2O4UX

Crystal structure of mammalian dimeric dihydrodiol dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of dimeric dihydrodiol dehydrogenase apoenzyme and inhibitor complex: probing the subunit interface with site-directed mutagenesis.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
molecule keywords Dimeric dihydrodiol dehydrogenase
total genus 115
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2o4uX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4uX01
4ZHSA 1LSJA 3NJ8A 3PHHA 3OQ6A 4WCFA 1R0KA 4YRBA 4RQTA 3OBBA 5IDYA 3X2EA 3OJ0A 3A1NA 1UDBA 3P5SA 4Q3AA 4EDFA 3DZJA 1BWSA 4QXMA 2R00C 1DC3A 1HDZA 1U8XX 2RH8A 3JQFA 1JKIA 1O95A 3ANNA 3JYLA 3PJGA 4QUKA 4D0RA 5DULA 4ESOA 2OBYA 2C5EA 3MZ0A 4NG5A 4GVLA 3FPCA 1QRRA 4D44A 3DHYA 4RPLA 5BSEA 5CP8A 4QFCA 3Q9NA 3B6ZA 3CKYA 3PHLA 3AOEC 1O89A 4OIMA 4QO7A 2Q50A 1NAHA 4YQYA 3IP1A 4RLHA 3ETGA 2IRWA 4GKBA 3PWSA 4I5EA 1JTVA 4ZD6A 4AICA 2O3SA 4WGGA 2VOEA 4IQ8A 2GN6A 3UICA 1I10A 3V1YA 1ISMA 5DCUA 2JCXA 1X7HA 3BHJA 3AOGA 3CE6A 4RPGA 1B8PA 3Q0EA 1ML3A 3RC9A 1I2ZA 3LLSA 2GO1A 1KOLA 1VJ1A 3ZV3A 2O2YA 4I1IA 2YYYA 1CF2O 4GKVA 5CDYA 1UJMA 5J23A 4MPDA 4JQCA 5JYFA 1S6YA 2NUAA 4E5NA 1CIVA 2CSUA 4NJMB 4NI5A 1EDZA 2EW2A 2NTVA 1FJHA 2E6UX 4WUVA 1J0XO 4L76A 1SZJG 4LVUA 3E8XA 2BLLA 3EAGA 2HO5A 2HMUA 2X5OA 3FN4A 2VUSA 4KDEA 2GYYA 2X1HA 5KJEA 3ZU5A 2EGHA 4WE3A 4BNGA 4FB5A 2DBQA 1EUDA 2P9GA 1NVMB 4FGWA 3GG2A 3GK3A 4DBVO 3O03A 1I2BA 2Y1OA 1YH3A 4MO2A 2Y67A 3QV1A 2QG4A 4YAJA 3LDHA 4DLLA 1A72A 4PFJA 1XU9A 4P22A 4LRTB 4C4OA 3ON5A 1HLPA 1JVBA 2QZZA 4M86A 4NU5A 1JU9A 3WXBA 1LUAA 3RU9A 3DOOA 1MLDA 3BAZA 2ILTA 3GF4A 1WLYA 3BIOA 3VOSA 4D43A 4CM9A 3I6IA 1XWFA 2WTBA 4MKXA 1KC1A 1VL6A 4XJTA 3DZFA 3L6OO 2AQHA 4TVBA 3GAFA 1N5DA 4IBOA 4YT5A 2Z5LA 3A9WA 2A92A 4NBTA 4K1LA 3NEPX 4UUOA 1PJLA 4TQGA 3L9XA 1Z74A 3VPGA 4NFSA 4IMPA 1PWXA 4IXWA 3ADOA 2AQIA 3BMCA 3RIHA 3PPIA 4Z6KA 2HRZA 1OC4A 1R4NB 1I0ZA 3C3XA 5IFLA 4JNKA 4XYMA 1X7DA 2HJSA 1KC3A 5MGBA 2HUNA 3PI7A 4Y8VA 4OM8A 3UCEA 1F06A 3ZWCA 3ST7A 1SPXA 3BMNA 4YYZA 2X0RA 3KB6A 2GLXA 4E5KA 1PZEA 3NDIA 1H6CA 2R6JA 1NFFA 4FSHA 4WECA 3H9QA 3QY9A 3F9IA 4YTEA 5A3VA 2Y1DA 5FEUA 3I83A 1BRMA 1PEDA 3GRKA 2OFPA 3Q2KA 4BO9A 4URFA 2NACA 3UF0A 1IE3A 4IDAA 4A03A 2YV3A 5KNLA 1QR6A 1Q7BA 2ZCVA 1TLTA 4WLOA 4IS2A 5L4NA 3R3SA 1W8DA 2HDHA 4E12A 1PJSA 2Y68A 3F6YA 3UGKA 2GPTA 4BNIA 3ZHYA 5ICMA 2D4AA 5L40A 1DAPA 5A04A 1I3MA 3DAGA 3JD4A 4XDZA 5JPIA 5AXCA 1HEUA 5MDHA 1T2AA 3KYCA 4H15A 4JJIA 1J4AA 5IF3A 5COQA 2EKLA 1NR7A 4ND4A 4R3WA 1UP4A 5IJZA 2DFDA 1M6WA 3MWDB 3HADA 4A7PA 1H2HA 4TRMA 3PXXA 2Q46A 2OL4A 4GVXA 2OP1A 4OXNA 4FFNA 3TZCA 2JHGA 4Q9NA 2UV8A 4KUGA 1MUUA 2VTDA 5EJ2A 4ALKA 3DBVO 3WTBA 1DOHA 5LDHA 5TT0A 2VYVD 1NQAO 3F4BA 4ND1A 4WLNA 1KVQA 4AJIA 1NVTA 1X0VA 1YXMA 5JYAA 4BNFA 2WM3A 3CH6A 4PCVA 3RBXA 2CFCA 2FR8A 4E6PA 4CLOA 2NQ8A 3TOZA 1FDWA 1OAAA 3DZGA 4I5FA 4P38A 4AJEA 2PH5A 3L4SO 3GGOA 1KEVA 4J4TA 2JD0A 4NH4A 4MIEA 3AWDA 4FFMA 1UUFA 1DEHA 5GMOA 3K5PA 3IKTA 1YL5A 1UXKA 2RHCA 1UR5A 3F4LA 1Q0LA 3F1LA 4K6CA 3AJRA 4RF2A 3ZWNA 1GUFA 2X5KO 1BXKA 1TXGA 1XG5A 2YFQA 3DBLA 2X7HA 1JAXA 4WCFB 4XEHA 4W4TA 1GR0A 4LW8A 1DIHA 4Z9XA 2DBVO 3ENKA 4ZRMA 2CDAA 3FWNA 5JAZA 4J43A 4Z0HO 4L8VA 1UDAA 1SO8A 4ZJUA 4B3HA 1ZK0A 3WGTA 3DMTA 5JXWA 4HFJA 1VSUA 5M6DA 2I3AA 1JA9A 3PJEA 4Y98A 3GDFA 1LDEA 3WYCA 4OKNA 1LDMA 2ZJ1A 3DOCA 1C0LA 3EUWA 1PGOA 1O0SA 1V8BA 1Y6JA 3CTMA 3CZMA 5IAAA 5F3RA 3IIEA 2Y1EA 1RM4A 3IUPA 4GGPA 3ZHZA 3TJRA 5CDSA 3ANMA 5JDIA 4IGFA 2FWMX 3I9KA 3PTZA 3DB2A 1U5AA 1JDJA 3JCZA 1GZ6A 4YDRA 3ICCA 3DONA 4NK4A 5COBA 1AUPA 2JKVA 4P4LA 5TIIA 2AEMA 1UXJA 1I2CA 2D8AA 2GN4A 3EDMA 5CDGA 1O5IA 2BI8A 1HE5A 1U5CA 3ORFA 4NPCA 1PQWA 2FRDA 3H5NA 4YAGA 1QORA 4OYRA 4PG6A 1M67A 4R5HA 4LSWA 2VRCD 2NU9A 3OA2A 3D64A 1DC5A 1D8AA 1XU7A 3HZZA 2BI7A 5TX7A 1JVSA 4G81A 4EITA 3HSKA 3PDUA 4NJOA 4DPMA 4J7XA 4KUHA 3TZQA 6LDHA 1R16A 4AJ2A 3KSDO 1NPDA 1NASA 4L4SA 2J3IA 3TOXA 5CG1A 1N1EA 2EF1A 3V2HA 3NGXA 4B7CA 2B4RO 2NVUA 2LDBA 3QVOA 5A5FA 3EY4A 4FPXA 3PK0A 2CVZA 4TRJA 3VPXA 3WGYA 3KSZO 4PLYA 3WYBA 1ZMOA 2J5KA 1E3IA 3I23A 3IP3A 5LCXA 3OEWA 4IJUA 3QVWA 3CIFA 1WZIA 1XQ1A 1R4MA 2CY0A 5C5IA 4MVJF 2PK3A 1PZGA 1B16A 1PR9A 1T2FA 2P4QA 3WSWA 1JWBB 5EERA 5IDWA 4BQRA 1W6UA 4TRNA 4MINA 3FSRA 4MVJE 1T4BA 4D79A 4FOSA 3TZHA 3ZW8A 5JYEA 2VHYA 4R54A 5EIOA 4B8WA 1XGKA 2X4GA 4FIZA 2VHWA 3NTRA 1D1TA 1ISGA 2Q99A 2IZ1A 1QV7A 2NVUB 1X0XA 5A9RA 1E92A 3TZKA 1ARZA 1LRJA 1N1GA 3QA9A 5A05A 5JDCC 2D3TA 5H81A 1TT7A 1YO6A 3BTUA 4YQZA 1JLLA 3DR3A 3TF5A 5HA5A 1YB1A 4GMFA 4S1VA 1BG6A 2HMVA 3AUAA 5G4KA 2CVOA 2W98A 4CLOB 1F8GA 1L7EA 3VH4A 2NVBA 3KVOA 1B15A 5CPFA 1AXGA 5JE8A 1NR1A 2VRCA 1AGNA 4OOFA 3ROPA 1P1HA 3IKVA 1ADFA 4WLVA 1D7OA 4QTZA 1X1TA 4FOOA 3PIIA 3ZNQA 2BFPA 2GRAA 1F12A 2UDPA 3EVTA 1U4OA 1EQ2A 2DBZA 3JQ9A 1E7SA 1Y8QA 2WJPA 4XQEA 3AM4A 2VRBA 1SNYA 1WDKA 3K9QO 4IINA 2IE0A 4ILKA 3W1VA 1BDMA 4E0BA 3IUSA 4HFNA 3JQGB 4B79A 4CODB 4L4XA 4E2XA 3JD2A 2RBEA 4O6VA 1Y1PA 3UVEA 4HX5A 2P91A 2A9FA 1Q0HA 3DBHA 5EMHA 1JW9B 5JYDA 1PGQA 1C1XA 1ZK3A 2PLAA 4LMPA 4BO7A 1I3KA 1NM5A 1U3UA 