2O49A

Crystal structure of the n-terminal cut domain of satb1 bound to matrix attachment region dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
84
structure length
84
Chain Sequence
EVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQSLLVNLRAMQNFLQLPEAERDRIYQDERERSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of the matrix attachment region of DNA by transcription factor SATB1.
pubmed doi rcsb
molecule keywords DNA (5'-D(*DGP*DCP*DTP*DAP*DAP*DTP*DAP*DTP*DAP*DTP*DGP*DC)-3
molecule tags Transcription/dna
source organism Homo sapiens
total genus 34
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2o49A00
2LYJA 3SCHA 4YG7B 4MCTA 1PRAA 1S7EA 3F51A 4PU8A 1RZRA 1LQCA 2JVLA 4X4FA 1BDHA 3D1NI 1LCDA 4NDWA 3TRBA 3G5GA 1GT0C 3BD1A 1JH9A 1QQAA 3G7DA 1ZUGA 3MLFA 1Y7YA 2GRMA 2D5VA 2PUAA 3FYAA 1QP0A 3OP9A 2OFYA 2KEIA 2AXZA 2HINA 4IVZA 2PUDA 4FBIA 1NEQA 1ZS4A 1CQTA 2LYLA 2BNOA 2LYSA 3SCFA 1PRUA 2AXUA 3S8QA 2IU7A 2CSFA 4MCXA 1ZVVA 1XWRA 4IWRA 1R63A 2IUOA 1POUA 4I6TA 1ZZ9A 2ICPA 2O49A 4JCYA 2XI8A 1ZZBA 1PNRA 1ZPQA 1ZZ8A 1X57A 1PRVA 2PIJA 2PUCA 4FN3A 1QP4A 2AUWA 1HF0A 1OSLA 3F52A 4I6RA 2GZUA 1ZZ6A 2LCVA 3QQ6A 2MEZA 3BS3A 2R63A 3GBFA 3JXCL 2XJ3A 2KZ8A 3QYXA 3QWGA 1LMB3 1O4XA 4X4IA 1BDIA 4Z5CA 2B5AA 1DW9A 1JFSA 3F6WA 4JQDA 4YARA 1QP7A 2PE5A 2BJCA 2GRLA 2AW6A 3SCGA 3B7HA 2H8RA 2EF8A 1AU7A 4PU3C 1IC8A 3UFDA 2IVBA 1WH8A 3R1FA 4J1WA 3H5TA 1WIZA 2R1JL 4YG4A 2BNMA 3ZKCA 1WH6A 4I8TA 2BNNA 1B0NA 4GQMA 4J1XA 2WIUB 3RZZA 1SQ8A 4GHJA 4X4EA 2IV1A 3KXAA 3CLCA 2KEKA 2LYQA 2LYRA 2KEJA 4X4DA 2OR1L 1X2LA 3LISA 4JCXA 1VPWA 3KJXA 4YG1A 4X4BA 1NERA 3L1PA 1OCTC 4Y42A 2PUFA 1QPZA 1CJGA 4X4GA 4PU4C 2L8NA 1E3OC 4Z5DA 4IA8A 3CROL 1DWKA 2HSGA 3U3WA 1UXDA 3JXBC 4YBAA 3FMYA 1QQBA 5A7LA 3OQOA 1JWLA 1WETA 3QF3A 3OMTA 1ADRA 2WUSR 2CROA 1Y9QA 4Z59A 3FYMA 1L1MA 2L49A 1RZSA 1LLIA 4Z5HA 1PERL 3PXPA 2IVGA 3VK0A 2ICTA 3CECA 2O4AA 3O9XA 1RIOA 2JCGA 2O38A 4X4HA 3JXDL 1ZAYA 4I6UA 3ZHMA 2AWIA 3LFPA 2PPXA 3EUSA 2EBYA 2LYPA 4F8DA 4OB4A 2PUGA 2LYKA 1UTXA 2XCJA 3GN5A 2A6CA 3BDNA 4PU7A 1JFTA 2KPJA 1R69A 1LCCA 2IVQA 5K98B 3OQNA 2MQKA 3HZIB 2EWTA 4X4CA 3ZHIA 1EFAA 2PUEA 2XSDC 3DNVB 2XIUA 4O8BA 1RPEL 2AXVA 2FJRA 4Z58A 2PUBA 1UXCA 1ZZ7A 1YSEA 3GN5B 3KZ3A 1ZZCA 3OQMA 1RZRD 3IVPA
