2O4UX

Crystal structure of mammalian dimeric dihydrodiol dehydrogenase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
b'ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dimeric dihydrodiol dehydrogenase
publication title Structures of dimeric dihydrodiol dehydrogenase apoenzyme and inhibitor complex: probing the subunit interface with site-directed mutagenesis.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
total genus 115
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2o4uX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4uX01
4WCDA 1DAOA 4GMGA 1NWCA 1EBUA 3CKYA 4RO0A 2GN9A 2ZJ0A 4FFNA 3KYCA 2Q2WA 2DQ4A 4TRMA 1OOEA 3AFNA 4XIYA 1DC3A 4UUOA 1LSUA 6LDHA 3W4IA 5COBA 4DRYA 3NEPX 2JFGA 2FSSA 2QZZA 4CLXA 3H2SA 2XXBA 4J4TA 4XEHA 2CSUA 1QXSA 3DB2A 3LC7O 3RFXA 2VOEA 3JYPA 1L7DA 4Q3EA 4N5MA 3ZNQA 4GKBA 5AOVA 4MKXA 3EUWA 4ZRNA 1SCUA 1ONOA 4XQEA 4IS2A 4NHEA 2Q49A 2OMEA 2IEDA 1PIWA 1AUPA 3R1IA 4GX1A 2HJRA 1PU2A 1PWZA 1YJQA 1R6DA 1C1XA 3OIFA 5L7WA 1JKIA 3INGA 3RBXA 4INAA 1BGVA 4PRKA 5JFOA 1H2HA 1RKXA 2I9PA 4AICA 4J9UE 1P0CA 1A7AA 1FDVA 4QFCA 1IUKA 4RVDA 4CQLB 3D5QA 1HTBA 1NAIA 4FIZA 5JDCC 1FDTA 4BS9A 5ICMA 1ZSNA 3NJ8A 3I83A 4CV3A 4K1LA 1EVZA 4RPJA 7MDHA 5U9CA 3GAZA 2WJPA 2NUAA 3P2OA 1T2FA 2BFOA 4JP2A 2G82A 1YXMA 3RKRA 4DQXA 3UOGA 4B4VA 3RBVA 1YGYA 4BO0A 1ADFA 4FB5A 2Q45A 3BMNA 1ONNA 1DO8A 3ST7A 4D79A 1JN0A 2X1HA 2CVQA 2J3KA 2Y1DA 3H9GA 4EYEA 1KVUA 2A94A 3GLQA 3RC7A 3ASVA 2NQTA 2J5KA 1Y5MA 1I0ZA 1T25A 2H1SA 4IDCA 2E37A 3PIIA 2PD3A 3JYNA 2G0TA 3D4PA 4WKGA 1D4FA 3FTNA 4GH5A 4TVBA 2DPGA 4MVJE 2OGUA 2W2KA 3WGZA 3NAQA 1QLJA 3U0BA 4CODB 2HK9A 3IS3A 4BO4A 1P3DA 3JTMA 3RASA 1DRWA 1E6EA 5FYDA 4BNXA 1OBFO 2EERA 4P4LA 2JD1A 3AU9A 2GSDA 1RM5A 3DOJA 2AEMA 1DIGA 4YPOA 2YV1A 2Q2VA 3HNPA 1YL6A 2PLAA 1G6KA 4LGVA 2D8AA 3VPXA 1KY5A 2C20A 2GUGA 3TOXA 4IY1A 3D64A 4BNFA 5T6BA 5BNIA 1GZ4A 5JYFA 3AOEC 4GLLA 1O5IA 3JD4A 1HKUA 3GAFA 2B5VA 5KVCA 5F3RA 5GMOA 1HLDA 3DHYA 3IC5A 3I9OA 1GPJA 2QW8A 1GUFA 4K28A 1XLTA 4TQGA 3OJOA 1Y7TA 2ZTVA 3KM0A 3QE3A 1QYWA 5KCZA 2FR1A 4EEZA 3TPCA 1X1EA 2DBQA 4ALKA 8ADHA 1KOLA 4BOYA 3JSAA 1U28A 2NWQA 2ZCVA 1HF3A 4CM8B 3OIDA 1CWUA 1MC5A 4PN3A 4NG5A 3CTMA 3GK3A 4NJOA 1F06A 3VDRA 1GYQA 4ZICA 1CETA 4ZQEA 4GX2A 4RVHA 2IYPA 2RHCA 5JAZA 3L9WA 4OSPA 4XB1A 1ZNQO 2BRUA 5IDQA 4RF3A 1BHSA 3L6EA 1JA9A 3OM9A 4IJKA 2IEBA 1P0FA 1P74A 4BKUA 3KVOA 3MJCA 4CL8A 1BDMA 2B4QA 2JCXA 3OQ6A 3QWFA 1I3LA 2D4AA 4B8ZA 1LNQA 3PJGA 1IL0A 3ZWVA 2WE8A 4NIMA 4F46A 5T8KC 2Q4BA 1ZK1A 3GFGA 3PWSA 4ITUA 4XJSA 3MWEB 1SZJG 4MDHA 3RD5A 2XXJA 2G5CA 1YBMA 2B4RO 1ZO8A 4MVJI 2H63A 1F12A 3GEGA 3NYWA 3E1KA 4E4YA 4E5PA 2JL1A 3PGJA 3ZWPA 4W7HA 4CQMB 1UZMA 4ALMA 3Q9UA 3H3JA 5T64A 3DR3A 1GQYA 1PZFA 2WD7A 5I7FA 3KB6A 4ND5A 1YO6A 5HWSA 1L7EA 5B37A 2PD4A 5JCJA 1AGNA 3OEYA 2Q99A 1WXDA 4RPGA 1PJ2A 1HDGO 1LJ8A 3WGGA 4J0FA 4F6CA 1O0SA 3PFFA 4CM9A 5JDCA 1ZW1A 2VZ8A 3OA0A 4Z3KA 4RQUA 1R16A 1ZJZA 3LT1A 3PHHA 1RM4A 3ZWCA 3MOGA 3ZZNA 3BHIA 4FN4A 4O6VA 5C7IO 3KLPX 3W6ZA 2NTVA 1EE2A 1H9BA 2YDXA 3K2EA 4J6FA 3TWOA 4J90A 1LDEA 1YQXA 1OAAA 3LSYA 1LDGA 3E9QA 2YHIA 3DTTA 2WTBA 2WYWA 4Q3AA 4R5HA 1XG5A 4MP6A 4R5MA 1VPDA 2OXIA 5U1PA 3ZWMA 4GBJA 3LVFO 2OHXA 4MVJM 3VTZA 4J91A 1ZIDA 4MIYA 3VKUA 3OIGA 4R9SA 2FY8A 2IE0A 2J3JA 1O94A 2GGSA 3K30A 3O8QB 2HDHA 2VHXA 1UP6A 4CM4B 3DL2A 2TMGA 1U3UA 4E13A 2Z95A 1FJHA 1I36A 2HCTA 4U0JA 4XYGA 3DO5A 2VWQA 5EN4A 4YJHA 3VPHA 2ZYGA 2YYYA 4OYRA 3G3EA 3GNQA 2X5OA 1Z75A 3E03A 3FR7A 5GZ6A 3LLSA 4M86A 3WLFA 1DIHA 1ULSA 4FC6A 4W6ZA 2DBZA 2ZK7A 1IPFA 1P33A 1R4NB 4R9RA 3AOEA 3MWDB 2CDCA 3ON5A 4ZQHA 1GZ3A 5HRUA 3PDUA 5JE8A 1C1DB 1GZ6A 5EL0A 3FWNA 3PQFA 5COAA 4K9DA 5G4KA 2NVUA 3PDJA 3BTVA 3U4DA 1XA0A 1XQ6A 5TT0A 3EVTA 5DBIA 2VZ9A 3GEMA 4CUZA 4PRLA 1Q1NA 3OJEA 4E5YA 1PJQA 3C24A 3ZHXA 3ZI0A 1K6JA 2NVWA 3GNTA 1ISHA 5J9GA 1UXHA 1EVJA 1SC6A 2FPIA 2ZJ1A 5CDTA 1E3EA 2RBEA 3PLRA 4DWVA 3DZFA 4YCAA 3K2BA 1VC2A 3GDGA 1B7GO 1AN9A 1G0OA 4TVOA 3TZHA 3F6YA 2GD1O 2O3UA 1A9YA 1P44A 2V6GA 2DUUA 1T1RA 1LQTA 3C7CB 2OZPA 5COQA 1Y9EA 3MOIA 1XDWA 2FR8A 3CMCO 1HDYA 5JO0A 4YXFA 3R6DA 1PS0A 1WDLA 1XEAA 5EIOA 4WECA 3INTA 4BV8A 1V3VA 1V6AA 3WQRA 3DHEA 3LT0A 4OXYA 1O95A 2IZ1A 3U3XA 2A35A 5TX7A 4R69A 2X5KO 3DBHB 4FFMA 2O3QA 4N5NA 4OXKA 3NX4A 5A5EA 1WLYA 4UVIA 3UHAA 5BNTA 3VZSA 4U0KA 3WGTA 3W8FA 3EYWA 1HL3A 2O7QA 5I7EA 1NQ5A 3HDQA 1SEPA 4CMKA 4I8XA 3FRJA 3OH8A 1NASA 4RL6A 3MTGA 4KP7A 4DIBA 3R0IA 5G0UA 5IN5A 1SB8A 1DBVO 5T73A 1KVSA 2AXQA 4I1IA 4YAIA 2B35A 9LDBA 3Q9NA 3ADOA 5TC4A 1I33A 4Y9DA 3UICA 1S6YA 3UKOA 4PZDA 4H15A 3ZCXA 1BSVA 1MG5A 4A0SA 2HKIA 1MC4A 4JJFA 5TQVA 5G0WA 3DFZA 5A1TA 2D0IA 2O4CA 2BLLA 1PS9A 1UP7A 3I4FA 1NHWA 4I5EA 5EMHA 3AUAA 1ADGA 1KEVA 1R12A 3JQ9C 3EHEA 3ZHYA 3ASUA 2NV6A 2CVZA 5L4SA 1KBZA 2X7HA 3E48A 4YR9A 3TJRA 4CMIB 2ILTA 3ANMA 1GADO 3KYBA 4IJWA 4YBZA 3NTRA 5TGDA 2JHGA 4FD3A 4MOWA 5I7VA 4MKZA 2C5EA 4CMCA 3K92A 3CZRA 2R2GA 1CEQA 3ROQA 2E49A 4E5NA 4U6SA 1CERA 6ADHA 4NZ9A 1U2GA 3I6IA 3NDRA 3GVHA 3EMKA 4MIEA 5DDIP 1N1GA 2B5WA 3MJEA 1MLDA 4Q9NA 2JHFA 5IZCC 2Y1OA 3NGLA 3E18A 4U5QA 1LA2A 1MXHA 