4TKLA 3Q11A 3RUDA 1EK5A 2WEKA 3BMCB 1YL6A 3OFSA 2JD1A 4DA9A 1PIWA 2WE7A 4E21A 1MFPA 2CNBA 5G2OA 4KQWA 1EK6A 5GY7A 2W2KA 1TB4A 2NLOA 4H7PA 3F47A 5U4QA 2J3JA 2BFAA 2CF5A 1RM0A 5G0VA 3ZV5A 4ZQEA 3OECA 4NBUA 4Y6SA 1I36A 5CPBA 3RC2A 1BDBA 3S8MA 2E48A 4XD2A 3KYDA 5B1YA 4PLGA 3C7CB 3T4EA 1PJQA 1YDEA 4XR9A 1F8FA 3O8QA 4KMSA 1C0PA 4II3A 1CQIA 1DBVO 1DXYA 5I7EA 4XR4A 2JAPA 1ZNQO 4CQMD 5KJ6A 1NXQA 2UYYA 2AG5A 1HDOA 2O2SA 4BV8A 1GPDG 3DL2A 1CDOA 1V35A 2QW8A 4M89A 3H4VA 5EQFA 4I9UA 4RZIA 4IDDA 3FR8A 2VHZA 3U09A 2AQKA 3AM3A 2G82A 2E37A 4NFYA 1GADO 5HTOA 4UVHA 3FHLA 3VKUA 3OF2A 1B14A 3UHAA 1FF9A 4IZIA 4WNIA 4L74A 3FNFA 1Z7BA 5DBFA 3CINA 2FSSA 2FPIA 4W7IA 2PNFA 3D5TA 3LF2A 4A73A 3JQ7B 4QECA 4WEOA 3VKVA 4YJHA 3E48A 4XQCA 4ALJA 1FDTA 4GH5A 3W6ZA 3ZN2A 1T25A 2EWMA 1P9LA 2ZTMA 1ISFA 1P1FA 2PWZA 3GNSA 1LRKA 1WDMA 1IB6A 4CL3A 4BO1A 4EJ6A 5B4VA 1E1KA 4M87A 3EMKA 2NU8A 3IC5A 3BMOB 3G0OA 3VZSA 3DTYA 1YB5A 1H9AA 2BHLA 3FRJA 5IN5A 1IHXA 1D3AA 3S2EA 4CQLA 3JTMA 3JQDA 1PU2A 4Q3BA 4FC6A 3NTOA 4K6FA 4BNLA 1EVYA 1CWUA 1Q7GA 3RUFA 4BOYA 5TLSA 1U8FO 3ZGYA 1VRWA 3ZWOA 3LK7A 2YHUA 4BNXA 5L4SA 4HWKA 4PLCA 4GSLA 3WDSA 3E9NA 2Y66A 5KKCA 1LJ8A 4ROSA 2JAHA 4CMCA 3PHJA 2XXJA 1GQYA 2RH4A 1F17A 3D7LA 3I9JA 3UOGA 4IMRA 2NNLD 2X86A 1EQUA 1B26A 3O38A 2J8ZA 4MVJH 3HE3A 1VM6A 3P2YA 4CM1A 1YOVA 3U5TA 3U4DA 1LU9A 2EIHA 2FPGA 1DSSG 2A4KA 2ZATA 4FFPA 4DUPA 4UEOA 3KYDB 4O1MA 3OHSX 4CQLB 2BELA 4FJ0A 1OOEA 1ZJYA 1VE9A 1C1DB 3W6UA 4RVUA 2DPGA 2G17A 4FW8A 4XDYA 1IUKA 1ZSVA 3ZWBA 2Q3EA 3IQDB 1KVTA 2AE2A 5DDIP 1FDVA 2V6FA 3FTPA 3U4IA 3A14A 4R9RA 2RCYA 5DBIA 5T8KA 1Z7EA 3O26A 2EJWA 3ZNOA 4PIVA 2Y0CA 2P9CA 1Y9AA 2ZB8A 3DOJA 2C20A 3W4IA 4MKZA 1EVIA 1ZSNA 3VZQA 4OO3A 2VWHA 3WFIA 2F00A 4J2HA 4RO0A 1A4UA 5JCJD 1PL8A 2JD2A 1ZKMA 4FDAA 3HDHA 3G79A 5BNIA 2DU8A 4FQ8A 3DZKA 4L0QA 1VC2A 4C7KA 5IXSA 3ANLA 3U4HA 1C14A 3C7AA 5GZ6A 1UXIA 5DT9A 2WD8A 3BXXA 4NIMA 4HP8A 4II2A 2PKQP 2XAAA 2C54A 3HHPA 5DBGA 5JNLA 5LC1A 2EJVA 5FF9A 2I76A 1HDGO 2AE1A 2BFMA 4F46A 4U5QA 4HKTA 4MIYA 2Q49A 3ZWPA 4ND3A 1SEPA 1NTOA 1PZHA 1SEVA 4WPGA 3ETEA 4E13A 4TMFA 4L4RA 4R69A 5CAEA 4E2YA 4HUJA 1NQOA 5JW6A 1HZJA 1GUYA 2O50A 4HBGA 3A06A 1RM3A 3DTTA 3FPLA 3WQRA 4FBGA 3SJUA 4PLVA 4ZGWA 2Y1CA 3WIEA 2A35A 4RPHA 4GAEA 3IOYA 1LDNA 1ZMTA 3GOHA 3W8FA 4BNYA 1HT0A 2ZKLA 2HMTA 1V0JA 3BA1A 4IPTA 1HKUA 4WCDA 2OHXA 3VVCA 4EGFA 2LDXA 3OIFA 1BW9B 1V3UA 4XGKA 4J90A 4Q3NA 2Y0EA 2D1YA 4XRGA 2VZ8A 1MXFA 5HS6A 1Y5MA 1TT5A 4RCVA 3GPIA 5G4LA 1YONA 3WGGA 2NM0A 4ZQFA 2GZ2A 4RF5A 5JDIC 5AOVA 9LDBA 4INAA 4NBWA 4ALIA 4J9UE 1DRUA 2GASA 4HADA 1LDYA 4PRLA 3RWBA 1V3VA 4XZ3A 4X54A 3DC2A 1LDBA 5DOVA 1B8VA 4CR7A 2Y93A 2PGJA 4LN1A 4PLPA 2D0IA 1D4FA 5ER9A 3JD3A 2HKIA 4P8RA 1GYPA 1Y8RB 5GZ1A 1ZK2A 1NHWA 2JFGA 3ADPA 3GVXA 4PZDA 4TZKA 1GZ3A 2H1SA 1BMDA 4GBJA 5DZSA 4BNUA 5KOIA 4JP3A 2C59A 3HUDA 1R0LA 3L6DA 3OEYA 3ONEA 1ZH8A 3PP8A 4RVDA 5L45A 1LXCA 4XB2A 4MKRA 2VHVA 3S55A 1E7YA 3PZBA 2O4UX 2G76A 4CL8A 1TEHA 2PGDA 3H3JA 4HNGA 3TSCA 1VJ0A 5TQVA 4F3YA 4CUKA 1U28A 3L07A 5IZCA 3AUSA 3GUCA 3E5RA 5TS3A 2BGKA 4Z3DA 3SC4A 1SBYA 5JY6A 1HDYA 4BKRA 1OI7A 1U1IA 2DUWA 2PTGA 1YS4A 5T5QA 4M54A 1UP7A 3QWAA 3H9EO 5HS4A 1U3WA 1QYWA 1J6UA 2W8ZA 4PG8A 4J1TA 5ADHA 4DIBA 3DHNA 4CV2A 2JJYA 2BGMA 2PV7A 2O3TA 2PKRA 4AJ1A 4XYGA 2H6EA 1A71A 4CMKA 4CUZA 5TC4A 4DWVA 3W4JA 1T2EA 5B4TA 3HG7A 4PG4A 1N2SA 1PSDA 4I08A 3GPDG 4YAEA 4XIYA 4KWIA 2W2LA 4U6SA 1MC5A 2IODA 4XQGA 1SOVA 1K6JA 1WP4A 1T24A 4M1QA 3GNQA 1B2LA 1BVRA 4AJ4A 2I65A 4ZN6A 2EEZA 3I4FA 1ISHA 3IJRA 3B20A 1YE3A 5HM8A 1LI4A 4KWHA 4KDFA 1IL0A 3JQAA 1LQTA 3JD1A 4FFOA 5H83A 3FNGA 3JQAD 4J7UA 3SC6A 3HN2A 1I01A 1PS0A 1DIRA 4BO2A 4CMIA 1W0CA 2J5QA 3RD5A 3WLFA 4MP8A 4IGEA 3PDJA 3SBOA 1RJWA 4FJ2A 4A5OA 4BO8A 4XB1A 5HBRA 4W9NA 1KIFA 3LU1A 4E2WA 3FNEA 4PGFA 1DPGA 4JBHA 3QVXA 4CR6A 1KY4A 2C5AA 2UUOA 4U7WA 1A9ZA 3SXPA 3IDSA 1DDOA 3H2SA 5K6AC 5A9SB 4O5OA 4YVFA 3G17A 3H6KA 3O9ZA 1DC4A 4JBIA 2O3QA 5JS6A 3AW9A 2FMUA 1ONPA 2EP5A 3GNTA 2PKQO 5EESA 2P5YA 4YCAA 3NV9A 1G1AA 4R16A 3U49A 4BQPA 3VDQA 4KZPA 4PZEA 2Q45A 3OH8A 4BNVA 4B4OA 1H94A 3JYNA 1CETA 2AW5A 3CMCO 2G1UA 5G0TA 3P2OA 1RYDA 2FP4A 2QYTA 1B3BA 4QQRA 4DQVA 2P4HX 5T67A 1KERA 5JAQA 3GC6A 2BMAA 2VYND 1DRVA 3V1TC 4D3DA 3L4BA 2ZK7A 2R2GA 3GG9A 4BO6A 3LT0A 3MJSA 4NMHA 4C7JA 3I9MA 1B3RA 1AXEA 5KVVA 2J3KA 7ADHA 3O8QB 4BNJA 1P45A 4KQXA 1WXDA 3QWIA 2DQ4A 4QSMA 2JFHA 2C2XA 2GCGA 2EKQA 2W2LD 3HB5X 2VUUA 4CM8B 1YBAA 3GZNA 2X9NA 3H9GA 5A1TA 1CEQA 2C82A 2IYOA 3H5AA 1HZZA 4HY3A 4YT4A 4IQGA 3PGJA 1WPQA 2AG8A 1WMBA 5ICSA 4YR9A 1F0YA 1Q2XA 4J1NA 4MJLA 3WWZA 4MVJM 1KVRA 2HCTA 4ZQBA 4LRSB 1NQTA 4OQZA 4Y9DA 1X15A 2YUTA 3DAFA 2H63A 1LX6A 2JHFA 3R6DA 4K9DA 3RFTA 1QSGA 2B36A 3WGIA 2VNSA 4UULA 3UKOA 1E77A 1J49A 3RROA 2GN8A 1QV6A 2HAEA 4GX5A 1YVEI 3SEFA 1DHTA 3AU9A 2JFFA 4W7HA 4DMLA 2PZKA 1EBUA 1LBEA 4JIGA 4UVEA 4GMGA 2PH3A 3HJAA 5FI5A 4AJLA 5EQDA 3WQQA 1BTOA 1GTMA 4N5LA 4E5YA 4DLBA 4PG5A 4LMRA 1GAEO 2CMDA 5EL0A 1LSUA 2J5RA 4IDEA 4R1UA 1BXGA 4BUCA 1UAYA 1ISJA 4BO5A 4QFDA 1P0CA 4B3JA 3AUTA 1ZBQA 3MJTA 4TROA 1FXSA 3EW7A 2NQTA 4XKJA 4Z9YA 