chains in the Genus database with same CATH superfamily
4MCTA 3F51A 3GZDC 2JVLA 3G5GA 1QQAA 1Y7YA 2D5VA 2PUDA 3R09A 2BNOA 2CSFA 1ZVVA 1PNRA 3F52A 4I6RA 2R63A 2V3CC 1LMB3 1BDIA 2LNMA 4Z5CA 1DW9A 4ER3A 3F6WA 1QP7A 2HCSA 2H8RA 3UFDA 1WIZA 2PXTA 4YG4A 4I8TA 4J1XA 2WIUB 2IV1A 2KEJA 2L1PA 4Y42A 4DE8A 4IA8A 1DWKA 2HSGA 3TELA 3JXBC 4YBAA 3OQOA 2CROA 1L1MA 4DE9A 1PERL 4Z5HA 3NROA 3CECA 4ER5A 3NXHA 3LFPA 2PPXA 3EUSA 4F8DA 2LYPA 5JUWA 3PE5A 2LYKA 2XCJA 3BDNA 1LCCA 2IVQA 3SX0A 2EWTA 4X4CA 2PXLA 2LLWA 1EFAA 1NW3A 5GAHi 2FJRA 2PUBA 2B5AA 4YG7B 3QOXA 4PU8A 4X4FA 3A9ZA 3BD1A 3G7DA 1ZUGA 3MLFA 2GRMA 1DULA 5DTQA 3A9YA 1QP0A 3OP9A 2KEIA 4FBIA 1ZS4A 2IUOA 1POUA 4ER6A 4JCYA 4Q2JA 2PXEA 4EZIA 3NDBB 4FN3A 2AUWA 2LCVA 3QQ6A 3UWPA 3BS3A 3GBFA 3TFLA 2AW6A 3B7HA 1AU7A 2IVBA 3R1FA 3H5TA 3ZKCA 1WH6A 5DRTA 3RZZA 4X4EA 3KXAA 3LISA 3KJXA 4YG1A 4EKGA 1HQ1A 2L8NA 5DT2A 1UXDA 1JWLA 1WETA 2L49A 3PXPA 3ZHMA 3JXDL 3A9XA 2PXBA 4OBMA 2HFZA 2LLVA 1QZXA 3GN5A 2PXQA 2KPJA 1R69A 3M9LA 2MQKA 3QFIA 2ODRD 3ZHIA 4O8BA 4Z58A 3ZPXA 1UXCA 1ZZ7A 2J7WA 3OQMA 1RZRD 3SCHA 1S7EA 1LQCA 1BDHA 4NDWA 3TRBA 1GT0C 1JH9A 2PUAA 2PXPA 2HINA 2LYLA 3TEPA 1PRUA 2IU7A 4MCXA 1XWRA 4IWRA 1R63A 2PXKA 2HCNA 1ZZ9A 2M4HA 5DTMA 1ZPQA 1X57A 2YBDA 1HF0A 1ZZ6A 3JXCL 2XJ3A 4X4IA 2XXQA 1JFSA 4YARA 2BJCA 2GRLA 3LQXA 2EF8A 1IC8A 3MEJA 2BNNA 4GQMA 1SQ8A 3CLCA 2KEKA 3OKZA 4X4DA 2OR1L 1X2LA 4JCXA 1VPWA 3KL4A 3ME5A 4X4BA 4X4GA 3DM5A 4Z5DA 3U3WA 3FMYA 1ADRA 3OMTA 4HRAA 2MXDA 4Z59A 3FYMA 1ZAYA 4OB4A 2PUGA 1UTXA 3QOWA 2A6CA 2XSDC 3DNVB 2PXDA 3VWSA 1RPEL 1U2ZA 3GN5B 3KZ3A 1ZZCA 2LYJA 1PRAA 2FFHA 1RZRA 4WVLA 3D1NI 1LCDA 3G0TA 3OWQA 3FYAA 4ER0A 2OFYA 2J7UA 2AXZA 4IVZA 1NEQA 1CQTA 2LYSA 3SCFA 1MFQC 2AXUA 3S8QA 2VEOA 4I6TA 2ICPA 2O49A 2XI8A 1ZZBA 1ZZ8A 1PRVA 2PIJA 5DSXA 1QP4A 1OSLA 2GZUA 2MEZA 5DTRA 2KZ8A 3QYXA 3QWGA 5DRYA 1O4XA 4JQDA 2PE5A 2XXAA 3SCGA 2PUCA 4PU3C 1WH8A 