2O4UX

Crystal structure of mammalian dimeric dihydrodiol dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dimeric dihydrodiol dehydrogenase
publication title Structures of dimeric dihydrodiol dehydrogenase apoenzyme and inhibitor complex: probing the subunit interface with site-directed mutagenesis.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2o4uX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4uX01
2WJPA 4DREA 4BB6A 4S1VA 1YKFA 4GX5A 4W7HA 4NFSA 3MJ4A 4IZHA 1PZEA 1JW9B 3GG9A 5DOVA 4ZQBA 3UXYA 4QQRA 1Z82A 1LTHR 5L53A 3TFOA 4IJUA 3VTFA 1C0KA 3RKRA 1M67A 3ITDA 4BIIA 5U9CA 4XDZA 2C7GA 1ENOA 3VH4A 3K2BA 2Q1SA 4R16A 3DTTA 1A4UA 3BMNB 4XGNA 1C1DB 3Q9NA 1A9YA 2PLAA 4L0QA 1G6KA 2WYVA 7MDHA 5KVQA 3PEFA 1LSSA 3VDRA 3E9MA 4BNKA 2PD3A 3A1NA 3I6IA 3DB2A 1CETA 1CWUA 3WXBA 2TMGA 4AVYA 5BNTA 1R37A 5KKAA 2AG8A 4TWRA 3CEAA 3DZJA 4P4GA 3L07A 3CINA 4OSPA 2IDZA 1XHLA 2HSDA 2V6FA 3NJ4A 4NJOA 3TRIA 3V8BA 3DOJA 4UUOA 1N9GA 3DEYX 5LCXA 2AE1A 4R54A 1NYTA 4J6FA 4E21A 2XF8A 5A04A 3ENKA 3PHHA 4D0SA 4B79A 4BO5A 4IGEA 1IULA 3PP8A 4NIMA 4BO0A 1GADO 2HLPA 1A4IA 1B26A 3KBOA 2YUTA 1EZ4A 2BI8A 2O3UA 4WECA 2GZ1A 2RHCA 4PLTA 4B3HA 2OBYA 3Q11A 2F00A 3I9OA 3LF1A 3I3OA 5TIIA 4L73A 2CD9A 3UAGA 4CJXA 3E48A 4JX8A 1E3LA 4PG5A 4WASA 5EPOA 3ZWMA 4YBZA 4BO2A 3BZUA 4J49A 1JVBA 5TGDA 3WTBA 2C82A 3UH1A 2IYOA 4BNZA 4YQZA 5LDGA 3ZNNA 1EQUA 2Y99A 2UAGA 4OXYA 1E5LA 1GV1A 1B2LA 1HEUA 5JBIA 3AI2A 5G0UA 5JDIC 4RQUA 5JAIA 5G0WA 1IL0A 3TPCA 1LI4A 2NTJA 5JO0A 3GZ4A 3KYDB 4Y98A 4QT0A 3AW9A 1U7HA 4G5HA 1FDUA 5L7TA 1K5HA 3PYMA 3ORFA 1NFQA 4Y6RA 4ZQHA 2HCTA 3ZW8A 3AU9A 3GRKA 3W6ZA 2VWPA 2DT5A 2DU8A 5BNIA 2CVQA 4U6QA 2JCXA 5IDXA 1YBMA 4ZRMA 1DFGA 1T2EA 4PLCA 3DHEA 3F46A 1WLYA 3FSRA 3H65A 4ROSA 4CM8A 4J0FA 5CPFA 2DPGA 2PH5A 4CM8B 4YB8A 1EUZA 4BNTA 4Q3NA 5I8WA 3OQBA 4O5OA 3U9LA 1ENYA 1KERA 1AN9A 4CMIA 1D8AA 3O03A 4GMGA 2B4QA 1IOLA 1V3TA 2VUTA 5DZSA 4MINA 1WVGA 1FK8A 4GMFA 3NRCA 3RC2A 4KMSA 4II3A 5TRTA 5HWSA 4ZGWA 4OKNA 1ADBA 5T8KC 4FFMA 1SCUA 3M2TA 1O9BA 3AFMA 3FCOA 5GMOA 4BO6A 1KETA 5H81A 3A14A 4CM6A 3OSUA 5B4UA 4YQYA 2OP0A 2PWZA 5KVVA 1W0CA 4CMJA 4RF5A 4Z0PA 4BV9A 1HLPA 2AQIA 4HKTA 1PS8A 1E3WA 3AI3A 3NX4A 2A9FA 1UXJA 4IDGA 4NDNE 4R1SA 2ZIZA 4LW8A 1DEHA 3NT4A 2Y93A 4Z3KA 1B16A 1J49A 1U8XX 2I65A 3EY4A 1TT5B 5KTKA 1P74A 1JWAB 3P5SA 1QMGA 2F1KA 1DO8A 1XWFA 4XRGA 4WEQA 1H2BA 3WBFA 5U4QA 5CEFA 2WD7A 4YT4A 3GDFA 3HDHA 1PJSA 4CM3A 3C7CB 1FMCA 1MV8A 4R5HA 4JLWA 1QYCA 2FN7A 4R1TA 1CRWG 4J7XA 3HB5X 1YB5A 1U9JA 4CQLA 3GPDG 3JQFC 1GYPA 3L4SO 4YPOA 5LC1A 4CQLB 4IS3A 1HYGA 3IQDB 3KSUA 3VZPA 5EQFA 4Z9XA 3M1LA 1LQTA 2FOIA 1DC4A 3RC7A 2DBQA 1KY5A 4N54A 3JQAA 5CDYA 4RPHA 4R1NA 2BFOA 3JQAB 3PIIA 3DBVO 1TI7A 3WGGA 4MVJH 4LGVA 3PJGA 2NV6A 3KYBA 1K2WA 4BV8A 1UP4A 3UICA 3PZRA 1HF3A 5C7IO 2P68A 2VQ3A 3RI3A 2X5JO 1MFZA 2I9PA 3PK0A 3ZWXA 2IZZA 5L7WA 1I8TA 1I3NA 1WW8A 3ZU2A 3CSDA 2CMDA 3C7AA 3TOZA 2NNLD 4FS3A 4EDFA 1Y81A 3ANMA 2FR0A 3ZI0A 2IEBA 4NK4A 1FF9A 4GH5A 5KVCA 1YH3A 1NWCA 5A5FA 3KVOA 4CUZA 5C37A 3B1FA 4CM9A 4XZ3A 3FBGA 1E3IA 2B5WA 1HL3A 3DFUA 2PKQO 1S6YA 1QXSA 1DPGA 3WQSB 3NKLA 1HDCA 4XKJA 3DTYA 1QYDA 4RO0A 3HSKA 1B8PA 4N5NA 3RFVA 2Y05A 3W8FA 3AFNA 1ZKMA 4ALKA 3AOEA 2QIOA 1CDOA 5HS4A 3A9WA 1I0ZA 4RVUA 3LF2A 2EJVA 3ASUA 3IUPA 4WLEA 1LQUA 3RUEA 4BNVA 4PZCA 3VAZA 3UHAA 2DUWA 1KEUA 2X1HA 4DMLA 2O2YA 4E0BA 3WB9A 1GQQA 2C2XA 4BNIA 7ADHA 1ISJA 4JJGA 3RU9A 2VYVD 3GEGA 2DUUA 2Q46A 3HB4X 1IHXA 4YJGA 3S2FA 4Z9YA 2R00A 3U4IA 2RIRA 4YJGB 1E6UA 4I5FA 4F45A 3P19A 4I1IA 4RZIA 2J3JA 3WFJA 3A28A 2GNAA 4R9RA 2X9NA 4OHUA 2FY8A 2BFMA 3NTRA 2P91A 1NTOA 2QYTA 1BRMA 1IYZA 5G0VA 1MP0A 4WE3A 4XJSA 4O59O 3HE3A 4XCVA 2IZ0A 5AXBA 2WD8A 1UH5A 4MVJI 1WAMA 3GY0A 4D44A 4CQMB 2UDPA 3MWEB 2HKIA 2OZPA 3QWAA 3M1AA 1R4MA 4CM4B 2VRCD 3PLRA 4KTVE 2VN8A 3ETGA 3M2PA 2CF5A 1XSEA 1QLJA 2ZQYA 1P1JA 3C3XA 3MJCA 1H6BA 3NYWA 1WMAA 5HA5A 1H6CA 1N8KA 3DONA 4CL8A 4DVJA 1E7SA 1K6JA 1MX3A 1Q2XA 2X58A 3L6DA 2QQ5A 2GSDA 4AG3A 3GUYA 2VYNA 3H8VA 2B5VA 2JCVA 2HRZA 3BYZA 1CYDA 3H9UA 2Q2QA 5JXWA 3C24A 4IDBA 4I5GA 3L77A 3RKUA 3K9QO 4H3VA 4NFYA 4OAQA 1QYWA 1LU9A 4MOWA 4XRRA 4B4VA 4IPTA 3DBRA 1XU9A 2R2GA 5BT9A 3ONEA 3DBRB 2GERA 4PLVA 4EITA 1VI2A 1HE5A 3ULKA 4N7RA 2NVBA 4N5MA 3F6YA 3SC6A 1CIVA 5IG2A 4GI2A 5KKCA 1HYEA 1GUFA 4RPLA 3HADA 5JDCA 2WEKA 1EK5A 4RORA 3KETA 1YJQA 3ASVA 1DAOA 5TS3A 3U3XA 4UULA 1I2CA 4W9NA 1KY4A 4AJKA 4Y8VA 2VUSA 4I9UA 5L40A 1ENZA 1U3VA 3OH8A 3EK2A 5C7OO 1Q7GA 3I9KA 1LSOA 4C4OA 1QYVA 5HM8A 1LC3A 2B0JA 3GZNA 3PI7A 1CJCA 4CM7A 2EEZA 1DC5A 3PWSA 4EI2A 4NJMB 4AJEA 3AU8A 3OF2A 5COQA 1ADFA 4OL9A 3DAGA 3O38A 3L4BA 3LC1O 1IB6A 5L51A 2EIHA 3TL3A 3GC6A 1E7RA 4MP3A 1ZEJA 2EW2A 3FNFA 2J8ZA 1JQBA 3GR6A 3PRJA 3QQPA 2RHRA 1UZNA 2JFGA 1ISHA 1VL8A 3WWYA 1GFSA 1LSJA 3JQ7A 3IKVA 2UUOA 1B14A 3TN7A 1BDBA 4AJ2A 2GZ3A 4MVJD 4CV2A 4MIOA 4B3IA 1JLLA 4U0KA 2QRJA 1IZ0A 1PGPA 3DBHB 3VTZA 1I01A 4WLNA 3ZV5A 4PG4A 1BWSA 1N5DA 4DGSA 2QRLA 3UF0A 4ESOA 3UOGA 1GZ6A 2ZCVA 3JQAD 3W1VA 3L0DA 1BTOA 3IJPA 2A4KA 4D45A 4E3ZA 1EDOA 1UR5A 4J90A 3VZRA 1R0LA 3D5QA 4PG7A 