2O50A

The crystal structure of toxoplasma gondii enoyl acyl carrier protein reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
290
Chain Sequence
PIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title Studies of Toxoplasma gondii and Plasmodium falciparum enoyl acyl carrier protein reductase and implications for the development of antiparasitic agents
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 95
structure length 290
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o50A00
2Y0DA 4UVDA 2QRJA 3M1LA 1PSDA 3JCZA 3LLSA 1TEHA 1GYPA 1YL6A 2QHXA 2V65A 4IXWA 5A3VA 3TQHA 1M6HA 4AL4A 1PGOA 2CVZA 3EC7A 3DO5A 3EAGA 2X4GA 3KUXA 1Z73A 3PXXA 4N54A 4GGPA 4LMRA 4RORA 1BXKA 3ZNPA 1C1XA 3E9NA 3GFBA 2Q1WA 1OOEA 4O1MA 5JW6A 2PD6A 3K96A 1FDWA 1LI4A 3EZYA 1NM5A 2ILTA 3H9QA 2HMWA 1DAOA 2RIRA 3I9LA 5JAZA 1GCUA 1FF9A 4R4JA 4YJFA 4RDHA 3D3EA 2VNSA 2C5EA 5I9MA 1E3IA 3AI1A 3HB4X 1XU9A 1H93A 1E7MA 1N2SA 3N74A 5L7YA 4BL5A 4ZA2A 3WYCA 2VCYA 1PZFA 4BNZA 1N1EA 1AE1A 2JJYA 3S2EA 1MLDA 2VOJA 4I5GA 1NWCA 3QWAA 3WX0A 1BRMA 3GUCA 3MJVA 2O4CA 1DLJA 2GYYA 1U2GA 2WD8A 4XIJA 1PJ4A 1UDAA 1XQ6A 4CUJA 3K31A 3OHSX 3Q3CA 1YBAA 5C37A 1E1LA 3ASUA 4OXYA 1XHLA 2ZIZA 1W8DA 3RBVA 4C4OA 4GMGA 1MXHA 2VHWA 4DIFA 3PDUA 1DO8A 1SOWA 4PLTA 2WE8A 2B83A 3MJCA 4C7JA 5K9ZA 5K6AC 3WQQA 2VTEA 3ZI0A 4BGUA 4GX1A 3IMFA 3CH6A 2OZPA 4GLOA 3FTPA 4AJKA 1CF2O 4PLWA 1XR3A 4N18A 1Y7TA 2DU8A 5TC4A 4IIUA 1ISJA 5DN9A 3UCXA 1MXFA 1PL8A 3FNHA 5L9AA 3KV3O 1HE4A 1PX0A 1YO6A 3IDSA 2UUOA 3N58A 1NX6A 4TRJA 5CG2A 5BR7A 1Z7BA 2J5QA 5KJCA 2DBRA 4NBWA 4AJ1A 3U3XA 5JY6A 1NVTA 3D7LA 3JD4A 4OIMA 2PGLA 4XYMA 3WS7A 1D1TA 4CQMA 3AOEC 5HA5A 4JCOA 4EJ0A 4DBZA 4YJGA 3OQBA 3AOEA 4L76A 5GZ3A 1WVGA 4OSOA 2A94A 3DZJA 3NGXA 4W82A 1WW8A 1SEPA 4GAEA 5IZCA 5I7VA 3B6ZA 1F8GA 2AXQA 2GN4A 2QYTA 3GF4A 5JNLA 4D0RA 2P4QA 1PZEA 2FR8A 3GMDA 3RASA 4G2NA 4INAA 1P1IA 1DC5A 1XIVA 3ZV6A 3H3FA 1H9AA 3TFQA 1YDEA 5L7TA 4M8SA 3U4IA 1Y1PA 3PWZA 3DOOA 4CLRB 2OFPA 3WTBA 2W2LD 1R37A 1B0AA 3UVEA 2YV3A 1LSJA 1NVGA 2OP0A 3COSA 1K6IA 2EKQA 1DSSG 1YQDA 4OXKA 4YR9A 3GVCA 5T64A 4LRSB 1YJQA 2PZMA 3GAZA 4WLOA 3QV1A 3PGJA 4F45A 2Y1OA 3DDNA 4CR8A 1HYGA 3WYBA 3F4BA 1R0LA 4BNFA 4YTEA 4A0SA 3FBGA 3PHIA 3WQRA 3F5SA 4OQZA 5GY7A 4NI5A 4MKZA 2I6TA 4RVDA 3ZV3A 2GN6A 3MWDB 1UXHA 2RHRA 3QVWA 5JFOA 5F5LA 2PR2A 1R0KA 4BO4A 1KEVA 3OEYA 1YL7A 1P1KA 1GU7A 4K6FA 1VM6A 1BXGB 2NTJA 3CXRA 4QEDA 1PGQA 2VYVA 2XPCA 3KVOA 3VH2A 2VTDA 1OZAA 4ALMA 2CVOA 5DZSA 5JO9A 1X15A 5JXWA 5CFZA 1P45A 1EVIA 2PA3A 2ZKLA 4YJHA 3JD2A 2FSVA 5IG2A 3HADA 1PS0A 4QO8A 2PWZA 3VDRA 3KLPX 4I8XA 3WJ7A 3WNVA 3TZQA 2C59A 2EJVA 1A72A 4R3WA 3CEAA 1PGPA 3TPCA 1HDRA 2TMGA 2X0RA 1DPGA 4J2OA 4M49A 4R1TA 1K0UA 4HV4A 1DLIA 1BDMA 3D1LA 1MP0A 3PI7A 4DUPA 2FHSA 2DLDA 1BXGA 2NVWA 1LQTA 3CTMA 3GRKA 1BWSA 1R0SA 2EJWA 4J1SA 4KWIA 3W4JA 2I9PA 3VTFA 2NU9A 5IZ4A 3BMCB 3LF1A 3I6QA 4RF3A 1BSVA 4OOFA 1BXZA 5DT9A 3UICA 1YS4A 4BQPA 1HT0A 4AG3A 1UUFA 4KUHA 3M2TA 1NASA 1T26A 2RBEA 4CM4B 4Z3DA 4IGEA 3WJAA 5ITVA 5ES3A 4EI2A 3ABIA 2O3UA 1PGJA 1Y9EA 4RPGA 4WGGA 3RWBA 1LTHR 3GPIA 1IZ0A 2I99A 3OICA 1GEGA 4AJ4A 4GVLA 3E8XA 1LDMA 2R00C 1C0KA 4QSMA 2E48A 4UULA 3RKRA 5IDWA 1KC3A 1M2WA 4HWKA 1K2WA 2H5LA 3I9JA 3WMXA 4CMEC 4A7PA 5FI3A 1JVSA 4ND3A 3FNEA 3WIDA 4GKBA 2VUTA 4PG6A 5CEFA 3TZ6A 1H6CA 1N9GB 4KUGA 1N8KA 3M6IA 2ZB4A 3FI9A 5ER6A 2X5KO 3E5MA 2NU8A 4GVXA 1P44A 5GZ1A 3NRCA 4IPTA 1NPTO 3MJTA 5JAMA 1KVTA 2Y66A 3UW3A 4ZQBA 4CL8A 2E82A 4WLEA 4XA8A 1WDMA 2CMDA 3PJEA 4RGBA 3ZHYA 2WEKA 2DBZA 4DQVA 4BV8A 1BHSA 1VE9A 4JXKA 4TMFA 3ZNQA 1K5HA 3V2HA 2PY6A 3C1AA 4IDDA 4PG8A 4BNGA 4YAJA 1EDOA 1N9GA 2P91A 1UZLA 3L6DA 4QTZA 4FGSA 4CMCA 5TJHA 1UAGA 4MIYA 3W6ZA 5GZ6A 4E5YA 2C7VA 1B3BA 2DBQA 4RF4A 1IL0A 4DVJA 3A1NA 3FF4A 4QX6A 1U5AA 4XR4A 4LGVA 2VRBA 2H63A 3U4CA 3JYOA 2PD3A 4K1LA 3JV7A 4B4VA 3LC7O 4GMFA 3GH3A 2I3GA 4RVFA 1EVJA 3E6AA 1V9LA 4Y67A 4AJPA 1A9YA 4ALIA 1ZK2A 1S7CA 1JKJA 3MEQA 3OIDA 2P68A 3DBVO 2HMVA 5F1KA 1P31A 1X14A 3WTCA 3AWDA 4J6FA 1QKIA 4JLWA 4O59O 4YB8A 4E32A 4R1UA 1KVRA 2WD7B 4LK3A 3DZKA 4LVCA 2QRKA 1JKIA 1V6AA 1ENYA 3OMLA 5A9RA 1MX3A 3HDYA 4W99A 4A5OA 1DJQA 2GDZA 3V8BA 2YW9A 3W8DA 5ENDA 1ML3A 1HE3A 2Z1MA 3Q9UA 2AE1A 4I1IA 2P9GA 3GVXA 1UH5A 2GN8A 2J3IA 3TWOA 4S3MA 5DNAA 4XZ3A 3IIEA 3INTA 3PK0A 4GKVA 4CM3A 5EQFA 1OFGA 1A4IA 4G5HA 4B4OA 2RCYA 2YHIB 1YXMA 1B8PA 3FCOA 1TB4A 1RJWA 2PZKA 3H2SA 3F5QA 1I33A 2WD7A 3BTSA 4O5OA 2W90A 3PHJA 3GA0A 4E30A 1YE3A 2B5WA 3PIDA 4GSKA 5TLSA 3F1LA 1QXSA 1Z75A 3HN2A 3SBOA 4RVGA 4CMKA 1GEEA 1I30A 3JQAA 5KVQA 3QW2A 4XR9A 2CVQA 4XEHA 2B4QA 3P5SA 3WGOA 3JQFC 1YL5A 2JCYA 4MVJI 2IYPA 1QP8A 4OO3A 5BT9A 3CZMA 2WYVA 2CNBA 2VNAA 2VWQA 2NU7A 2VUUA 2YHIA 4NIMA 3RUFA 4ZQGA 3UOGA 3UHAA 5EJ2A 2QX7A 4YRAA 5LDGA 2D3TA 1LSUA 3RUAA 3VC7A 2F1KA 4W6ZA 3IS3A 3KHUA 3RUDA 2HO5A 1XA0A 1WP4A 3DMTC 1KY5A 3PIIA 3K9QO 2EGGA 4KQWA 1KYQA 3DMTA 1P0CA 4EDFA 5JMPA 4ZHSA 1X0XA 5I7EA 3LT1A 3OA2A 2P5YA 4OJNA 4BNVA 3I3OA 