5T6BA 1NP3A 3H5RA 4YACA 3V2GA 1C0KA 3NGLA 3GZ4A 1VL0A 5L7YA 4U8GA 1LTHR 1B7GO 4ZA2A 4IQ0A 3INRA 2FN7A 3K30A 3WMWA 3VH2A 5ILGA 1JQBA 3D0OA 1MB4A 4PLHA 1PWZA 4UEJA 2HLPA 2HRBA 3UUWA 2IEBA 1SB8A 3JQ7A 4G65A 3DZHA 1DFIA 1HRDA 4E33A 1XCBA 3HWRA 3TFQA 4E5MA 3FI9A 3JQAB 3C1TA 3JQEA 1E6WA 3CPSA 4Q3EA 3COSA 4YT2A 4F45A 1ONNA 2QQ5A 5CEEA 3WNQA 2Q1SA 1C0IA 2RIRA 2ZJ0A 3H8VA 3FCOA 3JD0A 1L1FA 4EZBA 2PZMA 3AI1A 1KETA 1XA0A 1S7CA 4J4HA 1P3DA 3MOIA 2TMGA 4DREA 4A10A 4GX0A 3GZNB 5C7IO 1TT5B 4RPJA 2I3GA 5AQ1A 3V5NA 4R51A 1PL7A 4RORA 2C07A 1N9GB 1XDWA 2E49A 2E82A 1I30A 1WAMA 3D4OA 1BW9A 1X14A 4CM4B 3E1KA 1LEHA 1QYCA 3GEDA 4A27A 1ZXLA 1A5ZA 1YKFA 2QRJA 4JK3A 1UZNA 4IY1A 3WGOA 4OQYA 2O3JA 4DGSA 4LSMA 4NBVA 2YHIB 3QWBA 3LLVA 2D59A 1Y81A 4JXKA 3GEMA 1TVEA 1YOVB 4WNCA 4DPKA 2DTXA 2PD3A 2OUIA 2J3HA 3NUGA 3WSVA 5F5LA 5A03A 3LC1O 3NAQA 4KTTE 4DVJA 2NU6A 3PLNA 4R3NA 1NFQA 2VT2A 2XXBA 2DVMA 2Y99A 4D45A 2FPPA 3KBOA 4RPKA 3WGZA 1GQQA 1R15A 3NRCA 1XQ6A 1E3LA 5DOZA 4AJJA 1ADCA 3ROQA 4CV3A 3OIGA 3DO5A 4EJMA 1O9BA 3ZWAA 3KV3O 3VVBA 2ZQZA 4R5MA 1I3LA 4JCOA 1EUZA 4ITUA 3IMFA 4DTIA 4IJKA 4HNHA 1QYDA 2PA3A 2DFVA 3DQPA 3ENNA 3GVHA 3GY0A 3QIVA 2QIOA 2CDBA 2FR0A 4YWJA 2GUGA 5THQA 1MG5A 1MC4A 4UREA 2EERA 4B4WA 5BSGA 3HN7A 4GGOA 1E7WA 3GN2A 5JY1A 5ENVA 1Y8RA 2HU2A 3EC7A 1VL8A 1ZSYA 4BNNA 4IXTA 4JGBA 4O63O 1DB3A 5JAIA 3PJDA 2GF2A 2WD7A 5A4DA 3E5MA 4FD3A 2D5AA 4CMBA 3A28A 5H82A 3OSUA 4QX6A 4XJSA 4RJTA 1KVSA 3HFGA 5I8ZA 3HQ4O 4LVCA 3KYCB 3E9QA 3NJ4A 5IDQA 1PTJA 3P7MA 3X2FA 4R9SA 3M2PA 4BMVA 2ZIZA 1NNUA 3RJ5A 2XOXA 4TKMA 3OA0A 4YRAA 2P68A 3VPFA 3ZNPA 3TZ6A 4J9VA 3ZCXA 3LT1A 3G3EA 4MDHA 3LT4A 2UVDA 1PJ3A 1HYGA 3DFUA 3SLKA 2QYSA 3HDJA 1HSOA 4Z9FA 1IY8A 3BMOA 3I52A 3RFVA 2P5UA 1GDHA 2QRKA 4RF3A 2P2SA 1EBFA 3BZUA 3UN1A 3ZWVA 2JCVA 2Z1MA 4Q3DA 1X1EA 4KP7A 3BMQB 1NPTO 3E18A 1G0NA 1IOLA 1PZFA 2ZYGA 1GU7A 4BHTA 4U6QA 2Q2WA 4N18A 2B35A 1XYGA 4J1QA 3UXYA 3W8EA 4CR8A 3EVNA 1HYEA 3AY7A 1P1IA 1EUCA 1G0OA 3ULKA 3KHUA 5A3JA 3UCXA 4BKOA 3KM0A 1VJTA 1X7GA 4EI2A 4EUHA 1XSEA 1A4IA 5BNTA 4O0LA 4Q3CA 3N74A 1BGVA 1I8TA 3K6JA 1LLCA 3E82A 4PVCA 1C1XB 4TRRA 3T4XA 2HK7A 3UCFA 4A26A 3RUAA 3RU7A 3GVIA 1NAIA 2GNAA 1I33A 4HFRA 1U3TA 2Q2VA 4BS9A 4DPLA 3EK2A 2O23A 4ZVVA 1PQUA 1GEEA 1K6IA 4JLWA 4PLTA 3F3SA 1GD1O 3R3JA 4TVOA 4XX0A 4BB5A 1VSVA 3VTFA 4PG7A 2PR2A 5BR7A 5L7TA 1X13A 4CM4A 1R37A 2HQ1A 4BV9A 1P1KA 3KZVA 4GWGA 3RUEA 2OZPA 1CJCA 3SJ7A 3WNVA 2VYNA 1DLIA 1H2BA 1O94A 4CMIB 3ETDA 3IAHA 2PD6A 3C7DB 3KXDA 4GX2A 1QLHA 1NWHA 1NBOA 4JROA 2WDZA 1PGPA 5IG2A 4GLLA 4U0JA 5DNAA 5AVOA 5G0WA 4XYBA 1KBZA 2DPHA 1DIGA 3RAJA 5G4KB 3SX2A 2X22A 2GD1O 4IDFA 2YV2A 1JN0A 1BXZA 1U7HA 1VKNA 2BF7A 2X0NA 1V9LA 3I5MA 5EN4A 3TNLA 3PGXA 3QP9A 4AVYA 3ONDA 2TMDA 2FOIA 4B3IA 4XQ9A 4IJVA 4W9NC 4CJXA 3Q3CA 1EVZA 1GV0A 2DTDA 4DL9A 3R1IA 3DBLB 1H5QA 3TL3A 5I9LA 2EW8A 3ZI0A 1HE3A 3QVTA 4KOAA 1LLDA 4RV9A 3DZIA 2WD7B 5DP2A 4O59O 4GLOA 4Y67A 3ABIA 4BNMA 2I66A 4BB6A 1DC6A 2Q2QA 3GLQA 3ZW9A 2BKAA 4QEDA 2NU7A 3D1LA 4JJFA 1YBVA 1YJQA 3G1UA 1P1JA 5BSHA 3DBHB 4EEXA 3RBZA 2GGSA 4YA6A 3QE3A 3TWOA 4MVJG 9LDTA 3FTNA 4B8ZA 4RLSA 2PY6A 2PZLA 1R12A 4RDIA 5G0UA 5AXDA 5EINA 3QQPA 3HNPA 5JMWA 4KTVE 2NV6A 3K31A 1U9JA 1XELA 4RDHA 4DQUA 1R4MB 2FSVA 3ZHXA 4E5PA 4ONEA 2D2IA 2BRUA 3TDKA 4YAKA 1DFGA 2QZ9A 4J1SA 5CEFA 3GDGA 3RUIA 2B5WA 3O4RA 2HK8A 5F1OA 4A2CA 1RM5A 5THKA 4F6CA 5K6AA 5F21A 3E03A 3GAZA 2ZB7A 4Z0TA 1U7TA 2IZ0A 4BVAA 5B4UA 4DRYA 1ZFNA 2ZB4A 3CZRA 4CPDA 4OSOA 2V6MA 1HE2A 4HXYA 3RC7A 1WVGA 2HSDA 2DBRA 1PL6A 3ASVA 3ZWYA 4PLFA 1OC2A 4TZTA 5FYDA 5I7SA 3DBRA 5A02A 1NFRA 1L7DA 1B0AA 4RL6A 1T1SA 2X23A 3F5QA 1QYXA 4E2ZA 1RPNA 1R4NA 2YHIA 4XA8A 1CYDA 3QHAA 4Y6PA 2VTEA 3PHIA 4R1NA 4N5NA 3VPHA 1TI7A 4BNHA 5CDUA 5K9ZA 1N9GA 3T7EA 2X0IA 3KSUA 3ITKA 4YJGB 2YFHA 3MJEA 3L4BC 5JDCA 4J91A 4YXFA 1WDLA 2HMWA 3FBGA 1P44A 2VQ3A 2Y05A 2Z95A 3BYZA 5L51A 2SCUA 2EGGA 2Q4BA 2ZTLA 4GSKA 1NQ5A 3HB4X 1KEWA 5B37A 2XF8A 4I5DA 2IXAA 4WLFA 3WWYA 1Y8QB 5T8KC 2ZB3A 5COAA 5JLAA 3QJ5A 4MVJD 3C1OA 3KEQA 4EJ0A 2AHRA 1PJBA 3PYMA 3Q6IA 4R41A 3CXRA 4EBFA 3NYWA 3AUUA 3I9NA 4DMMA 1C3VA 3JQ9C 2VOJA 2Q1WA 4ND5A 4HV4A 3RVDA 1XHLA 1M6HA 1EVJA 1IZ9A 1RKXA 3DZBA 1ZK4A 1U2DA 4B4VA 4ID9A 3VH3A 2O7QA 2OOSA 1ADBA 4MIOA 1KY5A 1CERA 2JL1A 1K2WA 4RVFA 3VAZA 5L9AA 3LZ6A 1FDSA 1E5LA 2VYVA 3JQ8B 3LF1A 3NKLA 2NTNA 3NT2A 4MP3A 4W6ZA 5KJCA 5JSFA 5L95A 1KEPA 1M66A 3F1KA 4WLEA 3PLRA 1B8UA 3GVCA 5FI3A 2VWGA 4M8SA 1DIAA 2E4AA 4OOEA 4YPOA 4OL9A 5I7VA 1NWCA 4H16A 2VZ0A 4P4NA 5I9MA 1BVUA 1P1RA 4RQUA 1BXGB 3M1AA 2IEDA 4NDNE 3WX0A 2YJZA 1MG0A 4LK3A 1Y9EA 2IZZA 3CEAA 1K6XA 1WW8A 4WKGA 5JFOA 4DYVA 4NQZA 2HK9A 4BGEA 4D42A 4J4BA 4FFRA 3GEGA 2DKNA 5CDTA 2QRLA 4OKIA 1I32A 4E31A 5KVCA 3LVFO 1E3SA 1ZEMA 2Q1UA 3BMNB 1PS9A 2WYWA 5JO9A 2POQX 5TJHA 1FDUA 4YT8A 4BNTA 4BMSA 1XIVA 3KUXA 3I6QA 2AMFA 3ZV4A 1OZAA 3TL2A 5KVSA 3R0IA 1K89A 4N54A 1YGYA 5C7OO 3AFMA 5ILOA 3FR7A 1VI2A 5TRTA 1DJNA 1Q7CA 3PJFA 3STHA 4AG3A 2C29D 4WASA 1CRWG 1MP0A 3N58A 4FR5A 4G5HA 5KJ1A 3RUCA 1ZW1A 1KEUA 2DM6A 3NX4A 3V8BA 1GCOA 1M2WA 4DBZA 1E5QA 4J6FA 1TA4A 1QYVA 3OICA 