1I30A 1RPNA 2LDBA 3TSCA 1VI2A 3RC2A 4DYVA 3JD0A 5I8WA 3IAHA 3ROKA 3RSHA 4WOJA 2NU7A 4OSOA 4CM7A 3KZVA 5A9SB 4BHTA 2UV8A 3RU7A 2ZYAA 2Y67A 3SLKA 2JD0A 4L9RA 4IMRA 4AJJA 3K8ZA 1ULUA 4E21A 1YS4A 3AUSA 4UVGA 4P4GA 5CEFA 4S1VA 1HT0A 2VNAA 5FI5A 5JPIA 3Q2KA 4QUKA 3F3SA 4J43A 5LCXA 5KKAA 4RVSA 4AFNA 4FOSA 1KIFA 4L4XA 5F21A 4IIUA 3TRIA 4GLOA 1NFRA 1BXKA 3AY7A 2I99A 3TL2A 2V7PA 1Z82A 4BO8A 5TF4A 1BVUA 1LSOA 1X1TA 2HMVA 2PZLA 3PJDA 4NJMA 2FZWA 4RF5A 3O9ZA 3RUAA 4IZIA 3VKVA 9LDTA 4YDRA 3SLGA 1GUZA 4JQCA 4R41A 4BQPA 5L40A 4ZA2A 1XU9A 3MJTA 4DA9A 1MB4A 1BW9A 5TJHA 3WYEA 4PVCA 2POQX 3JQFC 2G76A 2X23A 4QSMA 3VH2A 4BNTA 1PGOA 4E2ZA 2I3GA 3PTZA 4GKVA 3DBRA 4YYZA 3L77A 4BMVA 1U7TA 4IJVA 1K6IA 1WW8A 3TFQA 1A5ZA 1G1AA 1NYTA 3WGIA 2I65A 3FNFA 3RU9A 1F17A 1GUYA 3PEFA 5F1PA 3L4BC 4PIVA 4R1SA 2Q1TA 4EBFA 1YBVA 4AJPA 1OC2A 3EZLA 3COSA 4CPDA 5DP1A 1P1JA 2QRLA 4IDBA 4YA6A 3ORFA 4ND2A 1L1FA 5CPBA 3SBOA 4Z0TA 4BNGA 1GU7A 4QO8A 4CLRB 1N8KA 2OL4A 3HDHA 3JQGB 4W7IA 4B79A 2UAGA 3MCVA 2CFCA 3ZN2A 4NH4A 5LDHA 2PTGA 3GN2A 4DPMA 3PHLA 2VWGA 3T4EA 1CYDA 4EITA 4IDEA 3ENKA 2C54A 4OOEA 3HFSA 3MTJA 1JVSA 4CQMD 1Q7CA 3FPLA 3JQ6A 1KEWA 1HDCA 1LQUA 4CLHA 1A4IA 1SEVA 4F6LA 3JQEA 4N54A 1MXFA 4CL3A 4I5DA 1XELA 1FXSA 4LN1A 3H5AA 3S2IA 3WQSB 1UH5A 1U9JA 1FK8A 4NFHA 3W1VA 2B36A 2IODA 2ZYDA 3QW2A 2D2IA 3EW7A 1ZBQA 2VRCA 1Q2XA 4RORA 3JQ8B 2I6TA 1PJSA 4DQUA 1UR5A 3MEQA 1EE9A 5C7OO 1N2SA 4IUYA 4BO6A 1Y9AA 4GWGA 2NTNA 5DP2A 1PL6A 4IBOA 5A3JA 1GL3A 4DPLA 4OAQA 4IPTA 3RC9A 3BTOA 2DTXA 2EKPA 4Z6KA 1ZUD1 2O3JA 4CM1A 3HDJA 3M2PA 1YOVB 4R54A 3NKLA 2P91A 3DXFA 3TN7A 3V2GA 4CLOB 5HS4A 5KIAA 4UREA 1HZZA 4B4UA 4NMHA 4B3IA 1R0SA 2E4AA 3DDNA 2FOIA 2AQHA 5JAQA 3GZNA 4BNZA 2V6BA 3V2HA 3WNQA 4FR5A 3E5RA 1U2DA 4XA8A 1MFPA 2VT2A 4HX5A 4P38A 4XZ3A 4BIIA 4Y6SA 3W4JA 1I32A 4WEQA 3L0DA 4EJ6A 3PHJA 1A71A 5L51A 4HP8A 3ROMA 4HFRA 1EUDA 5ITWA 4PLVA 3H7AA 3RROA 4FQ8A 2X22A 1IZ9A 2HRZA 3IUPA 1LSJA 1QKIA 2Q50A 1YH3A 2O3SA 2CD9A 3GT0A 1QMGA 4XJTA 4XB2A 4JCOA 3VAZA 4MINA 2OFPA 3G49A 4FGWA 4QXMA 3QVXA 4ALJA 3MZ0A 2WYUA 1X7HA 3BMOB 2VYND 3O4RA 5KOIA 5IG2A 2I3AA 4BNNA 1HLPA 5HA5A 3AFMA 4YAEA 5I7SA 2BF7A 5A5FA 4MVJH 4E0BA 1PJLA 5JDIC 3DMTA 4XIJA 2QYTA 4LRTB 1DDOA 4Y6RA 1EQUA 2PA3A 3JQFA 2ZQZA 4NFYA 3LT4A 4XQGA 3WSVA 3HWRA 4RV9A 3DEYX 4J4HA 4I9NA 2P4HX 4CMAA 5AXBA 5K6AC 5ILOA 2HSDA 3NJ4A 1KC1A 5EQFA 1LRLA 2QQ5A 4BB5A 2ZTUA 5KJ1A 3GHYA 1I3KA 1XGKA 3L4BA 1WMBA 1E6UA 1X7GA 1U7HA 4UAGA 5JW6A 3P7MA 1KEPA 3GMDA 4M55A 3UCEA 1ISGA 2GZ2A 1PQWA 1R37A 3ITKA 1ZSVA 4WLVA 3TZ6A 5H82A 1QYDA 2BFMA 3JQ7B 1V3TA 3WGHA 1K0UA 3NDIA 4L8VA 4IDGA 4R01A 4J16A 3WBBA 3RUCA 1PJCA 1PJ3A 3V5NA 3E9NA 5JYDA 1IY8A 3P5SA 4J1QA 4DGSA 2BKAA 4G5HA 3V1YA 1DJQA 4IQGA 1YKFA 4BO9A 3SX2A 1PR3A 3JQAA 1WMAA 3ZDFA 3I5MA 1M75A 1CF2O 1WPQA 1JKFA 2IDZA 4LRSB 3KXDA 1NBOA 5U4QA 4D46A 3WGQA 1GY8A 5CG1A 2BFAA 3D0OA 4MPDA 1SNYA 3GHHA 3RQSA 1HSZA 1IOLA 3ZV3A 4K6CA 1Y8RB 5L7TA 4FDAA 2I67A 1ADCA 3F5SA 1U3WA 2EHDA 3A14A 4J3FA 4KWHA 2VUUA 4NI5A 3VZPA 4URFA 2JFFA 2QYSA 3DBLA 1NR7A 3RC1A 2GNAA 4NBTA 4ALIA 3DHNA 3V1TC 1WDKA 4GL4A 1BXGA 4GSLA 4RQTA 4YT4A 4W9NC 1HSOA 2WD8A 5JC8A 3ABIA 2HU2A 1B15A 4B4OA 4YJFB 4OJNA 3AWDA 2GLXA 4ZD6A 1JWAB 1DSSG 2UYYA 2AE1A 5J23A 2X0NA 3GG2A 4DREA 1EDOA 4E2XA 2X6TA 3HSKA 3GRKA 5H81A 4DMMA 1LC0A 3WDSA 2YUTA 3WFIA 1JLLA 4YJGA 1HXHA 5K0ZA 3FBTA 3KYCB 1J5PA 3N7UA 1GAEO 1IZ0A 3ONEA 3FBGA 5TSDA 1Q0HA 1XCBA 3K9QO 2C29D 4HFMA 3H5NA 1HRDA 4GAEA 1HE2A 3AUTA 4DPKA 1YB4A 2BGKA 3OQ1A 2HO5A 5JMPA 4CQMA 3U5TA 1QG6A 4ZVVA 1J4AA 4FS3A 1KEUA 2AE2A 1UXIA 3GY0A 5JC1A 3BZUA 3CZMA 3KHUA 2EGGA 2PGJA 4AJKA 3B20A 1LBEA 3A1NA 5B4VA 4P8RA 1DHRA 3GUCA 5L45A 4Y67A 4J9VA 1HYHA 4JJIA 2AEJA 1LEHA 5KVQA 1H93A 2CY0A 1F8FA 2JCYA 3LT2A 5EESA 4J7UA 5T57A 4JN6B 5TLSA 3DAPA 3K96A 1EVYA 4RVFA 3TL3A 1C1XB 1GCUA 1X14A 1DPGA 4P22A 2HUNA 4BGEA 2C7GA 4I5FA 2B69A 1WP4A 1ENPA 1Z73A 3NRCA 1J6UA 4R3WA 1AE1A 1VJ0A 3CXRA 5JDIA 5I9MA 2VWPA 3I6QA 1I2CA 1W0CA 4N5LA 5JCXA 3M1LA 3ETEA 4Z3DA 4L76A 1EBFA 2E6UX 3WB9A 1I01A 4XQCA 4KUEA 4R16A 4IS3A 2WYVA 4JBHA 3GVXA 4HV4A 1ZVMA 3B1KA 1JQBA 3B70A 5CG2A 3WTBA 4XYEA 1M2WA 3C1TA 5K6AA 1AXEA 1E7RA 2I66A 3K5PA 3F1KA 1E3WB 2Y0CA 5A03A 4JROA 1EUCA 4RF4A 4UEJA 3VOSA 3O8QA 3SJ7A 1WVGA 1P1FA 3Q1LA 4Q3CA 2AG8A 4KDEA 1PL8A 2O23A 4JNKA 4MP8A 4DUPA 2BGLA 3ADPA 2P9CA 3WOHA 2DUWA 5THQA 1FMCA 1PR9A 4IXTA 2HJSA 2BD0A 2QIOA 3S1LA 2W2KB 3N58A 4PVDA 4C7KA 3R3SA 4BO7A 2D1YA 1B14A 1ZZEA 1YBAA 1RYEA 2CVOA 1R4NA 3MJSA 4PLHA 2PGLA 4JIGA 1OMOA 4CR8A 2BI7A 2ZB4A 3VPFA 4I9UA 3WXBA 4BO3A 2DBRA 3NUGA 4Y6PA 3JYQA 4OKIA 4ZHSA 3DWFA 2VYNA 1LTHR 2PKRA 4TRNA 5AQ1A 4C7JA 3HQ4O 2PNFA 4K6FA 3GVIA 1K3TA 3HHPA 2VWHA 4EJMA 4UVEA 4RPKA 2O7SA 2F1KA 4WK6A 1LI4A 2P68A 5KWEA 1A27A 3PYMA 4ILKA 1VM6A 2PH5A 3LLVA 3M1AA 1P9LA 1PZGA 1W8DA 1AXGA 2EW2A 3ZWNA 1GEGA 1Y8QB 4W9NA 1EVIA 2RCYA 2O3TA 3WIEA 4IXWA 4I08A 3QLJA 1ZXLA 5F5LA 2Y1GA 2PZJA 3ZU3A 3G1UA 5KKCA 1F0YA 1KVTA 1PJ4A 1ZMOA 2VTEA 3WG9A 4E5MA 1H5QA 1NQTA 2HRBA 2P5YA 1YB1A 2QG4A 2DM6A 3G17A 4RDIA 1T2DA 2LDXA 4CM5A 4MIOA 3DBHA 5JMWA 2GASA 3EAGA 5C3MA 4JK3A 1BDBA 