1AU7 A;  2E1M C;  1YE9 A;  3GXO A;  4ZDO A;  3BJA A;  1FBS A;  1O3Q A;  2HDW A;  3RPU A;  4F92 B;  4AIK A;  5EYR A;  3V8K A;  5JLX A;  3M1E A;  4YIF A;  1GDT A;  2ZBK A;  2MSY A;  3BCA A;  1PVE A;  4XOR A;  4HF0 A;  1SAX A;  1BW5 A;  4KNY A;  3WU1 B;  2O8X A;  4P9F A;  1BN5 A;  2Y9Y A;  1IDZ A;  4IPA A;  4BDY A;  4KIS A;  3BPX A;  2HYJ A;  2GAU A;  4RS8 A;  3IAM 2;  3ESW B;  2LC2 A;  5HLI A;  2KLO A;  3S93 A;  2VON A;  2V7F A;  3WGG A;  1RKW A;  1YW9 A;  3CCV I;  5J40 A;  2FBH A;  3DCF A;  3GW2 A;  1HKS A;  3LST A;  2COM A;  3OV8 A;  2V9K A;  3ZQG A;  3FXU A;  3R60 A;  1FOY A;  1NHA A;  2CUF A;  4DYR A;  2K85 A;  3F9K A;  4FT8 A;  4C3H J;  1Q1V A;  3I0T A;  3VB2 A;  2XF6 A;  1FTZ A;  4QTR A;  2X51 A;  3FM3 A;  1JKO C;  4KN4 X;  3K9T A;  3CJQ B;  4PUS A;  2HVS A;  1VZ0 A;  2G0E A;  4ZC3 A;  2L01 A;  1ZAR A;  1EF4 A;  1T33 A;  2UUZ A;  1XTA A;  3I55 I;  3S2H J;  2WB1 A;  5J8F A;  1UHS A;  3E3V A;  3L2Q A;  3A1Y A;  4HST A;  5F1R A;  2WB1 N;  1FBU A;  1HW2 A;  1QZZ A;  3K4N A;  5CVI A;  4BY7 J;  3VPR A;  5E8I A;  2GWR A;  3M8E A;  4JK1 X;  2FRH A;  4H4K C;  2OBP A;  1VQ9 I;  5IOY A;  1T38 A;  1OFC X;  2QZ8 A;  2TDX A;  4ESF A;  2IBD A;  2KIF A;  1U3E M;  2R4G A;  5IYB J;  2W57 A;  4P5O A;  4MEX F;  1A6I A;  3FMQ A;  4MFE A;  2XPV A;  4L5I A;  2R7S A;  3K69 A;  3SZT A;  1I50 J;  5FGM A;  1B8I A;  3AG3 H;  4XN3 A;  4XR6 A;  3CUQ A;  4CO8 A;  3HOZ J;  1Z7U A;  2KRH A;  3T8T A;  2VOD A;  1HKQ A;  2FQ4 A;  1K4T A;  2ZSI B;  3KPH A;  5K1Y A;  1O7F A;  1W1W E;  4E7Z A;  3FHZ A;  4IVN A;  4C3I J;  1XGM A;  2V26 A;  4LB6 B;  3HUG A;  3MZH A;  2GQQ A;  4G7O F;  3CJR B;  5CPR B;  1Y0N A;  3F8F A;  1H89 C;  4M9S A;  5TRD A;  3MMY B;  2ZXH A;  2K9L A;  2M5W A;  4DW6 A;  1JI8 A;  1OCP A;  1AA7 A;  4KT5 C;  1GVD A;  3F8B A;  3P9I A;  2E1N A;  4RLF A;  4P96 A;  3GLL A;  1H8A C;  3DLL F;  2IA2 A;  4M3G A;  4CA0 A;  1W4M A;  2D2W A;  5KHD A;  2HXO A;  1VQL I;  1HDP A;  1K78 B;  4GXO A;  5JHU A;  5DTD A;  2JSC A;  3CLQ A;  3BG5 A;  3DP7 A;  2FEZ A;  2L9N A;  2FQ3 A;  3PM1 A;  4U88 A;  5F0C A;  2XGE A;  2ZSH B;  1KYZ A;  1W0T A;  4MLO A;  1UMQ A;  1OCZ H;  2DPU A;  3PFY A;  3ERE D;  2L7Z A;  3ZQI A;  2CS3 A;  1FMV A;  1X2N A;  4CDG A;  3I64 A;  5FKO A;  3VYU B;  1R71 A;  5E3L A;  2JUC A;  2W84 A;  2F48 A;  4P1W A;  5D6F A;  2P7C B;  2BW3 B;  5BQT A;  2LH9 A;  3HL2 A;  2CFX A;  2G7H A;  2X1C A;  2H8R A;  1P4A A;  1UHM A;  4O5V A;  4ENK A;  3ZPL A;  4A93 J;  2VE9 A;  4C30 A;  4ZYE A;  1BC7 C;  3OYI A;  3K2Z A;  1B4A A;  1EH6 A;  4MGR A;  4IRG A;  3KEO A;  5ICC A;  2DA5 A;  5LBQ A;  4OMY A;  2JSP A;  1HC8 A;  4DIQ A;  1PP7 U;  1B59 A;  2ZXJ A;  5DV5 A;  3N97 A;  4BDZ A;  3RTR A;  1GV5 A;  2A5Y B;  3F3X A;  5FLM J;  3CDI A;  2HQA A;  1XGO A;  1LUJ B;  2EPF A;  2RNJ A;  1N77 A;  1KQ9 A;  2YX4 A;  3CES A;  2ID6 A;  1MNM C;  3AKZ A;  2NS0 A;  2H1L A;  3HC7 A;  3OS0 A;  5DD4 A;  4Y33 A;  3CC7 I;  2R5Z B;  1AHD P;  3BCB A;  4EEF G;  1FT9 A;  2VC0 A;  4DGW B;  3BG3 A;  1G59 A;  1R5I D;  3MD2 A;  5AIP A;  1ZH5 A;  1YHQ I;  4IHX A;  5ILS A;  2L5Q A;  2HOT A;  3IHU A;  3D0S A;  2M8E A;  2WBM A;  1V5F A;  4JQF A;  2OU2 A;  3FIW A;  4IEJ A;  1IUF A;  1T98 A;  4XMY A;  3NEU A;  1P9Q C;  2VQG A;  4ZTJ A;  3HJE A;  1FOW A;  1JTX A;  1J75 A;  1VQN I;  5F08 A;  2X6Y A;  3ZMS A;  3JRG A;  2ZME A;  4XLA A;  1U5T B;  4M6X A;  1KZH A;  4IZZ A;  3SEZ A;  5ICF A;  2Y30 A;  4LOC A;  2WAE A;  3D5R C;  3GVA A;  2ELJ A;  3P9C A;  2QCO A;  1KU2 A;  5FD5 A;  3BPV A;  1B1B A;  3TKY A;  4ZJZ A;  4B43 A;  3W3C A;  5C44 J;  2KIQ A;  3OS1 A;  2QQB A;  5E1Z B;  3QOP A;  2J5P A;  2HTS A;  2UXX A;  2G9W A;  2D5V A;  3CCS I;  1CGP A;  3H35 A;  2R5Y B;  3TOB A;  3ZXS A;  3HZJ A;  3HOS A;  1R6R A;  2M7B A;  4QLC U;  2AXL A;  1I6H J;  5CVR A;  2R93 J;  3B02 A;  2GZW A;  1OYW A;  5BPD A;  2K4B A;  1IG7 A;  1D0Y A;  2YS9 A;  4LIT A;  1GVJ A;  1H88 C;  1A35 A;  3UKG A;  1A31 A;  1TL8 A;  3TED A;  4V2F A;  1MBF A;  3KX2 A;  2V79 