1RWBA 3B1JA 3HG7A 3S2GA 5A1TA 5JY1A 3A14A 3ZWAA 4EUHA 2EERA 3HHPA 1H2HA 4JX8A 3X2FA 1GPJA 3BXXA 4BO9A 4CM7A 4HUJA 4RVSA 3ZGYA 2A35A 2HCTA 3ZU3A 5HRUA 2QYSA 4N5NA 1MC5A 4RLHA 4B8ZA 1HDCA 3RJ5A 3WYEA 4D7AA 3AUSA 3WGIA 1G0NA 2Y0CA 3UKOA 4Z9YA 3FTNA 1HKUA 3RC1A 3QQPA 4MP6A 2D5CA 2OL4A 1LXCA 1EK5A 1GUFA 1U4OA 4JJIA 2LDXA 1NPDA 2E49A 3BMQB 4NH4A 3ZCXA 1GV1A 2EV9A 3KSDO 1JTVA 4TQGA 4XQ9A 2X5JO 3D4OA 2I65A 4BUCA 5A03A 3LF2A 2HU2A 5JO0A 5FF9A 1KVQA 3LC1O 2PLAA 2W8ZA 4RF2A 1PJ2A 4KOAA 2HLPA 1HE2A 4I5DA 1RM5A 3VAZA 4IJVA 5C7OO 2G1UA 4CM9D 4CQMD 1X7HA 1P9LA 3QA9A 1B26A 3VKUA 4MIEA 4UREA 1GY8A 5CHEA 3RUHA 4BO1A 5CAEA 3DBHA 4BO8A 4E2WA 4M1QA 2O4UX 1QYCA 5A04A 3RCBA 1R66A 2HSDA 2IDZA 3BMQA 1I3MA 4TKMA 4YAGA 2X0NA 3EVTA 1IULA 1KY4A 5T8KC 4B7CA 5L51A 2G5CA 3EZLA 1B7GO 1LSSA 5T8KA 4MP3A 3MTJA 1ZK0A 1FK8A 4JP2A 1BW9B 3ZU4A 2WM3A 1E5LA 3C7DB 1WNTA 4XRRA 4WCFC 3GDGA 5CEJA 1HYHA 4BKQA 2EP7A 1Y8RB 3JQCA 3VPGA 4B7UA 4I08A 4DIOA 1EVYA 2CDCA 3H5NA 4XYBA 5DCYA 2XXJA 4CR6A 5L95A 1WMBA 2WYWA 3L07A 1LUAA 2DTXA 3F1KA 5JS6A 3U5TA 3D5QA 2E6UX 3SC6A 1DC6A 1GQYA 3ONEA 4CUKA 3EVNA 2QW8A 3PYMA 3G79A 5I8WA 3UFXA 3IP3A 4WK6A 3JQ7A 1K6JA 3H5RA 1Q0QA 3VZSA 5HS4A 1B8VA 1BW9A 1HYEA 3WXBA 2Q1UA 3GDOA 1DXYA 3OP4A 1JU9A 3WSVA 4AJIA 5CG1A 1RM3A 4LVUA 3OETA 1E3LA 1PTJA 1Y8RA 3Q6IA 4ZQEA 1SO8A 3QWFA 1NTOA 4YT5A 3HDHA 5EQDA 3VPXA 5A9SB 2O48X 3GN1A 4H16A 4ALJA 3DR3A 1PJLA 2P2SA 3DWFA 3SLGA 1LDEA 1PS9A 1ORRA 3GFGA 3IAHA 4E13A 1I36A 4AJHA 2ZTVA 1ISHA 2PK3A 1AUPA 2YYYA 2VYVD 1DEHA 1AXEA 2HK7A 2C2YA 4A26A 5IF3A 1VSVA 3ZWNA 1BDBA 3HSKA 3ZWOA 1ZBQA 3DZHA 3MOGA 2G76A 3EYWA 1F14A 4RQTA 4MIOA 1MFZA 1T2FA 4GWGA 4RQUA 1IPFA 1I10A 2HJRA 3IJRA 4B4UA 4UEKA 2P9EA 3AI2A 4R9SA 1UP6A 2IE0A 4UUPA 4YQYA 1YGYA 3ENNA 1ID1A 3UUWA 1MG5A 2IXBA 5BSGA 2FZEA 1T1RA 4II3A 4RZIA 2O3SA 4WKGA 1ADCA 4F3YA 3RC7A 4MVJP 4BNNA 1A27A 3OA0A 2EW8A 2IEBA 4J90A 3VOSA 3H9GA 1CWUA 4DYVA 3GG9A 1J49A 5AQ1A 4R3NA 2VHYA 2HDHA 2C7GA 1MGOA 4FJ1A 5TF4A 3RFTA 4CM8A 1CERA 3T7CA 5DOVA 1EE9A 1DB3A 3OIFA 4FC6A 3GN2A 4Y8VA 4E6PA 1E6UA 1X1TA 1ADBA 2C5AA 3TOZA 3AK4A 1WWKA 3JQBC 1KEWA 3TL2A 5L53A 3EMKA 3GVPA 2OOSA 3JQBA 4NJOA 2DQ4A 3JYNA 4BGIA 2BRUA 3PHGA 4BO2A 1P77A 1YB4A 4ALLA 2AQIA 3GGGA 4IQ8A 4E3ZA 5BNTA 4BKRA 1T1SA 2PNFA 4BO7A 5TS3A 3B70A 3AY7A 3O8QB 1C1XB 2AEFA 5CDUA 3TDKA 3WWZA 3IOYA 2ZB3A 3L6OO 3DBLB 4ND2A 1X1EA 2CF6A 1LDYA 3IUPA 1A9ZA 3ADPA 1LLQA 5EL0A 2YQ5A 1H2BA 2XAAA 1XU7A 2DBVO 3BMOA 4IJWA 1O89A 4PLVA 4WLFA 4AJ2A 3KSZO 5H82A 2OUIA 5LDHA 3P2YA 4ESOA 1P1HA 7MDHA 1RYEA 4DL9A 4YJFB 3PHLA 2NSDA 4DREA 5IJZA 3U49A 3P2OA 3OF2A 1U3UA 3RD5A 3KBOA 2WTBA 3O8QA 1R12A 5COQA 4EJ6A 3FRJA 1Q7CA 4QECA 2CUKA 3ZWCA 3DBLA 5A5EA 1QYDA 1LC0A 4GX5A 3VH3A 4L4RA 3WIEA 1U28A 4ITUA 4F46A 3F6YA 5I7FA 2X8LA 3FPCA 1R4MA 1DRUA 2FZWA 5IDQA 5HBRA 3ZW8A 3JQGB 4BO6A 5TGDA 5JCJA 3SXPA 4MO2A 1EBUA 4EUFA 1AHHA 1ZUD1 3OBBA 2AHRA 4I9UA 2BHLA 3OEWA 1SBYA 3AW9A 4RCVA 4IMRA 4YPOA 4NR0A 3ZWPA 1PU2A 1E7YA 5KKAA 4U5QA 3H3JA 1KEPA 5KTKA 3Q0EA 3GC6A 4J1QA 3A4VA 3OM9A 1HDYA 3L4SO 1SEVA 4NBUA 1NR7A 4NBTA 3JQGA 5LC1A 2PKQP 5C7IO 2XF8A 1JAXA 3PEFA 2GF2A 3BA1A 3LSYA 1ZXBA 3C7AA 3BYZA 3UN1A 4HADA 1XQ1A 3WOHA 3D4PA 4RVHA 1C0PA 1UXGA 4JJGA 4TRRA 3S1LA 2I67A 3T4EA 2OMEA 3MZ0A 4F6LA 1SNYA 3P19A 5K6AA 3JQAD 1DDOA 3E82A 3RSHA 4CQMB 3VTZA 1ZSYA 1MV8A 1HDXA 1Z82A 4HFNA 1SC6A 4TROA 4YJGB 3WB9A 1HSZA 2NLOA 2Z5LA 2ZK7A 4L8VA 3A9WA 4CR7A 4L0QA 1J0XO 2BD0A 2UUPA 1XLTA 3H7AA 3U4DA 1A7AA 1V35A 1HTBA 3U62A 3ULKA 1OAAA 1EFKA 1PL6A 2X58A 3QRWA 5T5QA 4U0JA 1WDKA 1XGKA 4AJJA 3KM0A 3D64A 2JL1A 4R16A 3ZZNA 3E48A 2J3KA 1ULSA 1PQUA 1PJQA 5B37A 4CM9A 4BNWA 5J23A 3H9EO 4FS3A 4FC7A 4Z0HO 1NVMB 4B3HA 4L74A 3ZNOA 4Z9XA 3TFOA 1PJSA 2ZJ1A 1JN0A 1DFGA 4XJTA 2EF1A 3LT2A 2EW2A 3DFZA 3OJOA 3NUGA 4D3DA 1HSOA 2Q4BA 3GZNB 1EFLA 1VPDA 4Y98A 5DCUA 3ZWXA 4WASA 3I9KA 1PQPA 4FPXA 1LRJA 1CRWG 1YVEI 3LC2O 1ULUA 5C5IA 4UVHA 2B4TO 4G81A 4ROSA 4U7WA 2ZCVA 2NADA 4J7UA 4CV1A 1QG6A 4QXMA 3I1JA 3WBBA 1E77A 4EEXA 1HLPA 3F4LA 3IKVA 4G65A 3R6DA 3NEPX 4EITA 1ZH8A 4I9HA 5KKCA 4J1TA 4IJUA 5IXSA 1QYXA 5ILOA 4AJEA 1V0JA 3GZNA 4Y6SA 3DOCA 3DQPA 2HJSA 5JE8A 3FHLA 3G0OA 5I9LA 3PGXA 3R3SA 4Q9NA 3QLJA 4WECA 4R54A 3L4BC 3G3EA 3OQ1A 4JK3A 4ONEA 4RDIA 5KJ1A 2GSDA 1LLUA 3VPHA 4J7XA 4J3FA 1JKFA 4PN3A 4L73A 4UAGA 1W6UA 4YJHB 4CMAA 1Y6JA 3I23A 2X1HA 4YCAA 2JFFA 1YH3A 2B37A 4XD2A 1C3VA 3ITKA 3ONDA 4WJZA 4PVDA 2FMUA 1RPNA 4HFJA 3WMWA 1U2DA 2CFCA 2LDBA 3JD3A 3FR8A 2C82A 1ISIA 1UP7A 2C2XA 4QQRA 2BGMA 4CLDA 1U8FO 3DAPA 1ZFNA 1NQ5A 1O94A 2AE2A 3KOUA 1NP3A 4GSLA 4E5NA 1XEAA 1VRWA 2ZB8A 3B20A 3ZU2A 2Q2QA 4IS3A 2DUWA 4D3FA 2NM0A 4KQXA 3RI3A 3DBRA 2X9GA 3TZKA 4OXNA 5T57A 3ADOA 1DRVA 2UVDA 3S8MA 4UEOA 2O23A 2Y1DA 1ADFA 2IZ0A 1AGNA 4M89A 5U4QA 1EUZA 1OMOA 5FYDA 3O26A 4FCCA 3TN7A 4XYEA 5TNXA 1PWXA 2I66A 4CODB 4PLYA 4W9NC 4DQXA 4PRLA 4ZN6A 3R1IA 4DLBA 4RVUA 3WSWA 2QQ5A 4AFNA 3KZVA 4RV9A 3V1UA 2X22A 3F9IA 1E7QA 1LQUA 3GG2A 4CL3A 1QV7A 3EUWA 