2O49A

Crystal structure of the n-terminal cut domain of satb1 bound to matrix attachment region dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
84
structure length
84
Chain Sequence
EVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQSLLVNLRAMQNFLQLPEAERDRIYQDERERSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of the matrix attachment region of DNA by transcription factor SATB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DGP*DCP*DTP*DAP*DAP*DTP*DAP*DTP*DAP*DTP*DGP*DC)-3
total genus 34
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2o49A00
4GQMA 2PIJA 1ZAYA 2JVLA 2IU7A 2PUFA 2B5AA 1UXCA 2OFYA 2KEIA 1ZZ7A 1LCDA 2IVGA 4IVZA 1O4XA 3B7HA 1S7EA 4Z5DA 4O8BA 1OSLA 1JFTA 2JCGA 2PUEA 3BDNA 1JWLA 4IWRA 4J1WA 1PRUA 2KPJA 1ZZCA 2EF8A 4Z5HA 1WH6A 2AWIA 1XWRA 1QP4A 3SCGA 4FBIA 3FYAA 2XIUA 4F8DA 1PRVA 3O9XA 3KJXA 1NERA 1ADRA 3LISA 1WH8A 1ZVVA 3F51A 2KEJA 2OR1L 1QP0A 1ZUGA 2XSDC 3MLFA 1CJGA 1EFAA 3KXAA 4I6UA 3JXCL 3PXPA 1UXDA 3GN5A 4X4FA 1PNRA 2PUGA 4X4CA 2AUWA 1ZZ8A 1OCTC 3IVPA 1LMB3 2LYRA 2GZUA 2LYPA 3BD1A 4MCTA 2EWTA 4Z59A 4YARA 2BJCA 1WETA 3OQMA 3L1PA 2BNNA 3H5TA 4YG7B 4PU7A 3TRBA 1DW9A 3F52A 1DWKA 1RZRD 3LFPA 3G5GA 1B0NA 3ZHIA 4X4EA 2R1JL 1LCCA 2PUDA 1SQ8A 3F6WA 1ZZBA 4YG1A 2H8RA 2CROA 3QYXA 3UFDA 1ZPQA 3HZIB 2FJRA 2XJ3A 4JCXA 4X4GA 3KZ3A 3OQOA 3JXBC 1RZSA 1ZZ6A 2LCVA 2LYJA 3FMYA 2A6CA 2WUSR 3SCFA 2AW6A 1CQTA 4JCYA 4Z5CA 4OB4A 2LYLA 4JQDA 3QWGA 3CLCA 1QQAA 1BDIA 2CSFA 4NDWA 4X4BA 3RZZA 2L8NA 1ZS4A 2AXUA 4X4DA 2ICPA 2PE5A 2O4AA 3R1FA 1LLIA 2GRLA 2MQKA 2D5VA 4J1XA 1RZRA 2BNOA 2EBYA 2IV1A 3GN5B 3BS3A 1Y7YA 3S8QA 1Y9QA 2PUCA 2KEKA 1QQBA 4Z58A 1VPWA 1RPEL 4FN3A 3SCHA 2IVBA 2KZ8A 4PU8A 1LQCA 2BNMA 4IA8A 3G7DA 3D1NI 1R63A 1AU7A 1ZZ9A 3ZKCA 2L49A 1PRAA 3EUSA 3JXDL 4MCXA 4GHJA 5K98B 1JFSA 3ZHMA 1UTXA 2WIUB 1GT0C 1YSEA 3QQ6A 2LYQA 4PU3C 2LYKA 2O38A 1E3OC 2PUAA 1WIZA 3OMTA 1NEQA 4I6RA 2XCJA 1RIOA 2ICTA 1POUA 3OP9A 2AXZA 1L1MA 1QPZA 1R69A 3FYMA 4Y42A 3U3WA 4I6TA 2HINA 2GRMA 4X4IA 2IUOA 2PUBA 2MEZA 2HSGA 4I8TA 2R63A 4YG4A 4PU4C 3CROL 1QP7A 1PERL 5A7LA 1X57A 3OQNA 2PPXA 2O49A 1X2LA 1BDHA 3GBFA 3VK0A 2LYSA 1JH9A 1IC8A 3DNVB 4X4HA 3QF3A 4YBAA 3CECA 2IVQA 1HF0A 2XI8A 2AXVA