4IUYA 1SOWA 1U3VA 4RVHA 4RGBA 2D5CA 3CMMA 3JQBC 3FNHA 1RYEA 3K2BA 3PQDA 2B5VA 3ZWXA 1YWGO 3WMXA 3U62A 1HF3A 3MJVA 1N8KA 2X0JA 1PJ4A 3GT0A 1DLJA 1JWAB 2IYPA 3B1JA 4L9RA 3Q1LA 3TQHA 5K0ZA 5A06A 1HSZA 2X9GA 1H6DA 4F6LA 3PVZA 1PS8A 4DYDA 1Q0QA 4D3SA 4J3FA 2EG9A 4ZICA 1ZXBA 2YV1A 3GVPA 4J0EA 3AM5A 5KVQA 3WR5A 4HFMA 2YW9A 4WK6A 4UVIA 1MFZA 5AYVA 2OP0A 4TSKA 1LA2A 2FR1A 3WJ7A 2BGLA 1J5PA 5ITWA 3K8ZA 2B4QA 1UXHA 4PLZA 1H6BA 1PJ2A 3V2UA 3F5SA 2YQ4A 4QT0A 1YQDA 4P4GA 1EDOA 3PYLA 3L6EA 1N7GA 1UP6A 1YB4A 4AL4A 4Z3KA 4WJZA 5A9TA 2GZ1A 5AXBA 1NHGA 1V6AA 1IYZA 4NK5A 1QMGA 3QWHA 3TFOA 1E7RA 1PGJA 3H9UA 6ADHA 3QSGA 4CV0A 2C2YA 2V6GA 1E6UA 1W73A 3OJEA 4J2OA 1FMCA 2UUPA 4ZU3A 4CMHA 3U3XA 3MTJA 4CMJA 1MGOA 3ONFA 4OH1A 3RFXA 4YB8A 2FHSA 2BD0A 7MDHA 3S1LA 5J9GA 1HXHA 1ID1A 3KLPX 4XGNA 4CM9D 1WMAA 5IN4A 2EV9A 3FF4A 2WSBA 1ZJZA 4IDCA 2W90A 3MCVA 1GUZA 3LSYA 3WFJA 8LDHA 3M1LA 3MOGA 3C85A 3RC1A 1PGNA 4UAGA 1SAYA 1E3WB 1T2CA 4W99A 1PJCA 3L9WA 3MWEB 3LC2O 4CLRA 3DMYA 1E1LA 3QW2A 1IZ0A 2NVWA 3GN1A 4AFNA 4LGVA 4PRKA 3VHRA 4NNJA 3ZV6A 4ZQGA 2O7SA 3D5QA 3EGOA 2VN8A 4XWYA 1E0DA 3AY3A 2H5LA 3K96A 3JSAA 1IULA 4R4JA 3AI3A 1NVGA 4DIFA 1DRWA 1LC0A 4I9HA 4NU6A 4CQMA 4DC0A 1E7MA 1Y5RA 2O3UA 4J0FA 5I8WA 3M2TA 5TNXA 1LSSA 1G6KA 4CM5A 3N7UA 2Y1GA 3E9MA 1HDCA 3DMTC 3ZWWA 1A7KA 5CFZA 3PZRA 1GZ4A 4GI2A 4XIJA 1GQ2A 4J49A 1Z73A 3H2ZA 3CUKA 3HDYA 4XYLA 3EZYA 2X8LA 1D1SA 5F5NA 2DLDA 2G5CA 3WJAA 1GYQA 4BO3A 2DC1A 1DFHA 1HETA 2EXXA 3FBTA 3MJ4A 3DBRB 1RWBA 4B4UA 2GSDA 5JBIA 3MJCA 3P19A 1A9YA 2ZYDA 4BIIA 3GMDA 1LRLA 4RVSA 5BSFA 3JYOA 1UZMA 3ASUA 4ALMA 3S2FA 5KCZA 4JBGA 2WYUA 5CHEA 1EE9A 1HE4A 1YQGA 2NWQA 5TGDA 3D3WA 4BKUA 5T73A 3AU8A 5GZ3A 3ZWMA 4E32A 5FFFA 2GDZA 1M76A 3PQFA 1GCUA 1Z82A 2FY8A 3GUYA 5TT1A 4BNWA 4CMAA 4JN6B 3KOUA 4CM8A 4A0SA 2HMSA 1GYRA 1UZLA 3AI2A 4KUEA 1HTBA 3NT5A 1Q1NA 3B1FA 3C1AA 3L0DA 3SVTA 3JYPA 4BO0A 2EP7A 4M55A 5DP1A 3ZU3A 2OO5A 2DTEA 4PZCA 3PFFA 3QWFA 5B12A 1R66A 3ROMA 3GHYA 3JQBA 3QRWA 5U9CA 2RHRA 1IPFA 1DAOA 3KRTA 2B69A 4YJFA 5L3ZA 3I3OA 4NR0A 2ZTUA 1KYQA 2FZWA 1HDXA 3C24A 1HDRA 1YQXA 3GFGA 4XRRA 1FK8A 1N92A 4LCJA 2VWQA 3GFBA 4I9NA 4K26A 3WQSB 2GN9A 1T1RA 4OGWA 3UFXA 1ULUA 3HFSA 3NDJA 2YDYA 4OAQA 3OM9A 3TRIA 5C7LO 2FZEA 3WICA 1ENZA 4UUMA 2DAPA 3LYLA 4R68A 1DO8A 5KJFA 3NTQA 2I6TA 1E3EA 3W8DA 4OXYA 2AA3A 3FWZA 1WNTA 3AK4A 4PLWA 1T26A 3PWZA 1I5RA 1LQUA 2AEJA 1ZO8A 3ROKA 3OIDA 3RASA 3VZPA 3MTGA 2I99A 3H9JA 4FC7A 1AHIA 5DCWA 4TWRA 1UH5A 2ZCUA 1F14A 3WB9A 3BMQA 4PVDA 4EUFA 1E1MA 3EZLA 4CLEA 3RBVA 2F1KA 2CDCA 3I1JA 4FJ1A 2W4QA 3FD8A 4EW6A 4FS3A 2ZYAA 3H7AA 4ALNA 5F1PA 3B1KA 1Y7TA 1ZK1A 2ZQYA 2OBNA 2CVQA 4EYEA 3WBFA 1CQJA 3WLEA 1IHYA 3VZRA 3G1TA 2Y0DA 5G0SA 3OJOA 5TSDA 3BTVA 2YDXA 5AXAA 1JKFA 3WOHA 1K5HA 2CF6A 5HRUA 3K92A 4CUJA 3GHHA 3GH3A 1P31A 4BMNA 4DLAA 1C1DA 3U4CA 2VT3A 4R1SA 4J16A 3WTCA 2I67A 3JQCA 1O8CA 3VH1A 4D0SA 2VHXA 3L77A 4YRDA 1KS9A 4U0KA 3WGQA 2OMEA 1N7HA 3UH1A 2EKPA 3ZDFA 2VCYA 3OMLA 3QVSA 1T4DA 2QX7A 3H3FA 4YBZA 4NBRA 1QP8A 3SLGA 3WGHA 4AJOA 2YQ5A 4JX8A 3DFZA 3EYWA 3RKRA 1V3TA 4GX1A 3U0BA 3Q9UA 1UAGA 3JQGA 4G2NA 5CEJA 4BGVA 4MVJI 1ZUD1 3CSDA 8ADHA 5JC1A 3OQBA 1BHSA 2IDZA 1AN9A 4E30A 5IDXA 2WYVA 4CLHA 1EE2A 2X5JO 3INGA 1ENPA 1LLQA 3JQ8A 2NTJA 1HL3A 2GERA 1PJTA 3I9LA 1E6EA 1ORRA 3TPCA 5CG2A 1KVUA 4D3FA 4FFLA 1PX0A 3KETA 1Z6ZA 4D46A 4BO4A 4N5MA 5ITVA 1LDGA 2GR9A 2JCYA 3VDRA 4RF4A 5DCYA 1K3TA 4H3VA 1E3WA 4FGSA 1H9BA 1UDCA 1QKIA 4I8XA 4NZ9A 3OQ1A 1ENYA 1ZZEA 4CLRB 1ULSA 2DUUA 4OMUA 5IZ4A 2QHXA 3KLMX 2WE8A 1P74A 2Q1TA 3C8MA 3AFNA 4BGUA 5L4LA 2PFGA 3HDQA 2B0JA 3PHGA 4BKQA 3BTOA 1Z45A 1OBFO 2VZ9A 1ENOA 4ZRNA 1A27A 4IDGA 2V65A 4CQMB 4IDBA 4YJHB 4R1TA 5ENDA 3GGGA 2WMDA 4JJGA 2AEFA 3W4KA 4BGIA 4CLXA 1WZEA 3V1UA 2X6TA 4Z0PA 1EFKA 2G0TA 3DXFA 3LQFA 1SC6A 4W82A 1LC3A 2C7GA 3DWFA 3IS3A 4WOJA 3RCBA 1A7AA 2I9PA 2DT5A 3GDOA 4N7RA 4NHEA 1ZEJA 2PZJA 3ZH2A 1I3NA 5C37A 4GWKA 4XGIA 2YZ7A 2B37A 3GA0A 1GFSA 1O6ZA 4ALLA 1XEAA 4M49A 4LISA 4R01A 5T64A 3VPSA 1OFGA 2GZ3A 2CD9A 4YJDA 5ER6A 5BT9A 4WCFC 3OJFA 1JKJA 4BKPA 4DC1A 1GL3A 1LNQA 2ZTVA 4GPD1 2YY7A 2R00A 3JQFC 3F46A 1BSVA 4GQAA 2OXIA 1GY8A 3D3EA 2VUTA 2X9VA 1PR3A 3OETA 5JMPA 1AE1A 4QO8A 1YDWA 1ONOA 1ZCJA 5DF1A 5DN9A 1W4ZA 1DHRA 1T2DA 4PN3A 3A4VA 3ZNNA 3BHMA 4NFHA 3E6AA 1YBMA 5KTKA 3RQSA 1YL7A 4BNKA 3ZZNA 2P9EA 1XR3A 4K28A 2O48X 1Z75A 1QXSA 4GL4A 4I5GA 4CV1A 3IJPA 3DHEA 4WEQA 4WOKA 2PD4A 2B4TO 4DXHA 2OORA 2B83A 1MV8A 3AY6A 4IIUA 3K2EA 5I9NA 1SCUA 3GGPA 1YJ8A 3JQ6A 1E7QA 2O3RA 2C7VA 3PWKA 1P0FA 4E4YA 1ZVMA 3B70A 4ZQHA 5EPOA 2Q22A 4MVJA 1VPDA 4UVDA 5I7FA 2Y1FA 3PYXA 5JCJA 3Q2IA 1NX6A 3KO8A 4DIOA 4Q39A 3ZHBA 5HWSA 5JAMA 4UUNA 1MXHA 2VNAA 1VKOA 1UXGA 5A5EA 3INTA 5JC8A 3IL2A 3BHIA 1LLUA 4OHUA 3S2GA 3D4NA 3LT2A 1P77A 3I9OA 3ZU2A 5L7WA 4CM3A 2OGUA 4AJPA 1EMDA 5F1KA 2UAGA 3I4CA 3PIDA 2ET6A 4IS3A 1MA0A 1DJQA 3NDRA 2J6IA 4D7AA 5KWEA 2NADA 1E1NA 4IM7A 4CM6A 1R6DA 1DIBA 3DDNA 2W2KB 4J7CA 4XYEA 3D4PA 1VLLA 4FCCA 2Q4EA 3ITDA 4L73A 1E3JA 4CLDA 3UW3A 4ND2A 5U1PA 2H9IA 4XCVA 1IPEA 1SB9A 3M6IA 4S3MA 5TJ9A 4BL5A 3JV7A 2Z1NA 3KYBA 4MVJP 