2O4AA

Crystal structure of the n-terminal cut domain of satb1 bound to matrix attachment region dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
84
Chain Sequence
EVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQSLLVNLRAMQNFLQLPEAERDRIYQDERERSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of the matrix attachment region of DNA by transcription factor SATB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DGP*DCP*DTP*DAP*DAP*DTP*DAP*DTP*DAP*DTP*DGP*DC)-3
total genus 31
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2o4aA00
3OQOA 3R1FA 4Y42A 1GT0C 1PRVA 4YG1A 1ZZ8A 1LCDA 3FMYA 2R63A 4OB4A 3DNVB 4MCTA 1X57A 2IVBA 3JXDL 4JCYA 2MQKA 3BD1A 3OMTA 1QP4A 3H5TA 1LQCA 1ADRA 2LYLA 2OR1L 1HF0A 4MCXA 1QQAA 1POUA 3OQNA 2FJRA 3G5GA 4I6TA 1EFAA 2KPJA 1R69A 3KZ3A 4IWRA 1LLIA 2LYQA 2L8NA 3CLCA 2ICTA 1SQ8A 4I6RA 4X4FA 2EWTA 3MLFA 1RPEL 2HSGA 1RZSA 2AUWA 4YARA 2O4AA 2IVGA 3KJXA 3SCGA 3GN5B 3UFDA 4IA8A 1JWLA 3OQMA 1UXDA 1BDIA 3FYAA 2EF8A 1DW9A 3BS3A 3SCHA 3S8QA 2XJ3A 4X4IA 1PRAA 1OSLA 4JQDA 1NERA 1DWKA 3QYXA 4I8TA 2KEKA 2LYJA 2PUGA 4I6UA 4J1XA 4X4BA 4Z58A 2PE5A 1JFTA 2KZ8A 1LCCA 3GN5A 2PUDA 1RZRD 2H8RA 4X4CA 2O38A 1WETA 2AWIA 4F8DA 2L49A 3O9XA 2AW6A 4IVZA 4PU8A 4JCXA 2BNMA 2GZUA 3KXAA 1CJGA 3GBFA 3F51A 3B7HA 2AXZA 4PU7A 1NEQA 2XIUA 2AXVA 1PNRA 2BNOA 2LCVA 1ZZ9A 3QF3A 2CSFA 3JXCL 2ICPA 4X4EA 4X4HA 1UTXA 2WIUB 2BNNA 5A7LA 2XSDC 1ZVVA 2IVQA 2PIJA 2XCJA 1ZUGA 1L1MA 4FN3A 1Y7YA 2LYRA 1ZZBA 3ZHIA 3TRBA 2LYSA 4YG4A 2PUEA 3QWGA 4J1WA 3VK0A 3LFPA 1ZS4A 2AXUA 1ZAYA 1X2LA 2GRLA 5K98B 3OP9A 1LMB3 3F52A 2LYKA 1JH9A 1QPZA 2BJCA 4X4GA 3F6WA 3ZHMA 2GRMA 2PPXA 1CQTA 1R63A 1WH8A 4YBAA 1IC8A 2PUCA 3IVPA 2MEZA 1OCTC 1RZRA 3HZIB 1ZZCA 3PXPA 2B5AA 1ZZ6A 1B0NA 4FBIA 2KEIA 2JVLA 1PRUA 4Z5CA 2EBYA 2R1JL 3LISA 3ZKCA 2KEJA 1WIZA 3CROL 1XWRA 2HINA 3U3WA 2CROA 1E3OC 1S7EA 2OFYA 2PUBA 1Y9QA 2WUSR 2IV1A 4GQMA 1RIOA 1BDHA 2D5VA 4PU4C 3BDNA 2PUFA 2O49A 1AU7A 1VPWA 1O4XA 1QP7A 3CECA 1WH6A 1JFSA 2LYPA 3EUSA 4GHJA 3D1NI 4Z5HA 2JCGA 3L1PA 3JXBC 1YSEA 1QP0A 1PERL 2XI8A 4PU3C 2IUOA 4O8BA 3QQ6A 3G7DA 4YG7B 3RZZA 2PUAA 2IU7A 4Z5DA 4X4DA 1QQBA 3SCFA 4NDWA 1ZPQA 1ZZ7A 4Z59A 2A6CA 3FYMA 1UXCA