A;  3RSN A;  5BNG A;  1X3Z B;  5IOZ A;  4LG0 A;  5KAI C;  3I56 I;  1J09 A;  3HG9 A;  3T5X A;  3VWB A;  1I6X A;  2CGP A;  4WCG A;  2IVM A;  3GX4 X;  4FE7 A;  1R49 A;  1BJZ A;  2H6B A;  4I98 B;  1ENH A;  2MLK A;  2XF7 A;  5CQG A;  2ZJP F;  1ERD A;  3DTK A;  2VKE A;  1XS9 A;  2BY3 A;  2YX7 A;  2DMN A;  2EA4 A;  1XDS A;  2Y75 A;  3GFJ A;  3CDH A;  4E7K A;  1OCC H;  2IP2 A;  4A3B J;  2M87 A;  1SD7 A;  2LSO A;  4GYI A;  5TGT A;  3TW6 A;  3ZQL A;  4II3 A;  3QQA A;  1W7P D;  3BZK A;  2X6W A;  5CKT A;  5J8C A;  4RDU A;  2KQR A;  5D6E A;  4C9Y A;  1MSF C;  4BHC A;  2DA2 A;  3CC2 I;  3F6V A;  1X4P A;  2M2E A;  3BR0 A;  3COA C;  2K9S A;  2JPC A;  4BE1 A;  1HOM A;  1DGR M;  5HLH A;  3KEQ A;  2DMP A;  1S7E A;  3LL7 A;  3FXL A;  5LGT A;  3GFL A;  3IV5 A;  3HKZ A;  4IQJ A;  2ESN A;  2CV2 A;  2HR3 A;  1LE8 A;  1OMI A;  1IC8 A;  3S8P A;  1MW7 A;  3DKY A;  2L02 A;  3I3L A;  3BG6 A;  4HEA 2;  2HDD A;  4AM3 A;  1XC5 A;  3K4C A;  4IKF A;  3KET A;  3WTX C;  3ZQ7 A;  1X3U A;  4UB6 C;  3ZP5 A;  1HQC A;  2IAI A;  2HVQ A;  2VC1 A;  3K10 A;  5E20 A;  1QHG A;  5FLX Z;  3LQR A;  3ABT A;  3P7N A;  5DM6 F;  3J80 Z;  2WV0 A;  2L7M P;  4N4O B;  2W1O A;  1R23 A;  2NVX J;  3GTQ J;  4HNV A;  2A6E F;  3HRU A;  3GZN B;  2KIU A;  1UG2 A;  2DA3 A;  1KGS A;  3TP0 A;  4IX7 A;  2QEN A;  4GCV A;  3MEX A;  1Z91 A;  4BQO A;  1IXC A;  2BW3 A;  4RAF A;  1J59 A;  2HOA A;  1IZ1 A;  2MA3 A;  1WI3 A;  5M3M J;  2XHK A;  5J4V A;  4YFX F;  2LLK A;  4R1H A;  5F0F A;  1A36 A;  3ISP A;  3CMA I;  4HAM A;  2DFI A;  4CSW A;  5JVG F;  1IV6 A;  4IF4 A;  4BHP A;  5D8L B;  2NVT J;  1M1E B;  2OCC H;  2W82 A;  1BBY A;  3QU6 A;  1W36 D;  1D1B A;  1S8N A;  3CD6 I;  3HGY A;  1TC3 C;  2CYY A;  3BWG A;  3AL0 B;  4E70 A;  3OYE A;  4EJW A;  3ZQH A;  1JGG A;  1JKR C;  3OYB A;  1BR2 A;  1FNN A;  2RVC A;  4FQG A;  1JXS A;  5K5Q A;  1NTC A;  3F72 A;  2BE5 F;  3V7R A;  3DFG A;  1Y8Q B;  2LY9 A;  4G94 A;  4Q48 A;  4A6E A;  1NG6 A;  2KMU A;  4IHS A;  2NVQ J;  2VE8 A;  2Q0O A;  3LSJ A;  4LK0 F;  3DPU A;  5EG0 A;  2QVO A;  5HOO A;  2IS1 A;  2F5C A;  2STW A;  3ZGK A;  3C3W A;  6PAX A;  3S14 J;  3FX3 A;  3BP8 A;  1FP1 D;  1U6G A;  4MTE A;  1BI1 A;  1XG1 A;  2MD0 A;  1E3H A;  1VTN C;  4PJN A;  1MIJ A;  1YS7 A;  3FBI B;  3FXO A;  4KIG A;  1F36 A;  3GF2 A;  4RAG A;  1G6N A;  2VJ4 A;  1BIA A;  1T56 A;  1XN7 A;  2GA2 A;  2CQK A;  3G71 I;  5C3E J;  4BGD A;  2WV1 A;  1MJA A;  3KP5 A;  2DJI A;  1KQ0 A;  3IAS 2;  2WTE A;  1FX7 A;  1XSX A;  3QYB A;  4Y3O A;  5TJJ A;  4IOA F;  1W5S A;  2P5K A;  2CW8 A;  3LQQ A;  4ETS A;  2L54 A;  3HOW J;  2Y31 A;  2C6Y A;  1RUO A;  1P7I A;  3EET A;  3VDX A;  3CQZ J;  2KRC A;  5IT9 Z;  1ZRC A;  4BBR J;  4CYC A;  3SFZ A;  3SHF A;  4RB1 A;  3M8F A;  2F2E A;  2VJ5 A;  4Q47 A;  1XDU A;  1TTY A;  1ZR4 A;  4UUS A;  3EDP A;  1NK2 P;  4LIV A;  3KEY A;  4KN7 X;  3RDI A;  1MH4 A;  2HYG D;  2M4K A;  4HPQ A;  2KT0 A;  4A12 A;  4OOI A;  2DK5 A;  2IGK A;  1Y1W J;  4LG3 A;  3MFK A;  4KMU X;  1SMT A;  2XF5 A;  1BI3 A;  3LFU A;  5ERI A;  2HXI A;  1QGP A;  1BR4 A;  4HOB A;  5H20 A;  4G6T B;  2WWY A;  2EFP A;  5F0H A;  2IW5 A;  2Z16 A;  2V1D A;  5IY5 H;  1G3W A;  1B8I B;  2ISY A;  1XSV A;  1MBK A;  2VKH A;  3BG7 A;  4DOZ A;  2PLY A;  3CUQ B;  4ZH4 F;  1W7P A;  3LSM A;  2AO9 A;  3I59 A;  1S29 A;  4UUT A;  3PQK A;  4U0Y A;  4FX4 A;  2O03 A;  4XBF A;  3JRH A;  2V1N A;  4RA2 A;  2RV8 A;  2VLA A;  4AIJ A;  2L7K A;  1KU3 A;  1QZE A;  2W4S A;  5E1W A;  1P92 A;  1X1B A;  3NWT A;  4JOM A;  2MLG A;  2R7V A;  1N25 A;  2VJI A;  3ERM A;  3QOD A;  1IRX A;  4BKX A;  1IAW A;  3ZQF A;  3GTO J;  4CZC A;  1YIO A;  2LY2 A;  3JRC A;  3WE3 A;  1WI9 A;  1VFC A;  4KIC A;  2HS5 A;  2CW0 F;  1QPI A;  3CCY A;  4L0Z B;  5EJC A;  1R5H A;  3EUK L;  3IC7 A;  1POG A;  1XMA A;  3OYG A;  2DTR A;  2V1U A;  1R36 A;  3C2H A;  4CCK A;  1F4K A;  1N78 A;  4I0A A;  3T0Y A;  5JR3 A;  1NK3 P;  1I3Q J;  1I1S A;  2DU9 A;  3BZ6 A;  3P5J A;  4AVP A;  2ZFW A;  3F0C A;  2OTL I;  2MYS A;  