chains in the Genus database with same CATH superfamily
2B5AA 4ER7A 3KL4A 1UXCA 1O4XA 5DTRA 3TEPA 2AWIA 4EKGA 2HFZA 4FBIA 1U2ZA 1QP0A 1ZUGA 3UWPA 2PUGA 5DTMA 2LYPA 3BD1A 3L1PA 4YG7B 3NZLA 1DW9A 4DE8A 5DRTA 3G5GA 3ZHIA 3F6WA 1ZZBA 4YG1A 3UFDA 2FJRA 4EK9A 3DM5A 3KZ3A 3OQOA 2WUSR 4OB4A 2PXLA 3QWGA 3CLCA 1QQAA 2L8NA 1ZS4A 2XXAA 2GRLA 2BNOA 2IV1A 5GAGi 2KEKA 4Z58A 1RPEL 2KZ8A 4PU8A 1LQCA 4IA8A 5DRYA 2L49A 4MCXA 4GHJA 2WIUB 1GT0C 2LYQA 4PU3C 1E3OC 4EQZA 1NEQA 1RIOA 1HQ1A 1POUA 1QPZA 3FYMA 2HINA 4X4IA 2IUOA 4PU4C 2PXBA 3CROL 5A7LA 4ER3A 1JH9A 1IC8A 3DNVB 2PXPA 2XI8A 2VEOA 2AXVA 4GQMA 2IU7A 3G0TA 4EKIA 3A9YA 2KEIA 3B7HA 2PXQA 3BDNA 4IWRA 2MXDA 3QFIA 3GZDC 2YBDA 2EF8A 4Z5HA 1WH6A 1QP4A 3GZCA 3FYAA 2XIUA 3O9XA 1ADRA 1WH8A 3F51A 2KEJA 3SX0A 3MLFA 1CJGA 3KXAA 4I6UA 1DULA 3JXCL 3GN5A 4X4FA 3LQXA 4X4CA 2AUWA 1OCTC 3IVPA 1LMB3 3ME5A 2EWTA 1WETA 4PU7A 3F52A 3LFPA 1LCCA 2R1JL 4HRAA 3ZPXA 2XJ3A 5DTQA 4JCXA 1ZZ6A 2LCVA 2V3CC 2PXEA 2A6CA 3SCFA 1BDIA 2AXUA 2PE5A 2HCSA 3NXHA 1LLIA 3NDBB 2PXVA 1RZRA 1Y7YA 5JUWA 3S8QA 3TELA 3VWSA 3D1NI 3ZKCA 1JFSA 2PXTA 1UTXA 3ZHMA 1QZXA 2LYKA 3NROA 2ODRD 3MEJA 4I6RA 3OP9A 1L1MA 3U3WA 4I6TA 2PXFA 3GUUA 4I8TA 4ER6A 3TFLA 5DSXA 3OQNA 2PPXA 3GBFA 3VK0A 2XXQA 4X4HA 3QF3A 5GAHi 3CECA 2LNMA 2PIJA 1ZZ7A 2IVGA 1OSLA 4Z5DA 2PUEA 1JFTA 1PRUA 1ZZCA 4F8DA 3KJXA 1NERA 3LISA 3OKZA 1ZVVA 5DT2A 2LLVA 2XSDC 3PXPA 1PNRA 1ZZ8A 4Q2JA 2LYRA 4MCTA 2J7UA 2BJCA 4YARA 2XXPA 3TRBA 2HCNA 1DWKA 1RZRD 1B0NA 4X4EA 2PUDA 3QYXA 4OBMA 1ZPQA 3HZIB 4X4GA 3FMYA 2AW6A 3QOWA 2LLWA 4NDWA 3OWQA 4X4DA 3R1FA 2MQKA 2D5VA 2EBYA 3BS3A 1Y9QA 2PXUA 2PUCA 3SCHA 2IVBA 3G7DA 1R63A 3JXDL 5K98B 2JQEA 1YSEA 1WIZA 2L1PA 4DE9A 1R69A 3PE5A 2GRMA 2MEZA 2HSGA 2R63A 4YG4A 1PERL 2LYSA 4YBAA 1HF0A 1ZAYA 2JVLA 2PUFA 2OFYA 1LCDA 3A9XA 4IVZA 1S7EA 4O8BA 2JCGA 1JWLA 4J1WA 2KPJA 1XWRA 3SCGA 1PRVA 4EZIA 2OR1L 1EFAA 4WVLA 1UXDA 2GZUA 4Z59A 3OQMA 2BNNA 3H5TA 1NW3A 1QB2A 1SQ8A 