chains in the Genus database with same CATH superfamily
2L1PA 1X57A 2IVBA 2MQKA 1QP4A 3OMTA 3UWPA 1EFAA 2FJRA 4I6TA 1R69A 2J7WA 2LYQA 2ICTA 3MLFA 1RPEL 4YARA 2PXLA 3KJXA 3OQMA 2EF8A 3BS3A 4X4BA 2HFZA 4Z58A 2KZ8A 2PUDA 2O38A 2LNMA 2GZUA 3KXAA 3SR4A 2XIUA 3VWSA 2LCVA 2ICPA 1ZVVA 3LQXA 2IVQA 1Y7YA 5JUWA 1ZZBA 3TRBA 4OBMA 3VK0A 3LFPA 3OP9A 1JH9A 2LYKA 5DTQA 1CQTA 2PPXA 4YBAA 2MEZA 3PXPA 2KEIA 1PRUA 2EBYA 3LISA 3ZKCA 2KEJA 2PXBA 3CROL 2HINA 3U3WA 1S7EA 2PXUA 3A9YA 4GQMA 1RIOA 2O49A 3BDNA 2V3CC 1O4XA 1QP7A 3CECA 4Z5HA 3L1PA 3GZCA 4DE8A 4PU3C 2IUOA 1NW3A 1UXCA 4Y42A 1GT0C 1PRVA 2PXEA 2R63A 4OB4A 4ER7A 4JCYA 3H5TA 4MCXA 2PXKA 1LLIA 1RZSA 2O4AA 1BDIA 4EZIA 3S8QA 3GUUA 2PXFA 3QFIA 5DT2A 2KEKA 4I6UA 2J7UA 3PE5A 3GN5A 1RZRD 4X4CA 3M9LA 4F8DA 2AW6A 4IVZA 4PU8A 2HCSA 2BNMA 1CJGA 3GZDA 4ER6A 3DM5A 2CSFA 2WIUB 5A7LA 2FFHA 1L1MA 2JQEA 3ZHIA 2LYSA 4ER3A 2AXUA 5K98B 2BJCA 2PXPA 1MFQC 1R63A 2MXDA 1WH8A 2PUCA 1IC8A 1OCTC 3HZIB 1ZZCA 2B5AA 4Z5CA 5DSXA 1WIZA 1E3OC 2OFYA 2D5VA 1QZXA 2PUFA 1YSEA 3NXHA 2PXQA 2XI8A 5GAGi 3TEPA 3QQ6A 3SCFA 4NDWA 1ZZ7A 2LLWA 3OQOA 3R1FA 1LCDA 3FMYA 3TELA 3BD1A 1LQCA 5DTMA 3KZ3A 4IWRA 3G0TA 2L8NA 3CLCA 1SQ8A 3OKZA 5DTRA 2EWTA 2HSGA 3SCGA 3GN5B 3UFDA 1JWLA 1UXDA 3GZDC 1DW9A 1OSLA 1NERA 3QYXA 2LYJA 4J1XA 1LCCA 2HCNA 4JCXA 3GBFA 3F51A 2AXZA 1NEQA 1PNRA 1ZZ9A 3JXCL 4X4EA 4X4HA 2XSDC 2BNNA 2XCJA 1ZUGA 4EKIA 4YG4A 4J1WA 1ZAYA 2GRLA 4EKGA 1LMB3 3ZPXA 1QPZA 4X4GA 3ZHMA 2GRMA 2XXPA 3IVPA 4EK9A 3NROA 4EQZA 1RZRA 1B0NA 4FBIA 2JVLA 2R1JL 1XWRA 3OWQA 2YBDA 4Q2JA 2PUBA 1Y9QA 2IV1A 4PU4C 1AU7A 1JFSA 1WH6A 3ME5A 4WVLA 2LYPA 3EUSA 4GHJA 3JXBC 1QP0A 3G7DA 2PUAA 2IU7A 4Z5DA 1QQBA 1ZPQA 2LLVA 4YG1A 1ZZ8A 3DNVB 4MCTA 3JXDL 1ADRA 3QOXA 2LYLA 2OR1L 1QB2A 1HF0A 1QQAA 2PXVA 1POUA 3OQNA 3G5GA 2KPJA 4I6RA 4X4FA 2AUWA 2IVGA 3SX0A 4IA8A 3FYAA 3SCHA 2XJ3A 4X4IA 1PRAA 4JQDA 1DWKA 3QOWA 4I8TA 5DRYA 2PUGA 2PE5A 1JFTA 2H8RA 1WETA 2AWIA 3O9XA 2L49A 3B7HA 2PXDA 3A9XA 4PU7A 2AXVA 2BNOA 3QF3A 1UTXA 2PIJA 1U2ZA 4FN3A 2LYRA 2VEOA 2M4HA 3KL4A 2PUEA 3QWGA 1DULA 1ZS4A 1X2LA 3F52A 3A9ZA 3F6WA 3MEJA 3NZLA 4HRAA 2ODRD 3TFLA 4ER5A 1ZZ6A 4DE9A 2XXQA 2CROA 2WUSR 1HQ1A 1BDHA 5GAHi 2PXTA 1VPWA 2XXAA 4ER0A 5DRTA 3D1NI 3NDBB 2JCGA 3R09A 1PERL 4O8BA 4YG7B 3RZZA 4X4DA 4Z59A 2A6CA 3FYMA
chains in the Genus database with same CATH topology
3OQOA 3R1FA 4Y42A 1GT0C 1PRVA 4YG1A 1ZZ8A 1LCDA 3FMYA 2R63A 4OB4A 3DNVB 4MCTA 1X57A 2IVBA 3JXDL 4JCYA 2MQKA 3BD1A 3OMTA 1QP4A 3H5TA 1LQCA 1ADRA 2LYLA 2OR1L 1HF0A 4MCXA 1QQAA 1POUA 3OQNA 2FJRA 3G5GA 4I6TA 1EFAA 2KPJA 1R69A 3KZ3A 4IWRA 1LLIA 2LYQA 2L8NA 3CLCA 2ICTA 1SQ8A 4I6RA 4X4FA 2EWTA 3MLFA 1RPEL 2HSGA 1RZSA 2AUWA 4YARA 2O4AA 2IVGA 3KJXA 3SCGA 3GN5B 3UFDA 4IA8A 1JWLA 3OQMA 1UXDA 1BDIA 3FYAA 2EF8A 1DW9A 3BS3A 3SCHA 3S8QA 2XJ3A 4X4IA 1PRAA 1OSLA 4JQDA 1NERA 1DWKA 3QYXA 4I8TA 2KEKA 2LYJA 2PUGA 4I6UA 4J1XA 4X4BA 4Z58A 2PE5A 1JFTA 2KZ8A 1LCCA 3GN5A 2PUDA 1RZRD 2H8RA 4X4CA 2O38A 1WETA 2AWIA 4F8DA 2L49A 3O9XA 2AW6A 4IVZA 4PU8A 4JCXA 2BNMA 2GZUA 3KXAA 1CJGA 3GBFA 3F51A 3B7HA 2AXZA 4PU7A 1NEQA 2XIUA 2AXVA 1PNRA 2BNOA 2LCVA 1ZZ9A 3QF3A 2CSFA 3JXCL 2ICPA 4X4EA 4X4HA 1UTXA 2WIUB 2BNNA 5A7LA 2XSDC 1ZVVA 2IVQA 2PIJA 2XCJA 1ZUGA 1L1MA 4FN3A 1Y7YA 2LYRA 1ZZBA 3ZHIA 3TRBA 2LYSA 4YG4A 2PUEA 3QWGA 4J1WA 3VK0A 3LFPA 1ZS4A 2AXUA 1ZAYA 1X2LA 2GRLA 5K98B 3OP9A 1LMB3 3F52A 2LYKA 1JH9A 1QPZA 2BJCA 4X4GA 3F6WA 3ZHMA 2GRMA 2PPXA 1CQTA 1R63A 1WH8A 4YBAA 1IC8A 2PUCA 3IVPA 2MEZA 1OCTC 1RZRA 3HZIB 1ZZCA 3PXPA 2B5AA 1ZZ6A 1B0NA 4FBIA 2KEIA 2JVLA 1PRUA 4Z5CA 2EBYA 2R1JL 3LISA 3ZKCA 2KEJA 1WIZA 3CROL 1XWRA 2HINA 3U3WA 2CROA 1E3OC 1S7EA 2OFYA 2PUBA 1Y9QA 2WUSR 2IV1A 4GQMA 1RIOA 1BDHA 2D5VA 4PU4C 3BDNA 2PUFA 2O49A 1AU7A 1VPWA 1O4XA 1QP7A 3CECA 1WH6A 1JFSA 2LYPA 3EUSA 4GHJA 3D1NI 4Z5HA 2JCGA 3L1PA 3JXBC 1YSEA 1QP0A 1PERL 2XI8A 4PU3C 2IUOA 4O8BA 3QQ6A 3G7DA 4YG7B 3RZZA 2PUAA 2IU7A 4Z5DA 4X4DA 1QQBA 3SCFA 4NDWA 1ZPQA 1ZZ7A 4Z59A 2A6CA 3FYMA 1UXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OQO A;  3R1F A;  4Y42 A;  1GT0 