3M7G A;  2Z33 A;  2QEX I;  3FMR A;  2W25 A;  2ICW G;  2L9V A;  4GO1 A;  2VT2 A;  3U1D A;  2EV0 A;  4HQM A;  1LFP A;  1EJ9 A;  4G8X A;  1BA5 A;  1G8X A;  1LVA A;  5GPA A;  4IHT A;  5D5V B;  1JJ6 C;  4KIF A;  4CUG A;  2DOF A;  5D5U B;  3OOU A;  3KZI C;  1E2X A;  2P8T A;  5H6R A;  1J9I A;  3W2W A;  5FO5 A;  3K1P A;  1SFE A;  5GAD J;  3BR6 A;  2NRA C;  2OC6 A;  4ZDL A;  1FIA A;  1OKR A;  1R58 A;  4D7M A;  1JTY A;  4G12 A;  5JFR A;  2WY7 Q;  5M5X J;  1UFM A;  2IA0 A;  1MDM A;  4F55 A;  3MCZ A;  4YRV A;  3GWZ A;  3PIO F;  2E2J J;  4P55 A;  4XLN F;  3WTW C;  3EPZ A;  1D0X A;  2BY2 A;  1F9N A;  1DPU A;  1RUN A;  1G3T A;  2LDU A;  3IL2 A;  2MG4 A;  3JRA A;  3OWT A;  4GFB A;  5GAE J;  4A3D J;  3GTK J;  1TZL A;  2BOL A;  2O5R A;  2FU4 A;  3F6O A;  5JHF A;  5E17 F;  4ENJ A;  2MGQ A;  3R61 A;  2NVU B;  4A2U A;  4FE4 A;  1D3Y A;  5M3F J;  2KDO A;  4HX4 A;  3GUD A;  4P9U A;  2OZ6 A;  1U2W A;  4HDU A;  3RZD J;  4LK1 F;  2WAQ N;  1YOV B;  4ESJ A;  3HOV J;  4CZZ A;  2R7X A;  2E60 A;  4UNO A;  3S15 J;  4U87 A;  1U5T A;  2P7V B;  5B1B H;  2OPT A;  3SXY A;  1IDY A;  5EEA A;  3CJN A;  3Q9V A;  3AAF A;  4A3I J;  2VN2 A;  3CMM A;  4L9J A;  1XPX A;  2KP6 A;  3F22 A;  4A3L J;  4ZYD A;  3VSL A;  2DA4 A;  3BC8 A;  1VF9 A;  4BNC A;  2CUJ A;  4YEJ A;  4C2M J;  3OIP A;  4RB2 C;  2QSH X;  1P7J A;  3OR2 C;  3PQJ A;  1JJ8 C;  3IH3 A;  5M5W J;  1OR7 A;  3FF5 A;  3LFK A;  2W48 A;  3KFW X;  3CCE I;  3G3Z A;  3M9A A;  1S3J A;  2FMY A;  5A2Q Z;  2ISZ A;  2MD5 A;  2ZME C;  1LKX A;  1YW8 A;  4IO9 F;  2KIM A;  2F5V A;  5BMZ A;  2EIK H;  1KU9 A;  3K7A J;  2VBY A;  3FKI J;  4E4H A;  2H8W A;  1EA3 A;  2X1D A;  3TBI A;  2OZU A;  5EEG A;  1K6Y A;  1U9N A;  4CYC B;  1WJC A;  1HF0 A;  4A0X A;  4A0Z A;  3EYY A;  2LKP A;  4N9H A;  1JT6 A;  5DS9 A;  1YJN I;  5FRN A;  4NNJ A;  3OOP A;  4UUS B;  1E3O C;  3J80 K;  3E7L A;  3BG9 A;  2M0C A;  3OSF A;  3CC4 I;  3JRE A;  2A07 F;  4I0B A;  4LLL A;  4EAT A;  1ORK A;  2P4W A;  2DT5 A;  5HS9 A;  1P6R A;  3Q0U A;  1VND A;  3V8J A;  1ONV A;  1K83 J;  1P4W A;  1TNT A;  2PJR B;  3HSE A;  3H5R A;  2X1E A;  2M0M A;  3PIP F;  2ADU A;  2WAQ A;  4EGZ A;  1W7P B;  1YS6 A;  3GTM J;  2K3P A;  4EM2 A;  1ZRE A;  2Y0S N;  1VQ5 I;  1RR8 C;  3K1N A;  1LDJ A;  1Z3X A;  2IGM A;  2H27 A;  3W6K B;  3KLO A;  1F1Z A;  5IPA A;  3FK6 A;  2BGC A;  4YG2 F;  1BJA A;  5K5R A;  2KIS A;  1FTT A;  3SJM A;  2IEK A;  5HS8 A;  1DPR A;  5ICG A;  2HPM A;  1EKE A;  3PNT A;  1SAN A;  3FWE A;  4ZYH A;  1IRG A;  1WH7 A;  4HF1 A;  4QIW N;  2HQ5 A;  4Y17 A;  4UVC A;  4X6A J;  5FJ8 J;  2QM3 A;  3C18 A;  2PMZ A;  3GCM A;  4ASN A;  4KMF A;  2Z1D A;  4L9V A;  1T39 A;  3BR2 A;  3B73 A;  2XAH A;  4XNF A;  1UCR A;  3F8N A;  3H3U A;  2D1H A;  3BR1 A;  3G6E I;  2QQ8 A;  4OIQ F;  2GXG A;  4PGG A;  3K2A A;  3FXQ A;  5F04 A;  3BR5 A;  4UB8 C;  3HXL A;  2QGU A;  4AC0 A;  2YUS A;  4UVA A;  1BI0 A;  1V54 H;  3LOC A;  4BH9 A;  1S7O A;  1LJ9 A;  1YYV A;  4AYB A;  4EGY A;  4XOT A;  4CXF A;  3HYI A;  4Z2Y A;  4N0B A;  4BEH B;  2ID3 A;  1P2F A;  2E71 A;  2K9M A;  1R00 A;  4DYC A;  3OSG A;  1U78 A;  2EQR A;  4ANJ A;  2YU3 A;  3IP4 B;  5FLV A;  2XB0 X;  4L9N A;  2ELK A;  3IKT A;  3ASO H;  2AS5 F;  2QUF A;  1MJ9 A;  2OTJ I;  5B1A H;  2XIG A;  1J7K A;  2DA7 A;  3Q0W A;  2VQH A;  3ABU A;  4E7S A;  2NS8 A;  2LP0 A;  5D4R A;  3EYI A;  3D1N I;  2ME0 A;  3H0G J;  1WJD A;  2Z5U A;  4MEY F;  4Y15 A;  2BY1 A;  2XV4 S;  3TP3 A;  1HA8 A;  3TGN A;  3DKW A;  1W5T A;  2FOK A;  2X9D A;  5J6X A;  3E5Q A;  5HDK A;  2Q2E B;  4M6V A;  2KFD A;  4B3X A;  4ZDP A;  1FY7 A;  4PK4 A;  2M9H A;  3E6D A;  2BXZ A;  1ZLJ A;  1QVT A;  2XRN A;  1O57 A;  1UZC A;  1FSE A;  2ZJ2 A;  4E7H A;  3I5U A;  3J81 K;  3JRI A;  1I1G A;  3BLY A;  1HDD C;  4B47 A;  1DQU A;  1N75 A;  5DCM A;  4EJT A;  2DXI A;  2R5Y A;  3OL4 A;  1VQO I;  1DDN A;  2V6C A;  4IHV A;  2M34 A;  3KP6 A;  1ZR2 A;  2V4J C;  3HHG A;  4JBA A;  2PX9 A;  1IN5 A;  3E5X A;  2CV1 A;  5B66 C;  1LEB A;  4G6D A;  5B5E C;  