1HDOA 4Q3DA 2GZ1A 1E1KA 1P74A 5JC8A 4WEOA 4FR5A 4IZHA 5EESA 2VZ9A 4X54A 4CPDA 1UAYA 3GT0A 4ID9A 4NK5A 4TRNA 2R00A 4GL4A 4GWKA 4WUVA 4BO0A 9LDBA 1VL6A 4AJOA 3UCEA 1I3KA 3H9UA 4NPCA 1RM4A 3KSUA 5DULA 2OBYA 1I5RA 1B8UA 3OFSA 4YACA 4DLAA 5KOIA 4DWVA 5AYVA 1FDVA 4CMEA 5IDYA 4XKJA 4QT0A 4IZIA 4YAEA 2NVBA 2G0TA 3I9MA 4OM8A 4WLNA 1CJCA 2DPHA 4ILKA 4R1NA 4LCEA 5LCXA 3CSDA 3K6JA 1NNUA 5IN5A 1J4AA 3CMCO 5TQVA 4JJFA 5AXDA 2VHXA 4BGEA 1M6WA 3S2FA 2ZQYA 3QSGA 2AEJA 1YQGA 1AHIA 1JVBA 4CLHA 3RVDA 3TSCA 4BS9A 4EBFA 3CUKA 4NQZA 3N7UA 4Q3BA 5CDYA 4J7CA 4D44A 2O3TA 1YOVB 4PLZA 3W4IA 1HETA 1YWGO 1X0VA 1KETA 1XDWA 2OGUA 1JW9B 4FQ8A 3ZHZA 4BHTA 2PZJA 5L4SA 1WAMA 2Y1EA 4GX0A 2V7PA 2YV2A 2CY0A 4FBGA 2JAHA 3HUDA 3FWZA 3MCVA 3D4NA 4HFMA 1ISFA 4NDNE 1T4DA 1H6DA 1F0YA 5K0ZA 1EBFA 2B0JA 4LISA 5IAAA 2NWQA 1CEQA 1YOVA 3DOJA 2OHXA 4D3SA 2X9VA 3SEFA 3IP1A 4GX2A 1I32A 2F00A 2X0IA 2D0IA 3K2BA 4IMPA 2IZZA 4XQCA 1DRWA 5F1OA 3S2IA 1EZ4A 3VZRA 4H3VA 3GPDG 4Z9FA 4D42A 3QY9A 3GEDA 1A7KA 1HXHA 4W7IA 1C0IA 1DIGA 3ETDA 5KJFA 3L0DA 2J8ZA 2EKPA 1DJNA 1WXDA 3HDQA 4NJMA 1HE5A 3AUTA 2ZJ0A 3OH8A 3ROPA 4Y6PA 4BNKA 2G82A 3JQAB 4YVFA 4WNCA 1LC3A 3ZHXA 3IC5A 4P38A 1O9BA 2D5AA 3ICCA 2VQ3A 5A4DA 4RPKA 5HM8A 4TZKA 4BV9A 2VYNA 3KTDA 1I0ZA 4GBJA 5C3MA 3L9XA 4MP8A 1HWYA 4CLOA 1ONNA 4A2CA 1C1DA 2Q1TA 3W4KA 5B12A 4B79A 2VZ0A 1DIRA 1GTMA 2B4RO 3CKYA 5I8ZA 1U5CA 2W4QA 2Y1GA 2AEMA 4O6VA 3WGGA 2YFQA 3IL2A 4MVJE 4BMVA 4ZVVA 5DF1A 3UGKA 1ZK3A 3DTYA 4RPLA 1Z7EA 5G0UA 1DC4A 1LDNA 5JAQA 3OJLA 1QV6A 3AM4A 3NT4A 2ZCUA 2EIHA 3OECA 3LQFA 5TX7A 1O6ZA 4K26A 4FFNA 2GPTA 1Q0LA 4RL6A 3PWSA 3RUCA 2FR1A 2BI8A 1CETA 3HB5X 4M54A 1Y9AA 4P22A 1NFRA 5JCJD 3JQFA 2X86A 1KC1A 4MKXA 3DHYA 4UVGA 1GYRA 5TSDA 2AG5A 4XYLA 5DDIP 1VSUA 2DTDA 3DONA 1GZ6A 3PLNA 3QVTA 5DBIA 4I5EA 3LDHA 2G17A 3BTUA 3GLQA 4A27A 2O50A 1E5QA 4BGVA 2FP4A 3C3XA 3CPSA 2WSBA 3ZWBA 2FSSA 5EPOA 1Y8QA 4NU6A 2I3AA 4LSWA 2V6MA 4YEDA 4GQAA 1U7TA 4KUEA 1VLLA 2VWHA 1SB9A 2RH8A 4FW8A 1WMAA 4GPD1 4K6CA 1QYWA 1VI2A 1XKQA 2FOIA 4CMHA 2FY8A 1OC2A 2YY7A 2DKNA 4BB6A 2JD2A 3QVOA 3JQ8B 3NAQA 4BKOA 1HF3A 3G49A 2DUUA 2Y1CA 3I83A 4FFLA 4FOSA 5AXBA 1ENZA 2J5RA 4A03A 4FJ2A 3KEOA 4L4SA 3IJPA 2YV1A 4IDAA 5GMOA 2YDXA 2VHVA 3DBHB 1Q2XA 1TVEA 2GGSA 1JWAB 3RBXA 4R9RA 1DHTA 5JBIA 3VPFA 2GRAA 3G1TA 4UUNA 3UCFA 1DIHA 5T6BA 5JYDA 1D4FA 1IOLA 4FN4A 5ADHA 3NDJA 5EERA 3WGTA 3ANMA 4MVJF 1ISGA 4NFSA 1ZMTA 1ZW1A 3BTVA 2AW5A 3JQ8A 2Q2WA 2Q49A 3PFWO 1M75A 1N7HA 1GR0A 1LBEA 3KYBA 4JNKA 4YRBA 1KIFA 1ZEJA 4ZRNA 2Q50A 1HZJA 3GNTA 3T7EA 1CQJA 1HLDA 2VWPA 3SX2A 1BVRA 1PJ3A 4MVJD 3LT4A 3GQVA 5HS6A 4R5HA 4WCFB 4DRYA 4J0EA 2NNLD 4DQUA 4TZTA 3E1KA 4YQZA 1ZIDA 1S6YA 4Z3KA 1CDOA 5KVVA 3INRA 2QG4A 3ZNNA 4HX5A 4WE3A 2AMFA 4YRDA 2PD4A 2V6GA 3DAFA 3FR7A 4MDHA 2ZTMA 3M1AA 4IQ0A 3K30A 2QIOA 4XB1A 2A9FA 4CMJA 3QHAA 1O0SA 5EN4A 4E2ZA 3FD8A 3RIHA 3O03A 2X9NA 4PVCA 1Q1NA 3JQ7B 1ZMOA 1H6BA 2HMUA 2R6JA 2Q1SA 3WGZA 2BFMA 4M87A 4U6SA 1EUCA 3B1FA 1R15A 4WCFA 3HDJA 3LT0A 4IQGA 4DTIA 3KETA 2YHUA 4AICA 4II2A 1EVZA 2BMAA 3L9WA 5A05A 3DEYX 4IDGA 1YB1A 2UYYA 4JN6B 5ICSA 2NACA 2UAGA 3AOGA 2DFDA 4DPMA 4YYZA 2B35A 3SVTA 1Q7BA 3S55A 3W8FA 3GHHA 4PG7A 4Z6KA 3WFJA 3IKTA 2C07A 1E1NA 2DFVA 1B15A 4MINA 1Q0HA 2DAPA 3BZUA 4B7XA 1XCBA 2GR9A 4R69A 3RU9A 1GUZA 2Y67A 1K3TA 3H4VA 2C0CA 4ND4A 1G6KA 3HFGA 1V8BA 1DC3A 4QFCA 2IXAA 4PLCA 5I7SA 2FPPA 2X7HA 3U0BA 2GZ2A 1IE3A 1DBVO 4BO3A 1T2CA 3WGHA 3WBFA 1HZZA 1SAYA 4UVIA 3NT2A 1P0FA 1UXIA 1O95A 1RYDA 3E18A 3A28A 4MKRA 4UEJA 5JLAA 4GI2A 3I6IA 4FGWA 2GN9A 1G0OA 4LMPA 4D43A 5ITWA 1KBZA 1VL0A 1ADGA 2RH4A 1IY8A 2IZ1A 3I9OA 4GLLA 3UXYA 2PTGA 4AJNA 5CPFA 2O3RA 1GUYA 4Z0PA 3RUEA 2O3QA 2BELA 4NZ9A 1BMDA 3AM5A 2GD1O 4XGKA 1B14A 3CE6A 1OC4A 3KEQA 3F46A 4GGOA 5I9NA 3Q2IA 1O5IA 4CM8B 2EHDA 2Q45A 1UZMA 1U3VA 1T4BA 3MTGA 4NBRA 2Y68A 3TNLA 5CDTA 4B8WA 1BGVA 2I76A 3QWHA 1YDWA 1G1AA 1O8CA 1NHGA 3C8MA 1LLDA 3B1KA 4ZJUA 4E2XA 3DC2A 4YAIA 1MG0A 2CF5A 1BTOA 3HE3A 2Y93A 1GV0A 4CV2A 3CMMA 2FRDA 2PGDA 4PLPA 5DBFA 3BMNA 5BNIA 5A02A 1NAHA 1ZSNA 5AXAA 3GDFA 1XSEA 3AUUA 1P33A 5ER9A 4AJLA 1LDGA 4IBOA 1K6XA 3V2GA 4DLLA 5JDCC 3BMOB 4A10A 2ZTUA 1X7DA 4TSKA 1SCUA 5JDCA 2BI7A 3G17A 2HK9A 3RFVA 4TVOA 4U6QA 3V1YA 1GADO 4XB2A 5F3RA 1HEUA 4CMIB 5G0WA 5L4NA 1XELA 1GYQA 1HDGO 4P4LA 1ZO8A 1Q7GA 3E9QA 3NYWA 5KJ6A 1QLHA 4B3IA 1PJCA 2Q99A 3EK2A 1MA0A 3GGOA 3GVHA 4WLUA 4UUOA 1TLTA 3RQSA 4OGWA 1D8AA 1QRRA 2YDYA 2E37A 3P7MA 5MGBA 5DOZA 3OJEA 4P4GA 3Q1LA 4NBVA 3GAFA 1R4MB 3ANLA 1F06A 1PZHA 4PG5A 3AU8A 3JD0A 2H6EA 3PJFA 3ST7A 4YXFA 1KVUA 2X5OA 3ANNA 5BSEA 4CMIA 3ENKA 4W7HA 2POQX 3WGQA 1LU9A 3FSRA 2D2IA 2E4AA 3T4XA 3LK7A 3EY4A 1YONA 6ADHA 2GO1A 4JBGA 1F8FA 4KP7A 1EEHA 2HKIA 4D45A 4EW6A 3WLFA 4ZRMA 3QE3A 3HNPA 3HFSA 1VJ1A 1R16A 5ENVA 4FFRA 4EUEA 5KJEA 2PH3A 3CZRA 3NJ4A 1Z74A 3QVXA 3HZZA 1L7EA 4DIBA 2HRZA 4DGSA 2NUAA 4WPGA 5L3ZA 3GR6A 1V3VA 3TZHA 2J3HA 4HKTA 5FI5A 2JKVA 4DXHA 3ONFA 2GASA 8ADHA 1GAEO 3IUSA 2EKLA 2P4HX 3CINA 4NNJA 