2H8RA 3A9ZA 2CROA 2J7WA 2PXDA 3JXBC 1RZSA 2LYJA 4JCYA 1CQTA 3R09A 4Z5CA 1MFQC 2LYLA 4JQDA 2CSFA 4ER0A 4X4BA 3RZZA 2ICPA 2O4AA 3QOXA 4J1XA 3GN5B 4ER5A 1QQBA 3M9LA 2M4HA 1VPWA 4FN3A 2BNMA 1AU7A 1ZZ9A 1PRAA 3EUSA 2PXKA 3QQ6A 2PUAA 2O38A 3OMTA 2XCJA 2ICTA 2AXZA 4Y42A 2PUBA 3GZDA 2FFHA 1QP7A 1X57A 2O49A 1X2LA 1BDHA 2IVQA 3SR4A
chains in the Genus database with same CATH topology
4GQMA 2PIJA 1ZAYA 2JVLA 2IU7A 2PUFA 2B5AA 1UXCA 2OFYA 2KEIA 1ZZ7A 1LCDA 2IVGA 4IVZA 1O4XA 3B7HA 1S7EA 4Z5DA 4O8BA 1OSLA 1JFTA 2JCGA 2PUEA 3BDNA 1JWLA 4IWRA 4J1WA 1PRUA 2KPJA 1ZZCA 2EF8A 4Z5HA 1WH6A 2AWIA 1XWRA 1QP4A 3SCGA 4FBIA 3FYAA 2XIUA 4F8DA 1PRVA 3O9XA 3KJXA 1NERA 1ADRA 3LISA 1WH8A 1ZVVA 3F51A 2KEJA 2OR1L 1QP0A 1ZUGA 2XSDC 3MLFA 1CJGA 1EFAA 3KXAA 4I6UA 3JXCL 3PXPA 1UXDA 3GN5A 4X4FA 1PNRA 2PUGA 4X4CA 2AUWA 1ZZ8A 1OCTC 3IVPA 1LMB3 2LYRA 2GZUA 2LYPA 3BD1A 4MCTA 2EWTA 4Z59A 4YARA 2BJCA 1WETA 3OQMA 3L1PA 2BNNA 3H5TA 4YG7B 4PU7A 3TRBA 1DW9A 3F52A 1DWKA 1RZRD 3LFPA 3G5GA 1B0NA 3ZHIA 4X4EA 2R1JL 1LCCA 2PUDA 1SQ8A 3F6WA 1ZZBA 4YG1A 2H8RA 2CROA 3QYXA 3UFDA 1ZPQA 3HZIB 2FJRA 2XJ3A 4JCXA 4X4GA 3KZ3A 3OQOA 3JXBC 1RZSA 1ZZ6A 2LCVA 2LYJA 3FMYA 2A6CA 2WUSR 3SCFA 2AW6A 1CQTA 4JCYA 4Z5CA 4OB4A 2LYLA 4JQDA 3QWGA 3CLCA 1QQAA 1BDIA 2CSFA 4NDWA 4X4BA 3RZZA 2L8NA 1ZS4A 2AXUA 4X4DA 2ICPA 2PE5A 2O4AA 3R1FA 1LLIA 2GRLA 2MQKA 2D5VA 4J1XA 1RZRA 2BNOA 2EBYA 2IV1A 3GN5B 3BS3A 1Y7YA 3S8QA 1Y9QA 2PUCA 2KEKA 1QQBA 4Z58A 1VPWA 1RPEL 4FN3A 3SCHA 2IVBA 2KZ8A 4PU8A 1LQCA 2BNMA 4IA8A 3G7DA 3D1NI 1R63A 1AU7A 1ZZ9A 3ZKCA 2L49A 1PRAA 3EUSA 3JXDL 4MCXA 4GHJA 5K98B 1JFSA 3ZHMA 1UTXA 2WIUB 1GT0C 1YSEA 3QQ6A 2LYQA 4PU3C 2LYKA 2O38A 1E3OC 2PUAA 1WIZA 3OMTA 1NEQA 4I6RA 2XCJA 1RIOA 2ICTA 1POUA 3OP9A 2AXZA 1L1MA 1QPZA 1R69A 3FYMA 4Y42A 3U3WA 4I6TA 2HINA 2GRMA 4X4IA 2IUOA 2PUBA 2MEZA 2HSGA 4I8TA 2R63A 4YG4A 4PU4C 3CROL 1QP7A 1PERL 5A7LA 1X57A 3OQNA 2PPXA 2O49A 1X2LA 1BDHA 3GBFA 3VK0A 2LYSA 1JH9A 1IC8A 3DNVB 4X4HA 3QF3A 4YBAA 3CECA 2IVQA 1HF0A 2XI8A 2AXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GQM A;  2PIJ A;  