4M6Y A;  1USS A;  3JTH A;  2QWW A;  2VJJ A;  2VKV A;  4B3A A;  2OF7 A;  4V19 K;  2FX0 A;  3VFZ A;  2IPQ X;  4F3Q A;  3J7Y J;  1MH3 A;  1GV2 A;  2VT3 A;  1YRN A;  2HEO A;  2EA2 A;  4B48 A;  4JX5 A;  1SFK A;  1UAA A;  1SC7 A;  3REO A;  5EGO B;  2ZNZ A;  1ZGW A;  2RC4 A;  3L2V A;  3MZY A;  2QBY A;  2L4A A;  4JX6 A;  3PFI A;  4A3J J;  4BQA A;  3S2W A;  2XGD A;  1TNS A;  2HWV A;  5EF6 A;  3OYM A;  4UV9 A;  3RKQ A;  2QA4 I;  1FZP B;  3C1D A;  5HNH A;  9ANT A;  2ZXW H;  3QP6 A;  2O6G E;  3S17 J;  1BR1 A;  4CHU A;  3HGG A;  3GTP J;  3LSG A;  1U5T C;  3AFH A;  4GGG A;  2O8K A;  1UEL B;  3CZ6 A;  3K4J A;  1ZTR A;  3SZP A;  2XAQ A;  1XB4 A;  4HYE A;  1R1U A;  2BXY A;  2JQ7 A;  4XN0 A;  2LBF B;  2CH0 A;  4KUM A;  1V55 H;  1TBX A;  3QAH A;  1X1D A;  1LFB A;  4XLP F;  4BS9 A;  3DV8 A;  4NC8 A;  4KA4 A;  4EJO A;  1MND A;  3L9F A;  5J1Y A;  3DXJ F;  1MSE C;  4ON0 A;  2HKO A;  3CCM I;  2VXD A;  2F4O B;  2E2I J;  3L09 A;  4KFC A;  2EFW A;  3PSI A;  4I09 A;  2DOE A;  3DEE A;  3DPL C;  1VQ8 I;  4XQF A;  2XAS A;  4YEL A;  1VQ4 I;  2BVL A;  5BS6 A;  2DW4 A;  2Y48 A;  1O3S A;  3E6M A;  3LAJ A;  1BW6 A;  4M74 A;  3BTJ A;  3JR9 A;  4XKB A;  4RAZ A;  3TL4 X;  2JA8 J;  3DU5 A;  1DU6 A;  2GLO A;  1KA8 A;  2FUG 2;  1S7A A;  1AWC A;  4LMY A;  4XKC A;  1PUF B;  3IWZ A;  5FKK A;  5FRM A;  3GO5 A;  1UG0 A;  3HOX J;  4YFK F;  5F6F A;  1Y56 A;  2CQN A;  2VOP A;  1A04 A;  1T6S A;  1ZAO A;  4IL6 C;  2DBB A;  3H9J A;  4FHT A;  3RKX A;  3WTT C;  2B9S A;  5DM7 F;  1D8K A;  2R3S A;  2NOJ B;  3OR1 C;  2FNP A;  3JAM Z;  2K9Q A;  3A03 A;  3KCC A;  1T0F A;  2ZNY A;  2HZT A;  3TDZ C;  1T8I A;  4U0W A;  2CQ7 A;  3F8M A;  3ZMV A;  1ZG1 A;  3H1C A;  1IXS B;  4L5E A;  1OIS A;  1V3F A;  4LIU A;  3J7A Y;  2EWN A;  1LB2 A;  2QF7 A;  4XKW A;  2R5Z A;  2K9N A;  3CP2 A;  2R7U A;  1YLF A;  4I76 A;  3BTC A;  3RPQ A;  3WTZ A;  1Y8R B;  2CQQ A;  4A3C J;  2JK3 A;  3ZN0 A;  2ZKZ A;  1GHC A;  1R4N B;  3OYF A;  2FBK A;  2F5F A;  3OL3 A;  3SQN A;  3JTG A;  3UR3 C;  1V4R A;  4AU7 A;  1CQT A;  1R1V A;  3F21 A;  1RKT A;  1AKH B;  3HRT A;  2JUG A;  2R0Q C;  3OIQ A;  2LR8 A;  4HV6 A;  1O7L A;  2JN6 A;  3OYC A;  3QWL A;  2Z2S B;  4B44 A;  2E1O A;  3WTY C;  1PDN C;  1OPC A;  3TQN A;  4S0H B;  1SVO A;  5D4S A;  4DQ2 A;  2RAE A;  1QU3 A;  3DBR B;  5BOX A;  2ELH A;  1FEX A;  3Q3S A;  2E1M B;  4CCN A;  2HQR A;  3GEZ A;  1FOK A;  1RR7 A;  4BAC A;  2LK2 A;  2COB A;  1EH7 A;  4PGH A;  1HXD A;  1R9T J;  5BPI A;  2H09 A;  1X58 A;  2BBY A;  2W24 A;  4LGW A;  1L0O C;  2E34 A;  2EIL H;  3W6V A;  5LGU A;  5LHH A;  1OJL A;  5L3E A;  4HF2 A;  1RPW A;  3OY9 A;  4A3K J;  3A0B C;  3AG1 H;  3RQI A;  2V9V A;  3Q0V A;  1D8J A;  3DPT A;  3FK7 A;  2B63 J;  2QLZ A;  2L3D A;  3WHC A;  1YJ9 I;  2YSR A;  4DJA A;  3QP5 A;  3O2P E;  3Q5F A;  4HQE A;  4FIS A;  4O6J A;  4BQN A;  2MC4 A;  1TQI A;  2DLL A;  3C7J A;  2L2O A;  3S1M J;  4LG0 B;  2R7F A;  1REP C;  4EM1 A;  3H92 A;  2K27 A;  4AYB N;  5CJ9 A;  2IS6 A;  3H5A A;  4XOP A;  4HBL A;  1QBJ A;  2DPD A;  3HRS A;  4KIB A;  4HX8 A;  1RZ4 A;  1F43 A;  4EMS A;  3LSR A;  3DTE A;  1NH3 A;  1PYV A;  1ETO A;  3CUQ C;  2JRM A;  2X85 A;  4O3M A;  2DCE A;  3K4B A;  3GFI A;  3KZY A;  3MKZ A;  3DEW A;  5K7F A;  2V6E A;  2OUM A;  2EK5 A;  3W2V A;  3LSK A;  2DOA A;  3VYR B;  1WHU A;  2Y0M A;  3S3O A;  4WXC A;  4HNT A;  2PMH A;  4EJU A;  1YI2 I;  5AIQ A;  1Z21 A;  1RET A;  4F52 A;  3I4N J;  1X3W B;  3ABK H;  2IJL A;  3NRV A;  4J01 A;  3P9K A;  2RNG A;  3VYS B;  1DP7 P;  3U2R A;  3ROU A;  1O4X A;  4BYY A;  1K79 A;  2OV7 A;  4R79 A;  3OYH A;  1KON A;  4CIC A;  2GA1 A;  3NWS A;  4PJM A;  2PJP A;  1TLH B;  1W5C C;  2LBF A;  3HSR A;  1IUY A;  3FM5 A;  4XRF A;  3VOE A;  2VIX A;  1SD6 A;  2HGC A;  2KHM A;  2AHQ A;  4JP0 A;  1JUM A;  4A3E J;  4EJV A;  4BE2 A;  3IRQ A;  5GAG J;  2R7W A;  5L3G A;  4U7B A;  3DEU A;  1S5L C;  2E7X A;  5FD6 A;  1YJW I;  1Z05 A;  2M7A A;  4EVI A;  3J7A O;  1OR7 C;  4BJ6 C;  1MBH A;  1A5J A;  3IH4 A;  3JRB