3NT5A 1BG6A 1VJTA 4BVAA 4FSHA 1UDBA 3OIGA 3MJEA 2PH5A 3I5MA 1R6DA 1U8XX 2HQ1A 4M55A 2GNAA 3WDSA 2D4AA 4HFRA 1YKFA 2VYND 3DB2A 3ZH2A 4BNYA 3NDIA 3ZWVA 4LCJA 2QZZA 5L4LA 1NAIA 4MOWA 2BGLA 2XOXA 3ORFA 2BFOA 4XQEA 1HRDA 1DHRA 3HQ4O 5KVSA 4CJXA 1BVUA 3QWBA 3RC9A 2OXIA 2VRCA 4CM1A 1W0CA 3DZBA 1AXGA 4PZCA 3RKUA 4XQGA 4BNMA 5HTOA 3TOXA 2NQ8A 4R01A 4DC1A 4HBGA 1LA2A 2P9CA 4JIGA 3L77A 2PKRA 3WNQA 1MC4A 3RROA 1E7SA 1IHXA 4NU5A 4D46A 1JLLA 4IDFA 3O9ZA 4J4HA 4PLGA 3V2UA 1SPXA 2YJZA 3L6EA 4KZPA 3GEMA 1EE2A 1J5PA 1GQ2A 1IUKA 1LX6A 3BHJA 1ZKMA 4UUMA 1X13A 4DA9A 4OOEA 1YQXA 2OP1A 1TI7A 3GHYA 1GPDG 4FFMA 4OKNA 1J6UA 1HDZA 3ROKA 4LRTB 3LYLA 3NDRA 2WYUA 1C0LA 4FIZA 3ON5A 2D8AA 1E0DA 3PYXA 3QIVA 3GVIA 4YAKA 3VHRA 1LEHA 2BF7A 3W8EA 1E92A 2O2SA 4MVJA 4R41A 4ZICA 3E5RA 1NFQA 2D1YA 4B4WA 1YBMA 1PIWA 1W73A 2V6BA 3F47A 1KS9A 3D5TA 3GOHA 1WLYA 3JQEA 3AY6A 4FJ0A 4PCVA 3NJ8A 4NHEA 4N7RA 2ZYGA 4BKPA 1KVSA 1VKNA 1VC2A 3PZBA 2A92A 5BNFA 1NQTA 4W4TA 1IPEA 3OSUA 4J43A 3VZPA 4MPDA 1I2ZA 3JYQA 4N5MA 5JMWA 3JYLA 5KCZA 3Q11A 2DC1A 4ZGWA 4OH1A 4KDEA 1UJMA 4KWHA 1SB8A 2B69A 4ND1A 5IZCC 1E3SA 1WDLA 4U8GA 4IXTA 4CQLB 2XXBA 3GZ4A 4FDAA 2FPGA 4E12A 1JAYA 4I5FA 4RPJA 1U9JA 3KB6A 2ZQZA 3EDMA 4Z0TA 2O3JA 2YFHA 1QR6A 4PZDA 1H5QA 1ZVMA 3GK3A 2C54A 5COAA 3K73O 4YWJA 4BIIA 5L7WA 1I2BA 1SZJG 4OL9A 3BIOA 3V1TC 4PLFA 5AVOA 2PKQO 3L4BA 2B36A 4CM6A 3PJGA 1DFHA 3AM3A 3H65A 3ZWYA 1MUUA 1GCOA 4DBVO 3BTOA 4EGFA 3DBRB 1LRKA 1WZIA 4JBIA 5JCXA 4WOKA 4CQLA 3EW7A 4P4NA 4FD3A 1NYTA 1Y81A 1T2EA 3E03A 4BMNA 1CYDA 4P8RA 2J3JA 2VWGA 3VVCA 2IYOA 3NTRA 4DYDA 1NQAO 2H9IA 4RO0A 1UDCA 1YRLA 4QO7A 2NU6A 4PLHA 4BNXA 4PZEA 4XWYA 2HMTA 4OHUA 5HWSA 3LZ6A 2B5VA 4KMSA 2O2YA 5U1PA 3ROMA 3JSAA 4CLRA 3FBTA 5MDHA 4E0BA 4IJKA 3G1UA 3FNGA 4TRMA 5CEEA 2JHGA 3TJRA 1EMDA 4YA6A 3ZV5A 2NV6A 2NVUB 2AQHA 5CPBA 5TT1A 1R4NB 2CD9A 1KERA 1U7HA 2C29D 3AJRA 3GRPA 3PQEA 5G0TA 1E3JA 1ZZEA 5FWNA 4R5MA 2V6FA 1E3WB 1PGNA 5AXCA 4BB5A 1XYGA 3WICA 5G0VA 4J0FA 3SJUA 1JDJA 1QYVA 4W9NA 5KIAA 1PEDA 1TA4A 3I4FA 4Q3NA 2CSUA 3PDJA 2Y0EA 3PTZA 3K92A 4CMGA 2J6IA 2GZ3A 4OMUA 2QZ9A 5COBA 4J2HA 3NTQA 2CDBA 3LLVA 3NTOA 4NFHA 5AOVA 4FOOA 2NVUA 1B2LA 1I3NA 1R4NA 3BHMA 2UV8A 3D3WB 1LSOA 4RJTA 4IUYA 4WEQA 1M67A 1ONOA 1ZJZA 4J91A 4JQCA 3QVSA 1DIAA 3U09A 2NQTA 1E3WA 3WGYA 1MFPA 5G4KB 1EDZA 3K5PA 2FPIA 1TT5B 2HUNA 5DCWA 4BMSA 1UP4A 3VZQA 1FXSA 4MVJG 1ZK1A 3WWYA 2OBNA 1DOHA 1WPQA 3H9JA 2PV7A 1M76A 4DC0A 2GUGA 5DBGA 3WLEA 2DM6A 3D3WA 1X7GA 5FFFA 4DPLA 2I5PO 3JYPA 3JQ9C 1V3UA 4UVEA 3AU9A 1EK6A 3VDQA 4BOYA 3JQ9A 4NFYA 1E1MA 3R3JA 4D79A 3BMCA 5G4KA 4EZBA 3GNQA 5EINA 2Z1NA 4IDCA 4J9VA 4LSMA 1TT5A 5A06A 5B4TA 1PS8A 1U4SA 1VKOA 3PVZA 3OQ6A 2W98A 2WDZA 5DP1A 4CM4A 4Q39A 1LNQA 3I52A 4O63O 4ZD6A 4HP8A 2C20A 5JDIC 2NTVA 4PRKA 3WFIA 1LDBA 1AN9A 3DL2A 3PPIA 3SC4A 1PJTA 3PWKA 4CUZA 3RJ9A 1ZNQO 5BQFA 5JDIA 4Q3AA 4HY3A 4ZU3A 1I24A 1A4UA 1YB5A 4LN1A 3VPSA 1JA9A 3C1TA 3SLKA 1IB6A 2Q46A 4NJMB 2GERA 2DPGA 4K28A 4XYGA 3C1OA 2ZTLA 3RFXA 5JSFA 3Q2KA 4QFDA 3I4CA 2J5KA 3X2EA 4A73A 4ALKA 2O7QA 4XX0A 3O38A 4KTTE 4CLOB 1H94A 4WNIA 4J1NA 1EQUA 3GGPA 1C1DB 3D0OA 3OJ0A 3ASVA 2Q3EA 5A3JA 4H15A 2RHCA 3HN7A 1T2DA 4OYRA 3TRIA 3FN4A 3OJFA 3ZN2A 2ET6A 4PIVA 2IODA 5B4UA 3ZWWA 2CDAA 2OO5A 2AG8A 1F17A 4CV0A 4YJDA 1ZCJA 1U1IA 3PZRA 3TL3A 3INGA 3K8ZA 2Q2VA 2JHFA 4RLSA 3JD1A 3TF5A 5ILGA 3STHA 2W2KB 4ALNA 2AQ8A 1TXGA 2A4KA 2X6TA 4XGIA 3MJ4A 1T24A 1PZGA 1LRLA 3PHHA 1V3TA 3VH4A 1JWBB 5F5NA 1GDHA 4BO5A 1CIVA 4MJLA 3ZDFA 4MVJH 4NG5A 5H83A 4GH5A 3UAGA 3WR5A 1I2CA 1PQWA 1Y8QB 3GMSA 3DMYA 2O7SA 5A5FA 2PGJA 4PGFA 1RKXA 1RM0A 3EGOA 4S1VA 2H1SA 4Q3EA 2GCGA 3LVFO 3VVBA 1T25A 3AFNA 3AY3A 3FWNA 3QJ5A 1ZJYA 5G0SA 3KYDB 1E3EA 1N5DA 2VT3A 4E33A 1FDSA 1ZK4A 3H8VA 5JC1A 2YQ4A 3HWRA 4FFOA 1ZEMA 4RF5A 2W2KA 2AQKA 1UXKA 3MWEB 4MVJM 2BLLA 2FR0A 3RC2A 1H9BA 2PZLA 3MOIA 1P1JA 2DVMA 3IQDB 3WQSB 1U3WA 2WMDA 1NR1A 3KO8A 4Q3CA 4U0KA 7ADHA 2ZYAA 3PYLA 2QRLA 1IYZA 1H0KA 3KLMX 2Y99A 1P3DA 4M86A 1NFFA 1D3AA 5T67A 1IZ9A 1QLJA 3KYDA 3H6KA 4Y9DA 4B3JA 1ARZA 3PRJA 4BNTA 4J16A 3JQ6A 1YBVA 5CP8A 3AUAA 1VL8A 2HRBA 2VRCD 4EYEA 1SOVA 2BFAA 4D41A 3ETEA 4EJMA 4L9RA 2GLXA 4XIYA 2EXXA 2HK8A 5F1PA 2ZATA 5IFLA 4IS2A 2SCUA 1DFIA 4NK4A 2PFGA 4WOJA 2HAEA 4TWRA 4DPKA 6LDHA 1KEUA 3H5AA 1C14A 4WLVA 4YBZA 2JFGA 3DTTA 3JQDA 4PFJA 2DT5A 2HMSA 4URFA 4DMMA 3NV9A 5CDGA 4FFPA 4DMLA 4E4YA 1PR3A 3DXFA 3WG9A 1D1SA 5TRTA 1L7DA 2X0JA 2X23A 4F6CA 1FDTA 3I9NA 2BKAA 2AA3A 1E6WA 4XGNA 1I01A 3U9LA 4C7KA 4BQRA 1KOLA 4OQYA 4TKLA 3DHEA 2VOEA 3ETGA 4YDRA 4XCVA 1P1RA 5ICMA 1B3RA 4RPHA 1P1FA 2ZB7A 5JYEA 3C24A 1IHYA 4BNIA 1FMCA 2W2LA 8LDHA 2UDPA 4JP3A 3W6UA 3ZV4A 3O4RA 1NPYA 1Z45A 3QWIA 2Y05A 4BNJA 3C7CB 1WZEA 3AFMA 3PLRA 5THKA 4EEZA 2Y1FA 3DFUA 3F3SA 3JTMA 2EG9A 1L1FA 4JBHA 1A71A 1E6EA 2VHZA 4J4TA 5TIIA 1Y5MA 5TT0A 3GUYA 3UF0A 1OI7A 5IN4A 1E7RA 4XDZA 3UH1A 4E31A 4CLXA 1TT7A 1GQQA 4E5PA 3KYCB 5KVCA 3ICPA 4CMBA 3DAGA 4Y6RA 5EMHA 5TJ9A 4IDBA 4ZQHA 4BKUA 