3AM4A 3SXPA 1GTMA 4XD2A 3Q3CA 1LDNA 1TI7A 1NQOA 1SBYA 4HUJA 1GDHA 3JQCA 1P77A 4G65A 4BL5A 3BTSA 3WMXA 3LF1A 4BNWA 2V6FA 2GZ3A 4B7XA 4KTVE 3JYOA 4WCFB 4NBWA 5BR7A 1C3VA 4N18A 1R4MA 2H5LA 4NBVA 1XWFA 3ZWXA 1I5RA 4FFRA 3MJVA 3OF2A 1I3NA 1SOWA 2HK8A 4AJEA 4E31A 4PLCA 5IDYA 4AJ2A 2GR9A 3DZKA 4BMNA 3ZH2A 4YAJA 2WD7B 3KYDB 3AOGA 1RYDA 3I9MA 4BQRA 4AL4A 1N92A 1Y6JA 1E3LA 2PZKA 4CLDA 4ALNA 4DIFA 1S7CA 4XKJA 4ZN6A 5CFZA 3FI9A 4NNJA 1PWXA 3IIEA 1HYEA 4JX8A 4YRAA 2X8LA 5TJ9A 4O1MA 3PYXA 3HN7A 1DC5A 3QVSA 2D3TA 2Q2QA 2EIHA 3V1UA 1B3RA 2NACA 3WWZA 4CMIA 3X2FA 2C7VA 1I3MA 2DAPA 1E7QA 4HWKA 3UH1A 4CM3A 2AQKA 2OP0A 3H9UA 2VTDA 4RLSA 3LC2O 1TXGA 1BRMA 1MA0A 4LMPA 5C37A 3WIDA 3PQEA 4F45A 1U3TA 5DBFA 2VN8A 2WSBA 3C85A 5B4UA 1M76A 5ILGA 4OH1A 1LX6A 4YAGA 5T8KA 4OIMA 2AQ8A 2HMSA 5CAEA 1VJ1A 1MG0A 3AI2A 3G79A 3Q2IA 2RAFA 4LVUA 2YHIB 3TZCA 4MVJF 3AU8A 4PLPA 1HDZA 4D0SA 4IJUA 3GNSA 2IYOA 1B0AA 5BSGA 3KSZO 4UUNA 4CV1A 4IGFA 4FBGA 4WLOA 1WZIA 1OC4A 3MJ4A 5L95A 1U5CA 4NPCA 5JLAA 1MUUA 1MV8A 4EI2A 2BELA 3GZ4A 5A9SA 1U3VA 5TNXA 2ZB3A 3BAZA 1BTOA 4Z0PA 4QFDA 1NM5A 2VUSA 5CDSA 2GN8A 4IDFA 3DZHA 5ER9A 3D1LA 2HK7A 3KSUA 1FDSA 1TT5B 2OO5A 3CE6A 1QRRA 3QWAA 2EEZA 1GD1O 1ENZA 3D7LA 1U4SA 3KO8A 1EZ4A 4GPD1 1DRVA 1SPXA 1LUAA 4WNIA 3JQBC 2QZ9A 2GZ1A 3JCZA 4AJHA 4J2OA 1YJ8A 3ZU4A 4XGNA 5B4TA 5H83A 1IPEA 1QV7A 2J3HA 3L6DA 2YW9A 2HMUA 5G4KB 1GEEA 4I9HA 1CRWG 4ZJUA 5G0VA 5IAAA 1ZFNA 1C0KA 1Z7EA 5MDHA 2W98A 1B26A 2FPGA 1E7YA 2OBNA 1M6HA 2Y66A 4ALLA 4EUFA 1WWKA 2WM3A 1X0XA 3B1FA 4NR0A 1EUZA 2AQIA 5JYAA 4MVJD 4XGKA 1HETA 5JAMA 4PG6A 5KTKA 2WEKA 4NU5A 4UEOA 5GY7A 3RIHA 1GPDG 1CDOA 3IL2A 3K31A 3HDYA 3OJLA 5F1OA 5AXAA 1HE4A 5ENDA 3WNVA 1H6CA 1RWBA 3EGOA 1DIBA 1TVEA 3ENNA 4IINA 4AJ1A 5AVOA 2J8ZA 1UXJA 3OMLA 4UVHA 4D3SA 1LDMA 1ZK0A 4EDFA 1DJNA 3T7CA 3ZWBA 3TDKA 1JAXA 2EF1A 5CEJA 3QV1A 4JBGA 2DFDA 1UDBA 1SOVA 3FN4A 2ET6A 4L4SA 3SC6A 4TROA 2W8ZA 4B7UA 1EFKA 5ES3A 1LLQA 3DZBA 2CZCA 4FSHA 4DTIA 4BO5A 1N9GA 2FWMX 1V0JA 3ZWAA 3I3OA 3ZNOA 3BMQB 2EW8A 2EP7A 3IP3A 2ZKLA 3BHMA 1B8UA 4E2WA 1ZEMA 1WDMA 5JY6A 3KETA 2X86A 3Q0EA 2J6IA 3ZW9A 4AJLA 4XR4A 3TOZA 3BTUA 3SC4A 5CHEA 1P31A 2NVBA 4L4RA 3L9XA 1VSUA 1B2LA 3U4HA 1JVBA 4FFLA 3KSDO 2J5QA 5HBRA 5CP8A 5JYEA 3PWKA 3V8BA 2CF5A 3UW3A 1VL6A 2V6MA 1U8XX 4O63O 4XDZA 3PGXA 3JD2A 1PGQA 4FJ1A 3WMWA 1PS8A 4J7XA 3CEAA 1DIAA 1C0PA 1T1SA 1YVEI 1OI7A 5FWNA 3PWZA 4A03A 1MFZA 1E5QA 5AXDA 2YV3A 1YDEA 2Z1MA 4DL9A 4IGEA 2G1UA 4KUGA 1AHIA 2C0CA 2XAAA 3PLNA 1UJMA 4BVAA 3U62A 1CQIA 1VLLA 3PI7A 4LSWA 1YOVA 2VT3A 4J0EA 1VL8A 4PLGA 4BNLA 1T24A 1BXZA 1R0LA 3OJFA 5EPOA 3PYLA 2FHSA 4XYBA 5GZ1A 4DMLA 3NV9A 3C1OA 4JGBA 5KVSA 5JY1A 4YT2A 3DBVO 5TRTA 2WMDA 4XCVA 3IQDB 1ML3A 4WGGA 2HAEA 1E7MA 3RUHA 4UUMA 3ITDA 3RJ9A 3FPCA 3FNGA 2X5JO 3ZU2A 1R15A 3RAJA 4WJZA 1JAYA 1PGJA 1BWSA 4Y98A 3I4CA 4JP3A 3UCFA 4O59O 2FSVA 3GR6A 2ZTMA 1U5AA 2I5PO 4UULA 3JQBA 2A92A 3F1LA 3GFBA 4D43A 5BNFA 3UAGA 5IJZA 3DAFA 1E1LA 2NQ8A 3C7AA 1DLJA 3H4VA 1XHLA 3ICCA 4NDNE 4PCVA 5DT9A 5T5QA 3GG9A 3JQ9A 2VHWA 4GMFA 1O6ZA 2VRBA 4PG7A 3DAGA 5K9ZA 3D3WA 4RCVA 2VHYA 3QRWA 5CDUA 3ETGA 4IQ0A 4DLBA 3GMSA 3IJRA 3DZGA 4PLWA 5F5NA 5A02A 1NR1A 4Q3BA 2R00C 3KUXA 1LLCA 4J4BA 4OO3A 1JDJA 3SEFA 1J0XO 1QORA 5L53A 4BNVA 4OMUA 4WOKA 4IMPA 2H9IA 4NJMB 1HE5A 5IN4A 3NTQA 2TMDA 4WASA 5IZCA 1EDZA 5IXSA 2VCYA 4A7PA 1DFGA 4EJ0A 1D1TA 3H6KA 1PQPA 4CV0A 1BW9B 5JO9A 4BKRA 4PLZA 3AY6A 2Y0DA 1Z7BA 4FJ0A 3WICA 4CM6A 1KY4A 2JFHA 1YE3A 3LDHA 4LSMA 3Q6IA 4FPXA 3BMCB 4GI2A 5CPFA 1Q7BA 1W73A 2IZZA 2ZQYA 4Q3DA 5DCWA 4BKOA 1ZK2A 1LC3A 1DC4A 3IDSA 3ONDA 4KMSA 1MP0A 1DRUA 4BNJA 3OSUA 3JQ7A 1K6XA 4BV9A 3QA9A 2VNSA 1C0IA 2DLDA 4JXKA 4W82A 1LSSA 2X0IA 3QVTA 1IHXA 3DZJA 3H9JA 1BMDA 3NDJA 2BH9A 3I9KA 2JKVA 3FD8A 4W4TA 4ZQBA 2UDPA 4H16A 3V2UA 2Y68A 1QV6A 1ZMTA 1XIVA 3I9LA 4AJOA 3NGXA 4M49A 2Y1EA 4RPLA 4G81A 2JD2A 2PH3A 4Z9XA 5JNLA 1TB4A 4CQLA 2IRWA 2P2SA 2NADA 1CJCA 4WPGA 2C2YA 2IXAA 1NVMB 4J1SA 3HJAA 1MGOA 2Q4EA 5EINA 3AM3A 3VPGA 3H3FA 3LK7A 3PJFA 1PZHA 4NK5A 1DC6A 3GDOA 4RGBA 3IJPA 3O38A 4MVJA 4XQ9A 3H9QA 3KEQA 3RUDA 3FF4A 5B1YA 2PGDA 3FNHA 4EEXA 4FC7A 3ANNA 1UXGA 3GH3A 3QVOA 2EG9A 2WDZA 4YJFA 3NT2A 3QIVA 1LDYA 4CM9D 3F4LA 2YQ5A 5FEUA 1JWBB 1VSVA 1PGNA 3AK4A 4ROSA 2PFGA 3PHGA 2BI8A 5B12A 1Z45A 2B4TO 3FSRA 4KDFA 3OBBA 3EY4A 5DCYA 3LU1A 3GF4A 3HB4X 2VOJA 4YWJA 2OP1A 3E8XA 4QEDA 2ZB8A 4ZQGA 4F3YA 3I9JA 1WNTA 3TZKA 4A73A 3HZZA 1EMDA 3CMMA 4ESOA 5KJ6A 4IIVA 3HADA 4RZIA 1PSDA 3QWIA 2JAHA 5G0TA 5A04A 3WR5A 2QRJA 4YVFA 4B3HA 3JD1A 3WJAA 3WGOA 3PPIA 1T2CA 4JLWA 2FN7A 1D3AA 4L74A 1NX6A 1H6DA 4B8WA 5TIIA 4BB6A 2OOSA 2DKNA 4Z0HO 4ONEA 4QQRA 3QSGA 2PD6A 4W99A 2ZB7A 4WCFC 4AJNA 5CDGA 1NPDA 2YY7A 3FTPA 3GZNB 4U7WA 3QWHA 2P9EA 2CDAA 1NXQA 3KRTA 4FOOA 1ZKMA 3ZW8A 4DLLA 1VRWA 4ND4A 2NTJA 4CUJA 2EP5A 1T2AA 3ZWOA 4UEKA 4CM8A 1Y81A 3GRPA 5DZSA 5DCUA 4PLFA 2PKQP 2E82A 5I9NA 3UXYA 4L75A 4LISA 3PK0A 1UAYA 1WZEA 3ICPA 3KTDA 1IULA 1UAGA 2CDBA 3W6UA 1Y1PA 1E0DA 4WLNA 2R00A 3FCOA 2IXBA 2BHLA 3RI3A 1V3UA 1B8VA 4Z9YA 2EKLA 4XYMA 5EQDA 4WNCA 2O3RA 3JV7A 1LRKA 2Q46A 5A9RA 2JCVA 3D5TA 1A72A 4HADA 