2BHLA 3M6IA 1PZGA 3DQPA 4NNJA 1BMDA 2B83A 1O6ZA 2EW8A 4MKZA 2EKQA 3R0IA 1DFHA 2NM0A 5CG1A 1KVUA 5IZCA 4D46A 4NZ9A 4EGFA 3RCBA 4A03A 2FR1A 3T7EA 3CE6A 3OJOA 4CLOA 1XKQA 5JFOA 1U1IA 1WNTA 2YFHA 5T67A 1WPQA 4J91A 4K26A 1UZLA 2DM6A 4L4SA 3GMDA 4ALJA 3KRTA 5DBIA 4H15A 3V1UA 2VT3A 3RSHA 5JYFA 4BKOA 2G0TA 3RBVA 4FC7A 4IS2A 3ENNA 4CM9D 5A06A 1YDWA 1PX0A 2FPGA 2QHXA 1OZAA 3ZCXA 1ZK2A 1JDJA 2OO5A 4KWHA 1YWGO 4GVLA 4RF2A 2I76A 2VHVA 1GD1O 3ZWYA 1XCBA 1XDWA 5GZ1A 3R1IA 3ZHXA 4AJ1A 3TDKA 5F3RA 1A7AA 4CLRA 2JAPA 2ZK7A 3WMWA 5JMPA 1ZSYA 2HJSA 1NQAO 2HAEA 2O3JA 2XPCA 3H4VA 4BS9A 2HRBA 4OH1A 1EVZA 4ZHSA 3RJ5A 1NBOA 1UAGA 4D79A 1DHTA 4G65A 3O26A 2QG4A 3OBBA 5L7YA 1JVSA 4ONEA 2GPTA 4JGBA 4IMRA 4URFA 3GOHA 3T4XA 2DFDA 2Y0DA 3I4CA 4YAGA 1LRJA 1V3UA 5IN4A 5CDGA 3Q2IA 3ZU4A 1VSUA 3DWFA 1R6DA 1R15A 1B7GO 1PJ2A 3HFGA 5DP2A 1E3EA 1PQPA 3EUWA 4EUHA 5IF3A 1GYQA 2VWGA 3D4NA 1E7MA 3R3SA 1E1NA 1N92A 1WP4A 1LLUA 2VHXA 4JBIA 4YJHB 2GGSA 3IP3A 3H7AA 3FI9A 3F9IA 4DPLA 1KC3A 4R01A 4LCEA 4IZIA 2P9CA 1PL8A 2X7HA 3B70A 4YJFA 4CQMD 4GPD1 4P22A 4S3MA 1FDWA 4YJFB 5JNLA 1I33A 3WOHA 1PTJA 2VOEA 4UVGA 4E5YA 4J1TA 3VDQA 4G2NA 4IXWA 2PY6A 2HUNA 3AOEC 3BHMA 4LISA 4QECA 3IJRA 4BB5A 3ZWVA 1G0OA 1U3WA 3QWFA 4DTIA 4TRMA 1EBFA 2H9IA 3QHAA 3FTNA 3PZBA 4PLYA 1EVJA 3MZ0A 4UUMA 4WCFA 2UUPA 4E2XA 3K30A 1P1IA 5DBGA 1ADGA 4WCFB 2XAAA 1H9BA 1PR3A 1PZHA 3QV1A 2CNBA 2ZB4A 1VJTA 3HG7A 4NPCA 4OJNA 2ZTMA 2PK3A 3VH3A 2A92A 4YT8A 1DLJA 4J1SA 4QXMA 4RLSA 1YBAA 4N5LA 4E12A 3WTCA 5ER9A 2PA3A 5MDHA 3WJAA 2R00C 4F46A 4MVJE 5JY6A 3RJ9A 3ZWAA 2VT2A 4RF3A 3K6JA 2IXBA 1MFPA 2VZ0A 5A9TA 3H2ZA 5JYDA 2PR2A 3INRA 3EVNA 1GEEA 1ARZA 3LDHA 5F5LA 2CZCA 3SJ7A 4TMFA 5ES3A 3I83A 1TB4A 4JP3A 4ALLA 3BMQB 4DPKA 3ZGYA 2FWMX 1HT0A 1MC4A 5IXYA 2Q4EA 3E9QA 1DIAA 4ZRNA 5U1PA 4LSMA 4IY1A 4J43A 4D3FA 3H5AA 3LYLA 9LDBA 1HE2A 4OM8A 1KOLA 1FJHA 4J7CA 2YV3A 4YRDA 1JN0A 3W4JA 3G1UA 4IGFA 3ZZNA 3AM4A 3NT5A 4WNIA 2GUGA 3Q6IA 4CLDA 2WE7A 5LDHA 3V1TC 4FBGA 1B3BA 2BELA 3RQSA 1X13A 4GSLA 4BO4A 1P77A 2W90A 5A3JA 1OOEA 2D0IA 2DFVA 2NLOA 3NAQA 5DULA 4KUGA 1PJCA 2PGJA 4GAEA 2ET6A 1OBFO 5TLSA 4JJFA 1X0XA 3PIDA 4M55A 5G0TA 4RPJA 3WX0A 1BXKA 3JTMA 4OKIA 1KVQA 3DMYA 1VRWA 3PVZA 4U0JA 1NPDA 1UUFA 1D4FA 3JSAA 4MKXA 3EYWA 3TZHA 2DBZA 1Y1PA 3GGGA 2C2YA 4TRRA 5AQ1A 3OQ6A 2VNSA 1T4DA 1H2HA 5THKA 1Q7BA 3VZSA 4RJTA 4BGVA 1NQOA 3CMCO 1T2CA 2Y0CA 2YJZA 1WXDA 5JDCC 3FR8A 2CDCA 3PWZA 1MC5A 3OJFA 4ND1A 4XYLA 1VJ0A 3SBOA 1PIWA 3P2YA 4HFRA 4W9NC 3E18A 3WICA 4W4TA 2XXJA 4E32A 1NVMB 4W82A 1NPYA 2VZ9A 3PDUA 1LDMA 1E1LA 3MCVA 4ZJUA 3BMNA 5L4LA 1C1DA 2IODA 2B69A 3SJUA 1EEHA 1PWXA 1Q7CA 4J4BA 1HSOA 1O5IA 1V9LA 1AGNA 1H93A 3GN2A 4DA9A 3L4BC 4PFJA 4Y9DA 2X9VA 1YGYA 5KJ6A 4RGBA 1ZW1A 3GVCA 2HMWA 5J9GA 1GU7A 1P0CA 3R6DA 4EBFA 3QIVA 5JSFA 4L9RA 3FF4A 3WIEA 1IY8A 2I99A 3DHYA 4LRTB 1PJ4A 4NU5A 4BO8A 2D8AA 4E5KA 3MJTA 1HDRA 3C85A 3VPHA 3DXFA 1V8BA 5GZ6A 1UDAA 3K31A 5ICMA 1Y5RA 1O95A 4E33A 1ZSNA 4ZU3A 2VYVA 4YAIA 1A5ZA 1ISGA 1VJ1A 1YB1A 2EV9A 3JYLA 3ON5A 1PGNA 4MDHA 6LDHA 5L95A 3RFXA 2B4RO 5HBRA 3GH3A 1YOVB 2HJRA 1NHGA 2IYPA 2J6IA 3KLMX 4GGPA 4K1LA 2O4UX 4XJTA 1U2DA 1NFRA 3DBLA 1YONA 3TSCA 3QVTA 3PYXA 1P1HA 3DBLB 4NBWA 1I30A 2DVMA 4XX0A 2GN6A 5B1YA 5IZCC 1MLDA 4GGOA 4BGUA 2POQX 4PRKA 4ZQFA 4BMNA 2JHGA 2WMDA 3QVOA 1PJTA 1X7HA 1RWBA 2C7VA 3TJRA 3SVTA 4M54A 3MJVA 5COBA 4CR8A 4I5EA 5DCUA 2FSVA 3H9JA 3ZV3A 4XWYA 4MIYA 3KYDA 4D43A 3GLQA 1V35A 2ZB3A 3ZWWA 2VRCA 3LVFO 1CF2O 5AXDA 1T2DA 1Q0QA 5JPIA 3TFQA 1OC4A 3JD3A 3NV9A 1YDEA 3ZV4A 3WQQA 2V6GA 1X1TA 1UXKA 2HDHA 1L7EA 4RL6A 1QORA 2VZ8A 3P7MA 3Q0EA 3VVBA 4FQ8A 4MVJG 2C0CA 1ZK1A 2VWQA 5KVSA 3F5SA 2IEDA 3PDJA 4YAEA 4Q3CA 9LDTA 1J5PA 1DRWA 1R66A 2NU9A 3AK4A 3FR7A 3ITKA 4MP6A 2WDZA 2GD1O 3KYCB 5EMHA 1GV0A 3QSGA 1H94A 1RYDA 1LDYA 1B3RA 1MA0A 4I9HA 3GHHA 4DBVO 2WYUA 4GX2A 4R5MA 3I5MA 3I6QA 3D64A 1NQTA 2Z1NA 3TOXA 5ILGA 5B12A 4R51A 4NBUA 2VWHA 4CLEA 1GUZA 1F17A 3JCZA 2AG5A 4IJWA 1X0VA 4M86A 1EE9A 3S1LA 2WTBA 5EINA 5T5QA 4HNGA 2D4AA 4PZEA 1V6AA 3GEDA 2HK9A 1CERA 4D0RA 2YDYA 4DUPA 1T1RA 3ZH2A 5G0SA 5L4SA 1Q1NA 1JA9A 2X23A 4IDFA 5K6AA 3DHNA 4E2YA 1ZVMA 1DIRA 4UVHA 4NHEA 2HMVA 4D42A 4OO3A 4GKVA 1PJBA 3WNVA 4BVAA 5KIAA 1I2BA 2O4CA 4EJ0A 2RH4A 1MG0A 3FBTA 1TT5A 1N1EA 3MOGA 5TJHA 3MTJA 3GG2A 2O3SA 2P5UA 4HFJA 5DNAA 1ORRA 1T25A 2YQ5A 3I4FA 1BSVA 1U2GA 1I24A 2BH9A 2P5YA 1T24A 1QV7A 1UXIA 3IMFA 5DCYA 5BQFA 3GFBA 3K2EA 3U4DA 3NDRA 4Z0TA 2E37A 1GQYA 4EEXA 4J7UA 4R69A 2DAPA 1WZEA 5H83A 1QV6A 1MG5A 2FZWA 5T64A 4MVJA 1NNUA 1U5CA 4ZN6A 2PZJA 1Y8QA 2OGUA 1ONOA 3RAJA 1ML3A 1LRLA 2O48X 1YBVA 1Y8QB 4WCFC 5G2OA 2YHIA 2X5KO 3JV7A 5DF1A 1UZMA 1AHHA 1P3DA 3I52A 2YHIB 1LC0A 4Q3DA 3WGYA 4E5PA 3FD8A 4YJDA 3KB6A 3CIFA 4RDHA 3PFFA 3BAZA 5C5IA 4MVJM 3GA0A 3BHJA 3R3JA 4DPMA 2GN4A 4XEHA 5B37A 3ZWPA 2GO1A 5CPBA 4XD2A 1H5QA 1M76A 2CF6A 4FFRA 5TSDA 3TNLA 2B4TO 3F1LA 3OIDA 2C20A 3PJFA 1HXHA 3PHGA 4FC6A 4FDAA 4I5DA 3HDQA 2X0NA 2P9GA 1UJMA 4DC0A 5BNFA 3GVIA 3COSA 3WMXA 3PHLA 1O89A 1GPDG 2J5RA 1GL3A 2LDBA 1PQWA 1YQDA 1E77A 2X8LA 3AUAA 4JCOA 1ONPA 2DLDA 3U4CA 5FEUA 1Y9EA 