C;  1PRV A;  4YG1 A;  1ZZ8 A;  1LCD A;  3FMY A;  2R63 A;  4OB4 A;  3DNV B;  4MCT A;  1X57 A;  2IVB A;  3JXD L;  4JCY A;  2MQK A;  3BD1 A;  3OMT A;  1QP4 A;  3H5T A;  1LQC A;  1ADR A;  2LYL A;  2OR1 L;  1HF0 A;  4MCX A;  1QQA A;  1POU A;  3OQN A;  2FJR A;  3G5G A;  4I6T A;  1EFA A;  2KPJ A;  1R69 A;  3KZ3 A;  4IWR A;  1LLI A;  2LYQ A;  2L8N A;  3CLC A;  2ICT A;  1SQ8 A;  4I6R A;  4X4F A;  2EWT A;  3MLF A;  1RPE L;  2HSG A;  1RZS A;  2AUW A;  4YAR A;  2O4A A;  2IVG A;  3KJX A;  3SCG A;  3GN5 B;  3UFD A;  4IA8 A;  1JWL A;  3OQM A;  1UXD A;  1BDI A;  3FYA A;  2EF8 A;  1DW9 A;  3BS3 A;  3SCH A;  3S8Q A;  2XJ3 A;  4X4I A;  1PRA A;  1OSL A;  4JQD A;  1NER A;  1DWK A;  3QYX A;  4I8T A;  2KEK A;  2LYJ A;  2PUG A;  4I6U A;  4J1X A;  4X4B A;  4Z58 A;  2PE5 A;  1JFT A;  2KZ8 A;  1LCC A;  3GN5 A;  2PUD A;  1RZR D;  2H8R A;  4X4C A;  2O38 A;  1WET A;  2AWI A;  4F8D A;  2L49 A;  3O9X A;  2AW6 A;  4IVZ A;  4PU8 A;  4JCX A;  2BNM A;  2GZU A;  3KXA A;  1CJG A;  3GBF A;  3F51 A;  3B7H A;  2AXZ A;  4PU7 A;  1NEQ A;  2XIU A;  2AXV A;  1PNR A;  2BNO A;  2LCV A;  1ZZ9 A;  3QF3 A;  2CSF A;  3JXC L;  2ICP A;  4X4E A;  4X4H A;  1UTX A;  2WIU B;  2BNN A;  5A7L A;  2XSD C;  1ZVV A;  2IVQ A;  2PIJ A;  2XCJ A;  1ZUG A;  1L1M A;  4FN3 A;  1Y7Y A;  2LYR A;  1ZZB A;  3ZHI A;  3TRB A;  2LYS A;  4YG4 A;  2PUE A;  3QWG A;  4J1W A;  3VK0 A;  3LFP A;  1ZS4 A;  2AXU A;  1ZAY A;  1X2L A;  2GRL A;  5K98 B;  3OP9 A;  1LMB 3;  3F52 A;  2LYK A;  1JH9 A;  1QPZ A;  2BJC A;  4X4G A;  3F6W A;  3ZHM A;  2GRM A;  2PPX A;  1CQT A;  1R63 A;  1WH8 A;  4YBA A;  1IC8 A;  2PUC A;  3IVP A;  2MEZ A;  1OCT C;  1RZR A;  3HZI B;  1ZZC A;  3PXP A;  2B5A A;  1ZZ6 A;  1B0N A;  4FBI A;  2KEI A;  2JVL A;  1PRU A;  4Z5C A;  2EBY A;  2R1J L;  3LIS A;  3ZKC A;  2KEJ A;  1WIZ A;  3CRO L;  1XWR A;  2HIN A;  3U3W A;  2CRO A;  1E3O C;  1S7E A;  2OFY A;  2PUB A;  1Y9Q A;  2WUS R;  2IV1 A;  4GQM A;  1RIO A;  1BDH A;  2D5V A;  4PU4 C;  3BDN A;  2PUF A;  2O49 A;  1AU7 A;  1VPW A;  1O4X A;  1QP7 A;  3CEC A;  1WH6 A;  1JFS A;  2LYP A;  3EUS A;  4GHJ A;  3D1N I;  4Z5H A;  2JCG A;  3L1P A;  3JXB C;  1YSE A;  1QP0 A;  1PER L;  2XI8 A;  4PU3 C;  2IUO A;  4O8B A;  3QQ6 A;  3G7D A;  4YG7 B;  3RZZ A;  2PUA A;  2IU7 A;  4Z5D A;  4X4D A;  1QQB A;  3SCF A;  4NDW A;  1ZPQ A;  1ZZ7 A;  4Z59 A;  2A6C A;  3FYM A;  1UXC A; 