1ZAY A;  2JVL A;  2IU7 A;  2PUF A;  2B5A A;  1UXC A;  2OFY A;  2KEI A;  1ZZ7 A;  1LCD A;  2IVG A;  4IVZ A;  1O4X A;  3B7H A;  1S7E A;  4Z5D A;  4O8B A;  1OSL A;  1JFT A;  2JCG A;  2PUE A;  3BDN A;  1JWL A;  4IWR A;  4J1W A;  1PRU A;  2KPJ A;  1ZZC A;  2EF8 A;  4Z5H A;  1WH6 A;  2AWI A;  1XWR A;  1QP4 A;  3SCG A;  4FBI A;  3FYA A;  2XIU A;  4F8D A;  1PRV A;  3O9X A;  3KJX A;  1NER A;  1ADR A;  3LIS A;  1WH8 A;  1ZVV A;  3F51 A;  2KEJ A;  2OR1 L;  1QP0 A;  1ZUG A;  2XSD C;  3MLF A;  1CJG A;  1EFA A;  3KXA A;  4I6U A;  3JXC L;  3PXP A;  1UXD A;  3GN5 A;  4X4F A;  1PNR A;  2PUG A;  4X4C A;  2AUW A;  1ZZ8 A;  1OCT C;  3IVP A;  1LMB 3;  2LYR A;  2GZU A;  2LYP A;  3BD1 A;  4MCT A;  2EWT A;  4Z59 A;  4YAR A;  2BJC A;  1WET A;  3OQM A;  3L1P A;  2BNN A;  3H5T A;  4YG7 B;  4PU7 A;  3TRB A;  1DW9 A;  3F52 A;  1DWK A;  1RZR D;  3LFP A;  3G5G A;  1B0N A;  3ZHI A;  4X4E A;  2R1J L;  1LCC A;  2PUD A;  1SQ8 A;  3F6W A;  1ZZB A;  4YG1 A;  2H8R A;  2CRO A;  3QYX A;  3UFD A;  1ZPQ A;  3HZI B;  2FJR A;  2XJ3 A;  4JCX A;  4X4G A;  3KZ3 A;  3OQO A;  3JXB C;  1RZS A;  1ZZ6 A;  2LCV A;  2LYJ A;  3FMY A;  2A6C A;  2WUS R;  3SCF A;  2AW6 A;  1CQT A;  4JCY A;  4Z5C A;  4OB4 A;  2LYL A;  4JQD A;  3QWG A;  3CLC A;  1QQA A;  1BDI A;  2CSF A;  4NDW A;  4X4B A;  3RZZ A;  2L8N A;  1ZS4 A;  2AXU A;  4X4D A;  2ICP A;  2PE5 A;  2O4A A;  3R1F A;  1LLI A;  2GRL A;  2MQK A;  2D5V A;  4J1X A;  1RZR A;  2BNO A;  2EBY A;  2IV1 A;  3GN5 B;  3BS3 A;  1Y7Y A;  3S8Q A;  1Y9Q A;  2PUC A;  2KEK A;  1QQB A;  4Z58 A;  1VPW A;  1RPE L;  4FN3 A;  3SCH A;  2IVB A;  2KZ8 A;  4PU8 A;  1LQC A;  2BNM A;  4IA8 A;  3G7D A;  3D1N I;  1R63 A;  1AU7 A;  1ZZ9 A;  3ZKC A;  2L49 A;  1PRA A;  3EUS A;  3JXD L;  4MCX A;  4GHJ A;  5K98 B;  1JFS A;  3ZHM A;  1UTX A;  2WIU B;  1GT0 C;  1YSE A;  3QQ6 A;  2LYQ A;  4PU3 C;  2LYK A;  2O38 A;  1E3O C;  2PUA A;  1WIZ A;  3OMT A;  1NEQ A;  4I6R A;  2XCJ A;  1RIO A;  2ICT A;  1POU A;  3OP9 A;  2AXZ A;  1L1M A;  1QPZ A;  1R69 A;  3FYM A;  4Y42 A;  3U3W A;  4I6T A;  2HIN A;  2GRM