1U3TA 3LU1A 5IDXA 1ZXLA 1GL3A 1QSGA 4ND5A 3DHNA 2WJPA 1B16A 4HNGA 2JD1A 3AI3A 1FDUA 1PWZA 2VT2A 1ONPA 5THQA 3ROQA 1GFSA 4XRGA 2ZYDA 4FB5A 2JAPA 1UZNA 3BHIA 4JGBA 1N1GA 1YJ8A 3RAJA 3KYCA 2JCXA 4R1SA 4CM5A 4HNHA 5A9TA 1QMGA 1GZ4A 4HXYA 2BGKA 3SJ7A 3U4HA 4PG4A 4H7PA 4IGFA 4JROA 1UR5A 1PJBA 3Q9NA 3R0IA 5EIOA 5G2OA 4L75A 5JPIA 4LW8A 3TZCA 1QORA 2JD0A 2TMDA 1HL3A 5F21A 4E21A 1F12A 4TVBA 4IDEA 3ZHBA 3ZWMA 3RUIA 4QUKA 3GNSA 4D0SA 2BH9A 4WCDA 3RBZA 3BAZA 2CZCA 5JAIA 3A06A 3GEGA 1EUDA 1D7OA 4KTVE 2RAFA 3BMNB 1ISMA 4KDFA 4N5LA 1ENOA 3DZFA 4J9UE 3RU7A 5KNLA 4NMHA 4IM7A 3K2EA 4J4BA 4OKIA 1UXJA 3KXDA 5BSFA 4E2YA 2VUSA 4YT8A 1K89A 1NHWA 1NXQA 3MJSA 3QP9A 5CDSA 5IXYA 5L40A 4E5MA 2EWMA 1GD1O 1DAPA 2OORA 4AVYA 2VN8A 2DTEA 9LDTA 5DP2A 1Z6ZA 5A9SA 3DZIA 4IIVA 2WE7A 3V5NA 1VJ0A 4R68A 2FN7A 5L45A 2R2GA 3PQFA 4I9NA 3E9MA 4K9DA 1W4ZA 3PFFA 1NBOA 1SMKA 4OSPA 3NX4A 4BNLA 3CIFA 4O0LA 3ZW9A 4XDYA 5G4LA 2YUTA 2Z95A 2EGHA 3FPLA 3ITDA 2JFHA 3EHEA 1NQOA 1N92A 3C85A 4XJSA 5H81A 2BFPA 3DZGA 3VH1A 3FNFA 4CLEA 1I8TA 3NKLA 2YZ7A 4YT2A 1E7WA 4YT4A 5B4VA 2JCVA 3W1VA 4IY1A 3M2PA 5B1YA 1OBFO 4E5KA 1XG5A 1PL7A 1ENPA 1XWFA 4OAQA 1H6AA 1JQBA 2IRWA 1PR9A 3PQDA 4L4XA 1N7GA 3KRTA 1NWHA 3PP8A 5FEUA 3PJDA 2IEDA 4BNHA 4J49A 2VZ8A 1MB4A 3VKVA 5U9CA 2D59A 1A5ZA 1DIBA 1CQIA 2P5UA 1GZ3A 1ZSVA 4IINA 1M66A 2Q4EA 4CV3A 5KWEA 2EEZA 2WWRA 1I3LA 1Y5RA 4BNUA 1FJHA 1LJ8A 2EP5A 4R51A 3HJAA 1T2AA 5BSHA 3ZU5A 4RZHA 5C7LO 3NGLA 3H2ZA 3GY0A 2NTNA 4ZQFA 1LLCA 2FWMX 1EQ2A
chains in the Genus database with same CATH superfamily
4UVDA 1JEQA 2QRJA 3EXEA 4RE6A 2WWHA 3LQ2A 1J5EB 1TLLA 2FN8A 2GKOA 3PNSA 4JZYA 3LLSA 1GYPA 1YL6A 2HU5A 1CB0A 1JL3A 4LNUB 4TT3A 3ZEIA 1S02A 2XW6A 2V6IA 3MJFA 4AL4A 1PGOA 1Y80A 2HNBA 2V03A 4DKXA 3FGPA 1ZY2A 2ZI5A 2R48A 3SEAA 5KC9A 4WHMA 3DO5A 3CZQA 5E9JA 2UXCB 3TXAA 2X4GA 5B7GA 4L51A 3NJRA 5FNVF 4N54A 4R81A 3WXMA 4ZV7A 2A1UB 2ZW9A 3GFBA 2Q1WA 1OOEA 4GVPA 1ESZA 1HGXA 1Z8DA 3BQNB 1LVUA 3NORA 1MRZA 3NHUA 4IH4A 4EG3A 1VQ1A 1FDWA 1QTNA 3T3GA 3QVLA 3FMGA 1ZGZA 3KR2A 4REQA 3TZBA 2HMWA 2JBAB 1D2EA 3M4JA 5CR9A 2OZEA 4ZJPA 2RIRA 1Q11A 4Q1AA 3TDNA 5JAZA 4Q4CA 1T10A 1GCUA 3LMKA 1FF9A 4QUBA 2YWDA 5HP4A 4YJFA 1X38A 4A16A 3FIUA 4CT4B 2C5EA 3O1IC 4LG1A 4MITA 1UBFA 1E3DA 3FUVA 3AI1A 3MD9A 4BAGA 4JR2A 4ERNA 2PHZA 3NHWA 1H93A 2FX2A 2IOQA 2OBBA 2DQZA 3TOVA 3CNOA 4ZA2A 4KGVA 3EIXA 4RQAA 4ZKEA 1GGFA 3USES 3H2BA 1C3XA 2GM5A 3MPUA 4NRDA 3N6RA 5DWDA 4X3OA 4JJ8A 1N6PA 3IHLA 4D3YA 1U2ZA 4BNZA 3FLMA 1G3QA 5I7HA 3S2EA 2VOJA 5JUWA 1TTTA 3SBDA 3TSWA 1BRMA 4O8CA 4RK6A 3MJVA 2GYYA 3GRAA 1MC8A 1P4HA 2WD8A 5TGTA 3RYCA 1XQ6A 1L5MA 3K31A 3OHSX 3AFIA 2EFDB 4CUJA 2FEKA 2WICA 1OI3A 1BZYA 3ASUA 1X3SA 3QXJA 1TCUA 2R66A 3AC0A 3D8NA 3OPXA 1JHOA 4HYEA 1MO4A 2QUHA 2FUEA 2QVLA 3BF8A 3P0HA 4OY3A 2OMKA 2HRCA 4KQ1A 5KWJA 1SKYB 1GTJ1 1CEXA 1BC5A 1SCAA 1LPBB 1TO2E 2IPMA 4DA7A 1VIYA 4URVR 2FETA 4EL0A 3ASYA 5H5JA 3PUJA 2ZYHA 4NBKA 1IK4A 4ZOAA 4C7JA 1HNWB 2VTEA 3N87A 3ZI0A 3MJHA 3UEOA 1NV9A 3ZE0B 4C2TA 2R86A 1ZD5A 4GX1A 3Q8XB 2JHCA 5GVRA 5JV5A 4QXOA 5D6OA 4GLFA 4LIPD 2OZPA 4P5EA 3C39A 5HQ3A 4G9BA 4AJKA 4QU5A 2EFGA 4FFSA 1XR3A 2HSGA 1Y7TA 4DDKA 4BCBA 4IIUA 4TXHA 4NULA 4YP9A 3LAWA 3FNHA 4CG0A 1XLWA 2Y76A 5EJFA 4Q03A 1HE4A 1YO6A 4QYMA 2FPGB 1KO8A 1NX6A 3JALA 1XZPA 4I6JA 4YJKA 2O1XA 2V0NA 3FTFA 3ZTTA 4CDMA 1RRCA 1N5LA 4R9NA 5E2IA 1E1YA 5CDFA 1VLVA 1NVTA 2P4SA 3GCXA 4M1TA 5GIPE 3E1SA 4OIMA 1XCLA 4HUTA 2HNKA 1TJNA 5JI2E 1CU1A 1JU3A 3N2IA 1LTQA 4N3AA 4QBGB 3W8RA 4BATA 1Y3HA 3MT0A 1V37A 4DG9A 2ZSEA 4DCVA 1WIWA 1Q3TA 3PX7A 1WVGA 1NMXA 3W06A 2EW1A 4DJTA 1WVIA 4KO4S 3DZJA 1D2RA 4RTLA 3LJKA 4WZAE 1FYVA 1KAMA 4X94A 3TRDA 4LYFA 2DYKA 2XGJA 4BP3A 3B6ZA 1N4DA 4TKUB 5AI4A 3WQHA 1TYAE 2GN4A 4GW3A 1NZJA 1V48A 3S2SA 3JZFA 4OHZA 2GZMA 1FFHA 2PKCA 4QGSA 1BMFA 1PT9A 2QJWA 5BNZA 4R1LA 1P1IA 2AJBA 1DC5A 3PX2A 1DAGA 1XIVA 4ZOLF 2C7QA 5HDQA 1OZHA 4EQ6A 2YJTD 4X64B 1VPTA 1YDEA 4MRNA 4M8SA 5LLSA 3DHWC 4WBNA 1V45E 2PMEA 1NA5A 5FWXB 3DOOA 4CLRB 1GPYA 1R37A 3UVEA 3HBFA 3K53A 1LSJA 3NWJA 3PE3A 3CB2A 1OPRA 2EKQA 3A26A 3DT8A 4WK0B 2I2CA 1JPVA 4BLTA 3JZMA 5EUCA 2Q5JA 1WUYA 3P97A 5IMSA 3L1VA 5ALOA 1CY6A 1VJGA 2KQUA 2PZMA 4INJA 3TLZA 1W4AA 2LIPA 2IIPA 2RJOA 3CUWA 1ONSA 1C7RA 2GHTA 3SKVA 2AKYA 3F4BA 2NAFA 3F97A 3AB7A 3KU1A 2ECQA 4A0SA 2EZUA 1L5SA 1VDMA 3OM1A 2LXNA 5GP1A 3F5SA 1H4SA 2JCBA 4QWWA 4NI5A 3WWEA 3BGWA 2VP0A 1YE8A 2MT9A 3JY6A 4C30A 1MX9A 3SVZA 1EPUA 4TVSA 2WJGA 2Z1DA 2YYAA 2J4FA 4IJ6A 4RVDA 2GEBA 3VOAA 2FUNB 3MWDB 5CFNA 3RTBA 4EG8A 2J6HA 2FYTA 2ZR7A 3RWOA 3AVPA 3NTLA 2JJ2D 3L49A 1KJWA 1UWVA 5EIBD 3VM6A 1TE2A 1P1KA 2H16A 1K3FA 4DCPA 2VQEB 3DWGA 1BXGB 2NTJA 1MOZA 3ZHQA 1ZJ5A 2GEJA 2XPCA 3RABA 3TQTA 3USZA 4B82A 1OVGA 2VTDA 5KSWB 1I7DA 3R9WA 5B6JA 2NU9B 3G5TA 4D6YA 1OZAA 4ALMA 5ADUS 4KJZA 5DZSA 3ZLBA 4B44A 1I80A 3RJTA 221PA 1NDQA 1XKXA 1GNVA 3THYB 1EVIA 2PA3A 1CULC 4DM7A 4YJHA 3DXYA 1B1AA 2FSVA 3DE5X 3E0QA 2G9VA 3I9FA 1T6YA 2PWZA 3LXRA 2G7ZA 