#chains in the Genus database with same CATH topology
 2L1P A;  1X57 A;  2IVB A;  2MQK A;  1QP4 A;  3OMT A;  3UWP A;  1EFA A;  2FJR A;  4I6T A;  1R69 A;  2J7W A;  2LYQ A;  2ICT A;  3MLF A;  1RPE L;  4YAR A;  2PXL A;  3KJX A;  3OQM A;  2EF8 A;  3BS3 A;  4X4B A;  2HFZ A;  4Z58 A;  2KZ8 A;  2PUD A;  2O38 A;  2LNM A;  2GZU A;  3KXA A;  3SR4 A;  2XIU A;  3VWS A;  2LCV A;  2ICP A;  1ZVV A;  3LQX A;  2IVQ A;  1Y7Y A;  5JUW A;  1ZZB A;  3TRB A;  4OBM A;  3VK0 A;  3LFP A;  3OP9 A;  1JH9 A;  2LYK A;  5DTQ A;  1CQT A;  2PPX A;  4YBA A;  2MEZ A;  3PXP A;  2KEI A;  1PRU A;  2EBY A;  3LIS A;  3ZKC A;  2KEJ A;  2PXB A;  3CRO L;  2HIN A;  3U3W A;  1S7E A;  2PXU A;  3A9Y A;  4GQM A;  1RIO A;  2O49 A;  3BDN A;  2V3C C;  1O4X A;  1QP7 A;  3CEC A;  4Z5H A;  3L1P A;  3GZC A;  4DE8 A;  4PU3 C;  2IUO A;  1NW3 A;  1UXC A;  4Y42 A;  1GT0 C;  1PRV A;  2PXE A;  2R63 A;  4OB4 A;  4ER7 A;  4JCY A;  3H5T A;  4MCX A;  2PXK A;  1LLI A;  1RZS A;  2O4A A;  1BDI A;  4EZI A;  3S8Q A;  3GUU A;  2PXF A;  3QFI A;  5DT2 A;  2KEK A;  4I6U A;  2J7U A;  3PE5 A;  3GN5 A;  1RZR D;  4X4C A;  3M9L A;  4F8D A;  2AW6 A;  4IVZ A;  4PU8 A;  2HCS A;  2BNM A;  1CJG A;  3GZD A;  4ER6 A;  3DM5 A;  2CSF A;  2WIU B;  5A7L A;  2FFH A;  1L1M A;  2JQE A;  3ZHI A;  2LYS A;  4ER3 A;  2AXU A;  5K98 B;  2BJC A;  2PXP A;  1MFQ C;  1R63 A;  2MXD A;  1WH8 A;  2PUC A;  1IC8 A;  1OCT C;  3HZI B;  1ZZC A;  2B5A A;  4Z5C A;  5DSX A;  1WIZ A;  1E3O C;  2OFY A;  2D5V A;  1QZX A;  2PUF A;  1YSE A;  3NXH A;  2PXQ A;  2XI8 A;  5GAG i;  3TEP A;  3QQ6 A;  3SCF A;  4NDW A;  1ZZ7 A;  2LLW A;  3OQO A;  3R1F A;  1LCD A;  3FMY A;  3TEL A;  3BD1 A;  1LQC A;  5DTM A;  3KZ3 A;  4IWR A;  3G0T A;  2L8N A;  3CLC A;  1SQ8 A;  3OKZ A;  5DTR A;  