3RSHA 4FN4A 5BNFA 3RKUA 2XPCA 5A9SA 1JAYA 5ES3A 2AQ8A 4LCEA 1ISIA 3WBBA 3VTZA 3S2IA 5FWNA 4AJKA 3MEQA 5JO0A 2EHDA 1EEHA 4MOWA 2CZCA 4CMEA 2RAFA 5IZCC 2BH9A 2I5PO 3LC7O 2HJRA 3G49A 5LDGA 4IJWA 3UAGA 3EHEA 1HLDA 3DEYX 1H93A 2VWPA 5IXYA 4UVGA 2BFOA 3D3WB 1AHHA 4Y6RA 2PGLA 3WYEA 5BQFA 3PRJA 2AXQA 3GR6A 4DQXA 3ICPA 4YEDA 3RI3A 3WIDA 1I24A 3PFWO 3TN7A 1LSOA 2V6BA 4EUEA 3RJ9A 1PQPA 1U4SA 4B7XA 4NJMA 1H6AA 5KKAA 3KTDA 3QLJA 1H0KA 3PEFA 4CMGA 1XLTA 4CM7A 4OXKA 3K73O 3H65A 2CUKA 3OJLA 3GQVA 2WWRA 3RUHA 1NYTA 5T57A 1WWKA 4BNZA 1ZIDA 4YJFB 4D41A 1HWYA 1R0SA 1OMOA 4RZHA 4EEZA 2O4CA 5C3MA 4MP6A 3BTSA 1EFLA 4IZHA 4UUPA 1EZ4A 1U2GA 3GMSA 4RVGA 1M75A 3OP4A 4AJNA 4E3ZA 3PQEA 3WG9A 5L53A 1QLJA 3AOEA 1HYHA 5TF4A 3NT4A 1QG6A 3GRPA 4UEKA 1P33A 5KIAA 2C0CA 1MX3A 1NPYA 4YJGA 1SMKA 4CMEC 4AJHA 2IXBA 5JCXA 3VC7A 4OSPA 1K0UA 4JP2A 4WLUA 3JYQA 1GV1A 2X58A 1GEGA 3U9LA 3ZU4A 1ADGA 2A94A 4YAIA 2V7PA 3KEOA 3T7CA 3DAPA 2NSDA 4OJNA 1XKQA 4B7UA 1GPJA 3WS7A 4L75A 1YRLA 4IIVA
chains in the Genus database with same CATH superfamily
4ZHSA 1LSJA 1Q0TA 5IAEA 5JNWA 1UWVA 3OQ6A 1AQ6A 3D8SA 1R0KA 2VA8A 2POCA 3BRSA 1Q7TA 5KHOC 3A1NA 2OYRA 4YDHB 4QXMA 1DTWA 4IX1A 3JYLA 3NHLA 2RH8A 1U94A 4WRRA 2OVBA 3ANNA 3UH0A 4RPIA 5SZHB 4LJAA 5DULA 1GG5A 1SA0A 2C5EA 4NG5A 3E5HA 4KQ2A 2PH1A 3FPCA 1QRRA 4UU8A 4D44A 1C8BA 1AS3A 1TJYA 1KTIA 4WV3A 3JVVA 3NBXX 3OEHD 4QELA 2AKAB 3A4YA 3H11B 4GKJB 1PZMA 1AQYA 1GPNA 2JRLA 1DKLA 1Z3IX 2Y76A 3BB4A 3KJFA 3F2VA 3AOEC 3PHLA 3I8SA 5F3DA 2OYCA 1OB2A 1ZRHA 4M3NA 1K75A 3ZKWB 2JIPA 4HO1X 4HXGA 1GA4A 1INLA 4QO7A 4X1YA 1JF8A 1M1NA 2BL4A 3B60A 4Q3KA 3LKBA 5AKYA 3ETGA 4AICA 1NBMA 3ESYA 1N6KA 3N75A 3OJCA 4KQKA 2ZQ5A 4IQ8A 4GZ5A 5AI5A 1UIRA 4Q7KA 3OOWA 3LQYA 3K6SA 1ISMA 3BIXA 3DWEX 2JCXA 1XBTA 2QRUA 3E22B 2MYPA 3OO0A 4NMLA 2QUIA 2QLTA 4RA6A 1DE0A 4XI9A 4ZANA 3AOGA 3CE6A 3R6LA 2WJGA 3VNRA 5KQRA 2FZCA 2OAP1 3KSMA 4G8DA 1QH8B 2ZRPA 3MUOA 4UATA 5CX4A 3WWPA 4D4HA 2Y0PA 4GMKA 4DA6A 4DV2B 1NRIA 3HKEA 4S0ZA 5EE5B 1TM4E 2FQYA 4C4AA 5J23A 5JYFA 4E5NA 3OT4A 1L5KA 2X6QA 3FUVA 2GEJA 2H59A 3C3JA 1TW3A 4Y1FA 1W88A 3F6CA 3LWNA 1ZESA 4LVUA 3E8XA 2C57A 4PPGA 2G06A 2X5OA 1Z26A 1QH8A 3FN4A 3NAZA 4GYWA 4KDEA 3JWJA 4OH7A 2FEMA 2X1HA 2P2YA 1AGYA 1JG2A 2X40A 4MYCA 4OIFA 3ZU5A 2EGHA 2JGIA 4NYJQ 4Q9AA 3T1TA 1EUDA 4MA0A 4FGWA 4CIYA 4NC9A 4TS9A 1ZS9A 3CZ9A 3GK3A 4L5BA 4QRHA 2FR8C 5K4AA 4NMXB 4LF6B 2NPOA 3PC3A 1GGEA 4JHXA 4LECA 3HKDB 4IVNA 1FW6A 1K7FB 4MO2A 2OT3B 2Y67A 3AEUA 3QV1A 4GMHA 3K9HA 2FWIA 3NBAA 3ZY2A 4BASA 3THXA 4F7WA 5AW7A 1JZQA 2RGYA 3F7TA 1FQKA 5SYAA 3M3DA 1HLPA 1JVBA 1W8IA 4C4OA 1KI1A 5LQDA 2UU9B 1JU9A 3WXBA 1AA9A 1KJZA 1IRIA 5CYPA 2OGTA 3VZCA 2NSLA 4CN8A 4B6OA 2Q6OA 3E0QA 1WLYA 4X8HA 4BX9A 4K87A 4EKEA 1N2CE 4XPIB 1S0UA 1XRPA 1DUSA 2WJ6A 3I6IA 1LPBB 2D7JA 3EWIA 3MPOA 1WVMA 4G25A 3WFZA 4P1ZA 4CEHA 4ZHQB 1RP1A 1AZTA 1IB0A 2A5JA 2FV8A 1TTHA 3UWPA 1R9MA 3T94A 3GFSA 2FZVA 5FOUA 1IEVA 2E4ZA 4ER3A 4K1LA 2DB3A 1PJLA 1B43A 3G8CA 5IBCA 3ZLVA 5HG0A 3QIAA 4US1R 3A31A 5B1DA 2TECE 1JEOA 4PZ0A 1MBZA 3BMCA 4IWXA 1YR7A 2PX6A 1ZC3A 2MYTA 2V5UA 5DN6D 3BIJA 1ZHOA 5ES4B 5EYPA 1I0ZA 2I6SA 3C3XA 4XYMA 3M5WA 3RJTA 1KC3A 5FUXA 4DV3B 4DRZA 2AK2A 4JEHA 4Y8VA 4U2KA 1F06A 2X3FA 2RG1A 2AG1A 4ENSA 1LD3A 3EMDA 1G6Q1 1SPXA 3NH6A 3PPWA 4Q9LA 2XGOA 4YYZA 2X0RA 2GLXA 1QO0A 1PZEA 4MARA 4XXHA 1H6CA 4QXPA 4E5KA 3JAWA 3NR2A 1NFFA 3PFKA 3TE6A 2F7SA 2YIDA 3OFJA 3OLYA 3B48A 3OIWA 5A3VA 2I2XB 3EJWA 5CW2A 1I4EB 4DC9A 4YQEA 2B6NA 2LCIA 2QW1A 3EA0A 3G82C 1JB1A 1BCSB 4QRDA 1SU6A 2W70A 4FZ5A 2JEZA 3UF0A 3N2KA 3QEBZ 2Y4NA 5P21A 2GH1A 1C3JA 1ZGZA 4TLCA 5KYYB 4B7ZA 1QAQA 4B40A 3SI7A 1YVPA 5K05A 2AKEA 3GMTA 1RQPA 5GJVC 2GDJA 2BDUA 4H31A 3P52A 3C48A 4IS2A 4K8RB 1Y8ZA 1AZWA 3ICQB 4CG1A 3T6KA 2WMOB 2HMYB 4CMAA 3UGKA 4BNIA 1QZUA 3ZHYA 4O2BA 1Q84A 5ICMA 5F5XA 3V00A 1DAPA 4OJQA 1U2TA 3EPPA 4PFQA 3VC1A 1LK0A 5IF3A 2PXHA 4WCVA 4HZGA 3A6FA 3IE2A 2C2MA 1QFSA 1ZH4A 2DOKA 3CQ9A 1L0BA 1UT6A 4ND4A 4U2BA 5GAJA 4KYUA 4O2BB 4ZVPA 1BJRE 5G1PA 3L7MA 5FI1B 2H08A 4EL0A 3HS3A 1FVFA 4LSGA 1C7IA 4L0MA 4OXNA 4PZYA 4FFNA 4AK1A 2WKQA 3C74A 3EUAA 2CZGA 5JG7A 4WFQA 5CVCA 5K2MA 1MUUA 1FZTA 4YCJA 5EJ2A 3DOUA 1K8QA 1P1BA 2GD2A 4PPYA 3ER8A 3K0EA 1CDDA 1UWKA 4Z2YA 4CT4B 4EGAA 3COYA 1OHHD 3RRBA 1VKZA 4E7PA 2VYVD 2ZBRA 1E9FA 3JALB 1CQJB 4HRXA 4ND1A 2C3PA 4WLNA 3UANA 5K03A 2JGJA 4QOJA 1X0VA 3ZIAD 3F6RA 4BNFA 3BE8A 4AX8A 3JS5A 1VYUA 3VNQA 1KJJA 2FR8A 3N0RA 3GL9A 3R6GA 2W0SA 5EP1A 3TOZA 1LPAB 4CLOA 4J7AA 1OB5A 2QRVA 4X66B 3QKRA 1CUHA 4P38A 5ED4A 3L4SO 1CUCA 5ALFA 3GGOA 4O5AA 4QJ5A 4MIEA 3FOZA 3Q8KA 3KT0A 1LCIA 3ROEA 3ERCA 3BE4A 1E2LA 4MYSA 1DV2A 2RSLA 1U0EA 2AMVA 1G2PA 1YZVA 4PAWA 5K6RA 2FPPB 3BUSA 1YL5A 1L3IA 1UXKA 4DHWA 2EGUA 1DV1A 1J9ZA 3F4LA 2OV3A 3PL5A 3F1LA 5TPWB 4KKXB 3TOXA 2D1FA 3AJRA 1ICEA 3W5VA 1QH0A 1YR6A 3ZWNA 2OUKA 3RRFA 3EQ2A 2X5KO 1A82A 1K7XB 3NVMB 1H2XA 4WCFB 3AB3A 3EQZA 1GT6A 4LF4B 1P5RA 2JGMA 4LW8A 1TVKB 1DIHA 2JAUA 1GRQA 2DBVO 3ENKA 4ZRMA 2HDOA 4Z9XA 3RYFA 3KQLA 3W5CA 4RKWA 4OI4A 4Z0HO 3DAYA 4HH4A 3DLBA 4AF6A 3CJTA 4RVOA 5ENZA 3I53A 3NRJA 1ZK0A 1IEWA 