1EK5A 3RBZA 3ZHZA 5L4LA 4KUHA 1KVQA 3DZIA 1VKNA 4G2NA 2Q22A 4TWRA 2NM0A 4YQZA 5I9LA 5JAIA 4OM8A 3WGYA 3OJ0A 1E3WA 4PG5A 2UVDA 4S3MA 3ZV6A 3AY3A 4BMSA 1SO8A 3WYCA 3F5QA 5DBGA 2BFPA 3F46A 3F9IA 4D42A 4A5OA 2NLOA 1Q7GA 4KWIA 1HYGA 2PR2A 3P19A 5JSFA 2O2SA 4L73A 1QR6A 2P9GA 4YAKA 2GDZA 2DBVO 4GSKA 1XSEA 2VQ3A 4MVJP 3SVTA 4QECA 4BKQA 3DMYA 1UZLA 3DFUA 4MVJG 5DN9A 1H0KA 1TT7A 4D0RA 4TZKA 3HE3A 3U09A 1NHGA 3OEWA 5HTOA 4DQVA 1ENYA 4YRDA 3AI3A 2X0JA 4GVLA 3QVWA 4AJ4A 4HFJA 1Q0LA 1GCOA 4AG3A 2J5RA 1TLTA 5A4DA 5A9TA 1DLIA 3S8MA 3U9LA 3Q11A 4QT0A 5A06A 2DVMA 4OQYA 4EGFA 1PEDA 3JQAB 1XU7A 3PXXA 3RJ5A 3RKUA 4PG8A 2PV7A 3TZQA 3WLEA 3M6IA 4E2YA 1ZEJA 4NU6A 3HG7A 3ZU5A 1Z6ZA 2JAPA 4ZRMA 2VZ0A 3QWBA 5ADHA 4PLTA 4BGUA 1HDOA 2YV2A 4BUCA 5CDYA 4EW6A 1B16A 1NVTA 2RH8A 1N7HA 4L0QA 4PGFA 1EK6A 3KEOA 1ID1A 1Y8QA 2CMDA 5ITVA 4LK3A 3LZ6A 4DYDA 3ONFA 4FGSA 4II3A 4ZQFA 1ZCJA 3AJRA 2A9FA 3DBLB 1Z74A 4TKMA 1LXCA 3RCBA 3DQPA 1QSGA 4OOFA 3DONA 5KJEA 1HWYA 1BXGB 3BMNB 3GGGA 4CM4A 1X7DA 2W2LD 4TRJA 4GX5A 3RUEA 2AEFA 1E3JA 5I8ZA 5TT1A 3RFVA 1I8TA 3GC6A 4DBZA 5LDGA 1V35A 4XX0A 1F14A 3OP4A 4IDDA 1A4UA 3QHAA 3BHJA 2Y1FA 1GQQA 4O5OA 5ICSA 4KQWA 2NNLD 4HNHA 3VH3A 4XRGA 3DOCA 4HKTA 3FR8A 1Q0QA 4RPHA 4WCFA 4YJGB 3VHRA 5DF1A 4YJDA 1C1DA 1ZXBA 3OA2A 1GYPA 3UF0A 4YRBA 4IQ8A 1X15A 2NU8A 4NFSA 3EK2A 4C4OA 3VTFA 1ZH8A 2B0JA 4WUVA 3WBFA 4B4WA 3KYDA 4Z9FA 4R1UA 1A9ZA 2A4KA 1O9BA 3KBOA 1KYQA 4I5GA 3RVDA 4LCJA 4MO2A 4XR9A 4UVDA 2RIRA 1E77A 3FNEA 2YFHA 3T7EA 4AVYA 5BT9A 4A2CA 2FZEA 1HEUA 3H65A 5THKA 1H2BA 3GUYA 1NAHA 4FCCA 4DVJA 4XDYA 2BMAA 2W4QA 4PZCA 4FJ2A 3E5MA 5FFFA 1NFFA 4YEDA 4AJIA 2RH4A 2NU6A 2VYVD 4KQXA 4PFJA 4LVCA 1U1IA 4GVXA 4HFNA 3W8EA 1QYVA 2ZCUA 3C1AA 4GWKA 4RDHA 4E32A 4RJTA 5EERA 4TZTA 4DIOA 1H94A 1KVRA 1ZK4A 2WE7A 2EWMA 4LCEA 5AYVA 5G4LA 3VDQA 3RWBA 3IMFA 4D3FA 2VHVA 2ZATA 3UCXA 2GPTA 3INRA 3VC7A 4DXHA 5BSFA 4CMHA 2EJVA 1T4DA 1UZNA 3G1TA 4ND3A 3OQBA 2DTEA 4FFOA 3WYBA 5F1KA 5IDXA 1ONPA 3I1JA 1UXKA 1PGPA 1V9LA 4OGWA 3CIFA 1GQ2A 1SMKA 4GX0A 5KNLA 4BO2A 4M89A 2B83A 3PVZA 1NQAO 1TT5A 2C2XA 3P2YA 1O8CA 5G2OA 4OXNA 2C82A 3I52A 1P1RA 1X13A 1IYZA 1LDBA 2GN6A 2GRAA 5G0SA 1IE3A 2X4GA 4R4JA 2FR0A 4LW8A 2QHXA 3I23A 3WX0A 1NNUA 1E92A 1PTJA 2AHRA 3HN2A 3IP1A 4A26A 1E3IA 2HQ1A 4J7CA 1E1NA 1VJTA 3CH6A 4D45A 1RM3A 4R3NA 2XOXA 5LC1A 1DFIA 3CSDA 3KOUA 2P4QA 5HS6A 1HE3A 3U49A 1IB6A 1FF9A 3VVBA 4A10A 2BGMA 2O48X 3CPSA 2GCGA 3A9WA 4Q39A 2NU9A 1C0LA 1ORRA 2DFVA 4H3VA 1CQJA 2HMTA 3BXXA 4D44A 4CUKA 2YDYA 1TA4A 3H5RA 4ZU3A 4YT8A 2SCUA 4N7RA 3PIDA 4X54A 3BIOA 5IZ4A 3JYLA 2F00A 2W90A 2X9NA 3KLMX 3LQFA 3OICA 5BQFA 1DB3A 4CMGA 5DNAA 3GA0A 4BNMA 4WE3A 1SB9A 2GN4A 5BSHA 3ZHBA 3GGOA 3C3XA 2JJYA 2HLPA 2VRCD 4OL9A 2EXXA 2Q3EA 1P45A 1KS9A 3LF2A 3QJ5A 3K6JA 1K5HA 1H6BA 4YTEA 1H6AA 2O2YA 1NPYA 4BGVA 3W4KA 4BNIA 4CLEA 1DOHA 1DFHA 4NK4A 3C7DB 3ZWYA 4CR7A 2XPCA 4YJHB 5L3ZA 3H2ZA 1PQUA 5DOVA 4DBVO 1T2EA 2Q1WA 5C7LO 3WS7A 4CJXA 5KVVA 4R68A 1XQ1A 5M6DA 1ARZA 4RZHA 3BMQA 1B8PA 4BNHA 3PZBA 1ADBA 4CMJA 4NBRA 1N5DA 2IZ0A 7ADHA 2I76A 1R4MB 4IM7A 4YT5A 4D3DA 3ANLA 1HDRA 3B1JA 2X9GA 2NVUB 1ISJA 1PJTA 1NP3A 3HUDA 1DAPA 5A3VA 4CMBA 5FI3A 1BVRA 2P5UA 2DTDA 3ZNPA 4E6PA 4R51A 1JW9B 3OECA 1XYGA 3C8MA 3WFJA 1F8GA 1ENOA 2HMWA 1UDAA 1W6UA 1NPTO 3QQPA 1ISIA 5BSEA 2W2LA 3BYZA 4ZGWA 2D5CA 2PY6A 3VZQA 1VKOA 3FWZA 4DLAA 3EDMA 1ZSYA 4E5KA 1I10A 3VZRA 3WTCA 5MGBA 3NT5A 1BG6A 1CIVA 5GZ3A 1UUFA 3B6ZA 3LYLA 4M54A 2H6EA 2Z5LA 1IHYA 3TQHA 1XKQA 3L07A 4RVGA 4PZEA 3D4OA 1PJBA 4P4NA 1YQGA 3HB5X 3E82A 1UDCA 1EQ2A 1PX0A 2AMFA 8LDHA 4E12A 1ISFA 3CUKA 4HBGA 2Y05A 1JTVA 4CLRA 3JQGA 4CMEC 1I24A 3PJEA 3ZWWA 1NVGA 2Y99A 1SAYA 2YQ4A 4ID9A 1XR3A 2FMUA 1B3BA 1YL5A 2X9VA 1M6WA 2PWZA 2V65A 2WWRA 5AXCA 3VH1A 3A28A 4II2A 1GR0A 4PLYA 3VPSA 3GPIA 1E6WA 4RLHA 1WAMA 2NSDA 1YDWA 2UUOA 1E3SA 1YRLA 3ROPA 1T4BA 1M67A 1E5LA 4M87A 3ZV4A 1U8FO 4TRRA 1P1IA 1GV1A 1NTOA 2C5AA 4R1NA 2PZMA 4UUPA 4J2HA 3UFXA 5KJCA 3ETDA 4LMRA 2PK3A 2ZIZA 3QP9A 4Q3NA 5L7YA 4J49A 5T67A 3DC2A 2DT5A 3L6OO 2VYVA 4GQAA 3EVNA 1Y5RA 3U4IA 1U4OA 4CV2A 1FDUA 1D1SA 3ZNNA 3JQ8A 1P1HA 1GV0A 1E1MA 2O4UX 3S2FA 5A05A 5JS6A 3JQAD 1MX3A 3JQDA 4IDAA 4E30A 4MKRA 1V8BA 4WLFA 3G0OA 1HDXA 4NBUA 1H9AA 4KOAA 1A7KA 3S2GA 3S2EA 3IKTA 4XWYA 2PKQO 3OETA 4EUHA 5DOZA 3WWYA 3BA1A 4WEOA 4ND1A 4D7AA 4DC0A 3DMTC 4XYLA 4CLOA 3STHA 3GOHA 5FF9A 3AI1A 1C14A 3VH4A 1DXYA 1T26A 4E3ZA 1LLUA 4YQYA 2OUIA 4GGPA 3D4NA 1YONA 4XGIA 3UUWA 2Q1SA 3BMCA 1KERA 2OORA 3AW9A 5ER6A 2VHZA 4BGIA 1I2BA 3N74A 5IXYA 2CNBA 3T4XA 1J49A 2EGHA 3F4BA 3E6AA 4QX6A 4M8SA 3SJUA 3A4VA 3UGKA 1QLHA 1O89A 4EZBA 2Z1NA 5HM8A 3IOYA 1W4ZA 2C59A 2AG5A 2FPPA 3NT4A 1YQDA 1DEHA 3WQQA 2Y1CA 3OFSA 3S55A 3DOOA 3GPDG 2X58A 4HY3A 1OFGA 3O03A 3PP8A 3ZV5A 3E9MA 2DC1A 3GN1A 3VVCA 3U4CA 1NFQA 3TNLA 3BMOA 1R0KA 5JXWA 1N9GB 2CUKA 2ZTLA 3UN1A 3UVEA 4PG4A 1N1EA 1DIRA 1YL7A 2E48A 4MP3A 2YFQA 1E7WA 4IZHA 3GEDA 3QY9A 1G0NA 3X2EA 2G17A 1RJWA 2O50A 1UP4A 4U6QA 4B3JA 5EJ2A 2C07A 4E33A 1NWHA 5L4NA 1JU9A 2EJWA 3PFWO 1K89A 1N7GA 4MJLA 4J1NA 1D7OA 2FP4A 1GFSA 2J3IA 1GYRA 3NTOA 3FHLA 4BNYA 1VL0A 4M1QA 