2EWT A;  2HSG A;  3SCG A;  3GN5 B;  3UFD A;  1JWL A;  1UXD A;  3GZD C;  1DW9 A;  1OSL A;  1NER A;  3QYX A;  2LYJ A;  4J1X A;  1LCC A;  2HCN A;  4JCX A;  3GBF A;  3F51 A;  2AXZ A;  1NEQ A;  1PNR A;  1ZZ9 A;  3JXC L;  4X4E A;  4X4H A;  2XSD C;  2BNN A;  2XCJ A;  1ZUG A;  4EKI A;  4YG4 A;  4J1W A;  1ZAY A;  2GRL A;  4EKG A;  1LMB 3;  3ZPX A;  1QPZ A;  4X4G A;  3ZHM A;  2GRM A;  2XXP A;  3IVP A;  4EK9 A;  3NRO A;  4EQZ A;  1RZR A;  1B0N A;  4FBI A;  2JVL A;  2R1J L;  1XWR A;  3OWQ A;  2YBD A;  4Q2J A;  2PUB A;  1Y9Q A;  2IV1 A;  4PU4 C;  1AU7 A;  1JFS A;  1WH6 A;  3ME5 A;  4WVL A;  2LYP A;  3EUS A;  4GHJ A;  3JXB C;  1QP0 A;  3G7D A;  2PUA A;  2IU7 A;  4Z5D A;  1QQB A;  1ZPQ A;  2LLV A;  4YG1 A;  1ZZ8 A;  3DNV B;  4MCT A;  3JXD L;  1ADR A;  3QOX A;  2LYL A;  2OR1 L;  1QB2 A;  1HF0 A;  1QQA A;  2PXV A;  1POU A;  3OQN A;  3G5G A;  2KPJ A;  4I6R A;  4X4F A;  2AUW A;  2IVG A;  3SX0 A;  4IA8 A;  3FYA A;  3SCH A;  2XJ3 A;  4X4I A;  1PRA A;  4JQD A;  1DWK A;  3QOW A;  4I8T A;  5DRY A;  2PUG A;  2PE5 A;  1JFT A;  2H8R A;  1WET A;  2AWI A;  3O9X A;  2L49 A;  3B7H A;  2PXD A;  3A9X A;  4PU7 A;  2AXV A;  2BNO A;  3QF3 A;  1UTX A;  2PIJ A;  1U2Z A;  4FN3 A;  2LYR A;  2VEO A;  2M4H A;  3KL4 A;  2PUE A;  3QWG A;  1DUL A;  1ZS4 A;  1X2L A;  3F52 A;  3A9Z A;  3F6W A;  3MEJ A;  3NZL A;  4HRA A;  2ODR D;  3TFL A;  4ER5 A;  1ZZ6 A;  4DE9 A;  2XXQ A;  2CRO A;  2WUS R;  1HQ1 A;  1BDH A;  5GAH i;  2PXT A;  1VPW A;  2XXA A;  4ER0 A;  5DRT A;  3D1N I;  3NDB B;  2JCG A;  3R09 A;  1PER L;  4O8B A;  4YG7 B;  3RZZ A;  4X4D A;  4Z59 A;  2A6C A;  3FYM A; 
#chains in the Genus database with same CATH homology
 3OQO A;  3R1F A;  4Y42 A;  1GT0 C;  1PRV A;  4YG1 A;  1ZZ8 A;  1LCD A;  3FMY A;  2R63 A;  4OB4 A;  3DNV B;  4MCT A;  1X57 A;  2IVB A;  3JXD L;  4JCY A;  2MQK A;  3BD1 A;  3OMT A;  1QP4 A;  3H5T A;  1LQC A;  1ADR A;  2LYL A;  2OR1 L;  1HF0 A;  4MCX A;  1QQA A;  1POU A;  3OQN A;  2FJR A;  3G5G A;  4I6T A;  1EFA A;  2KPJ A;  1R69 A;  3KZ3 A;  4IWR A;  1LLI A;  2LYQ A;  2L8N