A;  4X4I A;  2IUO A;  2PUB A;  2MEZ A;  2HSG A;  4I8T A;  2R63 A;  4YG4 A;  4PU4 C;  3CRO L;  1QP7 A;  1PER L;  5A7L A;  1X57 A;  3OQN A;  2PPX A;  2O49 A;  1X2L A;  1BDH A;  3GBF A;  3VK0 A;  2LYS A;  1JH9 A;  1IC8 A;  3DNV B;  4X4H A;  3QF3 A;  4YBA A;  3CEC A;  2IVQ A;  1HF0 A;  2XI8 A;  2AXV A; 
#chains in the Genus database with same CATH topology
 2B5A A;  4ER7 A;  3KL4 A;  1UXC A;  1O4X A;  5DTR A;  3TEP A;  2AWI A;  4EKG A;  2HFZ A;  4FBI A;  1U2Z A;  1QP0 A;  1ZUG A;  3UWP A;  2PUG A;  5DTM A;  2LYP A;  3BD1 A;  3L1P A;  4YG7 B;  3NZL A;  1DW9 A;  4DE8 A;  5DRT A;  3G5G A;  3ZHI A;  3F6W A;  1ZZB A;  4YG1 A;  3UFD A;  2FJR A;  4EK9 A;  3DM5 A;  3KZ3 A;  3OQO A;  2WUS R;  4OB4 A;  2PXL A;  3QWG A;  3CLC A;  1QQA A;  2L8N A;  1ZS4 A;  2XXA A;  2GRL A;  2BNO A;  2IV1 A;  5GAG i;  2KEK A;  4Z58 A;  1RPE L;  2KZ8 A;  4PU8 A;  1LQC A;  4IA8 A;  5DRY A;  2L49 A;  4MCX A;  4GHJ A;  2WIU B;  1GT0 C;  2LYQ A;  4PU3 C;  1E3O C;  4EQZ A;  1NEQ A;  1RIO A;  1HQ1 A;  1POU A;  1QPZ A;  3FYM A;  2HIN A;  4X4I A;  2IUO A;  4PU4 C;  2PXB A;  3CRO L;  5A7L A;  4ER3 A;  1JH9 A;  1IC8 A;  3DNV B;  2PXP A;  2XI8 A;  2VEO A;  2AXV A;  4GQM A;  2IU7 A;  3G0T A;  4EKI A;  3A9Y A;  2KEI A;  3B7H A;  2PXQ A;  3BDN A;  4IWR A;  2MXD A;  3QFI A;  3GZD C;  2YBD A;  2EF8 A;  4Z5H A;  1WH6 A;  1QP4 A;  3GZC A;  3FYA A;  2XIU A;  3O9X A;  1ADR A;  1WH8 A;  3F51 A;  2KEJ A;  3SX0 A;  3MLF A;  1CJG A;  3KXA A;  4I6U A;  1DUL A;  3JXC L;  3GN5 A;  4X4F A;  3LQX A;  4X4C A;  2AUW A;  1OCT C;  3IVP A;  1LMB 3;  3ME5 A;  2EWT A;  1WET A;  4PU7 A;  3F52 A;  3LFP A;  1LCC A;  2R1J L;  4HRA A;  3ZPX A;  2XJ3 A;  5DTQ A;  4JCX A;  1ZZ6 A;  2LCV A;  2V3C C;  2PXE A;  2A6C A;  3SCF A;  1BDI A;  2AXU A;  2PE5 A;  2HCS A;  3NXH A;  1LLI A;  3NDB B;  2PXV A;  1RZR A;  1Y7Y A;  5JUW A;  3S8Q A;  3TEL A;  3VWS A;  3D1N I;  3ZKC A;  1JFS A;  2PXT A;  1UTX A;  3ZHM A;  1QZX A;  2LYK A;  3NRO A;  2ODR D;  3MEJ A;  4I6R A;  3OP9 A;  1L1M A;  3U3W A;  4I6T A;  2PXF A;  3GUU A;  4I8T A;  4ER6 