3O26A 2R6JA 3AUUA 3PZRA 2EV9A 3PQDA 4RF2A 3WSWA 4BNKA 4D41A 5TS3A 4FW8A 4YB8A 5CEEA 1DHTA 4O0LA 4A27A 3R3JA 1ISMA 4JJGA 4OKNA 1QP8A 3DBRB 4QO7A 4H7PA 3H9EO 1D8AA 3GDFA 4BNUA 1M66A 4DC1A 4K26A 2AW5A 5DULA 3RUIA 3L4SO 3D3EA 4CMEA 4TKLA 4CR6A 2UUPA 2VUTA 4KZPA 4EUEA 1ZK3A 1FDWA 1PZEA 4Y8VA 1RM0A 5C5IA 1KC3A 2CF6A 1YWGO 3DTYA 1I2ZA 3PRJA 2Y93A 1QYCA 2Y0EA 3HFGA 4R1TA 4WLUA 3KV3O 1LRJA 1LU9A 1E1KA 2EKQA 3GGPA 3IUSA 4OHUA 4JBIA 4J1TA 3ULKA 5IDWA 2Q1UA 2YZ7A 3W8DA 5L9AA 2D59A 4WLEA 3EZYA 5IFLA 1E7SA 2GYYA 3PHIA 2B37A 3LC1O 1VE9A 2YJZA 3I9NA 2DU8A 2QRKA 2X0RA 1Y8RA 1R66A 3ZGYA 2QX7A 3A06A 2DPHA 1EEHA 4KTTE 2D5AA 5ENVA 3H8VA 1YB5A 3F47A 2GO1A 1EFLA 3EC7A 2AA3A 3TFOA 1QYXA 4OQZA 5JCJD 3GQVA 3OHSX 2YHUA 3GVPA 4GGOA 4BO1A 3TF5A 4B7CA 1TEHA 4HXYA 5KJFA 5IF3A 3JD3A 4QTZA 4RVUA 1P1KA 3K73O 3D3WB 1LLDA 1PL7A 3RFTA 1X0VA 3M2TA 2RHRA 1HZJA 5JBIA 2GF2A 1OZAA 1AHHA 2OBYA 4NQZA 1K2WA 4BKPA 3CINA 4FFPA 3AM5A 2XF8A 1JKJA 4HNGA 4TMFA 2FRDA 1KETA 4U8GA 4YACA 3GVCA 4TSKA 4XRRA 3WJ7A 3RUFA 3IKVA 1ZJYA 2GERA
chains in the Genus database with same CATH superfamily
3G2LA 3CX3A 4NCJA 3O4FA 4XWTA 1PFVA 2OLJA 1E0SA 3EN0A 4BMDA 1NWCA 1NP7A 1A77A 4YQFA 3HI4A 3ILHA 3PDIB 4ND6A 1OLSB 2Q2WA 2WA2A 3OQPA 2DQ4A 4O02B 4OQDA 3TLBA 1E9AA 1GFZA 1Z4PX 3AFNA 1DC3A 1L8LA 4UUOA 4XIYA 1YA6A 3O3NB 2I9KA 3G2JA 3QNUA 3W4IA 1C3OA 3NEPX 3P9IA 3S28A 2FSSA 2QZZA 1GPNA 4BPBA 4AMBA 1NVXQ 1F9EA 2XXBA 4J4TA 4XEHA 3W6PA 4EW2A 3HBFA 4A9AA 5HXAA 3I0MA 2HQBA 1MJ5A 1JWLA 3LC7O 1HYBA 3KTAA 3CLSC 3DA8A 3JYPA 3GXBA 1BA3A 3VR5D 3NC1C 2CLFB 4AZ0B 2BGUA 3EUWA 1CY7A 5KOJB 1SCUA 4IS2A 4X1YA 3FWHA 4RETA 4O2AB 3I01M 4TLCA 2QTWB 4MGIR 1DL5A 4KFCA 1QPGA 3GELA 1O6BA 4CTOA 5BWOA 1FEZA 5L7WA 1FFBA 4B3BA 2CMHA 5DSXA 1AB5A 2REXB 2XWPA 3G6KA 1BGVA 1W59A 4RK0A 4EFNA 4KYTA 1HUQA 3HU3A 4IFIA 2I9PA 2BJHA 2L0XA 5J5VA 1JKMA 4R2LA 3AEQB 3OEED 4HQFA 5GJWC 4AYTA 1GZDA 3NTXA 3FTCA 2P69A 2PANA 2DE0X 1EFPA 3U1TA 3SBDA 2DETA 2DJIA 3A6FA 2BGIA 3QU5A 5JDCC 4BS9A 5ICMA 4JUFA 1WKBA 3NJ8A 5LZ7A 4K1LA 3R9IA 1WR8A 2IITA 2QT0A 3F5MA 5AJHA 3I1IA 3DMGA 5TEWA 3W3ZB 2WJIA 1T9GS 2W6ZA 4IGAA 2NUAA 1QMIA 2BFOA 1E89A 3PHBE 3RKRA 2LR0A 1FJ2A 3D2BA 3TAXA 4B4VA 3RBVA 5FTLA 1B93A 1NW8A 1VGQA 1YGYA 4OHMA 4WA7A 4FB5A 4YUAA 1ONNA 3ST7A 1VHJA 3KXKA 1DQRA 1NJ8A 2J3KA 3UFBA 4EYEA 2XE8A 3PQ3A 3QHPA 2GM5A 1UKVY 3ASVA 4QPZA 1I0ZA 5CVCA 1T25A 2FPKA 3K0AB 4BLVA 4IDCA 4IUCS 5DIFA 4OD0A 1K4YA 3TIXB 2G0TA 1O94C 4GH5A 3DPUA 3L4KA 2DPGA 4MVJE 1J99A 2ZSHA 2W2KA 1TU3A 3NAQA 1QLJA 3F8SA 3N0WA 4QE3A 4PBTA 4BE4A 3II6X 3RVKA 1K5PA 4WZZA 1DRWA 2GM9A 3ZHCA 2XNJA 1OBFO 2EERA 4IDOA 4Q1DA 3AU9A 3MJHA 4D3ZA 3JARB 1KY3A 2M2IA 4YPOA 1H1LA 5CW1A 3HNPA 3M6AA 2C20A 1I7CB 2GUGA 3TOXA 3OPMA 3K9CA 5FPKA 1DE0A 3A1WA 3DVLA 5JZMA 5K4HA 3B1XA 4H3HB 1WPGA 2I8CA 3UH0A 3KFVA 1PT6A 5BNIA 1R3UA 2O1SA 2OV8A 3HCOA 1GPH1 2UZ3A 4PZ0A 3K0EA 5EP2A 5CB4A 1FBTA 1WV1A 4W5HA 4A2QA 5UKDA 3GAFA 4FKBA 3BC1A 2QJFA 4M1ZA 5BO5A 1UBOS 3TQRA 1XTUA 3WIBA 5C81A 5KVCA 2BM9A 2QX8A 2C98A 2F62A 2IV2X 1PKEA 1YZHA 2QTFA 5KYKA 1GPJA 2CUTA 2QW8A 4JC4A 5DMXA 1RWKA 2OG2A 3T61A 2HIHA 3GWGA 1QYWA 3QGMA 4XUCA 2ZW9A 1FYFA 2WSLA 3TPCA 5KCZA 3G0HA 3AF0A 1MAVA 1VZ2A 2J67A 1UC5B 3AKZA 3JSAA 1UBGA 2LRHA 1V43A 3NYIA 5JSQA 4EPXA 4CIXA 3KDAA 1MC5A 3MUEA 1JX6A 1AKNA 1MTZA 3CUWA 3FPJA 2FWJA 2BKEA 2OCDA 1GYQA 2F55A 4A2WA 3N28A 2R44A 3G7UA 1C9NA 1NULA 2IYPA 4UBJA 1YIOA 3BBPA 5GOTA 2DXIA 2HWWA 1QVAA 2GBIA 4ZEVA 3VO8A 1N0IA 1XEFA 4HQ6A 3RW9A 2IXFA 4UMDA 2QR3A 3OM9A 4IJKA 2VJYA 4DSNA 3MLBA 2RD2A 5FADA 1WCXA 1OZFA 2A1TS 1TJ3A 4LYJA 4Y9TA 2CL7X 3KVOA 4FHCA 3NBMA 4UOEA 1RZRA 3V8VA 2B4QA 2FR8C 3OQ6A 5CDFE 1FA9A 1RD4A 2CCJA 1FP6A 1US8B 5BV0A 3PJGA 1ZRSA 2FPRA 1BMFA 4HB0A 1QFMA 3DMHA 3ZDZB 5BW8A 5A4FS 3T1TA 3IQXA 3IPCA 2P6PA 3INNA 4B7ZA 5T8KC 3D6HA 3GFGA 3PWSA 4MDHA 4LJRA 3D8SA 1OBCA 2XXJA 1FOEB 4YJ3A 3LS2A 2B4RO 2GI4A 1GNTA 4UMVA 1E2MA 1R9GA 3GMIA 5FUXA 3BN3A 3L8GA 1WY7A 4UNRA 1XQXA 4D9GA 1X92A 1UC9A 1BDHA 3MHTA 4LJ7A 2XKAA 1Y6RA 1BVYF 3ECAA 1JMYA 3Q7RA 4WNAB 2WIBA 4CQMB 4I9FA 4PSAA 1ATZA 1OYYA 2R62A 1JMVA 5HUJA 2WIGA 2FUG1 5AKGA 2WD7A 4ZI7F 1FRVA 5I7FA 1RWPA 2YRFA 1KI1A 4NBNA 4ND5A 4LFBB 1PR1A 1Y5LA 1XTVA 2R87A 3C5WP 4AULA 3GLFE 1L7EA 1U80A 1B43A 2QXYA 2JFUA 2PD4A 1JL3A 2EJUA 2YWJA 2HA0A 1RBZA 3HKCA 1XV5A 1QFJA 3EGCA 5CJJA 4BVLA 3T06B 2Q99A 1WXDA 2H52A 3KAKA 2Q21A 3M81A 2J6BA 3Q8KA 3S1SA 1K63A 2PSHA 4REOA 4UU1A 4ZEXA 3BH6A 1OIWA 3GJTA 2WP8J 3AR6A 4UZFA 3JRWA 4CIAA 4F6CA 3SKYA 1AK1A 2W70A 3AFGA 4MWZA 4MQ5A 1GUAA 4Z3KA 3S6JA 4L8GA 5KC9A 1KYYA 1NC3A 2I2WA 2C5FA 4GPIB 5IYZB 2LIPA 4WERA 3WRWA 4AB1A 3EW9A 4A16A 5C7IO 3IEMA 1QHNA 3PJRA 1EE2A 4Q9KA 2JARA 2YDXA 5BSUA 4ETWA 1GZUA 3IGFA 4MB6A 4EI7A 5CBPA 3F2IA 3LUGA 2ECOA 1UT5A 2ROQA 4PQRA 1LDGA 2NO7A 4IW3B 4N40A 4N49A 3E9QA 3IH5A 2RBGA 2WTBA 3VR4D 4ZZ1A 1FSPA 1YQTA 4MP6A 2QD1A 5HSGA 4R5MA 1VPDA 2RH9B 3MCAA 3ZX5A 3LHSA 2XADA 3HUTA 3ZWMA 1V5WA 4BRWA 3IV9A 1X2BA 1L4BA 1NVKA 4MIYA 3IIKA 3L7BA 5IBPA 1ANKA 4K2HA 3IQGX 4EAAA 2M6SA 1LI7A 1CVIA 1P9OA 2GGSA 3E8MA 1EUCB 3L82B 4JODA 4OP2A 3K30A 2IVZA 2HDHA 2P9QA 4D8VA 