4GX1A 4UEJA 3OA0A 4JXKA 2Y68A 3BTVA 1GZ4A 1KVRA 1QRRA 3WBBA 3HDJA 4WUVA 5CDSA 4OQZA 3EVTA 3PGXA 1PWZA 5BR7A 3NEPX 1DOHA 4B7XA 1SMKA 4GSKA 4FW8A 1I2ZA 2CFCA 1EMDA 1NXQA 4BMVA 1WDLA 3ROKA 3VPSA 3JQBA 4FD3A 1GCOA 5A5EA 3H9QA 4NR0A 1JAYA 1RM3A 4RPGA 4AJLA 4TKLA 5I7SA 4BKQA 1LUAA 1ADCA 4GQAA 1D3AA 2QW8A 4R1UA 2Q1TA 4MVJF 4U8GA 3OEYA 1HKUA 3CUKA 4IDCA 1U7TA 4FJ2A 3GNTA 4EJ6A 4BKRA 5EN4A 5DN9A 4QFDA 1DIHA 3EC7A 2EXXA 3UCXA 2R6JA 1I5RA 3JQ6A 1GY8A 3JQCA 2J3HA 1JWBB 4BNMA 4O63O 5ITVA 1SZJG 3NGXA 3GDOA 5DDIP 2D5CA 1E5QA 1GPJA 1I3MA 4Y6PA 5BSGA 1X1EA 5BSEA 1PL6A 4CQMA 4A0SA 4UVIA 4DQUA 4CM4A 2OHXA 2YYYA 3BTOA 2Q49A 1E3JA 3EW7A 5HTOA 1E1KA 2ZJ0A 2GASA 3PLNA 3JQEA 3ZWNA 1HDXA 2O7QA 3C1TA 3NTOA 4I9NA 4FGWA 1LDEA 1M6HA 1Z74A 3ADPA 5EQDA 4EEZA 1I3KA 1UDCA 1SO8A 5C3MA 5I7VA 1H0KA 2I6TA 3K92A 1RM4A 2P2SA 3H9GA 2W2KA 3UCEA 1FDSA 2JFFA 3ICPA 3F47A 3RUFA 2W2KB 1LDGA 3IOYA 4B8ZA 5ADHA 4PGFA 4X54A 4BNYA 3ZWOA 5G4LA 1J0XO 5JCJD 3GAFA 4MIEA 1SOWA 4A5OA 3MJEA 1M2WA 1KBZA 5HRUA 2X9GA 4P38A 1VL0A 2BMAA 3F5QA 2AQ8A 3HFSA 1K3TA 3QA9A 4XB1A 3DL2A 2Y1OA 1NM5A 4H16A 1T2AA 5IN5A 4DYVA 1LEHA 1ZSVA 4YT5A 4CV1A 4NFHA 2VHZA 3EAGA 3JYPA 3WQRA 2NQ8A 3BA1A 3OFSA 2NTVA 4UEKA 5M6DA 4IDAA 2O3QA 2ZCUA 4TKMA 4DQVA 4FOSA 5CDUA 2AW5A 2ZYDA 3QVWA 2NVUA 1EFKA 1Z73A 1DRUA 4M8SA 4J4HA 4NI5A 2NVUB 4DC1A 4MVJP 4XIJA 5CP8A 3LT0A 2VUUA 3QWHA 4YVFA 3RUAA 1ZUD1 3WSWA 2FPIA 2PKQP 3MWDB 4NJMA 4XGKA 5FI3A 1D7OA 2EP5A 2BGKA 2FRDA 3GHYA 1YS4A 3PYLA 1PJQA 2YDXA 1W6UA 2YHUA 2UVDA 3N58A 1DXYA 1K89A 5KJFA 4DL9A 4L76A 5AXCA 4DRYA 2OUIA 4YCAA 3Q2KA 1PJLA 3DFZA 2B36A 1G0NA 5JE8A 4UVDA 1F8GA 4FFOA 2I5PO 3OM9A 1AHIA 3RIHA 3GGOA 1XU7A 3DBHA 4WPGA 3EDMA 1K6IA 1LDNA 1T2FA 1N7GA 1M66A 3ZWBA 1I3LA 3G0OA 1LX6A 5TF4A 4BNJA 1W8DA 2PKRA 2RBEA 1PZFA 1YXMA 5CEJA 1EBUA 2YY7A 1T1SA 2AQHA 4J0EA 4PZDA 3WIDA 2JL1A 5B4VA 2WE8A 5K6AC 2AMFA 2BKAA 2RH8A 2I66A 2LDXA 3SEFA 1BW9B 4M49A 5F1OA 4AICA 4J2HA 4YACA 4G81A 5TQVA 2HO5A 4Z3DA 1HDYA 2C5AA 3ANLA 4WLOA 3VVCA 3KM0A 4KUEA 1F12A 1N2SA 2P9EA 1K0UA 3NT2A 2DBRA 1SNYA 1Y5MA 1HYHA 1D1TA 1U3UA 5ITWA 1RKXA 2PZMA 2AEJA 2PGLA 5EESA 3LZ6A 1RYEA 1GZ3A 4NG5A 4BNWA 4BUCA 4OQYA 3T7CA 3UCFA 3V1YA 4YDRA 1ZIDA 3WYCA 3WG9A 2PGDA 1W4ZA 4XQGA 4RCVA 1HDGO 4C7KA 2C59A 3QE3A 4PLPA 1PS0A 1YQGA 1EUCA 1Z7BA 1B8VA 1QLHA 1EUDA 2OOSA 3HDYA 4OYRA 1T26A 4DIOA 1YRLA 4WK6A 2HQ1A 1RM0A 4FJ1A 1ZO8A 3L9XA 3HWRA 1U8FO 2WYWA 3GT0A 2BGLA 4ND4A 4W7IA 3C1AA 4JIGA 1VKNA 4Q9NA 3DAFA 3FWZA 4PLHA 1DHRA 1PU2A 3DC2A 3V2HA 2YV2A 3CZRA 4AJPA 5I8ZA 2C54A 2Q2VA 3D0OA 4RZHA 4E5MA 1K6XA 1R0KA 4BKUA 4QTZA 3WYEA 1LNQA 5EIOA 4GLOA 3I9JA 4WLFA 3A4VA 4NQZA 3S2IA 4ZVVA 3H9EO 1BVRA 4QSMA 1VLLA 4FJ0A 3DR3A 3G3EA 2HMUA 1Q0HA 3ZN2A 3VPXA 4INAA 3BHIA 1HDOA 4WCDA 3TQHA 4NBTA 3KOUA 3OJ0A 4TZTA 4L8VA 4CR7A 3RUDA 3QWIA 3CTMA 1ISIA 3MOIA 1NQ5A 3QP9A 5DP1A 4YJHA 2A35A 3OIFA 3LK7A 1O94A 4CMEC 3GUCA 3PHJA 4J3FA 2FPPA 5T73A 4J16A 2DPHA 4QO7A 3W4IA 4RVFA 1U3TA 3E6AA 2E48A 2JHFA 3PJDA 4WOJA 3F4LA 3BXXA 3DZGA 2EF1A 3WJ7A 1N1GA 1R12A 3BTSA 5F1KA 5L45A 2CY0A 1N7HA 2BD0A 2P4HX 1R16A 1U28A 4IQ0A 1XA0A 1ZNQO 4L4XA 3H6KA 3AY6A 1C1XB 4QO8A 2X0JA 3AM5A 3DOCA 4ND2A 1DIGA 4TQGA 3UGKA 2CUKA 4IXTA 3QLJA 4E2ZA 4ND5A 2IRWA 5T57A 3JQBC 3HNPA 1HSZA 1PJ3A 2Z1MA 3FNEA 4GLLA 4O6VA 3VPFA 5JYAA 1NR1A 5CAEA 5TNXA 2P4QA 1G1AA 2YQ4A 3AOGA 4R68A 2GCGA 1EE2A 3KZVA 5A02A 3AJRA 4XYMA 3S2EA 4B4WA 4HFMA 4YYZA 3JYQA 1SAYA 3DDNA 1VPDA 3UFXA 3G1TA 3AI1A 3U5TA 4Q3EA 2C07A 1L1FA 3NTQA 1U4SA 4OOEA 1F0YA 3VH1A 5DBFA 3N74A 4LCJA 5T6BA 2AQKA 3O8QA 3K73O 3LQFA 3O8QB 1UDBA 3SX2A 1J4AA 3RWBA 4CLHA 3PGJA 3BMQA 3X2FA 2EERA 5CEEA 4R3WA 2YFQA 1Z75A 1WDKA 2X4GA 2FSSA 3GAZA 4LSWA 2VCYA 2DKNA 3ANNA 3VZQA 4AJHA 2HK7A 1Z45A 3Q9UA 4C7JA 2XOXA 1PEDA 4JK3A 4IQGA 4L75A 4QX6A 1F14A 3JQ9C 4IM7A 2NWQA 1NAIA 1ULUA 4DMMA 3TWOA 3VKUA 4DYDA 2I3GA 3EHEA 3GGPA 1GAEO 3WNQA 4BQPA 4BNFA 1P44A 2GN9A 4GBJA 4LMPA 4Q39A 1BXZA 3C1OA 3NGLA 2W2LD 4RDIA 1MGOA 5I7EA 4PLGA 2DBVO 3FNGA 1ZXLA 2JD2A 1ZJYA 3BMCB 3U0BA 4WEOA 1SB8A 4PRLA 4TRJA 1ZFNA 1LLDA 3CZMA 1DSSG 2C29D 4XIYA 1DBVO 3WGOA 4PLWA 3OMLA 8LDHA 4KQXA 1ZK3A 4AJIA 4HADA 5EERA 4HNHA 4ILKA 1KVTA 1YB4A 2QYSA 4PN3A 3H5NA 4B4UA 1ID1A 4BO3A 1LBEA 1DRVA 5JW6A 3RC9A 3WR5A 1Z7EA 3IAHA 2Q45A 2X0RA 3ZHBA 4TROA 1DC6A 2PD6A 3RUHA 1E3SA 4ZD6A 4DIFA 4BQRA 2GF2A 4GKBA 4LVCA 3ZHYA 1I32A 1C3VA 2CVOA 4Y67A 2AA3A 2GRAA 4WNCA 1AUPA 2JKVA 3ONFA 3IL2A 1S7CA 5A9SA 3B20A 1UXHA 2O23A 4R4JA 2OBNA 4FOOA 5A9SB 5J23A 3ZHZA 2Y1DA 5L4NA 3LC7O 4K9DA 4HXYA 4XDYA 3S2GA 3OJEA 5L3ZA 2OORA 5A9RA 1PL7A 5G4KB 1GCUA 2JJYA 2Y1FA 3JD1A 2Y1GA 1QG6A 1DJQA 2Y66A 4HBGA 3VPGA 1P1RA 2CDAA 4BNGA 1A71A 1ZJZA 3WGIA 2J3KA 3D5TA 1NP3A 3ONDA 3D4PA 1XELA 3LLVA 4IBOA 4CMCA 1EFLA 5ER6A 3GVHA 5F21A 5TC4A 3TL2A 2ZB8A 4YR9A 3O9ZA 4UEOA 4JP2A 2ZQZA 1RM5A 4R9SA 1E1MA 1I36A 4MKRA 4ITUA 3P2OA 4WJZA 4ALNA 4J9VA 4FFPA 4D3SA 3I1JA 4YEDA 2CVZA 3L6EA 2D2IA 1XGKA 4JJIA 3HHPA 4IDDA 4J4TA 4BO7A 1JKFA 3ICCA 2Q22A 4JBGA 1SEVA 1YOVA 4K28A 3ZU3A 4CLXA 1NAHA 3DOOA 1WDMA 2FR8A 2FZEA 3PTZA 4E4YA 2GLXA 4KUHA 2O7SA 2ZTVA 3RROA 4J9UE 