A;  3TFL A;  5DSX A;  3OQN A;  2PPX A;  3GBF A;  3VK0 A;  2XXQ A;  4X4H A;  3QF3 A;  5GAH i;  3CEC A;  2LNM A;  2PIJ A;  1ZZ7 A;  2IVG A;  1OSL A;  4Z5D A;  2PUE A;  1JFT A;  1PRU A;  1ZZC A;  4F8D A;  3KJX A;  1NER A;  3LIS A;  3OKZ A;  1ZVV A;  5DT2 A;  2LLV A;  2XSD C;  3PXP A;  1PNR A;  1ZZ8 A;  4Q2J A;  2LYR A;  4MCT A;  2J7U A;  2BJC A;  4YAR A;  2XXP A;  3TRB A;  2HCN A;  1DWK A;  1RZR D;  1B0N A;  4X4E A;  2PUD A;  3QYX A;  4OBM A;  1ZPQ A;  3HZI B;  4X4G A;  3FMY A;  2AW6 A;  3QOW A;  2LLW A;  4NDW A;  3OWQ A;  4X4D A;  3R1F A;  2MQK A;  2D5V A;  2EBY A;  3BS3 A;  1Y9Q A;  2PXU A;  2PUC A;  3SCH A;  2IVB A;  3G7D A;  1R63 A;  3JXD L;  5K98 B;  2JQE A;  1YSE A;  1WIZ A;  2L1P A;  4DE9 A;  1R69 A;  3PE5 A;  2GRM A;  2MEZ A;  2HSG A;  2R63 A;  4YG4 A;  1PER L;  2LYS A;  4YBA A;  1HF0 A;  1ZAY A;  2JVL A;  2PUF A;  2OFY A;  1LCD A;  3A9X A;  4IVZ A;  1S7E A;  4O8B A;  2JCG A;  1JWL A;  4J1W A;  2KPJ A;  1XWR A;  3SCG A;  1PRV A;  4EZI A;  2OR1 L;  1EFA A;  4WVL A;  1UXD A;  2GZU A;  4Z59 A;  3OQM A;  2BNN A;  3H5T A;  1NW3 A;  1QB2 A;  1SQ8 A;  2H8R A;  3A9Z A;  2CRO A;  2J7W A;  2PXD A;  3JXB C;  1RZS A;  2LYJ A;  4JCY A;  1CQT A;  3R09 A;  4Z5C A;  1MFQ C;  2LYL A;  4JQD A;  2CSF A;  4ER0 A;  4X4B A;  3RZZ A;  2ICP A;  2O4A A;  3QOX A;  4J1X A;  3GN5 B;  4ER5 A;  1QQB A;  3M9L A;  2M4H A;  1VPW A;  4FN3 A;  2BNM A;  1AU7 A;  1ZZ9 A;  1PRA A;  3EUS A;  2PXK A;  3QQ6 A;  2PUA A;  2O38 A;  3OMT A;  2XCJ A;  2ICT A;  2AXZ A;  4Y42 A;  2PUB A;  3GZD A;  2FFH A;  1QP7 A;  1X57 A;  2O49 A;  1X2L A;  1BDH A;  2IVQ A;  3SR4 A; 
#chains in the Genus database with same CATH homology
 4GQM A;  2PIJ A;  1ZAY A;  2JVL A;  2IU7 A;  2PUF A;  2B5A A;  1UXC A;  2OFY A;  2KEI A;  1ZZ7 A;  1LCD A;  2IVG A;  4IVZ A;  1O4X A;  3B7H A;  1S7E A;  4Z5D A;  4O8B A;  1OSL A;  1JFT A;  2JCG A;  2PUE A;  3BDN A;  1JWL A;  4IWR A;  4J1W A;  1PRU A;  2KPJ A;  1ZZC A;  2EF8 A;  4Z5H A;  1WH6 A;  2AWI A;  1XWR A;  1QP4 A;  3SCG A;  4FBI A;  3FYA A;  2XIU A;  4F8D A;  1PRV