4AKSA 4KQ1A 1VB3A 2ZSFA 3Q3HA 3MTDA 1F8YA 1HE8B 4CM4B 3PPXA 2TMGA 3L1JA 1U3UA 5CB6A 4DC9A 1A9SA 5BVHA 3EFBA 4WY5A 2CXSA 4EH1A 1I36A 3FGNA 4J7AA 4CKBB 5HUQA 1SVSA 2OBXA 3LCUA 2P3LA 2J4FA 4M0KA 4I4LA 2ZXUA 5MN5A 5BR4A 4EO9A 4FMDB 5AMXA 2ZYGA 2GN2A 3V4RA 1OH6A 2YYYA 2P40A 4QDTA 4BB9A 2WRZA 3E03A 3FR7A 5GZ6A 3LLSA 3RS4A 3VC3A 1DIHA 4W6ZA 5AI8A 1SCBA 2VJPA 2ZK7A 4V39A 2D0PB 5AW9A 3UXEA 5CFLA 1Q74A 5JRZA 1SELA 4TV9B 4AF7A 4R9RA 1C3EA 1ODTC 4D02A 1SRQA 1NKTA 1KQPA 1MF7A 5HRUA 5TQ0A 5DHFA 4KI0A 2P65A 1JF8A 3I28A 1KJ8A 3QBVA 4Q21A 4EY7A 2QUAA 3GJSA 4KYVA 3I2KA 5G4KA 3CLVA 3BWMA 1SN7A 1J20A 2XB9A 4AUMA 1XQ6A 1B6RA 1S89A 1XXHB 5ITSA 2Q3MA 3EVTA 3PNYA 3EIQA 2TSYB 1D04A 3GBPA 2Z4TA 2ZRPA 1SHKA 4BLSA 1LBQA 1PJQA 5TR9A 2ADOA 1A0OA 1JDTA 3GJ8A 5I4CA 2OCKA 5DTJA 4RTPA 4L6AA 3JWJA 3OWHA 1II8B 5DTIA 3U3MA 2WKRA 4ZVQA 2R751 1EVJA 3RT1A 5GIPE 3KT8A 5F7JA 3IAFA 5CDTA 1E3EA 4PO8A 2WVGA 4MO9A 2JLAA 4EECA 4RVNA 1C80A 1H5UA 2NUTA 1P4RA 4Z1MA 1E98A 2GO7A 4J0QA 2D7CA 4K8OA 4AY5A 1A9QA 3UMRA 4TVOA 2FJUA 2O3UA 4MQFA 2BGWA 3RTAA 5AM1A 1NXPA 2DUUA 1T1RA 4LJSA 1IHDA 1S2OA 3E22A 1TC2A 2OZPA 5COQA 1WBJB 1Y9EA 3G0GA 5LQSA 5B5SA 1PK8A 3I61A 2P2CA 1B1CA 1DWPA 1XQYA 3BE6A 3O4IA 1XEAA 5C8XA 1AQIA 4BV8A 2RCNA 5E3JA 1V3VA 1XQ9A 2WB2A 4HH4A 5CM8B 1G42A 3DHEA 3LT0A 5CXSA 3ME5A 3S2SA 4ZU6X 4BQNA 1YU9A 4Y2XA 5DW0A 1N57A 1NUTA 4MR7A 2AF4C 4N5NA 3IUEA 4BZXA 1D2CA 3NX4A 4PHCA 5E1BA 1WLYA 3N75A 4XFJA 4H1VA 4YROA 4DLKA 3H0EA 1JEOA 3A4YA 1HQCA 1GT91 5I3CA 1BFKA 1HL3A 1NQXA 2O7QA 1NQ5A 1IPHA 1J0CA 1DJOA 4HEA1 3TTXA 5I7EA 5MN4A 4LXXA 4I8XA 2ZI7A 4MWDA 4PWZA 1GPLA 2AXPA 3OH8A 5DGHA 4RL6A 2GD2A 2HDOA 3H97A 3VHLB 4EG3A 2J7PD 1SCAA 5K0JA 4IRUB 1XD2B 1KVSA 4KPUA 4LOIA 1UJ6A 1N7IA 3TW3A 5H4GA 2EU8A 3WYAA 1X8XA 2E3JA 1S6YA 4PZDA 3ZCXA 3FOWA 4XD7A 4LV6A 2DWCA 4GRAA 1ST3A 2HKIA 3HDVA 1Z8HA 3AZQA 3KE8A 1W0JA 1C7FA 5G0WA 5FWYA 1QU3A 1IQPA 2D0IA 2O4CA 2BLLA 1XZDA 2O57A 4ME6A 1KI6A 2WM9B 1NHWA 1H2RS 1DX9A 2GCPA 2WW8A 4I5EA 5EMHA 3K53A 4A8JB 2O8FB 2IYFA 1X39A 4LV5B 3ZQKA 3RIMA 2KE5A 3OKAA 1ADGA 4YMVA 3KIPA 1KEVA 3T0GA 1W48A 4N47A 1JFTA 3ASUA 1WOMA 3KVYA 5L4SA 1RIIA 3JVUA 2AYYA 4ZWNA 2VPIA 5EVCA 4D56A 3FMOB 3ANMA 1WCIB 2O8DA 4IJWA 3CUEF 3ZBUA 2RARA 3F71A 1PYOA 4WKNA 5M3BA 5I7VA 3PC8A 3R9XB 2C5EA 2FZGA 3K92A 1YS9A 1LS1A 1CEQA 3M70A 5BOSB 1UBHS 4JB0A 3ROQA 4RF5A 4YIHA 1WSAA 3N2LA 3TSWA 1JECA 3BDVA 2JJ1A 1CQJB 2AZXA 2GCIA 2HA4A 4Z4IA 4YRGA 5JD5A 4IOJA 3SZ3A 3HJFA 4PICA 1JI3A 1LGYA 1XPJA 3C6MA 1Z38A 4MIEA 5J43A 1N1GA 3IR5A 1J21A 2UVPB 3M1YA 3MJEA 1B0ZA 1V5GA 3ZHVA 5IZCC 2P62A 2H7VA 2XYPA 3B78A 2VS1A 4K9LA 3E18A 1SD5A 4PU0A 4O5AA 1IUOA 2QTMA 2JGKA 3MGGA 4OFXA 3GEHA 2D1TA 1JSRA 1U5BA 2BTQA 2EAUA 2QMQA 3H7IA 4IG9A 1U81A 4XVHA 3GCDA 3TSCA 2ZJ4A 3JD0A 4DYVA 1BDIA 2ECKA 1KJYA 2FSFA 2GILA 2WPDA 3IAHA 3RSHA 5LNK6 1HC7A 1ECPA 3MIIA 4I6GA 5HGXA 1V7CA 1W2HA 1G21E 1HX7A 4B83A 1G66A 1S3SA 2UV8A 4GSYA 4BHTA 1NXWA 5IWAB 4MITA 3HXKA 1DWOA 2Z98A 4Q18A 2OM2A 1KMQA 2JD0A 4G24A 3GLGE 5FPQA 5DHSA 3NP9A 2R96A 1SBTA 9ATCA 1QK4A 1IWOA 1ULUA 4KXVA 4JBWA 4E21A 2ZRFA 2JFBA 1NE7A 5ECDA 5KAMA 1DOAA 1GUDA 1E9FA 5GTDA 2H18A 2XA9A 5FI5A 5JPIA 4ARBA 4QUKA 2YYAA 3ZDEA 3U7EB 1EU1A 3GA7A 1SUDA 4IF6A 3I8SA 2C2KA 4UTRA 2AFIE 1J2TA 1ETUA 2HXGA 5J5AA 1YF3A 1QE3A 4HAWA 4IIUA 3E0QA 1WEHA 3A37A 2G8LA 2CUNA 3I2HA 3GFQA 4YCCA 1A8IA 3ZBQA 1BXKA 3K8YA 4JGIA 4ZAZA 4MUBA 2A8YA 2ZWOA 3H2HA 2V7PA 2Z9DA 5DSZA 2YASA 2PCLA 3AHFA 4EYSA 1BVUA 3PJDA 2HMVA 2ISSD 4H7HA 4LYAA 4NJMA 4NMLA 3AR7A 4NENA 2XWBF 4QOEA 5IAKA 2O6LA 3RUAA 4G4JA 3ZD6A 1XZBA 1CUJA 4OA5A 3OTQA 4KPEC 1M2EA 2DEUA 5L40A 3TE6A 2JFNA 4D8YA 2CNNA 5CHYA 2AIRA 1OAKA 3A70A 3IVCA 2VPXA 4MZDA 4X6YA 1AQLA 3WYEA 2Q5CA 1HMPA 2ZJ8A 2IE8A 3NHJA 2FSPA 3I73A 4QUJA 2G76A 4FQ7A 2BZ1A 5EZ5A 3VH2A 4BNTA 2B2XA 4F8YA 3H1PA 2HTEA 2J3QA 5DWQA 3PTZA 4JC5A 2A0FA 2X40A 3S7ZA 1U7TA 1OV4A 4ZI7A 1KH3A 1SZPA 1WW8A 2FUNB 3TFQA 5D7BA 5A62A 4UXHA 2VFAA 1NYTA 2JDID 1ZIOA 1W4AA 2QTTA 2V4MA 1XDUA 2IYSA 4FI3C 2OG1A 3RK1A 4ZDJA 1XQVA 5IVPA 4PIVA 3L1KA 1THZA 3OJWA 3ZDBA 2P0AA 3IVRA 2O07A 2Q1TA 2J0QA 4DLPA 2WC1A 2QS9A 1H5NA 1YBVA 2CHQA 4HQLA 1OC2A 4AJPA 2AOUA 4PNHA 1U2QA 1W88B 3PRYA 4HVTA 4QUBA 2GFQA 3NBFA 3CFYA 4QO8A 3RREA 2HM7A 3B36A 1RYMA 1N8KA 2QTCA 3QA3E 1QYIA 3C45A 1DKPA 3I12A 3P4UA 2CFCA 2IEGA 3C3WA 821PA 3SZGA 2PTGA 1C30B 4FFSA 4D9IA 2EW1A 2FLVA 2W2TA 1P1BA 2XBMA 4DPMA 1GKUB 1DXHA 5B7NA 4DDMA 1XZEA 4IDEA 2GAOA 4XEUA 4OOEA 1QR2A 2I4NA 2JKYA 2P35A 4G26A 3I6ZA 5C4IA 1FL9A 1II9A 3V1KA 1FX0A 3GLSA 5KVAA 1EZ1A 4DDUA 2LKDA 2E4VA 4RHXA 2Y92A 4PSKA 1M1NA 3VU1A 2WIJA 4E51A 3LMKA 3EZGA 4Y2TA 1XELA 4JJZA 3UFXB 1GPUA 4C2UA 4WZBB 3UT0A 3ZGVA 1YA4A 2JH3A 1USWA 3S2IA 4MRRA 3RVRA 1FK8A 3W1VA 1FYXA 4KO8A 2HPHA 2IODA 4LJ8A 2ZUUA 2AJ8A 4TUYA 2ZYDA 3EW7A 3D6VA 4ENWA 5CYOA 3A6EA 1HDEA 2P8SA 1Q2XA 3LOPA 3PRHA 5KDLA 2FEWB 3K4QA 4IIXA 5C7OO 2VF4X 1Y9AA 5BN4A 3KZKA 2NTNA 3OUTA 3RU3A 3UG7A 1T1JA 2GH1A 3LT5A 4IBOA 4BZQA 4CT4B 1ZJ6A 3O4HA 2CNWD 1MGPA 3TXAA 5K8LA 4PW0A 3BTOA 4WHMA 1PEKE 2DTXA 3C6ZA 5DK6A 3FIUA 3QUQA 4AX8A 4CM1A 4Z6KA 1UBFA 4NMXB 3CR7A 1GARA 2QAIA 