5JYEA 3F1KA 3KUXA 3PWKA 4R41A 3UN1A 1LSUA 1H6AA 1N9GB 1ZH8A 2CDBA 4QUKA 4XQEA 4CV0A 2E4AA 1M6WA 4EUEA 4DIBA 4PVCA 3NUGA 1YE3A 3GDGA 4KWIA 3U09A 2D3TA 3EGOA 4JBHA 1FXSA 3DMTA 1HZZA 3JQ8A 4KTTE 1NASA 3IS3A 2O3TA 5I9MA 4I8XA 4RVGA 3TZCA 3JQ8B 3RBZA 3WGQA 2DTEA 2X5OA 5C7LO 4J1NA 3HQ4O 3IKTA 2AHRA 1WWKA 1CQJA 4MPDA 4EUFA 2BRUA 3H3JA 1FDVA 2B37A 3E03A 5DCWA 1QR6A 5B4TA 4Z6KA 1TVEA 1ZEMA 3D3WA 3DZFA 5KJEA 2Q50A 3D3WB 4DWVA 3FPCA 3KYCA 3DZKA 3GVXA 4Z9FA 1DIBA 3TF5A 4MO2A 3LC2O 4W99A 5JCJA 2JAHA 5IDYA 1QP8A 2O3RA 3BTUA 2AE2A 2Y1CA 2D59A 2EP7A 2NTNA 4FFLA 1JKJA 2X0IA 4QEDA 1GDHA 1UP7A 5IJZA 1HDZA 4RF4A 2J5KA 5EL0A 4CMBA 1W73A 3DZBA 4LK3A 3ZW9A 1PQUA 2CSUA 3VOSA 3G79A 5KOIA 1HE3A 4BHTA 3VKVA 2UV8A 4U5QA 2EKLA 2E6UX 3W4KA 2EHDA 3F3SA 5COAA 4Q3BA 4IJKA 4YTEA 3JYOA 3RUIA 4B7UA 1Z6ZA 3B1JA 1KEVA 4YT2A 4CMIB 2O50A 3GQVA 1Y6JA 1HWYA 1RPNA 2H63A 2ZYAA 2G82A 3W6UA 1EDZA 4GX0A 1SPXA 3IC5A 1U4OA 4OIMA 4TRNA 4RVHA 3OICA 5K9ZA 1E7WA 1LLCA 4B8WA 3INTA 2PTGA 1TT7A 2FMUA 4K6FA 4IJVA 3IDSA 1B8UA 3RASA 4FPXA 2H1SA 3LSYA 4UUNA 5JC8A 2G76A 3LLSA 4I08A 4KOAA 2QX7A 2UYYA 3SLKA 2EWMA 1AE1A 3HN7A 3CKYA 3OJLA 3PQEA 4E30A 1E3WB 4Z0HO 3FNHA 3E8XA 1XR3A 3QY9A 3A06A 1PS9A 4RPKA 4IDEA 3PPIA 3GRPA 3OHSX 2NUAA 4LMRA 3O4RA 4YRAA 4RVSA 4PIVA 4BNLA 5KWEA 4GWKA 2C5EA 3PQDA 1O8CA 1GTMA 3GK3A 4ZQGA 2RCYA 3KSDO 2PH3A 3OETA 2AXQA 4FGSA 4XYGA 4AJOA 1P0FA 3W8EA 3PFWO 1T4BA 5CFZA 1YL6A 1AXEA 2YZ7A 2XXBA 3QVSA 5A05A 2WD7B 4R3NA 1VM6A 3ABIA 4CUJA 1LJ8A 2NACA 1HLDA 4JNKA 4U6SA 1SOVA 2WM3A 3I9NA 2J5QA 4NMHA 4OGWA 1H6DA 1HZJA 4XGIA 1O0SA 3IIEA 5TJ9A 4OXNA 1ZK4A 1X7DA 2IXAA 2D1YA 3LT1A 3TZQA 5ENVA 6ADHA 2Q99A 2RAFA 2HU2A 4XR9A 1A27A 3WYBA 5BSHA 4CR6A 4B4OA 4CMEA 5JS6A 3PHIA 4IIVA 1Y7TA 3V2GA 5MGBA 4EJMA 2SCUA 4M89A 3K8ZA 1E6WA 2DC1A 3D4OA 4LVUA 3VH2A 2AEFA 3AUUA 2VTEA 3K96A 2E49A 1NWHA 1QKIA 4DLAA 1VC2A 5FF9A 1BHSA 3JQDA 3S8MA 3WGZA 4CMGA 1CQIA 3TZKA 3GN1A 3ZV6A 1B0AA 1NR7A 2YV1A 5AOVA 1C0PA 3T4EA 5HS6A 1JTVA 1VKOA 1IHYA 4B7CA 5TX7A 5JCXA 4PG6A 1MB4A 4FR5A 2BLLA 3FRJA 4DXHA 5KJCA 4BO9A 3KSZO 4RLHA 1UXGA 2GDZA 1E92A 3AUTA 1DAPA 3L9WA 4U7WA 5THQA 1U5AA 2ZTUA 2DTXA 4RQTA 1R4NA 4MP8A 4F3YA 1R4NB 4RVDA 2O2SA 3E82A 4E6PA 1RJWA 2V7PA 3D7LA 3Q1LA 3ROPA 3SC4A 1PR9A 2BFAA 4EZBA 3UW3A 5I9LA 5KCZA 1KEPA 5IAAA 3OP4A 3NDJA 4W6ZA 4QFCA 1BVUA 1E0DA 1ISMA 3ST7A 2NSDA 3JYNA 1A7KA 3LT2A 1YQXA 4LN1A 3IUSA 4F6CA 1F06A 3KTDA 4CM1A 1IPEA 4ND3A 2OFPA 1PGJA 3JD0A 3MJSA 3H3FA 1X15A 1ZMTA 1X14A 3Q3CA 3FHLA 3ZU5A 3JQ9A 1AXGA 2ZYGA 4CMKA 2Y0EA 3E1KA 4O1MA 5JLAA 1D1SA 4DQXA 1KYQA 3OIGA 5JC1A 4YXFA 1KVSA 2FP4A 4AJJA 2NU8A 4L74A 2Q4BA 3FTPA 1DFIA 4A27A 2QRKA 5GY7A 1JAXA 2YW9A 3RC1A 3QRWA 4KDEA 4KZPA 5I7FA 2EKPA 3CMMA 3STHA 5BSFA 4ALMA 4NH4A 2H5LA 3ZNQA 1ZK0A 3DAPA 4YA6A 1I10A 3W8DA 2DTDA 2ZB7A 4PCVA 3G49A 2E82A 4FFNA 4WOKA 3G17A 4KP7A 3N7UA 3PQFA 3WWZA 1R4MB 4P4NA 1BDMA 3WLFA 3MTGA 3HUDA 1P33A 3NDIA 3DZIA 4CUKA 3WDSA 4XQ9A 5JY1A 4NBVA 5CDTA 1YL5A 4FB5A 4WLVA 1TEHA 1B15A 1HETA 1MXFA 5IFLA 1SC6A 1KS9A 3ZNPA 2TMDA 5IDWA 3ADOA 5TT1A 2JD0A 2Y1EA 4HUJA 4XA8A 1DB3A 3VHRA 2PNFA 4BKPA 3FN4A 1ZCJA 1DLIA 3D3EA 3LU1A 4M87A 3GPIA 3PXXA 5A03A 4TZKA 1LA2A 3DMTC 3KV3O 3OA2A 2V6BA 4E13A 4YAJA 4CV3A 1TA4A 3HJAA 4MJLA 2G1UA 4B3JA 2Q3EA 3GMSA 1TLTA 1P31A 4IMPA 1BXGA 4EYEA 2NVWA 4NK5A 5I9NA 1BXGB 3KO8A 1HRDA 4CL3A 3K5PA 2GR9A 2W2LA 1NPTO 4A73A 2Z5LA 1EVIA 1A9ZA 2GN8A 1NVGA 4BL5A 5IZ4A 3H2SA 3H5RA 4RV9A 2VNAA 2ILTA 2VOJA 4TVBA 3I9LA 1Y9AA 3QVXA 3WGHA 5AXAA 3AUSA 4ZA2A 3GZNB 5GZ3A 1C0LA 5FI5A 1NX6A 1R0SA 3RU7A 3LT4A 4K6CA 5FYDA 1P1KA 2PD4A 2JCYA 4OOFA 5FWNA 1MUUA 4IINA 4AL4A 1C0IA 2PFGA 1LXCA 1X7GA 3QJ5A 4XQCA 5F5NA 1XYGA 4WGGA 3C8MA 1OMOA 3RD5A 3CH6A 4XYEA 1BW9A 2G5CA 2OL4A 1FDTA 2Y67A 2V65A 4BGEA 2HK8A 4XR4A 3U4HA 4L4RA 4E5NA 2W98A 2OXIA 3ETDA 3JQ7B 1NHWA 4D3DA 4UUPA 3JQGA 4NU6A 1OAAA 4J2OA 5A3VA 2VHWA 4J1QA 3WFIA 3JQGB 3X2EA 2PZLA 3UUWA 5K0ZA 2VHYA 1DJNA 2G17A 4GVXA 1WZIA 1SBYA 1OI7A 4P8RA 4BNXA 2DQ4A 1OFGA 1GUYA 1P45A 5KNLA 2BF7A 5ICSA 4UVEA 1DDOA 4BMSA 4D41A 2EGGA 4YAKA 1GR0A 3B6ZA 1NVTA 1Y8RA 1SEPA 1Y8RB 5FFFA 5IXSA 3UVEA 1KEWA 1XQ1A 4CLOB 5JDIA 3AY3A 5DT9A 4CMHA 1YL7A 5L9AA 4HP8A 5IDQA 1V0JA 4E2WA 3QW2A 1ISFA 2IZ1A 4WLUA 4AJNA 2ZATA 1BGVA 4PVDA 3SXPA 3RFTA 2QZ9A 3ZWCA 2GZ2A 1ZXBA 4LRSB 4ZICA 4HWKA 3GFGA 4OMUA 4P4LA 1WMBA 2Q1UA 5JMWA 3ROQA 4Y6SA 4CPDA 3HN2A 3OQ1A 1MXHA 4CODB 1XQ6A 1IE3A 2X86A 1OC2A 3GEMA 2W4QA 4PLFA 4DLLA 4OSOA 5CG2A 5JO9A 1JKIA 3OEWA 2Q1WA 2NU7A 1UAYA 2OP1A 2Z95A 1P1FA 1V3VA 1ZZEA 4IIUA 3WSVA 3HZZA 4FSHA 4CLRB 2NQTA 4UREA 3L6OO 1HE4A 4XYBA 3S55A 3BIOA 1H9AA 4F6LA 3KLPX 4OXKA 1ZMOA 2W8ZA 4A7PA 5AVOA 1VL6A 4BOYA 3V2UA 5DOZA 1PGOA 5T8KA 2HMTA 3DO5A 4HY3A 4JN6B 1E7YA 1GEGA 3UKOA 4BNUA 1CEQA 3WLEA 4BO1A 1E6EA 4TVOA 3AM3A 1GYRA 4ZQEA 4A2CA 4ALIA 2JD1A 3NJ8A 4DLBA 1KIFA 1C1XA 4TSKA 4PLZA 4PG8A 4GL4A 2BI7A 3RBXA 3INGA 2X22A 3OECA 1SB9A 3ROMA 3FWNA 3GVPA 1LLQA 3KXDA 1E7QA 4H7PA 2NU6A 1C14A 1UP6A 5JAZA 2BGMA 5AYVA 1XLTA 3DZHA 2IE0A 1PSDA 1QYXA 3EMKA 1M75A 3QWBA 4N18A 1BG6A 2H6EA 2HMSA 3JD2A 2EG9A 1IUKA 5KJ1A 3RVDA 1LRKA 4XB2A 4IUYA 5F1PA 5ENDA 2EJWA 1GQ2A 3JQFA 4KDFA 2ZJ1A 2WSBA 1XIVA 1DC3A 1EK6A 2I3AA 2VYND 3V5NA 5H82A 3SLGA 3GNQA 3U62A 4HX5A 3I23A 3JD4A 1EQ2A 4WKGA 1L7DA 1HTBA 3EZLA 4KQWA 1EVYA 3ZDFA 1J6UA 3WS7A 3WGTA 5A1TA 1PGQA 2EGHA 4FIZA 1IPFA 3AY7A 2WWRA 1ONNA 4IQ8A 5CHEA 3RUCA 3ZNOA 4AJ4A 3MEQA 5EJ2A 4E31A 4D7AA 2JFHA 1Q0LA 3E5RA 2VRBA 3CXRA 1IZ9A 1JU9A 1YVEI 4FN4A 3EZYA 2ZTLA 2OMEA 3D1LA 4CM5A 4DBZA 3E5MA 4O0LA 4BNHA 3KEOA 3I9MA 1XG5A 5JAMA 4UAGA 2BFPA 1VE9A 4HFNA 3IP1A 3TZ6A 4JQCA 2PZKA 1YJ8A 1ZBQA 2NADA 1F8FA 2B35A 4M1QA 2QZZA 4Q3AA 3BMCA 3FPLA 3ETEA 3U49A 1QSGA 4II2A 2PV7A 3VC7A 4BNNA 4CMAA 2V6MA 4ID9A 3F4BA 2AEMA 8ADHA 2VTDA 2X6TA 4A26A 1KC1A 4A10A 4AFNA 2I67A 3PJEA 1A72A 4GWGA 2FHSA 3KHUA 4YWJA 1TXGA 1XEAA 4EW6A 5TT0A 5JAQA 5A4DA 2A94A 4JROA 4FCCA 3AWDA 1ULSA 3BMOA 5ILOA 2ZKLA 4NBRA 3BMOB 3GF4A 1LDBA 3E9NA 1P9LA 3B1KA 2GYYA 1NFFA 3GNSA 4YRBA 1ENPA 2D5AA 3CPSA 2Q2WA 4BGIA 3C7DB 1VSVA 3KEQA 1YO6A 4HV4A 2J3IA 5G4KA
chains in the Genus database with same CATH superfamily
1QH8A 2OE2A 1ULZA 4MITA 1PFWA 1QGUB 3C5HA 2CZQA 4BB6A 3CVYA 4LHEA 3C70A 5JSQA 3K0CC 5LR6A 2A9QA 1K7CA 3NNSA 3GG9A 1L7OA 2IUEA 3K1AB 3MAAC 4G01B 3W79A 4ZQBA 5BXYA 1WUHS 2I2DA 4HNQA 5PNTA 2D7JA 3RSZA 1U63A 1Z82A 3TFOA 1MVOA 1C0KA 1NYRA 1M67A 2WABA 1N25A 2XA9A 1XTQA 2C7GA 4N6GA 4X66B 3ZCSA 5AI5A 5BWBA 3NHPA 5C7YA 2R2AA 2Q1SA 2O2XA 2FZ5A 2W83A 3EMDA 3GUZA 4HDMB 4O25A 3AJDA 3BMNB 3UWMA 1M2JA 1RQGA 1Q20A 1QGYA 4N8EA 2OBMA 3KJQA 3K09C 2IS4A 1U11A 2VJMB 3KSRA 4M36A 4P5PA 1QGOA 2ZSKA 2WKWA 1G6KA 3BD6A 4QUJA 1YCFA 3OPNA 4LMBA 2WUDA 1WY7A 2F3RA 2D0DA 2H5EA 2YHAA 2ECFA 3A1NA 2IHKA 3Q5DA 5TEVA 2ACEA 2A5LA 3DB2A 5LN1A 3JRWA 3OAAA 5F3WB 5KKAA 3L1HA 4UTXA 5IEBA 2PWBA 2V7BA 3CEAA 3OLZA 3DZJA 2N1BA 5IBQA 3TTXA 3CINA 4I3HA 3DHWC 2QSZA 5FBQB 1Z62A 1HG0A 1XL1A 3TUJC 4C4XA 2QM8A 1ACLA 1N9GA 4FR0A 2LW7A 2VDJA 5LCXA 4GMHA 3UWKA 1NYTA 2DPLA 4IHKA 1PBNA 2XF8A 1E1RA 4J6FA 4D0SA 1SVWA 4GOKA 3ZS9A 2B8NA 2GZAA 5FNZA 4IGEA 1WMDA 3L8ZA 4BO0A 2BR3A 5FL7D 3LO8A 4DZZA 1A4IA 3F96A 2B9VA 3ZHTA 3E0QA 3RS0A 3KBOA 4EAQA 1EZ4A 4LOKA 4MQMA 1IVYA 4PLTA 2AYYA 3KYIB 2OBYA 2F00A 4DCJA 3NTVA 1AQIA 1GILA 3R3VA 3T15A 3ZYZA 2Y2UA 5JXHA 1JA0A 5TIIA 2CD9A 3UAGA 4CJXA 1ST2A 4WASA 4BV3A 2XDQA 2DCMA 3WHIA 1G6HA 1KAMA 2AZXA 1FUKA 3ABZA 3FCYA 5C35A 1EWVA 1YZNA 3NOXA 2A8YA 2ZI7A 2C82A 4XX0B 2WVHA 3SY8A 2IYOA 4ZVOA 1E9AA 3M1IA 1XCJA 2V7QD 4MWDA 5BPHA 4L5JA 2PAAA 4LV5B 1J39A 1SC1A 3BK1A 4P82A 5FQNA 4DLWA 1Q1ZA 3I01M 1FUYB 2C2OA 5CMLA 1WHTA 1JHAA 1RHUA 4AUNA 4WFKA 2XE4A 2YBDA 4L5CA 4EHNA 2P0AA 2HWYA 3BREA 1WHSA 5CU7A 3VV2A 5IXYA 2IIBA 3ZG6A 1KF0A 2W4MA 3IVAA 1GNSA 3NBZC 4L16A 1QAMA 4G5HA 1X77A 5DLEA 1KYWA 3LWBA 1GCIA 4IHJB 3HY3A 4G8CA 1NYLA 1VHJA 1BCRA 2FXIA 2WFLA 1ZAYA 1FNDA 3P0HA 3BDVA 3ZW8A 1AUOA 3A1VA 3NYIA 5AICA 3W6ZA 4A16A 1MEEA 4YJ2A 4U6QA 2JCXA 1YBMA 2B30A 2QB5A 5JWOA 1HFKA 4PLCA 3DHEA 2CXSA 3QJYA 1YIOA 2Z56A 5E38A 1CUWA 1ITZA 1A8HA 4LJ6A 5K8IA 4E09A 5CPFA 5CURA 5LBTA 3HRKA 1HYBA 3MQ2A 4CM8B 1G9XA 2NO9A 4BNTA 3ZDXB 4WKBA 3P4UA 5F7XA 4R1OA 3OLVA 2FG6C 1ENYA 1AN9A 4PSUA 3O03A 4GMGA 4CCWA 1HTWA 4CTMA 3O6VA 2WF8A 4MINA 2C9MA 4KKVA 4K6KA 4GMFA 3NRCA 3RC2A 4KMSA 4EPWA 2J41A 4HOYA 4R9NA 1YVPA 1T35A 5TRTA 1SVOA 3CX6A 3FZNA 1U3FA 2TRSB 5DGDA 5LD2C 3B5IA 4O4JA 1SCUA 1T8RA 1O9BA 2QUHA 2YMMA 3B6EA 3FCOA 1KETA 4IDOA 2Y76A 4TXJA 4NVRA 4CM6A 2VQ6A 4YQYA 5BPFA 1AQ6A 2OP0A 1JB1A 1VIYA 2PWZA 3LPMA 5JRJA 5JXJA 4Y7CA 4BX8A 1FYVA 4CLQA 4LF6B 3WGUA 3L7LA 4YP0A 2OWDA 7YASA 2RCNA 1PS8A 3AI3A 2QTRA 1UPUA 2A9FA 4IDGA 2PMFA 5SICE 4ENPA 1DEHA 2HDOA 5JYBA 1Z7GA 1OPXA 5BQ5A 5FRDA 1U8XX 2VKQA 1XLWA 1MO3A 1W87A 1U8EA 3EY4A 3NG1A 3OIVA 1T36A 4HZUA 5KTKA 3VYTB 1P74A 5JQGF 4ZC1A 1UKEA 3CX8A 3H9BA 2IX3A 1Y6FA 3IMGA 2WWVD 2BV3A 4F4IA 3VR4A 1DO8A 2OD7A 3FUTA 1TZCA 1DO2A 3U6KA 2GZSA 3RHZA 1T5TA 2QX9A 4HG2A 3S40A 4CKEA 4HDSA 4I99A 3AR5A 1UPXA 3T0IA 4MRAA 1XZGA 1VXOA 3BERA 2A9OA 5U4QA 5CEFA 1M1YB 2A2ZA 4DG8A 2QVLA 4JL8A 5T3UA 1S3GA 2JIRA 3VUFA 1ADJA 3HCDA 1O6FA 3RF6A 3ZCTA 4C0QC 1PJSA 5DLQC 5ALTA 5FR2A 1G60A 1U4NA 2VJCA 1J0AA 3OZWA 3WSVA 4JLWA 4BFCA 2AOTB 3OKFA 3BXPA 1ZC3A 1DADA 1QZUA 1CRWG 3VR4H 3KQWA 5KPDA 1QTQA 3HB5X 3ZUGA 1N6LA 4RAQA 1KU0A 3GPDG 3JQFC 1GYPA 4CQLB 3SBXA 1HYGA 3FKSA 4MWZA 2HWKA 1RWNA 4WXHA 3RS2A 3VZPA 2EJCA 1EH5A 5G1NA 5K0FA 1UC5B 1Z2CA 4B3CA 3RC7A 2DBQA 1KY5A 1KO4A 1XTUA 4RPHA 2I6GA 4R1NA 4XUDA 3JQAB 4N3AA 2R97A 3WNDA 3WGGA 3COJA 2KW5A 4LGVA 4L27A 1U0FA 2GCOB 2L18A 5KYUA 3UMSA 1K2WA 4C0BA 1UP4A 2FF7A 3DW3X 2WAYA 4E1VA 4TX1A 2FPXA 2I4IA 4EG5A 1Q95A 2GJ4A 2XTJA 2Z3ZA 3OQIA 2IZZA 5CW2A 4EHHA 3ET5A 3JWGA 1I3NA 5DU2A 1WL8A 3RAEC 4JLMA 1EZZA 3C7AA 3NYRA 4KXYA 4QGFA 1OZFA 1VYVA 3M6VA 1J8VA 4FS3A 4J0GA 1NJ8A 4QGHA 4DSUA 4EDFA 3ANMA 5ALSA 2LCIA 4XEUA 3ZI0A 2IEBA 1FF9A 1ISRA 4GH5A 3HJFA 3BK2A 1T43A 1XEFA 3ITEA 3QKRA 1X1BA 3S5UA 5KVCA 2XBMA 1OAKA 3GFTA 3MFQA 1Z0AA 5H59A 3ROFA 4X8MA 3R8XA 3QBJA 3X1XA 3LHSA 3K9LA 1XZNA 4ZAFA 4DCNA 2AG6A 5C37A 3DWGA 1HNWB 4FCTA 4M37A 4Q4JB 3QU9A 2WWFA 1YJBA 1HL3A 5B7NA 5FPTA 2X8JA 2ZRPA 1ZINA 2JFUA 5ERXA 5JNVA 