4J1WA 2R1JL 2BNMA 3GZCA 1B0NA 4EQZA 3GZDA 4GHJA 4EK9A 5GAGi 2LYQA 2LYRA 1QB2A 1NERA 3L1PA 1OCTC 2PUFA 1QPZA 1CJGA 4PU4C 1E3OC 3CROL 3SR4A 2PXUA 2JQEA 1QQBA 3NZLA 5A7LA 2PXVA 3QF3A 2WUSR 1Y9QA 1RZSA 1LLIA 2IVGA 3VK0A 2ICTA 4EKIA 2O4AA 3O9XA 1RIOA 2JCGA 2O38A 4X4HA 4I6UA 2AWIA 2XXPA 2EBYA 2PXFA 4PU7A 1JFTA 5K98B 3OQNA 3GUUA 3HZIB 2PUEA 2XIUA 2AXVA 4ER7A 1YSEA 3IVPA
chains in the Genus database with same CATH topology
2LYJA 3SCHA 4YG7B 4MCTA 1PRAA 1S7EA 3F51A 4PU8A 1RZRA 1LQCA 2JVLA 4X4FA 1BDHA 3D1NI 1LCDA 4NDWA 3TRBA 3G5GA 1GT0C 3BD1A 1JH9A 1QQAA 3G7DA 1ZUGA 3MLFA 1Y7YA 2GRMA 2D5VA 2PUAA 3FYAA 1QP0A 3OP9A 2OFYA 2KEIA 2AXZA 2HINA 4IVZA 2PUDA 4FBIA 1NEQA 1ZS4A 1CQTA 2LYLA 2BNOA 2LYSA 3SCFA 1PRUA 2AXUA 3S8QA 2IU7A 2CSFA 4MCXA 1ZVVA 1XWRA 4IWRA 1R63A 2IUOA 1POUA 4I6TA 1ZZ9A 2ICPA 2O49A 4JCYA 2XI8A 1ZZBA 1PNRA 1ZPQA 1ZZ8A 1X57A 1PRVA 2PIJA 2PUCA 4FN3A 1QP4A 2AUWA 1HF0A 1OSLA 3F52A 4I6RA 2GZUA 1ZZ6A 2LCVA 3QQ6A 2MEZA 3BS3A 2R63A 3GBFA 3JXCL 2XJ3A 2KZ8A 3QYXA 3QWGA 1LMB3 1O4XA 4X4IA 1BDIA 4Z5CA 2B5AA 1DW9A 1JFSA 3F6WA 4JQDA 4YARA 1QP7A 2PE5A 2BJCA 2GRLA 2AW6A 3SCGA 3B7HA 2H8RA 2EF8A 1AU7A 4PU3C 1IC8A 3UFDA 2IVBA 1WH8A 3R1FA 4J1WA 3H5TA 1WIZA 2R1JL 4YG4A 2BNMA 3ZKCA 1WH6A 4I8TA 2BNNA 1B0NA 4GQMA 4J1XA 2WIUB 3RZZA 1SQ8A 4GHJA 4X4EA 2IV1A 3KXAA 3CLCA 2KEKA 2LYQA 2LYRA 2KEJA 4X4DA 2OR1L 1X2LA 3LISA 4JCXA 1VPWA 3KJXA 4YG1A 4X4BA 1NERA 3L1PA 1OCTC 4Y42A 2PUFA 1QPZA 1CJGA 4X4GA 4PU4C 2L8NA 1E3OC 4Z5DA 4IA8A 3CROL 1DWKA 2HSGA 3U3WA 1UXDA 3JXBC 4YBAA 3FMYA 1QQBA 5A7LA 3OQOA 1JWLA 1WETA 3QF3A 3OMTA 1ADRA 2WUSR 2CROA 1Y9QA 4Z59A 3FYMA 1L1MA 2L49A 1RZSA 1LLIA 4Z5HA 1PERL 3PXPA 2IVGA 3VK0A 2ICTA 3CECA 2O4AA 3O9XA 1RIOA 2JCGA 2O38A 4X4HA 3JXDL 1ZAYA 4I6UA 3ZHMA 2AWIA 3LFPA 2PPXA 3EUSA 2EBYA 2LYPA 4F8DA 4OB4A 2PUGA 2LYKA 1UTXA 2XCJA 3GN5A 2A6CA 3BDNA 4PU7A 1JFTA 2KPJA 1R69A 1LCCA 2IVQA 5K98B 3OQNA 2MQKA 3HZIB 2EWTA 4X4CA 3ZHIA 1EFAA 2PUEA 2XSDC 3DNVB 2XIUA 4O8BA 1RPEL 2AXVA 2FJRA 4Z58A 2PUBA 1UXCA 1ZZ7A 1YSEA 3GN5B 3KZ3A 1ZZCA 3OQMA 1RZRD 3IVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYJ A;  3SCH A;  4YG7 B;  4MCT A;  1PRA A;  1S7E A;  3F51 A;  4PU8 A;  1RZR A;  1LQC A;  2JVL A;  4X4F A;  1BDH A;  3D1N I;  1LCD A;  4NDW A;  3TRB A;  3G5G A;  1GT0 C;  3BD1 A;  1JH9 A;  1QQA A;  3G7D A;  1ZUG A;  3MLF A;  1Y7Y A;  2GRM A;  2D5V A;  2PUA A;  3FYA A;  1QP0 A;  3OP9 A;  2OFY A;  2KEI A;  2AXZ A;  2HIN A;  4IVZ A;  2PUD A;  4FBI A;  1NEQ A;  1ZS4 A;  1CQT A;  2LYL A;  2BNO A;  2LYS A;  3SCF A;  1PRU A;  2AXU A;  3S8Q A;  2IU7 A;  2CSF A;  4MCX A;  1ZVV A;  1XWR A;  4IWR A;  1R63 A;  2IUO A;  1POU A;  4I6T A;  1ZZ9 A;  2ICP A;  2O49 A;  4JCY A;  2XI8 A;  1ZZB A;  1PNR A;  1ZPQ A;  1ZZ8 A;  1X57 A;  1PRV A;  2PIJ A;  2PUC A;  4FN3 A;  1QP4 A;  2AUW A;  1HF0 A;  1OSL A;  3F52 A;  4I6R A;  2GZU A;  1ZZ6 A;  2LCV A;  3QQ6 A;  2MEZ A;  3BS3 A;  2R63 A;  3GBF A;  3JXC L;  2XJ3 A;  2KZ8 A;  3QYX A;  3QWG A;  1LMB 3;  1O4X A;  4X4I A;  1BDI A;  4Z5C A;  2B5A A;  1DW9 A;  1JFS A;  3F6W A;  4JQD A;  4YAR A;  1QP7 A;  2PE5 A;  2BJC A;  2GRL A;  2AW6 A;  3SCG A;  3B7H A;  2H8R A;  2EF8 A;  1AU7 A;  4PU3 C;  1IC8 A;  3UFD A;  2IVB A;  1WH8 A;  3R1F A;  4J1W A;  3H5T A;  1WIZ A;  2R1J L;  4YG4 A;  2BNM A;  3ZKC A;  1WH6 A;  4I8T A;  2BNN A;  1B0N A;  4GQM A;  4J1X A;  2WIU B;  3RZZ A;  1SQ8 A;  4GHJ A;  4X4E A;  2IV1 A;  3KXA A;  3CLC A;  2KEK A;  2LYQ A;  2LYR A;  2KEJ A;  4X4D A;  2OR1 L;  1X2L A;  3LIS A;  4JCX A;  1VPW A;  3KJX A;  4YG1 A;  4X4B A;  1NER A;  3L1P A;  1OCT C;  4Y42 A;  2PUF A;  1QPZ A;  1CJG A;  4X4G A;  4PU4 C;  2L8N A;  1E3O C;  4Z5D A;  4IA8 A;  3CRO L;  1DWK A;  2HSG A;  3U3W A;  1UXD A;  3JXB C;  4YBA A;  3FMY A;  1QQB A;  5A7L A;  3OQO A;  1JWL A;  1WET A;  3QF3 A;  3OMT A;  1ADR A;  2WUS R;  2CRO A;  1Y9Q A;  4Z59 A;  3FYM A;  1L1M A;  2L49 A;  1RZS A;  1LLI A;  4Z5H A;  1PER L;  3PXP A;  2IVG A;  3VK0 A;  2ICT A;  3CEC A;  2O4A A;  3O9X A;  1RIO A;  2JCG A;  2O38 A;  4X4H A;  3JXD L;  1ZAY A;  4I6U A;  3ZHM A;  2AWI A;  3LFP A;  2PPX A;  3EUS A;  2EBY A;  2LYP A;  4F8D A;  4OB4 A;  2PUG A;  2LYK A;  1UTX A;  2XCJ A;  3GN5 A;  2A6C A;  3BDN A;  4PU7 A;  1JFT A;  2KPJ A;  1R69 A;  1LCC A;  2IVQ A;  5K98 B;  3OQN A;  2MQK A;  3HZI B;  2EWT A;  4X4C A;  3ZHI A;  1EFA A;  2PUE A;  2XSD C;  3DNV B;  2XIU A;  4O8B A;  1RPE L;  2AXV A;  2FJR A;  4Z58 A;  2PUB A;  1UXC A;  1ZZ7 A;  1YSE A;  3GN5 B;  3KZ3 A;  1ZZC A;  3OQM A;  1RZR D;  3IVP A; 
#chains in the Genus database with same CATH topology
 4MCT A;  3F51 A;  3GZD C;  2JVL A;  3G5G A;  1QQA A;  1Y7Y A;  2D5V A;  2PUD A;  3R09 A;  2BNO A;  2CSF A;  1ZVV A;  1PNR A;  3F52 A;  4I6R A;  2R63 A;  2V3C C;  1LMB 3;  1BDI A;  2LNM A;  4Z5C A;  1DW9 A;  4ER3 A;  3F6W A;  1QP7 A;  2HCS A;  2H8R A;  3UFD A;  1WIZ A;  2PXT A;  4YG4 A;  4I8T A;  4J1X A;  2WIU B;  2IV1 A;  2KEJ A;  2L1P A;  4Y42 A;  4DE8 A;  4IA8 A;  1DWK A;  2HSG A;  3TEL A;  3JXB C;  4YBA A;  3OQO A;  2CRO A;  1L1M A;  4DE9 A;  1PER L;  4Z5H A;  3NRO A;  3CEC A;  4ER5 A;  3NXH A;  3LFP A;  2PPX A;  3EUS A;  4F8D A;  2LYP A;  5JUW A;  3PE5 A;  2LYK A;  2XCJ A;  3BDN A;  1LCC A;  2IVQ A;  3SX0 A;  2EWT A;  4X4C A;  2PXL A;  2LLW A;  1EFA A;  1NW3 A;  5GAH i;  2FJR A;  2PUB A;  2B5A A;  4YG7 B;  3QOX A;  4PU8 A;  4X4F A;  3A9Z A;  3BD1 A;  3G7D A;  1ZUG A;  3MLF A;  2GRM A;  1DUL A;  5DTQ A;  3A9Y A;  1QP0 A;  3OP9 A;  2KEI A;  4FBI A;  1ZS4 A;  2IUO A;  1POU A;  4ER6 A;  4JCY A;  4Q2J A;  2PXE A;  4EZI A;  3NDB B;  4FN3 A;  2AUW A;  2LCV A;  3QQ6 A;  3UWP A;  3BS3 A;  3GBF A;  3TFL A;  2AW6 A;  3B7H A;  1AU7 A;  2IVB A;  3R1F A;  3H5T A;  3ZKC A;  1WH6 A;  5DRT A;  3RZZ A;  4X4E A;  3KXA A;  3LIS A;  3KJX A;  4YG1 A;  4EKG A;  1HQ1 A;  2L8N A;  5DT2 A;  1UXD A;  1JWL A;  1WET A;  2L49 A;  3PXP A;  3ZHM A;  3JXD L;  3A9X A;  2PXB A;  4OBM A;  2HFZ A;  2LLV A;  1QZX A;  3GN5 A;  2PXQ A;  2KPJ A;  1R69 A;  3M9L A;  2MQK A;  3QFI A;  2ODR D;  3ZHI A;  4O8B A;  4Z58 A;  3ZPX A;  1UXC A;  1ZZ7 A;  2J7W A;  3OQM A;  1RZR D;  3SCH A;  1S7E A;  1LQC A;  1BDH A;  4NDW A;  3TRB A;  1GT0 C;  1JH9 A;  2PUA A;  2PXP A;  2HIN A;  2LYL A;  3TEP A;  1PRU A;  2IU7 A;  4MCX A;  1XWR