3DMTA 1IHPA 3WGTA 2H85A 3PJEA 1JA9A 1VRVA 4IMIB 1UOPA 4Y98A 5I6DA 5HNKA 4IO1A 3HSSA 1G20E 4OVKA 1MENA 1Z4MA 1XRMA 2BM9A 3FIJA 4YCMA 1G2OA 5AW6A 3V8RA 2O07A 1LDMA 1QNFA 2ZJ1A 3EUWA 1IC6A 3CTMA 3Q3VA 1Y6JA 4N49A 1ZY2A 3ICOA 2XEDA 2XH8A 3IIEA 3ZGLA 3IUPA 4GGPA 3QPAA 3ZHZA 5CDSA 3ANMA 3HBFA 3W06A 3VJRA 3PUZA 4KSYA 3D7MA 5DLQC 4WVFA 2Q5HA 4MRMA 3F5DA 2O7RA 5JJ5A 2OHOA 3JCZA 3K35A 1GKUB 3PNOA 3SNHA 3O2NA 3OZAA 2V7EA 3O7MA 3RU2A 1P73A 4X8LA 4KR0A 1RXSA 4N5IX 4YAWA 2WJ3A 1R9JA 3RE1A 1Q57A 1UXJA 5B64A 1XMSA 2VDQB 2CMFA 2D8AA 3CURA 5DCLA 3EDMA 4JT9A 1Q21A 4OGFA 4P7KA 1GZUA 4B3SB 2BI8A 2UVPB 3ORFA 1U5CA 4U3JB 2IT1A 5JSKA 3H0WB 3A10A 2O2IA 4A2PA 3HDTA 4W5RA 5LA6B 5TB5A 3WK8A 4OYRA 4M1SA 1P2UA 4P5DA 2FUG6 4YGYA 2R7AA 3TSWA 3ZY6A 3SY8A 4DMGA 5I9BA 4PTLA 2D2VA 5SY4A 4DDWA 5JCZA 4OUKX 5G40A 4DEXA 2NU9A 3KBBA 1G3MA 3D64A 4FHGA 1Q83A 1L4EA 3HL0A 1Z9BA 2FXIA 1FRQA 4GI1A 1KQNA 5LYJF 3U7HB 1D8AA 1T91A 4UHEA 3HZZA 2BI7A 4WXEA 3MQ4A 3ILXA 4DPMA 3R24A 1R16A 1NASA 3C3AA 5FUWA 2GF0A 1XZ8A 3UKJA 2F48A 1K6EA 5EIWA 3ROZA 4BN4A 2BGUA 2NU9B 1EFRA 1NVXQ 1U2PA 4FYIA 4G09A 4B7CA 2IKQA 3ME5A 5A5FA 3DDZX 2WSMA 2GEUA 4FPXA 1ZJ5A 1M10A 4M9CA 4MMYB 2YWRA 3T7RA 3OPYA 3VPXA 3ZDQA 1SR8A 1ZMOA 3L7LA 4N0QA 5C5EA 1KJWA 4IJUA 3R7SA 1SZPA 1QGUA 3CIFA 1WZIA 2RBKA 1R4MA 1ZH2A 2CY0A 4ZDJA 5MHTA 4MVJF 1M73E 2YJGA 3RTEA 2PK3A 1IN1A 4C7OA 1DJMA 4YMLA 4AKSA 2P4QA 3TMYA 3WSWA 1JWBB 5IDWA 5CVDA 5EP3A 4MHTA 2ROQA 5GOZA 4N3AA 1VG8A 2R8PA 3LMKA 4TRNA 4MW0A 5AICA 5FTMA 4P0PB 2O8EB 5KAMA 4MINA 3FSRA 1YHNA 4HWOA 3A9CA 2V0CA 1WMDA 3AT1A 1XRLA 5EXTA 4D79A 4FOSA 1FJGB 1E2MA 2HBYA 3ZW8A 3D2BA 3GFTA 4F4UA 2VHYA 1DT3A 1KQOA 1M74A 2C9CA 3WYFA 2C7OA 2OZEA 3N8HA 4UHBA 1DKRA 3F74A 1B8NA 1JHOA 1FXWA 1FS4A 1P7PA 3NC1C 5CLHA 2O05A 3FSGD 4PXAA 2J41A 5CRIA 1VHTA 3RIEA 3N70A 5D3QA 4LN1A 1X0XA 3ER6A 3WLMA 3MHTA 4ZVKA 4C4ZA 4FWTA 1ARZA 1CFZA 1N1GA 3PFCA 4LYAA 3IUQA 2A30A 4R2HA 1ISSA 5H81A 1BU8A 1TT7A 4FKBA 3OTHA 1JLLA 2ADFA 3ND9A 4ARAA 2D06A 5EJ5A 1UC9A 4JR2A 5FBZA 1KQPA 2VF8A 3B5IA 2V8BA 5HA5A 2VJAA 2WVGA 1BG6A 4JX9A 5BW8A 2D6FA 1WDWB 2MINB 2WB4A 2CVOA 5G4KA 1SPBS 2EJUA 1F8GA 3EEBA 3UHOA 2NVBA 1IBKB 2NXEA 1NR1A 3FCCA 4O2BF 3FHJA 3GJQA 3UOAB 621PA 3AL0C 1KOJA 2FJ0A 3IHWA 3B9QA 4WHMA 2RB4A 3IKVA 1ONSA 5HK8A 1ADFA 2BFPA 2G9RA 2XVXA 1BE8A 4HDRB 1XDUA 4OK6A 2WZDA 2C9DA 4JKOA 1U4OA 2DBZA 2H2IA 3G88A 3LPMA 3MS7A 4IO0A 1E7SA 4MQEA 1OX4B 4V0MA 4B82A 2GTPA 2WT4A 4NE2A 4WZBE 2HGZA 3SCZA 4UNQA 1EGAA 2AL7A 3G59A 5EP4A 5HJ2A 1NULA 1SURA 2ERXA 1JQ5A 5L95A 3JQGB 1FVXA 3UJ8A 1DQSA 2YKGA 3UVEA 3Q7IA 1TKRA 4F60A 1Q0HA 1TIBA 2IQ5A 2N47A 1PGQA 1NBEA 4CCAA 1U3UA 4TKLA 3Q11A 1FFBA 1L7OA 5TDHA 4P3XA 2JD1A 4Q9KA 1W5EA 4E21A 3DZ2B 1MFPA 1S3FA 1IZZA 2OV1A 3BRCA 4PF1A 1E2QA 3M4ZA 4OP1A 5J9FA 4AO6A 5AUPB 2P9BA 1QAMA 4Y2TA 2J3JA 2BFAA 2PU5A 2CF5A 1RM0A 3EXHC 3P9PA 5U4QA 3QKIA 1OZFA 4ZQEA 3TR6A 3ZV5A 1EYZA 1QGDA 2FXVA 5CVEA 2RHOA 4FYMA 4JYMA 3S8MA 2E48A 1N2XA 1KR2A 4WKCA 3CR8A 3U3ZA 4P7GA 4CDRA 1ZAYA 4X94A 3IKLA 5IARA 1J1UA 1BS1A 4TMVA 3QMWA 3HPQA 1F8FA 4KMSA 4E88A 1XTJA 1HA3A 4II3A 2VYFA 2Q3CA 1DXYA 2BZ1A 2VSOA 3AINA 4TV9B 2KLHA 1KS2A 1LH0A 2ZJ4A 3IP7A 2IXGA 1YCFA 3K4PA 4RWEA 1NXQA 4EF6A 3FZYA 5KJ6A 1HDOA 4LJ6A 4BV8A 3GLSA 2WTNA 2BEWA 3U40A 3GJYA 4BJHB 3PD0A 3HNRA 3HKDA 1MHMB 1W76A 4DCUA 5HF6A 3VC3A 3DUFA 3CVOA 3HO1A 3HO6A 3U09A 4MUXA 2AQKA 2JLQA 4OB7A 4RFSB 4WA8A 2G82A 5IJAA 3P4XA 4HGPA 4NFYA 5HTOA 2XTMA 3TLYA 2PG3A 4H1TA 3QVUA 3UHAA 1N5JA 2HGSA 3DZCA 1FF9A 3WKBA 3ADBA 5IMSA 4L74A 2IZOA 5TY0A 2BSQA 3CINA 2GKSA 1FFYA 2GRUA 2FSSA 3CLRC 1H23A 4XM2A 2NX2A 4C2BA 4A73A 2AMLA 2Q3HA 1R8YA 4ERXA 2HA7A 2NXNA 3CZCA 4HYEA 4W6QA 5A5GA 5ARDA 1FU4A 3A3KA 4YJHA 4B9AA 1WXGA 4EHAA 3R9KA 4ALJA 5H80A 1QVRA 4MLCA 1GAWA 1TYAE 4X3CA 1OKKA 3C0KA 1FDTA 5F3WB 1K0FA 1NIJA 1PK9A 5EUMA 4AQDA 5D5HA 1ISFA 1YR1A 5I7WA 3TW0A 1DAIA 2Z8YM 5L8VA 4G41A 3FUUA 2NO7A 3OOSA 1ST3A 1G8JA 4EJ6A 5B4VA 2NU8A 5E9AA 2JAOA 4GYKA 4MQMA 4P58A 3MBOA 4JFAA 4X92A 5IEBA 5JADA 2NSHA 1H9AA 4HH0A 3FRJA 4WXHA 1IHXA 1O77A 1ZMXA 5HUHA 4DA0A 1HO3A 1EDEA 1QQ5A 3JQDA 1PU2A 3HY4A 4FC6A 1NW3A 2HPVA 4H17A 4ZT3A 3FLEA 4HR7A 4P4SB 3CR3C 3OP1A 1E8DA 4TXMA 1PWHA 1ZG3A 3CH5A 4Y2JA 2RHLA 1F2TB 1VRWA 3DLHA 3LK7A 5AJTA 1MJ5A 3PXCX 4FMPA 2A3RA 3NW9A 4PCLA 1KAMA 4M38A 1ZA1A 2P9FA 4M0PA 2OXTA 1PHPA 2VPTA 2Y66A 4AY5A 1IQPA 4ROSA 2H2GA 4CMCA 2ZRNA 2WU8A 3N2KB 2RH4A 3I9JA 4F4FA 1YRBA 4TKUB 3NYRA 1PT6A 1G7CA 2X86A 4IMRA 3DF9A 1ZHFA 4GOND 1G3QA 3O38A 1TK9A 1P62B 4MVJH 4JSYA 1VM6A 1V1RB 2H52A 3EJ6A 4WOCA 4Z8XA 1YOVA 1XAGA 2FPRA 3MTDA 3IVGA 1U6IA 2QL5A 3GLIE 2AXNA 3RLIA 3ENWA 5CT8A 3RFUA 3T52A 4PNPA 3S2ZA 3V4ZA 3NDBB 3T41A 4QDZA 4WACA 3DMDA 1ODKA 4D9IA 1C0EA 2RHHA 2AR9A 2ZRDA 3MTBA 2BELA 4N6NA 4IHJA 5EXPA 1F6DA 3VSEA 3BFVA 1C1DB 4M1TA 1KMHA 4FW8A 3OKCA 5IABA 1QC5B 4P86A 2Q3EA 3FNRA 4DNXA 1W36D 1W4RA 2H29A 4LYFA 1D6JA 2DQYA 3OKPA 3X43A 3VYSB 3DV9A 4NF2A 5BXQC 1XTRA 5E6RA 3PGKA 3KALA 1N0WA 3H86A 1CNEA 1CUZA 4YRJA 4C05A 5BVHA 3JRNA 3ESQA 3NM6B 5KC9A 3VZQA 4OO3A 2VWHA 3D0QA 3QLEA 1NI3A 2G5GX 2ECPA 4RO0A 3AC0A 5CLGA 4CTJA 