1SM4A 3NKLA 1IZYA 3DXFA 3TN7A 3L84A 5LMNB 2WFAA 3NWBA 1ZJJA 1EJ2A 4AMYA 1AU9A 3OU7A 4MAFA 4B6QA 2F4NA 3X44A 3DDNA 4O89A 3EQ9A 3WGMA 2BSAA 2VIIA 3HKBB 1IXRC 1EX7A 1LS6A 1TO1E 3D8HA 3WNQA 4XA8A 4DWOA 3L40A 4NRDA 3ZUGA 4EG1A 1DAIA 2V1XA 4A0QA 3OO1A 4OXXA 1I32A 1GCAA 3RARA 1LK7A 3VVLA 5KBYA 3KUDA 2G8NA 4YP5A 1GTRA 5D3MB 4K5QA 4JA2A 2IHVA 1A71A 5L51A 1BEUB 4PYOA 3UBMA 2OCPA 4YPFA 1T6BY 4HDNA 2OYSA 3FDZA 4LOLA 4PLVA 1W5AA 4Q9AA 2LNDA 3I0NA 1DBPA 4MSUA 2WHPA 4QDZA 2JA2A 3GB9A 4EENA 1IZ9A 3LE8A 2FPPB 2ZZKA 1AHPA 1LSJA 2I3BA 1IM2A 3EPRA 1CPYA 1ZOSA 2O3SA 4JUCA 4EO7A 3G2KA 2VBCA 3O8OA 4DHWA 3PNOA 3ETNA 3NBQA 2EDCA 4MHSA 3TPFA 1RHJA 4FGWA 3H87A 4DJTA 1QF6A 1O2DA 3MZ0A 1DBRA 3PNSA 3BMOB 3R7AA 4D96A 2QLLA 2R5WA 5FOVA 5IG2A 3W5AA 1TPYA 3S5JA 4BNNA 1N5MA 1HLPA 5HA5A 4QGFA 5I7SA 2R7LA 3VNRA 3D6UA 4IIFA 1ZNZA 4IVNA 2FFAA 1PJLA 3OHPA 3DMTA 1L5KA 5DHTA 3GCGA 4L4YA 5T4BA 3LPLA 3OPYA 3BIXA 4LRTB 4G8BA 1Z2CA 2A5LA 4WDRA 1P4AA 2HRCA 5HIMA 4NFYA 1ABEA 3LT4A 1TQ4A 2AC7A 1E64A 3UT5A 4JSYA 3EVFA 1I1HA 1LPPA 2AWOA 2OSVA 4Q9JA 3AIIA 4UCQA 4DB2A 2ZWAA 2Q28A 1M5RA 3KUUA 2UU9B 3W0LB 4O2RA 3EPAB 5B1EA 2QQ5A 2HF2A 2ZTUA 1ZGAA 1I3KA 2R97A 1N2EA 4EL0A 3UATA 5A1JA 3VA7A 2RKOA 3UBTA 1E6UA 1TIKA 2P11A 3P0HA 2Y71A 1KEPA 1D9ZA 2WABA 1B4DA 1H1TA 2CJXA 2YXDA 4PQFA 3X1JA 2IHTA 2QW0X 4IXDA 3ITKA 1PQWA 4Z2YA 2YHSA 1ZSVA 5H82A 2IU4A 1V3TA 2NO0A 2JIRA 4EA7A 1H2XA 1N4AA 5ARCA 2ZPTX 2V5VA 2XUOA 1ZD1A 4RANA 2WAAA 4BRSA 5CA0F 4ICIA 4CL2A 3RUCA 1PJCA 1PJ3A 2O2JA 3E9NA 5E38A 2P2DA 5EE9A 1IY8A 1FMLA 4KFTA 2BKAA 3V1YA 1M73E 2C8VA 4IQGA 2WTNA 3QXCA 3WB0A 1RMYA 4R98A 4U39A 1U1DA 1PLKA 2NTYC 3ZDFA 3EFOA 1M75A 4FZ3A 2P9HA 1N6LA 1JLHA 2B3DA 3OD1A 5U4QA 3DPSA 1GY8A 3TYXA 5BVGA 3WY9A 2R85A 3R5KA 5BY2A 3DMNA 4JOSA 1N1MA 3CVOA 3DL0A 3U48A 1SNYA 1MJHA 5LVAA 4PS1A 3RQSA 5CIQA 1HSZA 1V5IA 3CGGA 5FLYA 1I51A 3IKLA 4YCBA 5HEKA 5HGJA 3ZV3A 1YI1A 4HDCA 3AEKB 3KHTA 4U3JB 3WLNA 4NJEA 1U3WA 3KP1A 1IZZA 1FLVA 2ZJFA 3QYAA 4HDQB 1U2RA 4J3FA 4PCLA 3UMFA 3FUUA 4NI5A 3U9TA 2JFFA 2QYSA 2FXVA 3DBLA 3D0RA 1UKEA 3EC1A 3RC1A 1TYEB 1CY2A 1TRKA 4GPAA 1HRKA 1WDKA 4ZVSA 1TMGE 5M2QA 4J2TA 4DCJA 3A3KA 1EI9A 3B1ZA 4HAYA 5IAOA 4RQTA 4YT4A 4W9NC 2NYVA 3UMVA 2HU2A 1B15A 3U3ZA 4B4OA 4BN4A 2EJCA 2GLXA 3K05A 2B2CA 5HE9A 2OTCA 1YR8A 1RRFA 1X9GA 2BF4A 2UYYA 2ZZNA 2AE1A 2X0NA 4DREA 1EDOA 2FEKA 4HEHA 4E2XA 5KYWB 3A25A 3GRKA 1QQ6A 2E18A 3EG5A 3QFCA 3PQ7A 5ESWA 1C9DB 4ZAWA 3VFDA 4DIOA 5IANA 1UMCA 1Z83A 1F8XA 4LJ6A 4JI1B 3DOUA 1YU6A 2NIPA 3A11A 3D0KA 5I6DA 1AQNA 2UYOA 3I39X 4O3FA 1IZ0A 4ILEA 5TSDA 3K0CA 1W52X 1YFZA 2Q7OE 3H5NA 3IAXA 4YECA 2GD0A 1YB4A 2C83A 2PPLA 2QRNA 1O58A 5GJCA 5JJBA 1V71A 7REQB 1XA4A 2YBDA 3QH4A 1NOKA 3U4GA 5K0CA 3D59A 3DTVA 3OU2A 4K88A 2YS6A 4FS3A 5H3LA 3ER9A 2FKNA 1AGYA 1UXIA 2O6HA 2CW5A 4ZVOA 3FPAA 3U56A 2WJAA 2FK7A 3BZUA 3CZMA 4P7BA 4XD7D 2JJQA 3I37X 4EIWA 4JYZA 2HD4A 4JAVC 1E18A 1U9CA 4N3NA 4AIIA 2AJBA 2EGGA 2F3RA 2PGJA 3B20A 5G41A 1JLMA 5CU7A 5ADVA 2HL6A 4X6UA 5B4VA 1RTKA 1O4VA 4Y67A 4J9VA 3I2GA 4JJIA 3CZCA 1KEEB 4URXR 3I92A 3D7NA 4QYSA 3ZJVA 5K2OA 2HCFA 4X1IB 1F38A 1OD6A 5BQOA 1FNDA 3KZNA 1Y8ZA 4FE3A 3M4YA 1R6VA 4G0OA 1VG9B 1AC5A 2I2AA 2C7GA 1G9XA 2A5GA 4Q7LA 2P6OA 4LHVA 1U1CA 3CXRA 1YZUA 4YREA 5B6JA 2KSQA 3EA0A 3KDPA 4N5LA 3M1LA 2FSIA 1W85B 4KAJA 1JDNA 3CURA 1R4ZA 3WB9A 2E6UX 4J0JA 4DDVA 1C3LA 1XF1A 2A9RA 3PNBA 1HL7A 4FZ5A 2GAAA 4NG4A 4X6LA 1GNQA 1F8UA 5CT6A 1G5QA 3RTBA 4C9BA 3M5CA 3W7AA 3GVXA 1N2HA 4DXDA 3B1KA 1EP9A 1JQBA 5G3ZA 4HV4A 1QU2A 3UYLA 2RGGA 3FGZA 2NUAB 5ED4A 2I66A 1N2GA 3K5PA 2ZYVX 1S8FA 1YDHA 5EYPA 3OCVA 2ZIAA 4HNQA 4JROA 1M2OA 3VQTA 4UEJA 1NLZA 1TGVA 3V8PA 5IJWA 2W83A 1G3UA 2V8BA 4LWPA 3OOEA 3UJ8A 2H07A 2CB9A 3DCNA 3B5IA 1PL8A 3OX1A 4JNKA 3VR6A 4DUPA 2PR7A 2OGTA 5AKZA 4ZXFA 2DG2A 4ZYYA 2RDMA 3UKDA 4RJJA 1M7BA 4TXMA 1FMCA 1QOQB 3C3JA 4LK2A 5KTTA 1Y63A 1CF9A 3LUAA 3SHQA 1DEKA 2KM1A 4GM1A 2BD0A 1WX1A 2QIOA 3RVBA 4BMVA 2HWUA 2SHKA 3ID6C 3QKWA 2W2KB 3GH1A 3N58A 4PVDA 4C7KA 4MUYA 5KYGA 2I2DA 2BHSA 4UEQA 2AFVA 4G84A 5DASA 1TD1A 2CVOA 1J8MF 2IYNA 3OE7A 3UJHA 1QNLA 1Z2DA 2PGLA 1OMOA 3PXEA 1FXUA 1E58A 1HH4A 4O1IA 4OQMA 2MINA 5AKJA 1NM5C 3FLMA 3Q6NA 1JIKA 2D2VA 2ZEJA 3P9ZA 1MPTA 3QF4A 4I9UA 4KV9A 4UHHA 1BD4A 4Y6PA 5CVVA 5J4VA 1TQ6A 1U2TA 1XUOA 2I33A 2OO5C 3K09C 3BKWA 3MAAC 3W04A 4BZWA 4ENUA 3BJRA 2AFRA 3HDTA 3OBIA 3RFFA 3SK0A 4EPYA 3AIMA 2C03A 2PNFA 5FORA 3GVIA 1K3TA 3CLHA 4ZHQB 2HJ9A 1VL2A 2WZCA 3D9QX 5CB4B 4EARA 3V80A 1O5TA 2AK2A 4LXUA 4ND8B 2MYTA 3Q7EA 2AN9A 3AZOA 1A69A 2O7SA 1VTKA 3JSXA 5JQGF 2FEAA 3EGDA 4UHJA 3SYLA 3ZLTA 5LQRA 5E9QA 1LI4A 1R88A 3LDAA 3SDBA 1GSAA 3RRBA 3VX4A 1MHPA 5L3SA 3IILA 3SSAA 4AZWA 5JSZA 4ILKA 3B6KA 2YWBA 1VM6A 4B47A 4G1EB 1VCOA 4AF6A 5K45A 1P9LA 4H0FA 2HYDA 4YALA 3ZPXA 4CU5A 3T3HA 3ZWNA 2EW2A 2P30A 3FFXA 1T3LA 1G17A 2CBZA 3K70D 1TJ4A 221PA 4F97A 1EVIA 1ZH2A 2RCYA 1S96A 2XVMA 1I6LA 1KJ9A 2UZ1A 3NC0C 4IXWA 5IK2D 3QLJA 1WETA 1MB0A 1ZXLA 1K4MA 3G0BA 3KZMA 4QHYA 5LMUB 4KACA 2PZJA 3ZU3A 5JD6A 1F0YA 1CQPA 3WG9A 3ZDQA 2IUEA 1KYWA 3N0XA 3PQ6A 3HM9A 2VQ6A 4Z4GA 2JI7A 4E5MA 2UYCA 4M46A 4HUTA 