A;  3I53 A;  2DFH A;  3RI4 A;  2MFZ A;  4A5M A;  2KJC A;  1XSD A;  1WJ5 A;  1GXP A;  3LA2 A;  3WTU C;  4CCL A;  3R4K A;  2CMP A;  5IT9 K;  4RM2 A;  3L2W A;  3F23 A;  2A3S A;  2KKO A;  1WRJ A;  4Q4Z F;  1T2K A;  4PSW A;  3HOU J;  5J4Y A;  1IJW C;  3BOQ A;  1Z0X A;  5IYC J;  3B6C A;  2M45 A;  3QYF A;  3OYN A;  1BI2 A;  2EZL A;  1FBQ A;  1TW2 A;  4ZZD A;  1YX3 A;  4I01 A;  1H9T A;  5JLW A;  4IOC F;  2OCE A;  3U1K A;  2K5C A;  2N8G A;  1LQ1 A;  1VQK I;  3S1Q J;  2LNB A;  4RMN A;  4DBR A;  1SVM A;  2PQ8 A;  2HI3 A;  2DOD A;  1K6O A;  2DT6 A;  3U21 A;  3ZN1 A;  3A01 A;  2CSO A;  3L7W A;  2GOX B;  3AG4 H;  5EDN A;  3WGH A;  2O9L A;  2D45 A;  1X1C A;  1LDD A;  1Z3Y A;  3MZ8 A;  2ME6 A;  3OMY A;  4HA8 A;  3T1B A;  3RIR A;  5C4X J;  4BE0 A;  4OAY A;  3UNG C;  2H1K A;  1BOA A;  4OIO F;  2B7E A;  5DCF A;  1R4M B;  2VQC A;  1IXR C;  2K7L A;  2Z9O A;  2GOM A;  4CYD A;  2UXN A;  3FHN A;  3S16 J;  1ETQ A;  4AD9 A;  4XLC A;  1J5Y A;  4W97 A;  5DUI A;  1B72 B;  1HCR A;  2F5E A;  5ILU A;  5FB2 A;  2BEO A;  3H5N A;  4BJ5 C;  1BC8 C;  4XRS G;  4MNU A;  3V7S A;  4OIN F;  1K61 A;  1X1A A;  3X2Q H;  3LNQ A;  2A5W A;  2M1B A;  1GUU A;  4HRI A;  4G9Y A;  4WF2 A;  4G7Z F;  2CUZ A;  2DMQ A;  4D5C A;  1T0F C;  3H9Q A;  5LGN A;  3WU2 C;  2GM4 A;  3HB9 A;  4IRI A;  2Q2E A;  4A69 C;  2EIM H;  1OCR H;  2LF8 A;  5M5Y J;  3WG7 H;  1JE8 A;  4B8X A;  1ZEL A;  4E7L A;  4HNU A;  3C2G A;  2LMD A;  2TCT A;  1TT5 B;  1XMX A;  3ZMT A;  1LDK B;  3G1M A;  3OIO A;  3S1R J;  3BR3 A;  4HSR A;  3LMM A;  3PJR A;  1B9N A;  2JWT A;  4LB5 A;  3W6J B;  3FMS A;  5JI6 A;  3ZCO A;  2HQN A;  2STT A;  4PJL A;  1J2X A;  2EV6 A;  3QPH A;  3JSO A;  3CCQ I;  4A3G J;  1DUX C;  1BOB A;  3ZQQ A;  5LEK A;  2FSW A;  3GBG A;  1JUP A;  3MWM A;  2QQA A;  4DYQ A;  3CCR I;  1FOX A;  5E18 F;  3K70 C;  2CWE A;  2FF4 A;  5ILV A;  3KE2 A;  1Z6R A;  4BXF A;  1HW5 A;  2YR2 A;  4S05 A;  3CO6 C;  5IP9 J;  1WPK A;  1ODD A;  2EV5 A;  2WAD A;  5DUK A;  1I39 A;  5LRS A;  5IT3 A;  3FKJ A;  3CCU I;  1S9H A;  2DI3 A;  3S1N J;  3O8H A;  5TIS C;  4CCM A;  2O3F A;  1TWG J;  3T8R A;  3BDD A;  1RRJ A;  2NS7 A;  3HBL A;  2ECB A;  5KVR A;  4A6D A;  2DT7 B;  2K40 A;  3SEQ A;  2K86 A;  4M3F A;  3HTS B;  3K70 D;  1JT0 A;  4IHY A;  1PUE E;  4RGS A;  2L7F P;  3G1L A;  1R7J A;  4D9J A;  3MVP A;  2WA0 A;  1YG2 A;  2EFO A;  2M8G X;  1C0W A;  2HNH A;  5IP7 J;  1TWF J;  1D0Z A;  4ENM A;  5DEQ A;  3S2D J;  4BXX J;  1LPQ A;  3QPL A;  3EUH C;  2JT1 A;  2UV1 A;  1K4S A;  3WHB A;  3CP8 A;  2P5V A;  1MGT A;  1DU0 A;  3M4O J;  3O6B B;  2R92 J;  2VL8 A;  1X1P A;  2VXZ A;  2QKL B;  1ACI A;  2LOO A;  3CDL A;  4JYK A;  2BHY A;  1IO2 A;  1SFX A;  4M72 A;  4I7H A;  1B9M A;  3E1S A;  3HUG B; 
#chains in the Genus database with same CATH homology
 2JPB A;  2QQ9 A;  4TV7 A;  2FBI A;  1B6A A;  4U7D A;  2FML A;  3DQV C;  4CGZ A;  3ZMZ A;  3E97 A;  1ZRD A;  2BV6 A;  2MH9 A;  4UV8 A;  3CLO A;  2JTV A;  1OYY A;  2XKO A;  1Y0U A;  1R5G A;  3V8L A;  1SFU A;  4UHT A;  2CO5 A;  3E5U A;  5CVU A;  3GLX A;  1KQ8 A;  1CF7 B;  1ZRF A;  2V1X A;  2X0L A;  1WSU A;  1O3R A;  1H9G A;  1ON1 A;  3WU0 A;  2CG4 A;  3KP3 A;  3WGI A;  2ZCW A;  3BRO A;  1H0M A;  3RKW A;  3LWF A;  1K7A A;  5KK1 A;  1FYK A;  1P4X A;  3TOA A;  4HZF A;  1FYL A;  1IN8 A;  3ML6 A;  2EFQ A;  3LA7 A;  1RIO H;  1EH8 A;  2EFN A;  3VOD A;  1RI7 A;  2XRO A;  2YPR A;  3TO7 A;  4WX9 A;  2E1C A;  5DCM B;  3WTV C;  1MD0 A;  2E7W A;  4PZJ A;  2PEX A;  3ZMD A;  4ZZL A;  1HW1 A;  1IF1 A;  4MQV A;  2PFB A;  1ON2 A;  4OMZ A;  3L00 A;  4UVB A;  4U0V A;  2GIV A;  3IKV A;  1MZB A;  2NAZ A;  4BXU A;  1WWX A;  4HX7 A;  4NB5 A;  2QBY B;  4Q5S F;  3L2C A;  4GYG A;  4RAY A;  2UZK A;  4UUV A;  5HDG A;  3GZ5 A;  2P6S A;  5D8K B;  2FA5 A;  4ESB A;  3Q9S A;  1Z9C A;  4EM0 B;  3HIF A;  2DQL A;  1UB9 A;  5EEH A;  3JSP A;  4DNC A;  2RKH A;  4MTD A;  1YW7 A;  1ZHF A;  2RN7 A;  3QRF F;  1UHW A;  5CLS A;  2HKX A;  1I5Z A;  2PI0 A;  1XD7 A;  3LA3 A;  1XMK A;  