4I8XA 4EY8A 1W36C 3TZQA 4RK7A 3W5DA 2EJVA 2JDIA 3EGEA 4R3WA 5FOVA 3CEAA 1PGPA 4Y1FA 2P79A 2V1UA 4HDKA 3LRPA 4R1TA 4Y2QA 4TUYF 4LK2A 1DLIA 3QHPA 3K8YA 3D1LA 1MP0A 3TSAA 1U81A 4KH0A 3H0EA 1OU4A 2DHDA 3DEJA 2EX4A 4I4TA 3MBOA 2X14A 2F7SA 1N0HA 3DV2A 4B74A 2OO3A 3BMCB 1ODFA 3N0XA 5F9HA 4ARZB 2H1IA 3HB7A 1JJFA 3R7NA 4H6WA 4OOFA 5JHGB 3R5TA 3B1WA 4UBNA 1JIKA 1YS4A 4BLVA 5A7FA 3B6JA 3AEQB 3M2TA 3TRHA 5ITVA 1DBIA 3RV4A 1RZVA 3ZD8A 1PGJA 2JJ1D 4WGGA 1W0JD 1LTHR 3W3ZB 3GP8A 2V0GA 4AJ4A 3PNKA 3U16A 1GTL1 1M2HA 2H4YA 4KR6A 2ZLBA 3HEAA 1IY1A 3W78A 1Q22A 1EK2A 2JASA 3KC2A 5C1PA 3BJZA 3D6FA 4UULA 3NTVA 5IDWA 4ENPA 2WF8A 1OE0A 1M2WA 4FZ5A 3RIEA 4NU0A 4ZAYA 3WKAA 2VDRB 2I2AA 4DDHA 3WMXA 5E6SB 3DMDA 4W8GA 4A7PA 1GU0A 4EL5A 1K0FA 4LE2A 1RLMA 4ZO9A 1FSPA 2BCJQ 2YXPX 1J97A 1V47A 2O1WA 5JPDA 1N9GB 3CWCA 1MB0A 2KYRA 2R60A 4KUGA 4MIKA 2Z6UA 3THOA 5CVUA 3FI9A 3R3YA 3QXCA 4A8PA 5A0TA 3H1EA 2X5KO 4DCCA 3E5MA 5DK6A 5HUHA 2PJRA 5KAPA 3FYTA 2W6NA 5GZ1A 2EBWA 3IIJA 4IPTA 4DMKA 1JIXA 2WOOA 5JAMA 1CZUA 3DDZX 4FNOA 3VNRA 4CL8A 4WLEA 3O73A 5BUCA 3I6ZA 4XA8A 1UK6A 2I87A 2OXFA 3H4MA 5HIIA 3N7TA 2DUJA 3FCEA 3PJEA 1H2RS 4GP9A 3B5JA 3ZHYA 1IN4A 3IRUA 1S8OA 2WEKA 1Z39A 3EVAA 3KDSE 4M38A 2B2CA 5ICFA 3T7JA 4HGQA 4MJ7A 1AM4D 1L4LA 1NLFA 2EFHB 1GL6A 1JKJB 2EC5A 2PY6A 2QSUA 2WIAA 3ANXA 3C1AA 4IDDA 1NRWA 4L07A 4R1QA 4YAJA 3VR6H 4BNGA 3A6PC 3LY9A 1TM7E 5KYTA 3W1WA 3TO5A 1GPUA 1JT2A 4MCAA 2C1XA 2WF9A 4PHTA 1XQ9A 4ZJYA 4M98A 1U2SA 1A9TA 1SURA 4RF4A 2ETXA 3FF4A 3LQKA 3OZRA 4LGVA 1S3FA 2R6FA 2H63A 1NMYA 1T35A 4K1LA 4LHXA 5EZYF 3LC7O 4GMFA 2I3GA 4RVFA 1EVJA 2JLAA 2D7JA 3X1KA 3L4KA 5JYBA 2P2LA 2WLTA 1V9LA 4AJPA 5KYUB 1Z63A 1W4RA 3WHLA 1A96A 4KIJA 6Q21A 5JQWA 4RZQA 3W5VA 1S7CA 1RLOA 2APJA 3B89A 1P72A 5C81A 3KELA 5K1ZA 5D00A 5F1KA 2IK8A 3RANA 1NATA 2IXGA 1R6UA 3NC0C 4AAYA 1Y1SA 3R3ZA 4OP2A 1KSGA 1OD6A 1K92A 1YB7A 3C3AA 3TIGA 4ETNA 2J0QA 3PRHA 4R1UA 4ZT6A 2WD7B 3FZYA 3DZKA 3G5AA 2WTAA 4LK3A 3WOVA 2OK8A 2TECE 4FWIB 4OUDB 3KLNA 4YN3A 5H80A 2RIPA 3HDYA 4HEA6 4JIMA 2GDZA 3LS2A 1HI9A 2YW9A 1E63A 3GA7A 4ZCIA 2BEWA 1RXCA 1D1PA 1ML3A 1R50A 2AE1A 2XDWA 4IV5A 5J5AA 5C8ZA 2ZIWB 1DBPA 5JRZA 2ATXA 1ABEA 2GN8A 3OJWA 4HYQA 4TMWA 3BGDA 1VL2A 3IIEA 3INTA 3PK0A 4JR1A 4CM3A 1JPUA 1OFGA 4OFBA 5CDFE 1NVFA 1NW6A 1Q1AA 2RCYA 4LBZA 2YHIB 2NU7B 1B8PA 1ZD2P 3CVXA 2Z5VA 3TUZC 3MK31 4MWBA 3R2JA 3H2SA 4JBYA 3F5QA 4YMGA 3BTSA 2C1ZA 3LKBA 2W90A 1FRQA 3RK4A 2HHJA 4E30A 1MABB 4DNQA 2B5WA 4IUCS 2UVPB 4Q9AA 3UHPA 5A71A 1JI3A 1TUBB 2WDPA 2RK4A 4GSKA 1HOTA 3F1LA 2WNHA 4LCBA 3KSAC 3QFFA 1A82A 1JR3D 1JSXA 4F21A 3QOWA 5FOXA 1N77A 1R5OA 1JEDA 4HS9A 4XR9A 2CVQA 4CL0A 2B4QA 2IYPA 1QP8A 2VNKA 4YHBA 1E62A 1FTWA 1M1NB 3EPPA 2A0KA 2CNBA 2QM3A 2VNAA 3RUFA 2WUFA 4NIMA 3UOGA 4ZQGA 3UA4A 4D8WA 3HU3A 4H6XA 4LOAA 3R4CA 4G25A 3DTVA 4YRAA 1ZC3A 3M9LA 1GFZA 4P34A 1LSUA 1FS5A 4TL6A 5CM2Z 5AKIA 4W6ZA 5CJ2A 3KHUA 3VC7A 2HO5A 3DL0A 3PDIB 2FTKE 5K05A 4CTKA 4RHUA 3S3TA 5BXQC 3ZJTA 2H7XA 3PIIA 4WFJA 2ANCA 4LJAA 3EA5A 2VI5A 4KQWA 3MGGA 4FMPA 2Q9UA 1UBEA 3F7TA 2W6MA 4FE3A 4LRQA 4EDFA 1NT4A 3DAYA 4WXPA 1X0XA 4ND8A 4XGQA 3OA2A 4NYMR 2P5YA 1TW3A 1XKTA 1MENA 1RWBA 3HG7A 3I3OA 3S2GA 3LCUA 2HJHA 3A14A 1T8TA 2SHKA 3O47A 4OYYA 2EERA 4KXQA 4BO9A 5L3QB 3NWBA 2N47A 2CXHA 4RVSA 4BC1A 4RKYA 1XDGA 2CDRA 4N5NA 1V6SA 3IIKA 4RLHA 2IGTA 3RJ5A 3WYEA 1GPH1 4D7AA 4QJ4A 3AUSA 3WGIA 1G0NA 4WERA 1CNFA 1IAVA 4JB0A 4QOJA 1B41A 2YZKA 4QDTA 3ZJUA 4YO7A 4DV0B 4RTRA 3M49A 2Q7OE 3AV3A 3RC1A 3QQPA 5J9FA 3W8NA 3L40A 3RIMA 1PUIA 1LXCA 2PRZA 5HJEA 4U3JA 1U4OA 2GCEA 4JJIA 3R0ZA 4RCZA 1NPDA 2E49A 4NH4A 3IFSA 3ZCXA 2PS3A 2PX5A 1GGVA 3UTDA 3TLXA 3AVOA 3QEBZ 4YRMA 2GBCA 1VSQA 2YUIA 4HVCA 5BSVA 2VSOA 2I65A 2WABA 4HB4A 5A03A 1GCGA 3LF2A 5JO0A 5ESDA 5IRCD 3HU2A 2W8ZA 1YR1A 4RF2A 2CEAA 3GJ5A 4RMNA 1RM5A 1EINA 2O8BA 2V96A 4DR1B 1M8JA 2IH2A 2J9RA 1P9LA 2VF8A 3QA9A 4G1BA 3VKUA 3TQIA 4FYVA 3RUHA 5JNUA 2DPYA 1WR8A 2YJGA 4M83A 4ARBA 5J2UA 4M1QA 5CA0A 3MSCA 4YCBA 1BD3A 2AMLA 2J30A 3ZXIA 1JDTA 4TKVB 2OHOA 2BZ0A 4Z0NA 3W77A 2WAOA 4YAGA 3W34A 3EVTA 2XTZA 1IULA 5T8KC 1OYWA 3ZGXA 1GT6A 5JCOC 5F9FA 1OTYA 2ESRA 3EZLA 3QMVA 1WCYA 5JCOA 4XDGA 5T8KA 1NW4A 1ZK0A 1Y5IA 2BTOA 5LWQA 1NURA 3DVLA 1E5LA 4RIFA 3QPCA 4WZAB 2QY9A 1WNTA 3NM6B 4K8RB 4WCFC 3GDGA 3LOPA 1FQWA 4D6PA 1HYHA 1YQTA 2ZJAA 3AKYA 4JV5B 4X65B 1JBQA 1IEVA 1DAFA 1WCV1 1WS6A 1Y8RB 1UIRA 3VHQA 3VPGA 4A6PA 1CW2B 4AZ0A 5BVGB 2C9CA 2CDCA 1YMVA 3H5NA 1YF3A 3A6LA 3CPJB 4HX9A 2FZ4A 4CR6A 1KZ4A 1WMBA 1UBKS 3X1JA 1M7GA 1LUAA 2FEOA 5JS6A 3U5TA 5JADA 5CXUA 1JYFA 4A8JC 4CUKA 3NCTA 3OTGA 3D6HA 3OPVA 3QBTA 1FLAA 1K6JA 3VZSA 3KZCA 5ERYA 2HLHA 3X1WA 2J3QA 1DXYA 3HRKA 3L8EA 3OP4A 3L8CA 3JYHA 1S1MA 3WSVA 5CG1A 5HFNA 4KMMA 2EBFX 1MPXA 1RHKA 1ZKDA 3KVRA 1QR2A 5GOZA 5KINB 1U0OC 1CG6A 1FW8A 3MMSA 4YX9A 1YASA 2D4HA 2QL5A 3K9BA 1SO8A 4KR7A 4X66B 3D6VA 1EDDA 2X2PA 4MB2A 4PINA 2P0YA 2YXLA 3HDHA 4YT5A 3UB2A 3VPXA 1CEYA 4YUXA 3GN1A 4H16A 4HB3A 2BSAA 2R8XA 3DR3A 