A;  4IWR A;  1R63 A;  2PXK A;  2HCN A;  1ZZ9 A;  2M4H A;  5DTM A;  1ZPQ A;  1X57 A;  2YBD A;  1HF0 A;  1ZZ6 A;  3JXC L;  2XJ3 A;  4X4I A;  2XXQ A;  1JFS A;  4YAR A;  2BJC A;  2GRL A;  3LQX A;  2EF8 A;  1IC8 A;  3MEJ A;  2BNN A;  4GQM A;  1SQ8 A;  3CLC A;  2KEK A;  3OKZ A;  4X4D A;  2OR1 L;  1X2L A;  4JCX A;  1VPW A;  3KL4 A;  3ME5 A;  4X4B A;  4X4G A;  3DM5 A;  4Z5D A;  3U3W A;  3FMY A;  1ADR A;  3OMT A;  4HRA A;  2MXD A;  4Z59 A;  3FYM A;  1ZAY A;  4OB4 A;  2PUG A;  1UTX A;  3QOW A;  2A6C A;  2XSD C;  3DNV B;  2PXD A;  3VWS A;  1RPE L;  1U2Z A;  3GN5 B;  3KZ3 A;  1ZZC A;  2LYJ A;  1PRA A;  2FFH A;  1RZR A;  4WVL A;  3D1N I;  1LCD A;  3G0T A;  3OWQ A;  3FYA A;  4ER0 A;  2OFY A;  2J7U A;  2AXZ A;  4IVZ A;  1NEQ A;  1CQT A;  2LYS A;  3SCF A;  1MFQ C;  2AXU A;  3S8Q A;  2VEO A;  4I6T A;  2ICP A;  2O49 A;  2XI8 A;  1ZZB A;  1ZZ8 A;  1PRV A;  2PIJ A;  5DSX A;  1QP4 A;  1OSL A;  2GZU A;  2MEZ A;  5DTR A;  2KZ8 A;  3QYX A;  3QWG A;  5DRY A;  1O4X A;  4JQD A;  2PE5 A;  2XXA A;  3SCG A;  2PUC A;  4PU3 C;  1WH8 A;  4J1W A;  2R1J L;  2BNM A;  3GZC A;  1B0N A;  4EQZ A;  3GZD A;  4GHJ A;  4EK9 A;  5GAG i;  2LYQ A;  2LYR A;  1QB2 A;  1NER A;  3L1P A;  1OCT C;  2PUF A;  1QPZ A;  1CJG A;  4PU4 C;  1E3O C;  3CRO L;  3SR4 A;  2PXU A;  2JQE A;  1QQB A;  3NZL A;  5A7L A;  2PXV A;  3QF3 A;  2WUS R;  1Y9Q A;  1RZS A;  1LLI A;  2IVG A;  3VK0 A;  2ICT A;  4EKI A;  2O4A A;  3O9X A;  1RIO A;  2JCG A;  2O38 A;  4X4H A;  4I6U A;  2AWI A;  2XXP A;  2EBY A;  2PXF A;  4PU7 A;  1JFT A;  5K98 B;  3OQN A;  3GUU A;  3HZI B;  2PUE A;  2XIU A;  2AXV A;  4ER7 A;  1YSE A;  3IVP A; 
#chains in the Genus database with same CATH homology
 2LYJ A;  3SCH A;  4YG7 B;  4MCT A;  1PRA A;  1S7E A;  3F51 A;  4PU8 A;  1RZR A;  1LQC A;  2JVL A;  4X4F A;  1BDH A;  3D1N I;  1LCD A;  4NDW A;  3TRB A;  3G5G A;  1GT0 C;  3BD1 A;  1JH9 A;  1QQA A;  3G7D A;  1ZUG A;  3MLF A;  1Y7Y A;  2GRM A;  2D5V A;  2PUA A;  3FYA A;  1QP0 A;  3OP9 A;  2OFY A;  2KEI A;  2AXZ A;  2HIN A;  4IVZ A;  2PUD A;  4FBI A;  1NEQ A;  1ZS4 