5H6Q A;  4EV0 A;  4WK8 F;  3BJ6 A;  2K4J A;  1YTY A;  2XAG A;  3CUO A;  1HST A;  3I58 A;  1U8R A;  5HDN A;  1UST A;  2XUB A;  1QO0 D;  4L18 B;  1YFH A;  2IA1 A;  3K0L A;  2RDP A;  1E17 A;  4HLX A;  2LF7 A;  3HRM A;  1ZN2 A;  3MAJ A;  3IRR A;  5DD8 A;  1GXQ A;  5FFX A;  2P6T A;  1XGS A;  2IRF G;  2ESH A;  4EQQ A;  1SD5 A;  2H94 A;  2PMU A;  3G73 A;  1TW3 A;  2A69 F;  3CTA A;  2O0Y A;  1XCV A;  1PP8 F;  4RGR A;  4M9X A;  2KRF A;  1L3L A;  1KU7 A;  5E8G A;  2BYV E;  3BY6 A;  4WXD A;  2HOE A;  4RGX A;  2JRT A;  2MBF A;  1JHF A;  2G7U A;  5L3F A;  3JAM K;  3HSF A;  1KYW A;  4ZYG A;  2VBZ A;  5K5O A;  3K1M A;  2QYO A;  1RNL A;  4D0P A;  1ZGJ A;  2MC3 A;  4HDV A;  4B09 A;  1R22 A;  5DDG A;  2FNA A;  5L3B A;  2B0L A;  3J81 Z;  1MKM A;  1R1T A;  2XAF A;  3QPT A;  1XGN A;  1FLI A;  2FXA A;  3IWF A;  2MH2 A;  2X4H A;  3WOD F;  2EJR A;  2EB7 A;  1IW7 F;  1QQI A;  1FP2 A;  2XVC A;  4I2O A;  3TO9 A;  5L3C A;  2IT0 A;  4R8H A;  1IN4 A;  3I4P A;  4IRH A;  3V7C A;  4G6Q A;  5D5W B;  2F5D A;  4FX0 A;  3HOT A;  3HHH A;  1ZYR F;  1TQP A;  1G4D A;  5CYV A;  4KYW A;  4YII A;  1MJB A;  4L0Y B;  3D5L A;  5ICE A;  2OQR A;  3JW4 A;  5A2Q K;  2D1V A;  2HDC A;  2ETH A;  4L9T A;  3KLN A;  2DO7 A;  2HYF A;  4HLY A;  4F7Z A;  3U9G A;  4IXA A;  1XCB A;  3BJO A;  2OA4 A;  3R6S A;  2L4M A;  1HBX G;  5HS7 A;  4OIP F;  3I59 B;  4OU0 A;  1G3Y A;  2O61 A;  1YQA A;  4LLN A;  4RB0 A;  1BIB A;  2RQP A;  3NQO A;  1YO5 C;  4BHB A;  2DQR A;  1S6L A;  4LD5 A;  1ZLK A;  3KZZ A;  1HKT A;  2H6C A;  3GFM A;  5LHI A;  2OQG A;  1FPQ A;  1ZG5 A;  2J5O A;  4Y13 A;  4N9I A;  1G3S A;  2W85 A;  4H0E A;  4MHG A;  3I54 A;  1JHH A;  1Z6T A;  4WXH A;  1WKM A;  4A5N A;  1J0R A;  1SMY F;  2A6H F;  2M30 A;  2VBX A;  3GYH X;  5AON A;  2XAJ A;  5D5X B;  3N4M A;  5LHG A;  4KDP A;  3KP2 A;  3QU3 A;  2WC2 A;  1EV7 A;  2NNN A;  4HV5 A;  3O3K A;  1AOY A;  1FWZ A;  1QPM A;  3ELK A;  3LAP A;  5CVJ A;  4HW0 A;  2P5L C;  3VEP A;  3E6C C;  1SD4 A;  1MDM B;  4UXN A;  2PBI A;  2ZME B;  3EQL F;  4NQW A;  3V4G A;  1QNT A;  1ZG3 A;  2UWM A;  3R0J A;  2K02 A;  2JZY A;  5DYM A;  1WQ2 A;  3WG9 A;  2ZO4 A;  2PG4 A;  2DK8 A;  5JVT A;  2HTJ A;  1D5V A;  5F64 A;  4AWX B;  2OAZ A;  1O3T A;  1FSH A;  5E1X A;  1F5T A;  3HTU A;  4M71 A;  4BAY A;  1ZGA A;  3ULQ B;  4M73 A;  3RYR A;  3TDU C;  1Z1D A;  2R7D A;  3GZ6 A;  3EUH A;  2NNY A;  4YFN F;  4K2E A;  2OD5 A;  4NHJ A;  2Z99 A;  5HVQ C;  2GXB A;  2ACJ A;  3RKY A;  3FXR A;  5FFZ A;  4G7H F;  1LNW A;  3RYP A;  2A61 A;  5L3D A;  5HLG A;  3H3Z A;  5LEJ A;  1BM9 A;  3E6B A;  1IN7 A;  3RJP A;  1STZ A;  2FE3 A;  5LLQ A;  3DF8 A;  4WWC A;  2NYX A;  3ECO A;  2DAO A;  5ED4 A;  2PN6 A;  3FZV A;  1IRF A;  1K78 A;  2VOO A;  3KP4 A;  2VBW A;  1QZY A;  5LRR A;  1LEA A;  3KP7 A;  4M9Z A;  1ULY A;  5CVV A;  4I02 A;  2Q8K A;  4XSZ F;  1TQM A;  2RGV A;  1Q1H A;  4IJA A;  3WE2 A;  3MQ0 A;  3R0A A;  4L5J A;  4LJZ F;  2Z3Y A;  4QWQ A;  4S04 A;  3F8C A;  3I71 A;  1OYI A;  4XSX F;  2XGX A;  4ENN A;  1HSJ A;  2HFH A;  4AIH A;  3ECH A;  4PDK A;  5FLX K;  1CF7 A;  3WTS C;  1IN6 A;  1I27 A;  3CO7 C;  1JGS A;  4MQ9 F;  4OIR F;  4RGU A;  2A68 F;  1FYM A;  3TO6 A;  4A0Y A;  1FC3 A;  2XKP A;  2KJB A;  4PCQ A;  3ZMU A;  4RB3 C;  4LFU A;  3GXO A;  3BJA A;  1FBS A;  1O3Q A;  4AIK A;  3RPU A;  3V8K A;  4YIF A;  3M1E A;  2ZBK A;  4HF0 A;  1SAX A;  4KNY A;  3WU1 B;  2O8X A;  4P9F A;  1BN5 A;  4IPA A;  3BPX A;  2GAU A;  4RS8 A;  5HLI A;  2VON A;  3WGG A;  1YW9 A;  2FBH A;  3GW2 A;  1HKS A;  3LST A;  2COM A;  3OV8 A;  3FXU A;  3R60 A;  1NHA A;  4FT8 A;  3I0T A;  3VB2 A;  3FM3 A;  4KN4 X;  3K9T A;  2L01 A;  1ZAR A;  5J8F A;  3E3V A;  5F1R A;  1FBU A;  1HW2 A;  1QZZ A;  5CVI A;  5E8I A;  2GWR A;  3M8E A;  4JK1 X;  2FRH A;  2OBP A;  1T38 A;  2QZ8 A;  2TDX A;  4ESF A;  2KIF A;  1U3E M;  2W57 A;  4P5O A;  4MEX F;  3FMQ A;  4L5I A;  3K69 A;  3SZT A;  5FGM A;  3CUQ A;  4CO8 A;  1Z7U A;  3T8T A;  2VOD A;  1HKQ A;  5K1Y A;  1O7F A;  3FHZ A;  4IVN