1PJLA 4ACBA 4D8YA 3OZ7A 1TVMA 2IX9A 1TMKA 3EGXA 1L5FA 3IAHA 4C4YA 6ABPA 1NJ8A 4OMCA 2OG2A 1D2GA 1OIVA 4AJHA 1EWKA 1ISHA 4XEUA 1NQXA 5F4BA 1WMDA 1AUPA 5IARA 3P9NA 4OLFA 2G71A 5FI1B 2WVAA 1E9BA 3BN3A 2HK7A 3H5VA 2C3PA 3O4FA 4HUQB 4M0FA 5EIFA 5HFAA 2XF2A 5KHAA 3QKIA 2G0AA 3LPAA 1TYEB 4A26A 3R6GA 1VSVA 2IPLA 4N7JA 1FFXB 2AXPA 2IZ7A 4FHFA 1IY0A 3B78A 4MEBA 1PW7A 4C0AC 1F14A 3VR1A 2AFIA 1OTXA 1UC5B 1MFZA 4Z7QB 1T2FA 1RRFA 2B3DA 2AMYA 1S2IA 5B1HA 2ZVDA 4W1PA 1HNZB 2NYAA 1I1QB 3U7FB 1IPFA 4RZXA 2HJRA 3TGPA 3ELYA 1AIPA 2CK3D 3OVMA 3PVCA 2GQ0A 2P9EA 1BX1A 1JBEA 2EDCA 2NOAA 1UP6A 2IE0A 4BU0A 1SCKA 4I50F 4CEJA 1EFTA 1PHRA 4YQYA 3ICEA 5KMGB 4BUJA 4QJIA 1US8A 3MT7A 1MG5A 4DJAA 2FZEA 3K35A 4II3A 3W5IA 4M9XA 1ND6A 4ED9A 3L8HA 4RLQA 3ZOZA 4EPRA 2WIJA 5KTYA 1GPKA 1JHMA 3IOCA 3TQSA 1HEYA 1TUGA 2IV2X 3VO2A 3KBBA 2JLWA 4J0QA 1MO3A 1BHJA 2H3HA 1QRSA 3OA0A 2EW8A 3WHKA 1IBSA 2IEBA 4DANA 3WWYA 1II0A 3EZGA 4FILA 3ME5A 3BF7A 4KN8A 4G67A 3SJZA 4DYVA 2QQEA 1LBQA 3QE4A 4OKSA 1CLUA 3CX3A 1KPIA 2DHEA 4XVHA 3V9AA 1T3TA 1A9XB 3EIEA 2C77A 1Y6FA 2Y6VA 1U7DA 1EB8A 5F52A 1CERA 1F8XA 2P75A 3HKBA 2R5FA 1NW3A 1JEQB 3Q3GE 5LZ7A 1JEEA 2QVGA 2QYHA 1RMQA 2PQMA 3ECCA 3FTQA 3MC1A 1E6UA 1X1TA 4LKRA 1PWEA 1ADBA 2ANBA 2C5AA 5D1NA 3TOZA 1WWKA 3JQBC 3TL2A 4CDNA 4DLZA 4DLSA 5LQJA 1XCPA 4RJLA 1RAFA 2PUDA 2OOSA 3JQBA 1M0TA 1FU4A 1BOOA 2HPVA 5C32A 2I7VA 5LOVB 3C6ZA 3L01A 1QOZA 1J8VA 2C5SA 1LKZA 3G9TA 5BNTA 4IQ8A 3I9V1 2OYSA 4ADSG 3SHOA 4BKRA 3EGDA 1LK5A 4BO7A 2ZBVA 1XRNA 3AY7A 2Z30A 2VP2A 3LUJA 3O8QB 4LJ8A 3BRWA 4HDSA 4RK5A 4ZYLA 2ZB3A 3L6OO 2VYFA 3AG5A 3WHIA 1DXOA 3ADPA 4MYUA 3DMGA 3Q3HA 4DV4B 5IHPA 1H2BA 4PZAA 3SFTA 1EJ0A 2H48A 4MO9A 4UBIA 4REQB 3UHOA 1KBOA 4YXWD 2PT6A 3ZYCA 3FGZA 1XK6A 2PKEA 3OCVA 4N01A 5KU1A 3SM3A 3P2YA 4ESOA 7MDHA 4DL9A 1Q44A 4UTNA 3IQFA 4YJFB 2G07A 2IOFK 5D3MA 1TTQB 1XQXA 3U49A 3O4JA 4K9KA 2M1ZA 3P2OA 3PEVA 3OF2A 4C4SA 1JG7A 1MRNA 5H3CA 5IJAA 4KLRA 3RD5A 3UANA 2O2XA 5LQDA 4PV7A 3D8TA 5COQA 4EHDA 4OMDA 4MUAA 1WD5A 2J0VA 2CUKA 2EHJA 3F3KA 4DGQA 5TGZA 4TTIA 1W6RA 1GSIA 4BJHB 4GX5A 3P27A 2FPSA 2D6FA 2BW0A 3F6SA 5BP7A 4HVAA 3GLRA 2UUBB 4HGRA 4F46A 1SRRA 1XRJA 2EFYA 3RYCB 3L7BA 3FPCA 3JWHA 2QT9A 3SJBA 1DRUA 2VJBA 5E7JA 3IUNA 5I6DA 5IDQA 3EWSA 3V97A 4GR9A 1O3YA 2H7YA 2BEVA 3A9VA 1AKYA 4YMLA 1W85B 1P0PA 1ZUD1 3OBBA 1ATIA 1L1EA 3N2GA 4HDAA 3OEWA 3FG9A 1L7BA 4G1CA 4IMRA 4YPOA 4O5AA 2D1RA 3N3BC 3NC4A 3RRBA 4CI0B 4MROA 2XB4A 1GNPA 1CUBA 4NBSA 2B1RA 5EJIA 1H2FA 3Q0EA 4ASUA 5LM3A 1HDYA 1KNQA 3K0CA 3L1HA 4MVWA 5JJBA 5DLQC 4FHCA 3KSBC 1NR7A 2ISCA 2NP7A 1BDJA 1DTEA 3DVAA 4LYAA 4ARVA 2PKQP 1VL1A 5C7IO 1JSRA 3DZDA 4FSDA 3HLKA 3HJCA 1Y3BE 3MB8A 2QN9A 1L8XA 3QOXA 4XD7A 3TM5A 4EKGA 1A2KC 3UN1A 1K97A 2HWUA 4RADA 1I6MA 4D0LB 3PRKE 4RVHA 1C0PA 1Z29A 2XLBA 1UXGA 1Z8NA 1D7AA 2ENWA 2XZPA 2I67A 3GPBA 4JJGA 3MZ0A 4DZZA 2BM8A 3DVSX 3F6EX 2GVDC 4J0HA 1T6ZA 1UQUA 4R8KA 3JQAD 5K6AA 1H3NA 4OU4A 3KXIA 1J1UA 3WIVA 2UZ3A 1QP0A 4IH9A 1M8GA 5PNTA 1Z0IA 3LUDA 1EH5A 2NLOA 1J22A 4LXTA 1HBJA 2C31A 1AD2A 4MRRA 4UU7A 1TJ5A 4P4TA 4L0QA 5HDBB 3CVOA 1J0XO 3E81A 1SBNE 1BEZA 2JI7A 3EGVA 4H77A 3GJTA 3SF8A 3U4DA 1RPTA 3S1AB 3CGWA 1S9DA 1W52X 4NAHA 1XZDA 2W22A 4IQFA 3OPYB 3O2NA 3QRWA 4U0JA 3WGKA 3JARA 2AZ4A 1U0JA 4AJJA 1MAUA 1ODLA 1W19A 3ABZA 4PX5A 4A6DA 1N34B 4PC2A 3ZZNA 3PE6A 2J3KA 1ZLXA 1ZJ4A 4FU0A 3K9HA 4BGIA 4ZCMA 2RONA 5B37A 2A7QA 4V3CA 3U80A 1PWHA 5J23A 3OQOA 1G20A 1J8YF 2C7OA 3ZNOA 2OCPA 1PJSA 4P3PA 4F8EA 3JWEA 2OC9A 4S12A 2PT9A 4ODIA 1UEJA 2WWWA 5THXA 5KO2A 3DFZA 2WBLC 3NUGA 5DCUA 3GZNB 5D87A 1Y4DE 5LMNB 1ZN2A 1MT0A 5EMKA 1LRJA 4CKYA 3LC2O 2YJNA 1IXZA 1PR1A 1N36B 1JR4A 4IDQA 4MHOA 5C5IA 4DUZB 2PVCA 1XJWA 4ZAZA 4ROSA 1PSZA 4ZTUB 3L0IB 3FLAA 3K2IA 2NADA 3K0SA 5E4YA 2RGGA 5DYTA 3WBBA 1HLPA 1IVYA 3IKVA 1RI4A 2DSNA 4MLCA 1I7QB 5EAIA 5K0GA 2DB3A 3IRVA 2X7XA 1C7QA 1VMDA 3BS4A 3L0PA 2PTHA 1S2DA 3LX4A 3DQPA 3TLYA 1ZICA 3FHLA 3G0OA 4MMYB 5KCMA 5I9LA 3R3SA 1GFWA 5BMVF 4WECA 4N6OA 2AFIE 4JK3A 5FUWA 3CJTA 3GWZA 3LOUA 1GA6A 1SUDA 3VPHA 4MV7A 3CC8A 1RAIA 2X7JA 4Y9SA 1MJNA 2RSLA 3E27A 4IRUB 8ABPA 4ETWA 1R0CA 4YJHB 4CMAA 2DETA 3I23A 3R5XA 1Y5LA 1NLMA 1RXIA 5CB6A 1Z16A 4EFKA 4XD2A 3VBEA 3ZR4B 1U7ZA 5TMBA 4TYNA 1W36B 2YHBA 4JI8B 1U2DC 2BGUA 2YBDA 4UHBA 3KTFA 5ALPA 3SQDA 2GK3A 1JXAA 2CBGA 2WKPA 1RPNA 4FCWA 1TM1E 4HFJA 1U2DA 4IIXA 4PVDA 3LX8A 4YLEA 1PLJA 2FQ1A 2LDBA 3FR8A 3UV6A 4I1RA 1IPHA 4LBVA 1ZD8A 1ECFA 1UP7A 1UMKA 1YIOA 4QQRA 2BGMA 3STYA 4BEWA 1ZFNA 3ZTYA 2HDNB 3QPBA 1HFEL 1NP3A 2P6PA 3HJGA 4KVFA 4NATA 4E5NA 5C5CA 5TMEA 3ZU2A 2BFDA 1N1MA 3FYCA 3IP5A 3OE1A 4MLDA 2FF5A 1FYXA 5KSPA 4M8NE 5HBGA 3U7HB 2I4OA 5DHAA 5BYBA 3KYIB 1YE5A 3MLEA 2QD2A 3ADOA 4OXNA 1DRVA 1C80A 1NX9A 2YICA 3B53X 5C8VA 5ALTA 2C7RA 2IZ6A 4L4UA 5BQ5A 2IYLD 2CNLA 2O8VA 3W1EA 5EGSA 1KJQA 3ZD9A 5IS2A 4DR5B 1AQUA 2MYUA 2WC1A 3QHQA 1ORWA 1OMOA 3WGUA 4JQSA 5FYDA 2Z8ZA 5KBYA 1Z68A 4WXEA 3FCCA 5JMOA 5T4FA 2I66A 5LBUA 2CHUA 1TQ6A 3KJZA 2C83A 2WV7A 