A;  3CLC A;  2ICT A;  1SQ8 A;  4I6R A;  4X4F A;  2EWT A;  3MLF A;  1RPE L;  2HSG A;  1RZS A;  2AUW A;  4YAR A;  2O4A A;  2IVG A;  3KJX A;  3SCG A;  3GN5 B;  3UFD A;  4IA8 A;  1JWL A;  3OQM A;  1UXD A;  1BDI A;  3FYA A;  2EF8 A;  1DW9 A;  3BS3 A;  3SCH A;  3S8Q A;  2XJ3 A;  4X4I A;  1PRA A;  1OSL A;  4JQD A;  1NER A;  1DWK A;  3QYX A;  4I8T A;  2KEK A;  2LYJ A;  2PUG A;  4I6U A;  4J1X A;  4X4B A;  4Z58 A;  2PE5 A;  1JFT A;  2KZ8 A;  1LCC A;  3GN5 A;  2PUD A;  1RZR D;  2H8R A;  4X4C A;  2O38 A;  1WET A;  2AWI A;  4F8D A;  2L49 A;  3O9X A;  2AW6 A;  4IVZ A;  4PU8 A;  4JCX A;  2BNM A;  2GZU A;  3KXA A;  1CJG A;  3GBF A;  3F51 A;  3B7H A;  2AXZ A;  4PU7 A;  1NEQ A;  2XIU A;  2AXV A;  1PNR A;  2BNO A;  2LCV A;  1ZZ9 A;  3QF3 A;  2CSF A;  3JXC L;  2ICP A;  4X4E A;  4X4H A;  1UTX A;  2WIU B;  2BNN A;  5A7L A;  2XSD C;  1ZVV A;  2IVQ A;  2PIJ A;  2XCJ A;  1ZUG A;  1L1M A;  4FN3 A;  1Y7Y A;  2LYR A;  1ZZB A;  3ZHI A;  3TRB A;  2LYS A;  4YG4 A;  2PUE A;  3QWG A;  4J1W A;  3VK0 A;  3LFP A;  1ZS4 A;  2AXU A;  1ZAY A;  1X2L A;  2GRL A;  5K98 B;  3OP9 A;  1LMB 3;  3F52 A;  2LYK A;  1JH9 A;  1QPZ A;  2BJC A;  4X4G A;  3F6W A;  3ZHM A;  2GRM A;  2PPX A;  1CQT A;  1R63 A;  1WH8 A;  4YBA A;  1IC8 A;  2PUC A;  3IVP A;  2MEZ A;  1OCT C;  1RZR A;  3HZI B;  1ZZC A;  3PXP A;  2B5A A;  1ZZ6 A;  1B0N A;  4FBI A;  2KEI A;  2JVL A;  1PRU A;  4Z5C A;  2EBY A;  2R1J L;  3LIS A;  3ZKC A;  2KEJ A;  1WIZ A;  3CRO L;  1XWR A;  2HIN A;  3U3W A;  2CRO A;  1E3O C;  1S7E A;  2OFY A;  2PUB A;  1Y9Q A;  2WUS R;  2IV1 A;  4GQM A;  1RIO A;  1BDH A;  2D5V A;  4PU4 C;  3BDN A;  2PUF A;  2O49 A;  1AU7 A;  1VPW A;  1O4X A;  1QP7 A;  3CEC A;  1WH6 A;  1JFS A;  2LYP A;  3EUS A;  4GHJ A;  3D1N I;  4Z5H A;  2JCG A;  3L1P A;  3JXB C;  1YSE A;  1QP0 A;  1PER L;  2XI8 A;  4PU3 C;  2IUO A;  4O8B A;  3QQ6 A;  3G7D A;  4YG7 B;  3RZZ A;  2PUA A;  2IU7 A;  4Z5D A;  4X4D A;  1QQB A;  3SCF A;  4NDW A;  1ZPQ A;  1ZZ7 A;  4Z59 A;  2A6C A;  3FYM A;  1UXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...