A;  1XGM A;  3MZH A;  4LB6 B;  3HUG A;  2GQQ A;  4G7O F;  3F8F A;  4M9S A;  5TRD A;  2M5W A;  4KT5 C;  3P9I A;  3F8B A;  2E1N A;  4P96 A;  2IA2 A;  1W4M A;  2D2W A;  1K78 B;  4GXO A;  5JHU A;  2JSC A;  3DP7 A;  2FEZ A;  2FQ3 A;  4U88 A;  1KYZ A;  2DPU A;  3ERE D;  4CDG A;  3I64 A;  2W84 A;  5D6F A;  2P7C B;  5BQT A;  2CFX A;  2G7H A;  1P4A A;  1UHM A;  4O5V A;  4ENK A;  3ZPL A;  2VE9 A;  4ZYE A;  1BC7 C;  3K2Z A;  1B4A A;  1EH6 A;  4MGR A;  4IRG A;  3KEO A;  5ICC A;  5LBQ A;  4OMY A;  1PP7 U;  1B59 A;  2ZXJ A;  5DV5 A;  3N97 A;  3RTR A;  2A5Y B;  3F3X A;  1XGO A;  2RNJ A;  1KQ9 A;  2YX4 A;  2NS0 A;  5DD4 A;  1FT9 A;  2VC0 A;  5AIP A;  1ZH5 A;  5ILS A;  3IHU A;  3D0S A;  2M8E A;  4JQF A;  2OU2 A;  1T98 A;  3NEU A;  1J75 A;  3ZMS A;  2ZME A;  1U5T B;  4M6X A;  5ICF A;  3GVA A;  3P9C A;  1KU2 A;  5FD5 A;  3BPV A;  1B1B A;  3TKY A;  2QQB A;  5E1Z B;  3QOP A;  2J5P A;  2HTS A;  2UXX A;  2G9W A;  1CGP A;  3TOB A;  3HOS A;  4QLC U;  2AXL A;  5CVR A;  3B02 A;  2GZW A;  1OYW A;  5BPD A;  2K4B A;  1GVJ A;  2V79 A;  4LG0 A;  3T5X A;  1I6X A;  2CGP A;  4WCG A;  2IVM A;  3GX4 X;  2H6B A;  4I98 B;  2MLK A;  2YX7 A;  2EA4 A;  1XDS A;  2Y75 A;  3GFJ A;  3CDH A;  2IP2 A;  2M87 A;  1SD7 A;  2LSO A;  4GYI A;  1W7P D;  5J8C A;  5D6E A;  4BHC A;  3F6V A;  3COA C;  2JPC A;  5HLH A;  3KEQ A;  5LGT A;  3GFL A;  2ESN A;  2HR3 A;  1OMI A;  2L02 A;  3KET A;  3WTX C;  3ZQ7 A;  1X3U A;  3ZP5 A;  1HQC A;  2VC1 A;  5E20 A;  5FLX Z;  3LQR A;  3ABT A;  3P7N A;  3J80 Z;  2WV0 A;  1R23 A;  2A6E F;  3HRU A;  2KIU A;  1KGS A;  2QEN A;  4GCV A;  3MEX A;  1Z91 A;  1IXC A;  1J59 A;  1IZ1 A;  2MA3 A;  2XHK A;  4YFX F;  4R1H A;  3ISP A;  4HAM A;  2DFI A;  4IF4 A;  4BHP A;  5D8L B;  1BBY A;  3QU6 A;  1S8N A;  2CYY A;  3BWG A;  4E70 A;  4EJW A;  1FNN A;  2RVC A;  1JXS A;  5K5Q A;  3F72 A;  2BE5 F;  3V7R A;  3DFG A;  4A6E A;  4G94 A;  4Q48 A;  4IHS A;  2VE8 A;  2Q0O A;  4LK0 F;  2QVO A;  5HOO A;  2F5C A;  2STW A;  3C3W A;  6PAX A;  3FX3 A;  3BP8 A;  1FP1 D;  1U6G A;  4MTE A;  1BI1 A;  1VTN C;  1YS7 A;  4KIG A;  3GF2 A;  1G6N A;  1BIA A;  2GA2 A;  1XN7 A;  2CQK A;  1MJA A;  3KP5 A;  1KQ0 A;  2WTE A;  1FX7 A;  1XSX A;  5TJJ A;  1W5S A;  2P5K A;  3LQQ A;  4ETS A;  2L54 A;  2C6Y A;  1RUO A;  3EET A;  5IT9 Z;  1ZRC A;  3SFZ A;  4RB1 A;  3SHF A;  3M8F A;  2F2E A;  4Q47 A;  1XDU A;  1TTY A;  3EDP A;  4KN7 X;  3RDI A;  2HYG D;  4A12 A;  4OOI A;  2DK5 A;  3MFK A;  4KMU X;  1SMT A;  5ERI A;  1BI3 A;  1QGP A;  4HOB A;  5H20 A;  2WWY A;  2EFP A;  2IW5 A;  2V1D A;  1G3W A;  2ISY A;  1XSV A;  2PLY A;  3CUQ B;  4ZH4 F;  1W7P A;  4FX4 A;  3I59 A;  1S29 A;  4U0Y A;  3PQK A;  2O03 A;  4XBF A;  2RV8 A;  4AIJ A;  1KU3 A;  5E1W A;  1P92 A;  2MLG A;  1IAW A;  1YIO A;  3WE3 A;  1WI9 A;  4KIC A;  2HS5 A;  2CW0 F;  4L0Z B;  1R5H A;  3IC7 A;  1XMA A;  2DTR A;  2V1U A;  1R36 A;  1F4K A;  4I0A A;  3T0Y A;  5JR3 A;  1I1S A;  2DU9 A;  3BZ6 A;  4AVP A;  2ZFW A;  3M7G A;  2Z33 A;  3FMR A;  2W25 A;  4GO1 A;  2VT2 A;  3U1D A;  2EV0 A;  4HQM A;  4G8X A;  1LVA A;  4IHT A;  5D5V B;  4KIF A;  5D5U B;  1E2X A;  2P8T A;  5H6R A;  1J9I A;  5FO5 A;  3K1P A;  1SFE A;  2NRA C;  1OKR A;  1R58 A;  5JFR A;  1UFM A;  2IA0 A;  1MDM A;  3MCZ A;  3GWZ A;  4P55 A;  4XLN F;  3WTW C;  1DPU A;  1F9N A;  1RUN A;  1G3T A;  2LDU A;  3IL2 A;  3F6O A;  2FU4 A;  5E17 F;  4ENJ A;  3R61 A;  4A2U A;  1D3Y A;  4HX4 A;  3GUD A;  4P9U A;  2OZ6 A;  1U2W A;  4HDU A;  4LK1 F;  4ESJ A;  4CZZ A;  4UNO A;  1U5T A;  2P7V B;  3SXY A;  3AAF A;  3CJN A;  3Q9V A;  2VN2 A;  4L9J A;  3F22 A;  4ZYD A;  4BNC A;  4RB2 C;  3PQJ A;  1OR7 A;  3FF5 A;  3LFK A;  3KFW X;  3G3Z A;  3M9A A;  1S3J A;  2FMY A;  5A2Q Z;  2ISZ A;  2MD5 A;  1YW8 A;  2KIM A;  5BMZ A;  1KU9 A;  2VBY A;  2OZU A;  5EEG A;  4A0X A;  4A0Z A;  3EYY A;  2LKP A;  4N9H A;  3OOP A;  3J80 K;  2A07 F;  4I0B A;  4LLL A;  2P4W A;  2DT5 A;  5HS9 A;  1P6R A;  3V8J A;  1ONV A;  1P4W A;  1TNT A;  3HSE A;  2ADU A;  4EGZ A;  1W7P B;  