1JU3A 1REQA 2HPZA 2QDKA 4XKJA 3DTYA 3ECAA 1WZCA 1QTIA 4D4JA 1QOZA 3TQFA 2D8MA 1NI4B 3P9PA 3WGKA 1OLOA 4KAJA 5IBRA 2QIOA 1GZ5A 4Z0NA 1CDOA 3QE2A 4AN0A 1V7QA 2O8NA 2Q6TA 5AKGA 4RVUA 2HC9A 1OAOC 1FS5A 2AC4A 2E4UA 1YRAA 3PR2B 1KFBB 3MMPA 4KC0A 4QNMA 4WLEA 1XNHA 821PA 3DMRA 5DGCA 4EA8A 4Q34A 4KAAA 4QJ5A 4ZP1A 4C78A 1TUEA 4YUZA 3GLFE 2PZ8A 1TJ4A 3GGSA 2X1HA 3W90A 1YBFA 3B53X 1NJFA 4JL6A 3CEMA 3DF9A 1X9HA 7ADHA 1E1RD 2C3PA 4JJGA 4GHWA 5DWDA 3ZI7A 1EWRA 2I8CA 2XADA 3HB4X 5F7JA 2IEIA 1Z88A 3H1GA 4Z9YA 1XZQA 4QYWA 4YJGB 1KI6B 2FLVA 3DCIA 4I5FA 2O5EA 4XLLA 1X7ZB 3DTNA 2J3JA 3ZR4B 1Y5NA 2V5AA 4CI0B 2AZ4A 4WDQA 5K3BA 4JC0A 5JRDS 4FUTA 3LHFA 2BFMA 3NTRA 2Z83A 3OX1A 4ICIA 2P91A 4ZCRA 4OU5A 3V7FA 4JLSA 3E3AA 2QYTA 1G4AE 8ATCA 1Y7PA 4JLKA 2PJRA 2J3EA 5G0VA 3PIRA 1L5MA 4WE3A 2RGAA 3EPHA 2H59A 3AHHA 3JRNA 4D80A 4YR7A 1RADA 1MEJA 2O07A 1G19A 3KDPA 4A2QA 1UH5A 4LYAA 1XTZA 1E94E 4CQMB 2UDPA 5EJ9A 3Q98A 4I50A 5AKYA 1W5BA 2OV1A 3FYUA 3GBSA 3PXDA 4KQJA 3PLRA 4K3VA 4KTVE 4GC5A 3BWEA 3W1WA 3O95A 3DQQA 1ODSA 4Q16A 1VZ2A 3NXSA 4Q19A 1I7SB 3FXAA 1YCHA 3PS9A 4KAFA 3U7IA 1ULBA 3FNIA 3GJZA 3MJCA 3Q3GE 2PO5A 3NYWA 5EGSA 5HA5A 3DONA 1MCZA 2CBZA 3W7VA 1Q2XA 1D1PA 1Q5PA 1Y3HA 2Q62A 2RGBA 2X58A 5KSZA 2GSDA 1VL1A 1WBBA 3I2KA 1CCWA 1ZUWA 2V5VA 4MS3A 4WINA 4TSRA 3WWCA 4ZKDA 1I5OA 1U7WA 4TV8F 3U26A 2Q2QA 4PC1A 4TYPA 3SF8A 1MT3A 3DDHA 3C24A 2V3CC 2YASA 2F3UA 4ZOEA 4C87A 2XUZA 2VSNA 3VHXB 3L77A 3INNA 4YQFA 4LJ8A 1XHFA 3OX2A 5JSUA 1ZH2A 4F5YA 1C3LA 1OZHA 4XRRA 4LQ4A 2V8BA 2C8JA 4Q82A 3QF7A 2R2GA 4ZHQF 2RKOA 2CCGA 2YZMA 3LD9A 2IX9A 5JS2A 3ZTYA 1YDMA 2RGRA 2R6GA 3PFHA 1HG1A 4Z1MA 3ULKA 1CW2B 4QVKA 1UBMS 5MGNA 1YS7A 1XALA 3HDGA 4PQRA 4DHEA 1RU3A 1SK9A 3RRZA 1K97A 1X1CA 1FXWF 2B61A 2HSWA 5TS3A 1L4UA 3U3XA 1QX4A 1IXZA 4HZIA 3NEYA 1F5NA 4AJKA 2FEOA 2VUSA 2IJGX 1I4EB 3LQ2A 1U3VA 5DYGA 3HR7A 4ITVA 4RK5A 1WBJB 5C7OO 2GBCA 3D7NA 3EK2A 3I9KA 2ONJA 3V3KA 5EY5B 3GB9A 3BWVA 3PCXA 4H1WA 2OV8A 4JI7B 2FZCA 1UADA 5JFTA 4Q05A 2VJKA 1K7EB 4OYHA 1EFPA 3LC0A 4NJMB 3V97A 3VR4D 3OCVA 4PV7A 3X1JA 4ZYYA 4J76A 3JVUA 1ADFA 1ZD5A 3O38A 3AB8A 2VLBA 3L4BA 1H65A 3CF2A 2F48A 1IB6A 3CUWA 5BQ3A 4MWOA 2GXSA 2QUBA 3GC6A 4IQFA 4WESA 2VYCA 2H85A 4MP3A 2YV5A 3LWZA 2R84A 4PF1A 2QTAA 3WGJA 2OXTA 2J8ZA 3LVQE 1WB9A 2QE7A 1UZNA 1I1QB 2V55B 2VPWA 3ENWA 3I32A 1LSJA 1D5WA 3JQ7A 2UUOA 4GEGA 4RIEA 5C8YB 3NDBB 3OIUA 4HEA1 1RABA 4FX5A 2VP0A 1JLLA 4FE7A 4L50A 4U0KA 4F5WA 1UBNA 1IZ0A 3VR1A 2O8DB 1I01A 2FI1A 4Q7KA 4PG4A 4IWNA 1GKIA 1XKLA 3BJRA 5KNDA 2GM5A 2B1QA 2HJ9A 2YTZA 2Q8QA 2XIJA 4FK8A 4TWZA 1GRNA 2ZITA 5IBPA 2GF9A 2HA3A 4EY6A 5BWMA 1FX1A 4AMUA 4FKBA 4D45A 2DY0A 5EJ7A 2FETA 1OLXA 1R0LA 3D5QA 5GP1A 3VU9B 3D7KA 2R96A 3I9V1 2FW9A 3DQPA 2X6QA 4WDRA 5FUBA 1M6YA 2L19A 5LQJA 2YRXA 4W5RA 2WWHA 5KNDH 1KVUA 4R8SA 5J40A 3DP7A 5LP6F 1VIAA 2PL3A 5GM1A 2B4KA 2FPSA 2JJ8A 4BDSA 5EUMA 4EMBA 3T7EA 2V3VA 1C7RA 3NP9A 5HJEA 1M9NA 3G7SA 4MXDA 2VP2A 4YMHA 1WKCA 2A1UB 1R0BA 2J3QA 2QTZA 4QOJA 2HFJA 5T67A 3UM9A 3ZPXA 4EX6A 4K86A 2XZDA 4ZAXA 2P0YA 4MVXA 1UZLA 4L4SA 3RSQA 4QUAA 1UM9B 1U2GC 4XLTA 3PXCX 3UMVA 4BP3A 1FFBA 3DVAB 5AI6A 3O7WA 2Z2KA 1YKGA 3IQZA 2VT3A 4FNOA 5JYFA 1QJCA 1X8KA 3LY5A 3QUTA 5CA0A 2X3FA 5SY4A 1U7ZA 2J9RA 5A06A 5JZVA 3CX7A 1YDWA 4LGCA 1P9OA 1OZAA 4RJ2A 3ZCXA 2CNKA 2CNWD 2FPGB 1W0JA 3LIIA 1YWGO 4LOLA 4RF2A 1G98A 4WZBA 3PGLA 2C4MA 4GM4A 3U4GA 1K1EA 4QYXA 1EUCB 1G3QA 3PKJA 4GF5A 1Z12A 2JJ1D 3ZWYA 1XCBA 2WNIA 4OHMA 2EP8A 2J6CA 3BB1A 1QIEA 3ITNA 3R1IA 3DM9B 4EFKA 5DISB 3TDKA 3S4YA 4CLRA 2JAPA 3R6LA 3Q12A 5JMPA 2ODNA 2HJSA 2RHGB 2IZOA 2HAEA 4ZOAA 3H4VA 4OH1A 2KYRA 1LZKA 2GYUA 2LUOA 4G5XA 3HCBA 1XX6A 3AESB 1WQ1R 4I1SA 2Q2NA 2QUJA 3O26A 2XF2A 5L7YA 2ZROA 2GPTA 1EFVB 1EPUA 1O97D 2A3NA 2WAOA 4JGBA 4URFA 2X0FA 1CUZA 3GOHA 3MRVA 2DFDA 2Y0DA 3G6WA 5IBCA 4LXQA 4YAGA 1GZDA 1YZHA 5IABA 1YK1A 5CDGA 2FSGA 2PNJA 2F17A 2W71A 2JW5A 4I46A 2ZR9A 1M6VB 1R6DA 1NMQA 3D8NA 3AKCA 1PV2A 1B7GO 3EISA 3FRHA 3I2JA 1G3MA 3PDCA 1IWOA 3R40A 4OQXA 4X20B 3QVMA 3V2HA 1E3EA 1PQPA 1WVMA 2OD2A 4Z2AA 4DCUA 1OH8A 3FAKA 3PE6A 1IG0A 4JBIA 5IRCD 3ETLA 4YJHB 5GVRA 3KR1A 3RK4A 4H3SA 5A3QA 1EGQA 4JLVA 3F9IA 3IVRA 4JUDX 4LCEA 3U7RA 3C3YA 4NH0A 4QOFA 4UNSA 2GM9A 3DFFA 5H3LA 3MVEA 1IBRA 4KXUA 1FDWA 4P22A 4YJFB 2DSTA 1G8AA 3AERA 3SM3A 1N0WA 1UEJA 4J1TA 1WBDA 2BGWA 1B1CA 2CFTA 1J5XA 3BMXA 4FFVA 1NN1A 2PRSA 2HUNA 3CZ9A 5KQPA 2O1EA 4TM8A 4OG2A 4XUGB 3SYRA 1G0OA 1O1YA 4X3PA 2D4HA 3KJIA 4DTIA 3D2BA 2WLTA 1PNQA 4TRMA 2BY4A 1P0MA 4I5IA 4AMVA 4X1KB 2EKBA 4C6HA 2ETXA 4TXLA 2QLLA 3K30A 4KHPB 5DBGA 3E7PA 2R7NA 4WCFB 3R7FA 1PZHA 1S2NA 5CPBA 3QV1A 3EIEA 1UINA 1CIJA 3HG7A 5CAEB 2C57A 4EI8A 2PK3A 4UAVA 4D9JA 2DP4E 4UUBA 5GV8A 1MNAA 5DSTA 1DLJA 1MAUA 1TKBA 1CLUA 2I4NA 2OVBA 4RLSA 1YBAA 1YE5A 3FDFA 2OZKA 3C5VA 4HDNB 5ER9A 5AR1A 5BOSB 5MDHA 1I4LD 2XE7A 4MVJE 3RJ9A 2ZIAA 3KTAB 4UU7A 5F5XA 3PJRA 2VT2A 3P32A 5DK4A 1F0PA 1MFPA 5A9TA 5JYDA 1OY1A 2PR2A 3EVNA 2PUGA 1X80B 2HB6A 2CZCA 2PX2A 1NLZA 4RWZA 2OHHA 1NUTA 1TB4A 3B2NA 3T34A 4JP3A 3K6KA 4ALLA 3PEWA 3Q0IA 3A3KA 3B38A 4CKZA 1I4OA 1NBMD 3M4NA 5AUOB 