3MELA 1GPYA 2C5GA 2XZPA 2YCLA 2L18A 1F5SA 3D7SA 3MWGA 5DHPA 2JD2A 2DUNA 2CDRA 4B4DA 4DLYA 4FEGA 2MSCB 2VT6A 3EFEA 4DJAA 5E6RB 2JFXA 3BREA 1XI2A 3LVRE 4WK0B 3E23A 4W5QA 2K2WA 3O9MA 3T35A 2ZZNA 3ANLA 3U4HA 1I7PA 3TGPA 2C7RA 1C14A 2YZMA 3EP9B 2IV3A 2YZKA 4N5DA 3KAKA 5KYXA 2WD8A 4ENVA 2QQEA 5UKDA 2P5SA 4HP8A 3ZJXA 2WHQA 4TTPA 2C54A 2XMRA 5DGCA 5MFPA 4KWEA 1FUYB 3W78A 3BE5A 1PT7A 2CGEA 3RTAA 2E5WA 4BJ3A 4F46A 3CBQA 4ARZB 4EAAA 4HKTA 4MIYA 1FBTA 1NVEA 1OPXA 2K4MA 2F9FA 2WJHA 5CXSA 3WDKA 4CL2A 2X14A 3EQ9A 4OJMX 3UMGA 3LBAA 3EAQA 1U1EA 1TC2A 4L4RA 5BMVA 1I7MB 1G63A 3B3FA 3CSSA 4HYYA 4GG1A 3FNIA 4I1YA 2NYUA 2VNIA 2GK6A 1GUYA 3OQOA 3A06A 3EQ6A 3F4KA 4MDFA 1IG0A 4C0AC 3SBXA 3O1JC 2PLFA 3SJUA 4BQOA 2EQ5A 4X7MA 1C7ZA 3FOAA 1E60A 2FW0A 4JEUA 3L4EA 4D4LA 3EGXA 4GEKA 3MCTA 3DLAA 3IOYA 4M83A 5ANRB 1LDNA 1Q15A 1EWKA 4CHTA 4YV1A 1HT0A 4WBXC 1V6SA 1IH8A 4NMWA 1SBQA 3OIFA 1KZ1A 3Q15C 4M53A 3TAHA 4ATNA 4Q3NA 4K2AA 5BY2A 2IFTA 1J2UA 2G7ZA 1GNLA 4WERA 5HFAA 1YHZA 3BFXA 1L7NA 2OA0A 2W6MA 2Q27A 1XV5A 1Y5MA 4LY9A 1T8RA 1TT5A 3WKDA 1Y82A 4C0SA 2XVYA 5DWVA 3HMQA 3QUTA 4HAUA 5KSPA 3HA5A 3OAAD 1GTRA 2HV9A 3P2KA 5AOVA 3GRRA 3E9RA 5DXJA 4INAA 9LDBA 4D6XA 5I3CA 1NX9A 2GEKA 3F9RA 3PC8A 3WLNA 1L5HA 1GPH1 4IOKA 1EG7A 1V3VA 3Q8LA 4LDQA 1KAOA 3GRCA 1G41A 2VEDA 2IA5A 2XMQA 1VHLA 3ZIDA 5HKKD 5DOVA 1B8VA 3I04M 2PGJA 4O4JB 4WSOA 1U7OA 2FQQA 3NORA 1D4FA 5LIPA 1M2GA 1G17A 2R8RA 4X84A 1Q0PA 3LGXA 4BV3A 5DI3A 1Q1EA 2GXAA 5HQ3A 5GZ1A 1UQUA 1TPYA 1GXSB 3ADPA 3BKXA 1JU3A 4TZKA 5DSZA 4NYIQ 2ZYWX 1QHHB 4UPVA 3R7DA 4NCJA 4TQUS 5KOIA 1JS1X 2YBDA 2AOTA 3OU6A 1EB8A 4DCNA 3SZMA 1R0LA 1E20A 4OP3A 4TTQA 2ZP1A 4IOJA 1ZGHA 2LV8A 3B3GA 3S55A 3PZBA 2VCHA 1TF7A 13PKA 4RYLA 3TSCA 1VJ0A 1L1RA 4Y6GB 1DAGA 3QBJA 4F3YA 1GPMA 4CUKA 4EGCB 1G5FA 1U28A 1D8TA 2V7UA 3A4LA 4NWIA 3W8NA 4BEWA 3GUCA 3V48A 4YX9A 5DISB 5EIBC 4C03A 1HDYA 2Y1KA 2JLZA 3K09C 2OVFA 1KSJA 4LCBA 1KZGB 2ZUWA 4IL5A 5ULLA 3IA7A 4EF5A 2VDPB 5LZ9A 3A7EA 2UYQA 2P9YA 4YECA 3QJYA 2P77A 5HS4A 4JH0A 1QYWA 5H16A 5DE3A 3DHNA 2BGMA 5JARA 1D2GA 4A0RA 3ZOKA 1D0SA 1OIXA 3KOYA 4C3VA 4D80A 1WB6A 4AJ1A 2VSYA 3NHWA 1YJAA 2H7XA 2ZRIA 1A71A 4L8GA 2GWHA 5TC4A 1U7XA 5D51S 5ERGB 4CUZA 4DWVA 4IJQA 4LJKA 1RXIA 1T2EA 2Q9BA 1PSDA 2Z4TA 2QX9A 4RH0A 5FQOA 5BSKA 4O8JA 1NSFA 2W6NA 2L69A 1MC1A 1SOVA 4XUCA 4ZT2A 4AJ4A 3W0LB 1GOTA 1X1CA 4RHCA 2XWSA 3IJRA 4HTFB 3B20A 1D2RA 4LRQA 5BT8A 8MHTA 1BYUA 1NL3A 1XN1A 4KDFA 4KWHA 4NU8X 4AMYA 1QE5A 4B80A 3JQAA 1JR3E 4DBLC 3ZVKA 2YJ5A 4WQMA 3JD1A 5JJCA 4OJKA 3JQAD 4J7UA 4PTZA 4QTYA 4JBNA 4HQNA 1W5FA 4C1NA 3OT1A 4LJSA 4DR4B 1QK4A 4HX9A 4KBYA 4PANA 1O54A 4N1AA 2J5QA 5CVJA 5J4HA 1Q17A 5IC4A 3GDHA 5E7MA 3WBJA 4Y9RA 4L7VA 2HF2A 4A5OA 5LL6P 3RAEC 3OZEA 1T8WA 1YQUA 1IN5A 3M7IA 3P9KA 4FUTA 1FRZA 4KYVA 3B51X 3VDNB 1WBDA 3BICA 1XZDA 4OLFA 1DPGA 1OFTA 1RKUA 3HJRA 3LH5A 1HPLA 2R7LA 4OHWA 4C04A 3GLHE 2UUOA 3E3AA 2OAEA 1VYHA 4CBVA 2BP7A 1QX4A 5C8YB 1JUDA 1M8JA 1U2EA 4ML3A 2W6JD 3Q7SA 2QKYA 4KR7A 5TXGA 1EXNA 2C3UA 3GGDA 5A9SB 3VGJA 1KEEA 2H4HA 1W35A 2N1MA 2ETXA 4KEAA 3O9ZA 2P1ZA 3T7DA 1BH6A 1ECJA 1TFUA 1LY1A 3AW9A 2FMUA 4G5YA 1D2NA 4TMYA 3DDHA 2P5YA 3V4OA 3IEUA 5DYNA 4HLUA 2JJQA 1XL1A 3VDQA 1XEWX 1XNJA 1M34B 3OH8A 2XCIA 3ODPA 4BNVA 1LK5A 4MW9A 1PO7A 3EZGA 3FTCA 3JYNA 1EVLA 3U26A 2JGLA 2WJ4A 3EGVA 2X0EA 2XUDA 2I4IA 1RYDA 2QYTA 3WO1A 4Q1EA 3AR8A 5LBIA 1JEQA 2O2CA 3WMRA 1KERA 5JAQA 3WADA 1U9YA 2VUIB 1IM5A 3GC6A 2GEBA 3LY9A 4OQPA 5LB2A 1DRVA 3OOEA 3V1TC 2LKCA 2ZSJA 2CVPA 3JZMA 1OH7A 4ZVLA 3E3OA 1CS4C 2G1JA 4NMHA 2R4UA 4ZI7F 3KT6A 2J3KA 4JLOA 5J2TB 3NWEA 4CIVA 4NBLA 2ZBFA 1WXDA 3QWIA 2ZAYA 3X1DA 4EFMA 2O0LA 3TJZA 1RVV1 2GCGA 2PYIA 3TUIC 1CZLA 3UBMA 2WYOA 4CM8B 2QN9A 3HA2A 2WFZA 2FEWB 1TCVA 3OFKA 2X9NA 2VJCA 2IYOA 5ESWA 3H5AA 3AEUB 4HY3A 2ZBEA 4D2IA 4YT4A 2AOUA 2B8JA 3A32A 3IHLA 1HKHA 2ZB2A 4R1QA 2I2AA 3PGJA 3V8PA 1WPQA 2OCDA 3QPDA 3ZJVA 3K1YA 4WZAE 1Q2XA 2VZLA 1PT9A 4KO2S 1FTYA 1W94A 4BEVA 2QUAA 3AR9A 1KVRA 3EGWA 4Y9DA 3TM5A 4OQZA 2A88A 1YZKA 1GQSA 1P39A 1X15A 2B1GA 2BFEA 2YUTA 3I1FA 2ZUCA 2H63A 3QSYA 2JHFA 4FT4A 2I22A 3R6DA 4BFXA 4C0QC 1X19A 4F4CA 2ZE6A 3UO8B 4HZUB 1QSGA 3BQNB 4KQIA 4QIHA 1C7RA 3P9XA 1W47A 5D6OA 3PXBA 3R6TA 4UULA 5T4HA 3ROFA 1E77A 2KLBA 3PEYA 2B4AA 3EVZA 2KWIA 3PR3A 4GOOD 2JLUA 1GQFA 2BEUA 4BRZA 1QV6A 2YMPA 4BEJA 1L6RA 3MFQA 4IR7A 5K3SA 4AROA 4M0DA 1CV2A 1JEAA 3COPA 3SEFA 5E1DA 1NNLA 2PZGA 3BGOS 4FZJA 1Z63A 4BZPA 1XRJA 2J30A 1K92A 1W75A 5AM0A 3DEHA 4EKYA 1L7RA 2B82A 2VAPA 3D54D 4DSUA 3D6HA 3LRTA 5FI5A 4RD1A 1AO0A 2RGXA 3MWDA 1BTOA 2PAFA 4O2AF 3KJEA 4N5LA 3RJZA 4ZMBA 3OCJA 5ALRA 721PA 2QZJA 4A0GA 4AS1A 1G2QA 2BWJA 4RKYA 4IDEA 1II9A 2FWBA 1KQFA 1C8KA 1ISJA 3HVKA 3R5SA 5DIZA 1P0CA 3SJCA 3DZDA 4AMBA 3JAWB 2ZM5A 3TD9A 2FN4A 4P4SA 4X64B 1FFXB 3MJTA 4GP9A 3PGA1 4IF6A 3EW7A 3QF4A 4JL8A 1HOXA 1DP4A 3HLYA 5GM2A 1AQIA 3LI2A 5T6BA 1VJGA 1NP3A 1J07A 2WG2A 1C0KA 1E4OA 1QR2A 3NGLA 1WTAA 2X2FA 3MS4A 3RW9A 2WQ6A 3CLTD 3GZ4A 4NHOA 2RK6A 1KO5A 3B2QA 5D5PA 4DWWA 4IQ0A 1KH3A 3NTXA 5DHAA 3CVXA 2A33A 3WMWA 5ILGA 1E6LA 2CCGA 2KJQA 5FUQA 3A2KA 4FDLA 1JE1A 