1YS6 A;  1ZRE A;  4EM2 A;  3K1N A;  1LDJ A;  2H27 A;  3W6K B;  3KLO A;  1F1Z A;  2BGC A;  4YG2 F;  1BJA A;  5K5R A;  5HS8 A;  1DPR A;  5ICG A;  3FWE A;  4ZYH A;  1IRG A;  4HF1 A;  4Y17 A;  4UVC A;  2QM3 A;  3C18 A;  4ASN A;  4KMF A;  4L9V A;  1T39 A;  3B73 A;  2XAH A;  1UCR A;  3F8N A;  3H3U A;  2D1H A;  4OIQ F;  2GXG A;  4PGG A;  3FXQ A;  4UVA A;  1BI0 A;  4BH9 A;  1S7O A;  1LJ9 A;  1YYV A;  4EGY A;  4CXF A;  3HYI A;  4Z2Y A;  4N0B A;  1P2F A;  1R00 A;  1U78 A;  2YU3 A;  4L9N A;  3IKT A;  2AS5 F;  2QUF A;  1MJ9 A;  2XIG A;  1J7K A;  3ABU A;  5D4R A;  3EYI A;  2Z5U A;  4Y15 A;  4MEY F;  2XV4 S;  3TGN A;  3DKW A;  1W5T A;  2FOK A;  5J6X A;  3E5Q A;  5HDK A;  1FY7 A;  3E6D A;  1ZLJ A;  2XRN A;  1O57 A;  1FSE A;  2ZJ2 A;  3I5U A;  3J81 K;  1I1G A;  5DCM A;  4EJT A;  1DDN A;  2V6C A;  3KP6 A;  3HHG A;  4JBA A;  1IN5 A;  3E5X A;  1LEB A;  4G6D A;  4M6Y A;  1USS A;  3JTH A;  2QWW A;  3VFZ A;  2IPQ X;  2HEO A;  2VT3 A;  2EA2 A;  3REO A;  2ZNZ A;  2RC4 A;  3MZY A;  2QBY A;  2L4A A;  3PFI A;  4BQA A;  3S2W A;  1TNS A;  2HWV A;  4UV9 A;  1FZP B;  3C1D A;  3QP6 A;  2O6G E;  4CHU A;  1U5T C;  4GGG A;  3SZP A;  2XAQ A;  1XB4 A;  4HYE A;  1R1U A;  4KUM A;  1TBX A;  3QAH A;  4XLP F;  3DV8 A;  4KA4 A;  4EJO A;  3L9F A;  3DXJ F;  4ON0 A;  2HKO A;  4KFC A;  3L09 A;  2EFW A;  4I09 A;  3DPL C;  2XAS A;  5BS6 A;  2DW4 A;  2Y48 A;  1O3S A;  3E6M A;  3LAJ A;  4M74 A;  4RAZ A;  1KA8 A;  1S7A A;  1AWC A;  4LMY A;  3IWZ A;  3GO5 A;  4YFK F;  5F6F A;  2VOP A;  1A04 A;  1T6S A;  1ZAO A;  2DBB A;  3WTT C;  4FHT A;  3RKX A;  1D8K A;  2R3S A;  2FNP A;  3JAM Z;  3KCC A;  1T0F A;  2ZNY A;  2HZT A;  3TDZ C;  4U0W A;  3ZMV A;  3F8M A;  1ZG1 A;  1IXS B;  1V3F A;  2EWN A;  1LB2 A;  1YLF A;  3RPQ A;  3WTZ A;  3ZN0 A;  2ZKZ A;  1GHC A;  2FBK A;  2F5F A;  3SQN A;  3JTG A;  1V4R A;  1R1V A;  3F21 A;  3HRT A;  4HV6 A;  1O7L A;  3WTY C;  1PDN C;  1OPC A;  3TQN A;  5D4S A;  4DQ2 A;  5BOX A;  2ELH A;  2HQR A;  3GEZ A;  1FOK A;  4PGH A;  1EH7 A;  1HXD A;  5BPI A;  2H09 A;  2BBY A;  2W24 A;  4LGW A;  1L0O C;  5LGU A;  5LHH A;  5L3E A;  4HF2 A;  2V9V A;  1D8J A;  3DPT A;  2QLZ A;  2L3D A;  2YSR A;  3QP5 A;  3O2P E;  3Q5F A;  4HQE A;  4O6J A;  1TQI A;  2DLL A;  3C7J A;  4LG0 B;  2R7F A;  1REP C;  4EM1 A;  3H92 A;  2K27 A;  5CJ9 A;  2DPD A;  4HBL A;  1QBJ A;  3HRS A;  4KIB A;  4HX8 A;  1RZ4 A;  4EMS A;  3CUQ C;  4O3M A;  3GFI A;  3KZY A;  2EK5 A;  2Y0M A;  4WXC A;  2PMH A;  4EJU A;  5AIQ A;  2IJL A;  3NRV A;  3P9K A;  1DP7 P;  3U2R A;  3ROU A;  4BYY A;  1K79 A;  4R79 A;  4CIC A;  2GA1 A;  2PJP A;  1TLH B;  3HSR A;  1IUY A;  3FM5 A;  4XRF A;  3VOE A;  1SD6 A;  2HGC A;  4EJV A;  3IRQ A;  5L3G A;  4U7B A;  3DEU A;  2E7X A;  5FD6 A;  1Z05 A;  4EVI A;  3J7A O;  3I53 A;  3RI4 A;  4A5M A;  2KJC A;  1XSD A;  1GXP A;  3LA2 A;  3WTU C;  3R4K A;  5IT9 K;  3F23 A;  2A3S A;  2KKO A;  1WRJ A;  4Q4Z F;  1T2K A;  3BOQ A;  2M45 A;  1BI2 A;  1FBQ A;  4ZZD A;  1TW2 A;  4I01 A;  1H9T A;  1LQ1 A;  2LNB A;  2PQ8 A;  1K6O A;  3ZN1 A;  2CSO A;  3L7W A;  3WGH A;  2D45 A;  1LDD A;  4HA8 A;  3T1B A;  3RIR A;  1BOA A;  4OIO F;  5DCF A;  1IXR C;  2K7L A;  2Z9O A;  4CYD A;  2UXN A;  4AD9 A;  1J5Y A;  5DUI A;  2F5E A;  5ILU A;  5FB2 A;  2BEO A;  1BC8 C;  4MNU A;  3V7S A;  4OIN F;  2M1B A;  4G9Y A;  4WF2 A;  4G7Z F;  5LGN A;  4IRI A;  2Q2E A;  2LF8 A;  1JE8 A;  4B8X A;  3ZMT A;  1LDK B;  1B9N A;  4LB5 A;  3W6J B;  3FMS A;  5JI6 A;  2HQN A;  2STT A;  3JSO A;  1J2X A;  2EV6 A;  3QPH A;  1DUX C;  5LEK A;  2FSW A;  3MWM A;  2QQA A;  5E18 F;  5ILV A;  2CWE A;  2FF4 A;  3KE2 A;  1Z6R A;  1HW5 A;  2YR2 A;  4S05 A;  3CO6 C;  1ODD A;  2EV5 A;  5DUK A;  5LRS A;  5IT3 A;  2DI3 A;  2O3F A;  3T8R A;  3BDD A;  5KVR A;  4A6D A;  2K86 A;  3HTS B;  1PUE E;  4RGS A;  1R7J A;  1YG2 A;  2EFO A;  1C0W A;  4ENM A;  5DEQ A;  2JT1 A;  2P5V A;  1MGT A;  3O6B B;  2VXZ A;  1SFX A;  4M72 A;  4I7H A;  1B9M A;  4LLG F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...