1XQWA 2PJZA 2Q4EA 1U8AA 3B5JA 3HYCA 5B1HA 5D01A 1PVOA 1JIUA 3M6AA 2HBYA 4IY1A 1E99A 2B2NA 1CRZA 2JGDA 1TW3A 5IMBA 4KI7A 4IX1A 4NCKA 2YV3A 4YRDA 5DFAA 4ZVTA 3FYUC 1W8IA 3W4JA 3UOWA 4IGFA 4WNIA 1Y8CA 4JUFA 3VO8A 3WADA 4DLYA 5LDHA 3SJCA 2C77A 4FBGA 2RJ3A 3B12A 4Z4QA 3ZCQA 1U9YA 1Z29A 5I7AA 5DEOA 4ZDJA 2EHJA 2HTEA 2ZE8A 2YIDA 4HTFB 4X97A 5HIIA 5DYTA 3W06A 5I9TA 5K8CA 4QBHA 4EDHA 2NLOA 1SUAA 2ZIFA 3WLNA 3JX9A 4IUBS 5IVHA 1PJCA 3DWIA 4OHPA 3L8DA 1XYVA 3QUBA 3WP1B 1F7UA 1ZLXA 4JJEA 3P0FA 4AZ0B 1M8FA 4YAUA 1SIUA 4QICA 4IWYA 1YV9A 5J4VA 2ECQA 3WX0A 1BXKA 1ZONA 2ONYA 3NHUA 4FDLA 1YIDA 4JFAA 4CQJA 4AS1A 3KR9A 3T99A 2ZBUA 2F8LA 1VRWA 4ZMBA 4MWBA 1YZVA 2D6FA 5HUQA 2QV0A 2DHRA 1UUFA 3WDMA 1Y89A 1U65A 3I28A 4B82A 1D4FA 1NM5C 3B6IA 2SHKA 3EYWA 4IIGA 5AP9A 5B64A 3TZHA 1RE1A 3O90A 3GGGA 3CFYA 3P1JA 4TGLA 3C74A 4TTSA 4JI5B 2XCOA 5AQ1A 4P53A 2ORVA 1Y6QA 2PKEA 3OX3A 5LBIA 4BVLA 4EM6A 4RJTA 2QPAA 1NQOA 3CH5A 4GPBA 4TTPA 4ZI2A 1L6RA 3TUZC 1T2CA 1V95A 2EATA 2OBLA 2A0XA 5TMPA 1G5QA 3F0TA 1MC5A 3C1UA 2QGZA 4ND1A 4R2WA 4QGAA 3TSOA 2CLOB 5BYJA 2O2CA 4MYTA 3P2YA 3H2HA 3WICA 4C7VA 2G67A 1MA3A 1XMVA 3KC2A 4W4TA 3TLGB 1NN0A 5IYZB 4JI0B 1XZBA 3RIXA 2RB4A 4HDMA 2IHVA 3MCVA 3BMNA 5L4LA 1XMQB 1H4TA 4LA4A 4BO3A 4OUKX 1FRNA 1RQNA 1K7YA 1FE8A 1NJ2A 3O3MB 1RD4A 1B73A 2WG0A 1KYZA 3HYSA 4J4BA 4ZYWA 4LMAA 3K6SB 1O5IA 2EU8A 4QHSA 3QEJA 4XSGA 3SQWA 1AGNA 3ESAA 3GN2A 3KT3A 4P5DA 1B00A 2DH5A 3L4BC 4DA9A 1VLZA 1RIIA 2X9VA 1PCXA 5KJ6A 4RJLA 2VSFA 5DWQA 2DFLA 5D5HA 1R5BA 5J9GA 1CJTC 2HMWA 1P0CA 3LCJA 2QK4A 4HL6A 5G41A 2QBYB 5JSFA 1JYEA 1NW3A 3FF4A 3CQ9A 2ZJ5A 1NDUA 1OV6A 2D8AA 1X94A 3HR8A 4HSGA 4E5KA 1GVHA 1P5FA 1CKEA 4GPIB 1QO0D 3DXFA 1V8BA 3L7KA 3PXAA 4FFBA 3DJYA 1XJWA 1UDAA 3K31A 3FUCA 3PUVA 2HIHA 4G8DA 3QOXA 4M1KA 3ZY2A 1O95A 5FOXA 3TG8A 4L7VA 1ZSNA 1T0IA 4QG7A 1SWVA 4ZU3A 2VYVA 5K3AA 4Q00A 3TIGA 4DSZA 2WMOB 1T5BA 4OK5A 3ZOZA 1YB1A 3ON5A 1O6CA 6LDHA 4PC2A 3PFIA 4MGIR 2NZWA 3AEQB 5JSZA 2J6IA 4GGPA 1KO1A 1OFTA 3NIFB 2P6MA 5HF6A 4JJ6A 4BFWA 3FM9A 3O47A 3OM0A 4BB0A 1EX9A 3H0CA 3QVGA 5CCDA 4C43A 2VXYA 5JJKA 1UOOA 4XX0A 1XKXA 2GN6A 3ODGA 4BGUA 4KIJA 1TKAA 4ZCIA 5B1YA 2WJJA 2UXCB 4AO6A 5T3YA 2G25A 4UEQA 2WMDA 3QVOA 4DADA 1ZH6A 3BX1A 3RHTA 4P7GA 3GZTB 2WI8A 2G06A 3LXRA 4M54A 3QU5A 1SVIA 1KH3A 3ABOB 1P6QA 2KMLA 3MJVA 2FPLA 2ARKA 2VC2B 3KKLA 4OJMX 3D6JA 5DCUA 3VR6D 4CR8A 1GNQA 5BN4A 1XNRB 3ZV3A 2I71A 1TEXA 4QAQA 2ATIA 4Y2UA 2X6RA 2ZB3A 1IBKB 1VJCA 3PKIA 1TA9A 3ZWWA 2VRCA 4IHJA 1UFRA 5F23A 1MQ8B 1MZVA 4ZT7A 1OZGA 3TFQA 2BSQA 4OLAA 4EHLA 5AK4A 2PYIA 4EO4A 1XRLA 4GXRA 4H7DA 1X1TA 1UXKA 4M4SA 1M8GA 2NW6A 3N2IA 3RRXA 1GPNA 2ZJ8A 4RL6A 1S3SA 3M5DA 3NH9A 3AV0B 3VPGA 3T1HB 4NCBA 3OZTA 1RRCA 3Q0EA 3PNMA 4IEFB 3VVBA 3AH8A 4GE0A 4KR6A 4IKPA 1UYJA 1AB6A 1KQ3A 4B45A 5BWOA 1ZK1A 2VWQA 5LXTF 3PDJA 2IEDA 3LQ4A 4H27A 9LDTA 4TL9A 1J5PA 1VGVA 3N7TA 4JKYA 1IHPA 1R66A 3FR7A 3ITKA 4GBED 4JT4A 2WDZA 2GD1O 3CT4A 3I64A 4B09A 2I91A 4DJ5X 3UV3A 1H2RS 2A78A 3A58B 3HYLA 2GJAA 2FP3A 1XOIA 1BWPA 5EP2A 4DCCA 1IAQA 3R0JA 4R5MA 4GVPA 3T9CA 3TOXA 1WVIA 3I05A 4E7PA 1MIHA 5B7PA 4C1BA 1M2NA 2Z5VA 2Q7DA 2VWHA 4O29A 2IV3A 4PYJA 3FWHA 4P1ZA 2DMRA 3JCZA 2AG5A 2IYNA 2FGKA 3PVSA 4P4UA 3WL4A 5JH7B 1EE9A 3HM9A 1DMSA 4JH0A 4D0RA 4QTUB 2BUAA 4INJA 4K9LA 3IUQA 1AZLA 2EFHB 3GEDA 3JTEA 1UM8A 3GJ4A 3H87A 2YDYA 3H8SA 3B52X 3NHMA 3OCCA 1DG3A 1JAIA 1T1RA 3FFBA 4IDFA 2X23A 1NXXA 5G0SA 3RPEA 2HF2A 3KKQA 5I7UA 4AIIA 5BVGB 1JQJC 4UVHA 2G0NA 1NE7A 2H2AA 4LCBA 4BVAA 4NCJA 5KIAA 2HXSA 2H8KA 2IY9A 4WAUA 4EB6B 4LRWA 1KK2A 1C4XA 3VDXA 5BSMA 4BPRA 1P8AA 4HLQB 1FFWA 1C3OB 1NLUA 2OHVA 2C9YA 4HFJA 1K06A 3G2PA 1KFKB 5DBHX 1T5DX 1ORRA 3L3BA 4DG9A 5AKLA 1MJFA 1T8TA 1T25A 3D0QA 3DM5A 1XQ9A 4MPPA 4CG1A 3FZQA 5K05A 2CXNA 2C7QA 2QWXA 1SPBS 1P7CA 5H68A 3VHQA 1KOGA 1KO8A 1I24A 1M1YA 1Y48E 2BH9A 2C61A 3CVWA 2HL6A 3PNYA 3IMFA 4AO8A 5BQFA 2VPQA 4X7BA 3U4DA 4MQ4A 5KQGA 1SKYB 4ZT5A 3STUA 3WOVA 3R9XB 3EXHB 3H2BA 4F3NA 2QRQA 1QV6A 5B3JA 2XMQA 4MVJA 2OFOA 3EPAB 4XWTA 1NNUA 1V16B 1H05A 1U5CA 1T5SA 2OV3A 1ULAA 3DDUA 3ENQA 1Y8QA 3ESRA 3FVWA 3ZK7A 2O2IA 3DV0B 3NEAA 1N34B 2O48X 4HQFA 1BHJA 3P9NA 4U39A 1KZ1A 3OF3A 4U2EA 4LTMA 4CL2A 4NZZA 3I52A 4Q3DA 1XMJA 1LC0A 1CZUA 2VUHB 2E4ZA 1TU3A 2QMUA 3FHJA 4CEJA 4RETA 5B7QA 3QHQA 3KB6A 1JIQA 1A9OA 3BAZA 3GCWA 4MVJM 3PT9A 3QGMA 4OBBA 4DPMA 4LV6A 4MQFA 4XEHA 1U3DA 2W8BA 3P27A 1H3NA 1T5HX 4O2BB 1XZKA 3FDXA 2BFBA 1H5QA 8MHTA 2ZWPA 2CF6A 3FZGA 4M46A 1KZHA 4DAOA 3LE8A 2V97A 1XDUA 4YP5A 2MSLA 3OTIA 3HO8A 2PL5A 3O8BA 4BAZA 3T35A 5AHOA 4FFRA 3AVUA 2RAUA 5LMNB 2F9FA 3M89A 5TSDA 2B4TO 1UEIA 3TNLA 3R76A 1N33B 1E66A 2JA1A 4FGZA 2C20A 1GTZA 2DUJA 1HXHA 3PJFA 1RI1A 3HDQA 1UWCA 2EQBA 2CHGA 4MQUA 4QUEA 4Y1FA 3VNQA 3OCXA 5BN5B 4KV7A 1RPAA 4PHFA 5ALLA 5BNFA 3RYCB 3LQRA 5F33A 5AUNB 1W9MA 3R5FA 4V0SA 3P0RA 4H0FA 4H77A 3GNLA 5JCPA 5EE1A 2FHPA 5KBYA 5J4YA 1NU8A 3EOZA 5C8XA 2AD5A 3HYRA 2AR9A 2C58A 2WILA 4Q4JA 2DJIA 2AXPA 3LP5A 1E77A 3AUAA 1LF5A 2JIQA 4JCOA 4Q1EA 1ZS9A 4B71A 5DTIA 2DLDA 1R3UA 5FEUA 4M9SA 3AVTA 1Y9EA 4UEJA 2HMYB 2Y68A 3FCUB 3GT3A 