A;  3O9X A;  3KJX A;  1NER A;  1ADR A;  3LIS A;  1WH8 A;  1ZVV A;  3F51 A;  2KEJ A;  2OR1 L;  1QP0 A;  1ZUG A;  2XSD C;  3MLF A;  1CJG A;  1EFA A;  3KXA A;  4I6U A;  3JXC L;  3PXP A;  1UXD A;  3GN5 A;  4X4F A;  1PNR A;  2PUG A;  4X4C A;  2AUW A;  1ZZ8 A;  1OCT C;  3IVP A;  1LMB 3;  2LYR A;  2GZU A;  2LYP A;  3BD1 A;  4MCT A;  2EWT A;  4Z59 A;  4YAR A;  2BJC A;  1WET A;  3OQM A;  3L1P A;  2BNN A;  3H5T A;  4YG7 B;  4PU7 A;  3TRB A;  1DW9 A;  3F52 A;  1DWK A;  1RZR D;  3LFP A;  3G5G A;  1B0N A;  3ZHI A;  4X4E A;  2R1J L;  1LCC A;  2PUD A;  1SQ8 A;  3F6W A;  1ZZB A;  4YG1 A;  2H8R A;  2CRO A;  3QYX A;  3UFD A;  1ZPQ A;  3HZI B;  2FJR A;  2XJ3 A;  4JCX A;  4X4G A;  3KZ3 A;  3OQO A;  3JXB C;  1RZS A;  1ZZ6 A;  2LCV A;  2LYJ A;  3FMY A;  2A6C A;  2WUS R;  3SCF A;  2AW6 A;  1CQT A;  4JCY A;  4Z5C A;  4OB4 A;  2LYL A;  4JQD A;  3QWG A;  3CLC A;  1QQA A;  1BDI A;  2CSF A;  4NDW A;  4X4B A;  3RZZ A;  2L8N A;  1ZS4 A;  2AXU A;  4X4D A;  2ICP A;  2PE5 A;  2O4A A;  3R1F A;  1LLI A;  2GRL A;  2MQK A;  2D5V A;  4J1X A;  1RZR A;  2BNO A;  2EBY A;  2IV1 A;  3GN5 B;  3BS3 A;  1Y7Y A;  3S8Q A;  1Y9Q A;  2PUC A;  2KEK A;  1QQB A;  4Z58 A;  1VPW A;  1RPE L;  4FN3 A;  3SCH A;  2IVB A;  2KZ8 A;  4PU8 A;  1LQC A;  2BNM A;  4IA8 A;  3G7D A;  3D1N I;  1R63 A;  1AU7 A;  1ZZ9 A;  3ZKC A;  2L49 A;  1PRA A;  3EUS A;  3JXD L;  4MCX A;  4GHJ A;  5K98 B;  1JFS A;  3ZHM A;  1UTX A;  2WIU B;  1GT0 C;  1YSE A;  3QQ6 A;  2LYQ A;  4PU3 C;  2LYK A;  2O38 A;  1E3O C;  2PUA A;  1WIZ A;  3OMT A;  1NEQ A;  4I6R A;  2XCJ A;  1RIO A;  2ICT A;  1POU A;  3OP9 A;  2AXZ A;  1L1M A;  1QPZ A;  1R69 A;  3FYM A;  4Y42 A;  3U3W A;  4I6T A;  2HIN A;  2GRM A;  4X4I A;  2IUO A;  2PUB A;  2MEZ A;  2HSG A;  4I8T A;  2R63 A;  4YG4 A;  4PU4 C;  3CRO L;  1QP7 A;  1PER L;  5A7L A;  1X57 A;  3OQN A;  2PPX A;  2O49 A;  1X2L A;  1BDH A;  3GBF A;  3VK0 A;  2LYS A;  1JH9 A;  1IC8 A;  3DNV B;  4X4H A;  3QF3 A;  4YBA A;  3CEC A;  2IVQ A;  1HF0 A;  2XI8 A;  2AXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...