2M6RA 1N5IA 5CAEA 5DBOA 2XVZA 4RNDB 1DEAA 1QIKA 1UFRA 3DEAA 4QUEA 5FUBA 4BC0A 3KQLA 3OTWA 5CCXA 3LLMA 3X3HA 2GZMA 4C0HA 4HNUA 5LM3A 1G16A 1MO2A 1XAIA 2F3QA 2JW5A 3NCHA 1MAWA 4MMYB 1GTMA 3I3SR 4CVNA 1NMXA 1NQOA 4RTKA 1OTYA 4HUJA 1KQOA 3ZXYA 2OBMA 4PF1A 2OAQ1 2EX0A 3DDSA 5CMLA 4G65A 4JL5A 3LF1A 4HS4A 1I4OA 2GZ3A 3CUTA 3MFYA 4XIGS 3WP0A 5BNWA 4CN8A 4PEVA 4XCQA 5GIOE 3JYOA 4YK7A 4KR3A 3QG1A 4YJ3B 2JLUA 1NW3A 3EOBI 4NBVA 1DQZA 5AOCA 3CEHA 1XYYA 3EEYA 2HNKA 3MJVA 4KH0A 4UARA 3OF2A 5CK5A 2QAGC 3G2HA 4DIMA 2C9CA 3WZ2A 4E31A 5LKRA 2AYZA 5JTUA 5L8VA 5IDYA 2ZSEA 3DZKA 2QVGA 4Q9LA 3ZH2A 3R0QA 2HLDA 2WD7B 1CHNA 2XOKA 16PKA 3I9MA 4DIDA 2H9AA 1Y6JA 2ACWA 5D3ZA 2PZKA 2QU7A 4CLDA 4TKUB 4XX1A 1S7CA 4LZAA 1M54A 1RZVA 3ANTA 2ZSUA 4FONA 3R3XA 3HKCB 1Z5NA 2XYGA 4CWAA 3T0IA 1SU4A 4LNHA 4QQ8A 1OXVA 3R5XA 3GJ7A 5TJ9A 3HN7A 3CF0A 4LFAB 3LHDA 4I50F 5LFAA 3A1TA 4KIJA 1G9SA 4HGQA 2QIPA 3QENA 4Q12A 4UAJA 1I3MA 2WF9A 2N47A 4HWKA 2DCUA 5BQPA 3TOSA 2IC5A 1C2YA 2OP0A 3FDJA 3H9UA 4RLSA 4B6PA 4FNOA 2A5JA 2XSZA 3LC2O 1KPHA 2HJHA 3QLUC 5ALXA 4W5JA 3R7FA 3O9MA 5B7GA 4IWXA 1FLDA 2GNOA 2VN8A 4KMRA 1X87A 4MWEA 2IIVA 1V7QA 2WSBA 1GA4A 3NQ41 5AKHA 5B4UA 2O8CA 4RY9A 4MQ6A 1RCTE 3T7KA 3O7WA 5T8KA 4L51A 5CBPB 2HMSA 3S0JA 4LS3A 4RJIA 5CA0A 4EGQA 4YDQA 2VI5A 3KR2A 1AX9A 4ZQHA 3CX6A 4GI1A 2GFIA 1FX1A 4Y6OA 4MJ7A 4NLLA 4R9VA 4NWIA 3TZCA 5K4GA 3BXHA 3AU8A 4M36A 2ZDQA 1RC1A 4IJUA 3AF4A 3TCKA 4D0SA 1XNHA 1FRQA 4G36A 3TSZA 2WICA 3EBLA 3CLRC 4TMZA 5I3ZA 5AP9A 3RRYA 4M1YA 4YV7A 4XUGB 1WZIA 2XCTB 1UYJA 1ESCA 2BBOA 3CF4A 1U5CA 2HQOA 2XITA 1RXCA 1SUFA 2BELA 1SXJC 5C0OE 3IXLA 4WXEA 2JGLA 3F2VA 3MBIA 4FI3F 2VP5A 1RT9A 3I30X 1JTEA 4KRXA 5TNXA 3QVUA 1Y5NA 3K1YA 1U3FA 3L7DA 4Z0PA 10MHA 3IE2A 1H3EA 2VUSA 5CDSA 2Q5OA 1LFDB 1T8YA 1TT5B 1RP1A 1ZA2A 2WJZB 1QRRA 3S2UA 2EEZA 1J0AA 2XBUA 2NV2B 1EZ4A 3NHWA 3TOCA 4BLRA 1LWOA 1ZG3A 2EFDB 4WNIA 3JQBC 4FOPA 1XCOA 1VG0B 1SXGA 4QYXA 1U6IA 2VT6A 1XTTA 3ZU4A 2ZU6A 4I8DA 3KGDA 4TS1A 3HA7A 3PB3A 1IPEA 3DYVA 5FUYA 2PQ0A 1IU9A 5JSKA 2HMUA 1IIBA 3JZIA 5G4KB 5B1SA 4WZ6A 1Z2OX 2VDMB 1Z5WA 4RACA 2BMFA 1XZHA 5IAAA 1X2EA 3ABZA 4JITA 1JRLA 1BYIA 3OAAA 1AB6A 3GXOA 1RWWA 2FPGA 1SOMA 1UQUA 3BORA 5BPFA 4YYEA 1OXMA 3K9HA 2OFOA 2CJFA 2V7QD 2Y66A 4R8LA 4RSGA 3B3AA 4EUFA 3TXXA 2K4MA 4US2R 5K51A 1PYGA 1X0XA 2GK7A 4IWNA 1UWKA 2X1MA 3DLIA 2G1PA 4MW6A 1ZA1A 4NOKA 3S1AA 5JAMA 4PSUA 5KTKA 4N8SA 1UL1X 1DARA 3Q8LA 2XR1A 2NUTB 1KH1A 2Y6UA 3I2IA 1VGRA 3KYJB 1CDOA 4KK3A 1V2HE 3P96A 3HDYA 1JAZA 5F1OA 4K9KA 2ZIWB 1YDMA 4PXYA 3FFBA 3HP1A 5ENDA 5A6SA 2B1RA 4U9IS 1TVEA 2FV8A 1IY0A 2VJBA 3QY0A 5JVDF 3IDOA 2G71A 1L5YA 4D8WA 3SQLA 3SDZA 4KIFA 2CHVA 2JJ2D 3T7CA 5KMGA 3MA0A 5CEJA 3MWJA 4V1CA 5EHNA 4NE7A 4JBGA 1D09A 3OUUA 3D1VA 2X4DA 4LDRA 5L3RA 2OXTA 1QRTA 5ES3A 6ABPA 4TYYA 4JENA 1U8TA 1CRLA 1GPKA 2FF7A 4WFQA 4JC0A 4FSHA 4FWBA 4MA4A 2XVAA 2JGNA 1V0JA 1ZCBA 3IQWA 4DE5A 4ER6A 2XZOA 1EHIA 2GHQA 3PF8A 4D1YA 1CR4A 3JY6A 3IP3A 1GAWA 4FLMA 4BVKA 1NZFA 1B8UA 3BHMA 4J1TC 3CLUD 4N1AA 1WDMA 4OHWA 4LF5B 3RGWS 4KGZA 4W1SA 3Q0EA 1U1EA 3HVIA 3BTUA 4NABA 3SC4A 2DYKA 2O1XA 2FI1A 4DEVA 1XRPA 2DH6A 3C8HA 1G20A 4HDKA 1OILA 1E2QA 5EXDA 3M3DA 3U4HA 4FFLA 4JYCA 4CKYA 2FYTA 4WW0A 3KSDO 3QE4A 4HMOA 3N3BC 3G68A 4OHPA 5HBRA 4PSDA 3QEMB 5I51A 1K6MA 1PF7E 4LYYA 1XPUA 3A31A 2YOFA 5C1IA 2JPDA 5JS8A 3HR8A 3JD2A 4NH0A 1PGQA 4CF3A 4CIWA 5FBQB 3WGJA 3HPRA 1N2CA 4BATA 1DIAA 1Y4SA 1C0PA 1T1SA 4OHKA 3MMZA 2IOHA 3ZCQA 4U7DA 3DR5A 4NZNA 5LD2C 3V32A 2XQVA 3PV0A 4ZO9A 4A03A 4FHFA 1CUXA 3P9XA 4OAPA 1THMA 2BLNA 2Z1MA 2WU0A 4KV7A 5AW7A 2G1UA 1PN3A 3E3OA 2J0SA 1AHIA 2VUHB 3DVRX 1W75A 2DSNA 2J9YB 3SF8B 4KYUA 4PZUA 4OCZA 3U62A 4BVAA 2PE5A 1CQIA 1YOVA 3GD5A 4MR9B 1QJ4A 1M8KA 1XZPA 3N2YA 2FRDC 4J0EA 3SNKA 4PLGA 1BH6A 2D2XA 3CZQA 6YASA 2X8AA 2FHSA 3RS8A 3T52A 3UNXA 4XWKA 3NV9A 3C1OA 2ZBUA 2IEYA 1XCJA 3PWTA 1I14A 2W22A 4JGBA 3IEVA 3DBVO 1E99A 2R4UA 3DT8A 5I45A 3IQDB 1NUAA 1U0SY 2R8ZA 3RUHA 2FPOA 3GYGA 3R23A 2XE6A 3ITDA 4F4IA 4DV7B 2JLCA 1QTRA 3L92A 3UUEA 1YZFA 4OJTA 1LF0A 3FNGA 5JQGA 3ZU2A 3IOBA 1IVSA 5JH7F 1EKXA 1U5BB 1ULZA 1PGJA 2ACVA 5DJ5A 1JILA 5E7JA 2P67A 3ZC3A 4O0MA 4O59O 4RPCA 2EFHB 2NT3A 1E4EA 4PZZA 5FUMA 1U5AA 1NBIA 3I04A 5EJIA 4DCUA 1NI3A 2A92A 1TJPB 1OH8A 5BNFA 4P33A 1M2GA 3C3DA 5IJZA 4NDNE 1E1LA 3H4VA 3ICCA 4V0MA 4PCVA 1W36B 4AIRA 2BKLA 2DRIA 4S1OA 3VJRA 4UW9A 2OBFA 4GMFA 2I34A 3TLZA 5BNZA 3WGVA 4DJFC 1XA3A 2VRBA 3N5CA 5H8WA 4HX2A 4TN1A 2VHYA 3C8DA 4TMTA 2A33A 3TCNA 3X1MA 4DLBA 1EDBA 2WIAA 1L6RA 2QZSA 1LNZA 1P39A 2MYNA 3RSQA 5A02A 4KSCA 1LLCA 4OO3A 2I4RA 3SEFA 3FKQA 1WJGA 1NF8A 1QORA 3I72A 1I2AA 3D2AA 4RM3A 2YRWA 3MPUA 3I5YA 2WTMA 4NENB 2PUTA 2B7LA 1PT9A 4NJMB 3HR4A 4ROTA 3DW3X 3F8WA 5CTJA 4YMHA 2TMDA 5IZCA 1WCYA 3HV0A 2VCYA 3GO4A 4OFBA 1XKXA 5JI2E 1QOZA 3H6KA 1PQPA 3N8IA 1GM5A 3LOQA 5ETJA 2X2PA 1YTLA 4PLZA 3RYHB 1WZUA 3AINA 4ZJPA 3AY6A 2Y0DA 4RFSA 4CM6A 1KY4A 3MRXA 2IS4A 2YMLA 1KHHA 1L5ZA 2B1IA 3M5WA 2ZUVA 3GIDA 3Q6IA 5F78A 3KE9A 1Y9ZA 5CPFA 3TQIA 2IZZA 3RAGA 4MPTA 1E5XA 1ZK2A 2NZUG 2RJ3A 3LUHA 3ONDA 4KMSA 4ZK2A 3PKZA 5KSWB 1KE1A 4G1FA 4E15A 3C41J