3H2YA 4HRVA 1KI9A 3I5YA 4PLHA 2VF7A 2FPOA 3L8FA 2CYAA 3L1VA 1CG6A 1I9CA 3TFQA 3HWRA 2I1WA 3G0IA 3OZTA 5GTDA 2REQB 2D5IA 3FAZA 2IPOA 4P93A 1P7VA 1ZL0A 1IM8A 3UUGA 4MO9A 4WBNA 5LSAA 4DQKA 4E4RA 1NMQA 2NZ2A 3JQEA 1SUCA 1E6WA 3CPSA 2R8BA 3COSA 4V0OA 2DEUA 2XXAB 1GO2A 2AJDA 3T3IA 2ZUTA 4RZSA 1QBGA 3U6KA 1YA8A 5CEEA 2JDID 3WNQA 2Z8XA 4M7RA 2R65A 2ADOA 5LZ8A 2V1UA 1C0IA 1J42A 2Q8NA 1RWXA 5K8IA 1Z2OX 2OMKA 1XMQB 1WY7A 2WKWA 4JBWA 1S7CA 1DX9A 1L2TA 1P3DA 3I9V1 3LBIA 3TLEA 3O4HA 4AP9A 5CITA 4G4IA 5C7IO 1NMSA 3OI7A 4FBMA 4AUNA 4EBBA 4IFEA 1K88A 5E7IA 5A1JA 4CNQA 3MLEA 4R51A 3HP1A 3I62A 3C16C 2E49A 3ZQKA 3LPNA 3FZQA 3AVXA 1KSHA 1BROA 4HPJB 3AEQB 4ZQIA 4FNMA 3M6LA 2IKSA 1HNNA 4CM4B 3O8CA 5LLSA 1U3CA 1QGAA 4PYMA 1LEHA 3W3ZB 1QYCA 4GQIA 5B58C 5HR5A 4Y18A 4A27A 1YKFA 2AOVA 4M0LA 4OQYA 4AWXA 3G8DA 1KWGA 1G20B 3H4MA 3BN3A 1R4ZA 1XD2B 2VVTA 2YN4A 4NBVA 3Q3GE 5JOQA 4ETMA 1RQ7A 4FGZA 3R40A 3UV7A 1QYRA 2IUFA 4P5EA 2Q1XA 4RTKA 3AH8A 4NECA 3GJ8A 5IDVA 3ADKA 1XA3A 4INPA 1LW6E 1AKVA 4J07A 5HUQA 4X85A 2H1OA 4DDHA 1YR9A 2FEKA 2AUNA 1FYVA 2X4DA 5FPSA 5A03A 1XVAA 1J5XA 4PM4A 4GYJA 1YK0A 4F2DA 1OUMA 3KWFA 4LX8A 3ZI7A 3RTGA 3ZVMA 2XD4A 4DYHA 2HR1A 5AJXA 3ORRA 3CB4A 2PUHA 4BZXA 4JY7A 3PLNA 4R3NA 2DX7A 3HLKA 5AKXA 3FZEA 3CR7A 4MHOA 2RB5A 3FXAA 1UBJS 5CFLA 1W52X 1YU9A 2A0YA 2CFRA 2PTHA 3AL2A 3KBOA 5NULA 1R15A 3NRCA 1E3LA 2IYXA 2TRSB 3CWCA 4AJJA 1ADCA 1LKZA 2PFSA 2PV0A 3W3AA 1P2TA 2Q5LA 2Z8ZA 4O08A 5FTJA 3DO5A 2O2EA 5DEOA 5ECYA 3T7TA 3ZDZB 3BH7A 3KV3O 1Y0BA 3QTBA 1JEYA 2C42A 3OY2A 4ITUA 1BX3A 1IG3A 1WVIA 3A8TA 1VLVA 2OCKA 3ICVA 4LNAA 1DKMA 1JPUA 2F8LA 2QTBA 2R84A 3OLQA 4PR0A 1IXRC 5HEKA 3WRYC 3IDAA 5C5CA 5EJ9A 4XH9B 3G7UA 3PC8C 4MRAA 5BQ3A 5MN5A 4QUJA 3BWEA 2OG1A 3ELWA 2XUQA 3ENNA 3S29A 1OKKD 3GY0A 2QIOA 3ZK9A 1SVUA 2FR0A 3U56A 2VI5A 1O0CA 5DMHA 5THQA 3QGMA 1MC4A 3W5DA 5BSGA 5ILQA 5F2KA 1UPFA 1G8KA 3GN2A 4K6KA 3NYQA 3ZXUB 1BYIA 1DBPA 3PEUA 1GUAA 5ENVA 3SBDA 3ELDA 3DPUA 3MAJA 1X9GA 1ZSYA 4IXTA 5F9FA 4O63O 3CLRD 1OLXA 3WGLA 2HYDA 2PCLA 2GF2A 4FBLA 2C77A 6NULA 2EARA 2D5AA 3EIQA 4RMJA 1S2OA 4XE5A 2PL1A 2EF0A 4QX6A 2HIAA 1KVSA 1T0JB 4JP1A 4LVCA 1V3QE 1XXHB 5A3SA 4KVAA 5LP6A 3ZBUA 4LY0A 4R9SA 3M2PA 1PG0A 4BMVA 1XRRA 1YK1A 3RJ5A 1M7GA 2FMIA 2WHXA 1P5FA 5D1HA 3VBCA 2HQOA 3U9TA 4MV4A 1O94D 3QU9A 3TOCA 2COKA 3NWBA 4J9VA 4JA0A 3KLOA 1ZD9A 2CJXA 4R81A 5DGIA 4BFCA 1J2RA 2BTEA 3LT4A 3BB3A 2CJYA 1BQ3A 2WKRA 3U4GA 4AIRA 2LIPA 3E8SA 2AXPA 3BMOA 4ZO6A 4XVRA 2QRKA 2QGFA 2P2SA 1F20A 2DPMA 3BZUA 3F96A 4DR3B 2Z1MA 1Y1KE 1SIWA 4EHIA 2AJLI 3EDCA 4CXMA 4E03A 1NPTO 1DGQA 4B81A 1IOLA 1PZFA 4IILA 4LBZA 3RGWS 4QG3A 1D1PA 4F6RA 2ZYGA 1SUDA 1O94C 1DWQA 1XYGA 2AJCA 2WUFA 3BM5A 2X42A 4J1QA 3UGJA 5NLLA 1HYEA 1P8JA 3AY7A 1P1IA 1EUCA 1G0OA 3QHQA 3WRWA 2MSEB 4PWYA 2DERA 1E1QA 2JKZA 1TEZA 1ES9A 1VJTA 1SVWA 1SCJA 4JV5B 1BGXT 4S24A 3UAWA 4EUHA 4LXGA 4ZREA 1JSLA 4UASA 4UZEA 3COVA 4XVCA 1E64A 1TOAA 4Y2UA 16PKA 1FC0A 2NYAA 2YRFA 1PJ8A 2GMWA 5LXTF 5KWIA 2PUAA 1VG9B 2R7MA 2XZTA 2XW6A 1U7UA 3LC0A 3N74A 5FT9A 5K0EA 1BGVA 2IZ6A 4H0CA 3ZXXA 3E82A 4GVPA 4Q02A 5BP7A 4P0QB 1C1XB 1MX9A 3T4XA 2CVHA 2VAMA 5WRFA 3M49A 2QM3A 2YNMD 4A0QA 5IT0A 1PJAA 1SVNA 2ZROA 4ZEVA 2C2GA 2ZJ7A 1VIVA 4HFRA 1BQEA 2GXSA 4NV3A 4QUHA 3A9RA 3ZGZA 3ZD6A 3P26A 1AN0A 1MA3A 4M9UA 3U60B 2GZAA 3A4TA 4ICIA 2BFBA 4X1IA 2XRMA 4F8JA 2OO5C 4TVOA 2X4LA 1FXWF 1HQKA 1R8QA 2GI4A 2KBFA 3AY0A 3M3HA 4Z86A 3T5GA 3VTFA 4E15A 2EEPA 5AOCA 1O57A 1Q50A 4WZAA 3HKBB 4Y2XA 5L7TA 4IGKA 3JWHA 1E9DA 1XFAA 3IPRA 3ZLUA 4LTDA 1Z4PX 4Q93A 4OGKA 1H0RA 3WNVA 1Z5UA 2BGJA 4GE0A 1H2BA 3LLCA 2PD6A 5FXMA 4NOLA 1NWHA 2D54A 3AETA 2GB4A 2I6FA 4U4AA 2ORED 4OBXA 4Q7MB 4MS3A 1TGYA 4JLNA 1W2WB 2WF7A 4OHYA 1B42A 1P4HA 4XYBA 3KCQA 1JH8A 4HEJA 1OD6A 4H7KA 3RRXA 4F5DA 2DPHA 3E9YA 3ZD8A 2V7QD 3KDSE 4IDFA 4FYJA 2PT6A 1BXZA 1R0YA 2LGJA 3PJRA 4F97A 1SH7A 1CJVC 3ZV3A 2B94A 2HPAA 3ONDA 2FJUA 4X93A 3SF8A 4B3IA 1DEKA 4XQ9A 4FX2A 3LA8A 4QPJC 1UBSB 1RCTE 4W9NC 1KK3A 1TYEB 4DL9A 1FYWA 2I03A 2QQGA 5FBRB 5I9LA 2ZXUA 2EW8A 2AB0A 4D5GA 2R8YA 1EJBA 1VSTA 2WD7B 4DT1A 1RLIA 1ZD3A 4GLOA 5CX1B 3CONA 2UUAB 4JXZA 1U0OC 2HJ9A 2I66A 3IBGA 3LO8A 3GLQA 1FXUA 3MGKA 3IR6A 2BKAA 3OZRA 2O1WA 4B44A 4QEDA 2NU7A 4M9QA 4M1KA 1UMBA 2A5FA 3KSBC 1XNRB 1MRNA 2XCLA 4BC0A 4LTNA 3DVQX 1QF7A 3FETA 3AVYA 2EOAA 3RBZA 1XK6A 2QTGA 1JEDA 3QE3A 4YA6A 4MVJG 3TWOA 3FTNA 3CCFA 2OKCA 3L6RA 1YJXA 2YTZA 1FP1D 2W22A 4RDIA 5JVDF 4BMYA 3D2AA 4YRLA 4KH1A 3K31A 4RANA 4UNPA 1Y6FA 1DUVG 2HCRA 2K7ZA 1GM5A 2F8SA 5JSUA 4P3OA 3ZKAA 1HMPA 4DVGA 2J5XA 3TDKA 4FIDA 1DFGA 5JZ9A 2QTAA 2EFYA 2RDMA 3ESBA 3I6YA 3S3TA 2XWQA 5A4JA 3Q0TA 4HVAA 1A77A 4D3YA 4M7WA 2BGTA 1L5QA 3C7TA 5FO0A 2Y1WA 1U31A 2IVZA 4E7OA 3UMCA 3O8BA 2EBHX 5F21A 1ECLA 2IF2A 2ZB7A 4DLSA 2KB0A 3QYFA 4DRYA 2HFJA 1PN3A 3EIXA 1ZFNA 2ZREA 4G24A 3SFZA 4G1MB 3WRYA 3M1IA 3FJYA 4B6GA 2PUCA 1MEJA 1M1YE 3E8MA 1SHJA 3LG2A 2B7BA 4YR7A 3NFYA 3ASVA 3PQCA 4PLFA 5I7SA 1I72B 5A02A 3AHCA 3JXEA 4LYHA 2GCPA 2CXXA 4RL6A 2FPGB 3F5QA 2O2ZA 1XKXA 3LUPA 4OK5A 1UPUA 4URVR 4MV1A 2GTHA 2JI4A 1V8PA 5I47A 1HX7A 2VTBB 3QHAA 4MVWA<