2XWBF 3BTVA 1KVRA 1QRRA 3W77A 1R8JA 3MLBA 3VYWA 3CURA 1NI4A 3EWAA 1B2RA 5G02A 2H1OA 1WPXA 3EVTA 4AF7A 4YX9A 4EG1A 5ESRA 2GJ9A 1UQTA 2MT9A 5FORA 4LXUA 5SYNA 5JAUA 1PWZA 4ZU6X 2YIMA 1SMKA 1VDZA 1YR2A 3HKBA 4JJZA 4RZUA 1HFEL 2CFCA 1YR8A 4J03A 1THZA 2GPJA 2Q6VA 1OBCA 5E3JA 3AFIA 3VOTA 4FD3A 5KPJA 4W8OA 2AVDA 3LOUA 4KW7A 1NXWA 1KP9A 3GLSA 5BYBA 2WFMA 1O5OA 1J24A 1B8NA 2JEZA 1SR8A 4LUCA 3VZBA 4RPGA 4LX0A 2WJ4A 3RTGA 3DLIA 1M5UA 3EXFB 1D3AA 1Z5ZA 1YAHA 4MB6A 3AEKB 3AQIA 4R1UA 2Q1TA 4TPKA 4JVNA 5D2CA 3SZRA 1RDFA 1U7TA 4FJ2A 1II9A 3QFFA 3ANYB 5EN4A 5KTRA 2P67A 1VHQA 5A2QA 4DLXA 4NENB 3QPUA 2R6JA 3RQIA 2CV2A 5I45A 2XE8A 3EQ7A 4P4SA 1JWBB 4WV3A 4O63O 5HJ2A 5ITVA 3NGXA 3GDOA 1I80A 1VI5A 1X92A 5HDQA 3KPUA 4D4MA 3CW8X 1I3MA 4YXWA 3GLHE 5HKKD 1F4PA 1USVA 2G7MC 1C41A 4WA8A 2NPFA 3F9RA 1X1EA 1HT2E 2RHBA 3M8KA 2BUBA 1TRKA 3KZOA 1CR2A 4XUCA 3ZOKA 4CQMA 5LLDA 3MRTA 2PVCA 5ALQA 5G3ZA 5TQ2A 4DQUA 2OHXA 2YYYA 2PX8A 2CSXA 3PGMA 3EW7A 3B48A 2PVSA 2PG3A 2IHZA 3JZIA 2ZJ0A 1MB0A 2FXVA 4M0EA 3JQEA 4DXAA 2HW8A 1NW8A 3NTOA 2I3BA 2VPZA 4URYR 5G40A 1PNOA 3ADPA 4OKSA 1ZGBA 2PLFA 4URZR 5EQDA 3VMFA 4EEZA 5JJLA 4WNYA 2XQVA 4WIAA 2XUJA 3LX8A 4OU4A 2I6TA 3GFQA 4HYTA 2FUKA 1SIWA 3HWX1 2P1ZA 3L43A 3WP0A 1RIFA 5JPDA 3F47A 3R6WA 5A5GA 2I1LA 1CRPA 5ADHA 4X54A 4TLLB 3EEYA 4IRXA 2XDWA 2H1FA 3ZWOA 5G4LA 5HP4A 5HW0A 3VHXA 5GIPE 2ZRAA 1SOWA 1Y34E 3AUXA 1JR6A 3G0GA 3R24A 2UZ1B 1I1NA 2Q3DA 3NVKI 2W48A 2X9GA 4P38A 3I5YA 3HFSA 2BMAA 4X8HA 3DL2A 4GNKA 2Y1OA 2RD2A 4HRAA 3JW8A 1T2AA 5IN5A 4DYVA 1X7WB 3LV8A 3W3ZB 3FLAA 4CV1A 5C3UA 2V7WA 4NFHA 3EAGA 3TQOA 3VKFA 3TEFA 1U0NA 2CNNA 5DJ5A 1Y1RA 2OZEA 3OC6A 4QDJA 1Y7IA 3IEPA 4YAWA 2NQ8A 2B3DA 3BA1A 1TM4E 1HC7A 3H0EA 4TKMA 3ND9A 2HF8A 4DQVA 1EJ2A 5L6LB 1VL5A 3HACA 2PWYA 2AW5A 3N28A 2NVUA 2C42A 4YQEA 5CFLA 3TFWA 4M8SA 4J4HA 3EG9B 1GO2A 4IQ4A 4WW0A 5DV9A 3M81A 1FP2A 1CS4C 2WG1A 1HZZC 1C4WA 3TNFA 1SUDA 3LT0A 2R7MA 2VATA 5JSKA 4YRMA 3RUAA 3QWHA 6REQB 5ED4A 3L7IA 2TMYA 5MF6A 4NJMA 3P71T 4UQPA 4F86A 1D7OA 2EP5A 4H35A 2FPIB 3N2ZB 3ORYA 5C1OA 2FRDA 4N0MA 3GHYA 4LY9A 1YS4A 4M9UA 1TLLA 1ZG3A 3PYLA 2OWEA 4WBNB 2JEOA 1NUSA 4Z51A 2GEUA 5JV5A 3CEHA 2MINB 5K51A 5JISA 2GEDA 1RWMA 2X9QA 2O5RA 3Q15C 2CLHB 3N58A 3N8KA 2XMPA 3EQ6A 4J0IA 2R86A 2OCIA 4A8PA 1EJBA 5KJFA 4FMPA 4L76A 4NRDA 4HMOA 3UG6A 4QPCA 5DGHA 3SOZA 5C18A 2J3DA 3Q2KA 5C8YA 2QNRA 4C4TA 2JGIA 1H1LA 2V7XA 3BHNA 3OKPA 5BR8B 4I4LA 4KN6A 4DY4A 2EZUA 1UOEA 1BH2A 4J8PA 4MDEA 2YQZA 4N03A 3BICA 1ST3A 4WPGA 1IM5A 5J5VA 2O8DA 5BV2P 1K6IA 4XWWA 1LBTA 1LDNA 4OSEA 1WMEA 2H51A 1M66A 3CO5A 1I3LA 1YZYA 1LBIA 2OXCA 1J97A 4C4PA 1TCAA 1W8DA 4BNJA 3KPVA 2JB9A 1I2MA 5CRIA 2XTNA 5E6SB 1N6IA 1VA4A 1T1SA 2VRWA 2QXYA 3EXIB 4PO1A 1DTEA 5D3KA 4O4IF 3UK2A 5AK6A 3IDZA 4WKOA 3IXMA 3WLAA 4Y1RA 1MQSA 1P9WA 2BCJQ 3MCWA 4KNVA 4Q18A 4A1FA 2BKAA 1E1DA 2LDXA 1JBQA 3NC1C 4YACA 1VIDA 1S02A 2VP6A 3A2LA 4B43A 5FO0A 2AYXA 3T7DA 3KHKA 1W46A 4PSCA 4CTKA 1OLSA 5IH7A 1TVKB 2V7VA 3WYDA 3QX8A 4KUEA 3WRXA 3RC3A 3LZDA 4G5SA 5CIWA 1Z6XA 1C2TA 2QLBA 4S1TA 4QVIA 4LY0A 3THYB 4ZOQI 3DT8A 3SHOA 1LK0A 1QTRA 3HEMA 4DLTA 1PR1A 1U3UA 4S2EA 4B46A 2PRIA 4JQOA 5EESA 1AKQA 3SDSA 1O08A 2I3DA 1LS1A 1SIBE 2JFBA 2NXEA 3FVTA 2ZUTA 4BUCA 3DVAA 3G8CA 3WLJA 2PTHA 1Y98A 1PSWA 5C53B 3E9EA 3REFA 3EGXB 1EXWA 4TQUS 2FG5A 3WG9A 2D5LA 3JATB 1TZJA 1KI1A 2AK3A 4BLUA 2F8TA 2OVFA 4C7KA 2C59A 4WX2B 5B3JC 4PLPA 1N6KA 3L6RA 1H0SA 1EUCA 2FF5A 4E30A 5LIPA 1EUDA 3GW8A 2DQKA 3RVJA 1FQJA 4EZEA 4PC3A 1RM0A 5IJ9B 2JBAB 1N77A 1ZCAA 2QQ0A 1P7YA 1ZO8A 4POOA 2BBWA 4ZGGA 2NMVA 5DM2A 1IHUA 5FNVF 1NUUA 1U8FO 1E2MA 1B42A 1G1MA 2AJBA 1XAGA 2WYWA 3CONA 1VKHA 3PTLA 4NU0A 3C1AA 1VCOA 4I4NA 5CFPA 1F4VA 3MWGA 3AZOA 3CRQA 1PU2A 3DC2A 3CZRA 1C2YA 2IT1A 4YMUA 4F5DA 5I8ZA 2Q2VA 1KMCA 2J7PA 1TAHA 4RZHA 1NNLA 4WY8A 4BKUA 3ZVRA 4E5MA 3F90A 4URUR 1KAGA 4V38A 4ED9A 2FWIA 1J0CA 1ESDA 1EUQA 3G0CA 4EQ6B 3D2CA 5AVRA 3A4VA 4KHZA 3S2IA 4IVQA 1BVRA 2FX3A 2ZR0A 3E2MA 1IMOA 1WF3A 1UBFA 1QK4A 1Q11A 2HMUA 1R9NA 1KO7A 5FT9A 1Y82A 1M6VA 3RG8A 3ZHOA 1Q0HA 4L6CA 4OCZA 4A0GA 1IMJA 3TQHA 1J00A 2ZUSA 1VMDA 1DU4A 3K3PA 1XDBA 4B6PA 1G8SA 4E1BA 3ZVLA 2AFVA 1U0SY 4HPWA 3CTMA 3KJXA 1R6VA 3WMEA 1NQ5A 1F9EA 3QP9A 4YJHA 5DP1A 1CUEA 1QKJA 1YRQA 4KE9A 4M0PA 2IPMA 4FZJA 2YXPX 1K6EA 3W04A 3LCUA 4X6UA 3PSHA 1Y7LA 3TIXB 3RGWS 4J16A 4LJ7A 3N6VA 3BWXA 4O4LF 4AD8A 3HN6A 5FWXB 3OOEA 4UQLA 3E6AA 1M33A 4OA5A 2REBA 2JHFA 3OTWA 4KLNA 2HY7A 3F4LA 3GYGA 4OHBA 4K8RB 3SQNA 5BMVF 4MR8B 1T0JB 3VJKA 1PDWA 1PR6A 5F1KA 3I09A 5E9WA 1N7HA 1B6RA 2P3QA 3EP8B 3EMBA 1ZNQO 4IF6A 4L4XA 3H6KA 4HCJA 2QW1A 1C9MA 2JK0A 3GLGA 3IODA 3PT5A 1TO2E 3AM5A 3DOCA 4ND2A 1W96A 5KQMA 1S3FA 1DWPA 4X1KA 1K68A 4TLEA 4COKA 3OCWA 3HNPA 5IX8A 4QBFA 5CAEA 5AHWA 3D8UA 1G1AA 4R68A 3GGJA 1LX7A 2WWIA 4NMXB 3Q3HA 3S2EA 4B4WA 2PDAA 4HFMA 1Z16A 2BM1A 3JYQA 3C41J 3NPMA 3DDNA 3AVYA 2GK3A 1VPDA 4O0MA 5JWHA 3SKVA 3OCJA 4Q3EA 4PGAA 4TOIA 3KTAA 2YRFA 4OOEA 2ZAOA 1XT6A 1E9SA 2FFJA 4LCJA 3BORA 4IG4A 3LQFA 2R6FA 3QTBA 3H9CA 1J4AA 2I6SA 3LUCA 2YJGA 2NO1A 3VR0A 3E81A 2EERA 4K9PA 3F7TA 1KDYA 1Z75A 1L7BA