A;  1CQT A;  2LYL A;  2BNO A;  2LYS A;  3SCF A;  1PRU A;  2AXU A;  3S8Q A;  2IU7 A;  2CSF A;  4MCX A;  1ZVV A;  1XWR A;  4IWR A;  1R63 A;  2IUO A;  1POU A;  4I6T A;  1ZZ9 A;  2ICP A;  2O49 A;  4JCY A;  2XI8 A;  1ZZB A;  1PNR A;  1ZPQ A;  1ZZ8 A;  1X57 A;  1PRV A;  2PIJ A;  2PUC A;  4FN3 A;  1QP4 A;  2AUW A;  1HF0 A;  1OSL A;  3F52 A;  4I6R A;  2GZU A;  1ZZ6 A;  2LCV A;  3QQ6 A;  2MEZ A;  3BS3 A;  2R63 A;  3GBF A;  3JXC L;  2XJ3 A;  2KZ8 A;  3QYX A;  3QWG A;  1LMB 3;  1O4X A;  4X4I A;  1BDI A;  4Z5C A;  2B5A A;  1DW9 A;  1JFS A;  3F6W A;  4JQD A;  4YAR A;  1QP7 A;  2PE5 A;  2BJC A;  2GRL A;  2AW6 A;  3SCG A;  3B7H A;  2H8R A;  2EF8 A;  1AU7 A;  4PU3 C;  1IC8 A;  3UFD A;  2IVB A;  1WH8 A;  3R1F A;  4J1W A;  3H5T A;  1WIZ A;  2R1J L;  4YG4 A;  2BNM A;  3ZKC A;  1WH6 A;  4I8T A;  2BNN A;  1B0N A;  4GQM A;  4J1X A;  2WIU B;  3RZZ A;  1SQ8 A;  4GHJ A;  4X4E A;  2IV1 A;  3KXA A;  3CLC A;  2KEK A;  2LYQ A;  2LYR A;  2KEJ A;  4X4D A;  2OR1 L;  1X2L A;  3LIS A;  4JCX A;  1VPW A;  3KJX A;  4YG1 A;  4X4B A;  1NER A;  3L1P A;  1OCT C;  4Y42 A;  2PUF A;  1QPZ A;  1CJG A;  4X4G A;  4PU4 C;  2L8N A;  1E3O C;  4Z5D A;  4IA8 A;  3CRO L;  1DWK A;  2HSG A;  3U3W A;  1UXD A;  3JXB C;  4YBA A;  3FMY A;  1QQB A;  5A7L A;  3OQO A;  1JWL A;  1WET A;  3QF3 A;  3OMT A;  1ADR A;  2WUS R;  2CRO A;  1Y9Q A;  4Z59 A;  3FYM A;  1L1M A;  2L49 A;  1RZS A;  1LLI A;  4Z5H A;  1PER L;  3PXP A;  2IVG A;  3VK0 A;  2ICT A;  3CEC A;  2O4A A;  3O9X A;  1RIO A;  2JCG A;  2O38 A;  4X4H A;  3JXD L;  1ZAY A;  4I6U A;  3ZHM A;  2AWI A;  3LFP A;  2PPX A;  3EUS A;  2EBY A;  2LYP A;  4F8D A;  4OB4 A;  2PUG A;  2LYK A;  1UTX A;  2XCJ A;  3GN5 A;  2A6C A;  3BDN A;  4PU7 A;  1JFT A;  2KPJ A;  1R69 A;  1LCC A;  2IVQ A;  5K98 B;  3OQN A;  2MQK A;  3HZI B;  2EWT A;  4X4C A;  3ZHI A;  1EFA A;  2PUE A;  2XSD C;  3DNV B;  2XIU A;  4O8B A;  1RPE L;  2AXV A;  2FJR A;  4Z58 A;  2PUB A;  1UXC A;  1ZZ7 A;  1YSE A;  3GN5 B;  3KZ3 A;  1ZZC A;  3OQM A;  1RZR D;  3IVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...