3B82A 1NUUA 5EEHA 3FWYA 1UBGA 3TE7A 3ZJYA 4I9GA 2JJQA 1GLGA 1GL9B 1M3SA 1ZG3A 3G7UA 3KFLA 3P9IA 2AXEA 3R1IA 4PRLA 4UZSA 3NNNA 1DT5A 5DJ5A 3QNMA 2XXAA 2IX3A 3RTAA 2X22A 3PLAE 4BLPA 1F6BA 2R5WA 3F9IA 3U7JA 2XMBA 1E7QA 1DKOA 3L0BA 4BBZA 1KK2A 1QV7A 1DADA 3E4CA 3MQ4A 1X7WB 4IOJA 4CL3A 2ZJ8A 4EFMA 1L7OA 4L8YA 3ZHSA 3EX7C 2FRVA 4FR5A 4Z99A 4ESEA 2DZDA 4IWNA 4W9RA 3DFIA 2GBLA 4K7JA 3SSOA 1ACMA 3IDOA 4UBOA 4N41A 4X54A 3Q5DA 4CPDA 4F7WA 2XNCA 4GL4A 1EZ1A 2C92A 2IYQA 2Y6UA 1KI6B 4NPCA 1D04A 1RM4A 1L1RA 1CY4A 4MVXA 4YACA 1B8UA 1I5OA 1EFRD 3NP9A 4K2HA 2Z4SA 4C7XA 4QG7A 4DLAA 1FDVA 2JS7A 2JKZA 1QFYA 2NPIA 4CMEA 1O0CA 2I2DA 3AP1A 2FFJA 4NE9A 1KWGA 2NVBA 2R6R1 3TD6A 1CJCA 2CV1A 2DPHA 2PMKA 2FJPA 4ILKA 1YSCA 1AS0A 2IEGA 1RRMA 5LCXA 3UT0A 4EG6A 5KHLB 3A9RA 3S4YA 1AGPA 5AICA 5DV9A 2QN7A 1J4AA 3OE7A 3UQZA 3AB8A 4EENA 5AXDA 2VHXA 1JZTA 4ZT3A 1PD1A 3JRNA 3QSGA 4GP6A 4AF7A 1SD1A 4EHNA 2AEJA 1K1EA 2WKRA 1JVBA 4I4IA 3URKA 2HXSA 4EBFA 2IT1A 1V8OA 1Z5GA 3N7UA 5DXFA 4C04A 1OBVA 2O3TA 4PLZA 4QQNA 2VP6A 4D9CA 3VPDA 3M7IA 1QZTA 3KWMA 1LPOA 2BEJA 3RRMA 3ZHZA 1FPQA 4BHTA 5L4SA 4RTNA 2Y1EA 4GX0A 1JR2A 3VYUB 3DLIA 4U2DA 2CY0A 2NZVG 4RCYA 3AUYA 2CL6X 4B09A 1YA6A 2GHRA 4ZOEA 1ZESA 5JXGA 3LA8A 2G9RA 4F97A 4HFMA 5BSKA 1SUEA 2CLMB 2OHVA 3QU4A 3CFYA 2BE7A 3GLKA 4NDNE 4Q4AB 1F8UA 1IVNA 5KOYA 3HGMA 2XZDA 1JIVA 1F0YA 1OXMA 2BEWB 3WZLA 5EJ5A 5K0ZA 1AK1A 3K1YA 5JRDS 1AZWA 3PS9A 3QUTA 1JSZA 5CCEA 4Y2XA 4D3SA 3SEFA 4D9HA 3IP1A 5JSQA 1MX1A 1NSTA 2F00A 4YMUA 5K0BA 1P6XA 2AN5A 1RCUA 2D0IA 2WHEA 4IMPA 3RS2A 4AQDA 4MHTA 3BZWA 5F1OA 3NVKI 1EZ4A 1P0MA 1NN1A 3OHPA 2HSJA 1NW7A 4H3VA 1OZFA 3FE2A 2ZE7A 2F43A 5DBOA 1K4KA 3QY9A 4LJSA 4MQFB 1H3EA 2JVJA 4ZVSA 2GB4A 1G21A 3MM4A 4QBHA 2FQWA 2GPWA 2OO5C 4LV8B 1QF7A 2W8BA 1TM3E 1BEEA 1TD1A 2J8ZA 2JI8A 2PANA 2REXB 4M8LA 4ZO6A 4NJMA 1HE5A 5AVYA 3AUTA 2ZIUB 3OH8A 5J1SB 2W2OA 2G06A 3DAHA 3GDWA 5ITZA 3ZHXA 2C4NA 1TAGA 2GPYA 4WK4B 1IQUA 1WXQA 1UEIA 2RHJA 2DHRA 2VYNA 3L0OA 4IVRA 3UTCA 5K8CA 1OV4A 4CLOA 1U8CB 3A1EA 1ONNA 2PMFA 4A2CA 4MWCA 5ES4B 1IRXA 4Q1DA 2B4RO 5LC1A 5I8ZA 2OAP1 2W4QA 2Y1GA 3BG5A 1IAQA 2FW8A 4MUEA 5F2EA 1NNLA 1X9GA 4D0NA 2BYTA 3BRQA 2Q27A 3LT5A 1EIWA 3A0UA 2I62A 4LYJA 1Q19A 1U5BA 1U2RA 1MOPA 3AM4A 3EVDA 2ZCUA 4Y2PA 5F4ZA 3LQFA 5TX7A 3VRHA 4CKCA 5JZMA 5C5EA 4BN5A 2GPTA 4F5YA 2Z57A 4US0R 4B71A 3RUCA 2FR1A 3BIWA 4P22A 5JCJD 1EHCA 1Y9AA 3A3YA 3SQXA 3WDLA 2Z5FA 3DHYA 2HIMA 3IPXA 4UVGA 4X6UA 3RVOA 3VR5A 1VSUA 2CXPA 4N0QA 4X97A 1C0EA 3UAOA 5DHTA 1CZLA 3GLQA 1R6BX 2O8DB 2H0QA 2V0CA 5AVWA 3E3NA 4B31A 3EPJA 4BGVA 9MHTA 2B1GA 2XTAA 4EECA 4CU5A 4ER0A 1Z7GA 4BFUA 1PFUA 4UNQA 2Z6AA 4KR0A 5FUMA 1CZHA 2I3AA 1FFWA 2ZYVX 3SZ3A 4CN8A 2P3QA 4L9AA 4L9SA 4GQAA 5JZBA 1G19A 4CE6A 5BSWA 1XVTA 4FEGA 1Z07A 5MN5A 2PBLA 3RRYA 3T15A 4U3JB 4ER7A 5LD2C 1YR9A 4AD8A 1VI2A 3C3JA 5GQSA 2HA7A 3I6BA 5FBHA 5BV1A 1N5JA 5AJTA 4H18A 1FDIA 2YY7A 4NFLA 2FN3A 3DEHA 3HJTA 3BD6A 1Z34A 1XKLA 3D8BA 3JQ8B 4K6HA 3GUUA 1GM5A 5CFRA 2GA8A 1WG8A 5EJ4A 5JQGB 3EBPA 3E1GA 1ML4A 3TCXB 2BBTA 3IUQA 4ZREA 4JLKA 1SUIA 1SBZA 4H4DA 1PJ8A 4L4SA 3IJPA 1VYVA 2G40A 2YDXA 2VHVA 3R6LA 4KXYA 1EJBA 5J2UB 3SZGA 4B43A 1DRKA 5JBIA 5CA0B 3ZJVA 1QV9A 3M4ZA 1SVOA 3G1TA 4HYTA 4UUNA 3Q1KA 3OLZA 1Q7EA 1W44A 3O74A 4JYMA 4PHFA 1AKMA 1QM5A 1M34A 3C41J 1GUBA 1KARA 2ZROA 4NFSA 1ZMTA 1SU4A 2P2GA 2X40A 4R1OA 2IW3A 4EA7A 2RB4A 3G5MA 1S2LA 3PFWO 3RWMB 3IXLA 1LBEA 4QOFA 1DJMA 2BEUB 1WRBA 4ITRC 1CR4A 1O1YA 1WMFA 4ZRNA 4PO3X 3GNTA 2E9SA 3U60B 3X1ZA 4MVJD 1DWPA 3BJIC 4WCFB 2ZRFA 5A4FS 3DQZA 4DRYA 4J0EA 5DFAA 1Z6AA 1YNOA 4G0ZA 3E1KA 1BYIA 4GDMA 1ZIDA 4YQZA 4BMCA 5HW0A 4Z3KA 4EYQA 2QG4A 4GXQA 1VMEA 2PBFA 3HA5A 2H29A 1DIOB 4ZT2A 4W8OA 4OQNA 2GK7A 4BPBA 3S8YA 4MDHA 5FUQA 5C3UA 3MSXA 3EDQA 2QIOA 4XB1A 3FD8A 3HR8A 3O03A 4V0LA 5ERXA 2FXIA 3S5UA 2XEXA 4A8JB 5IT9A 1ZMOA 3NIWA 1KEKA 2XCTB 1NBEA 2R6JA 3A6KA 2BFMA 1BCRB 2DP4E 3JVEA 4MTLA 5DTRA 4HXEB 1EUCA 5DTEA 4X62B 1MGPA 3IUEA 1E1QA 3A4IA 3B1FA 2BGGA 4Y2YA 4O29A 1U7OA 3GAMA 3SJAA 2HJ9A 5GVSA 4PSCA 1GKKA 4F85A 3HDJA 1T3HA 4IQGA 2WAAA 3MILA 4NCJA 4BC0A 1BWRA 2CB0A 4G5QA 4IOLA 4JLBA 4II2A 3WE7A 2BHRA 4G1VA 1YFLA 2PUFA 2TMYA 5A05A 2IYNA 1YB1A 1HDEA 1KQOA 2UYYA 3I72A 4JN6B 3EGXB 2FPPB 4HZUB 2MR6A 3AOGA 5AKXA 2WMOB 4AUMA 5A5DA 2B35A 2A84A 1QFJA 1R5BA 4QUGA 1COWD 3S55A 3CG4A 3FFXA 4UFNA 1JG3A 2YJ6A 1M2OB 5ESXA 4TN1A 5KOHA 4C7VA 4KN6A 4O63O 3SS9X 2PYZA 3MCZA 4B7XA 3BFJA 3FUWA 2PS9A 2GR9A 2R1VA 3X44A 1RLJA 4DR2B 2C0CA 4YHHB 4NEQA 3UV7A 2FXVA 2QGFA 4XOUA 3NQ41 4YRCA 1DAIA 5AKHA 3KQHA 3REFA 4U63A 3T3NA 3OAAA 3Q4GA 4ON9A 3GJQA 4PLCA 3VGJA 2H4XA 3K32A 5CW1A 2X7HA 3M3DA 3P0EA 4BO3A 1AC5A 1XE3A 3WGHA 3WBFA 4W5TA 1ZU5A 4IV0A 2VJKA 1UXIA 2Q41A 3ZKWA 3KFXA 3L2OB 3PNPA 4CETA 4HAYA 5DXAA 2IPNA 5JLAA 4MHSA 4E70A 2GN9A 1G0OA 2PS0A 5C80A 2O8EA 4GPEA 1ADGA 1BX0A 2C2GA 1T5OA 2HLDD 4XXHA 1EXWA 1UJBA 3M81A 2IZ1A 1Q3HA 3JATA 4GLLA 4ZOQI 5LSAA 4BBJA 3RARA 4KQCA 2G77B 3TQRA 3FHOA 3SXJA 1EJ6A 2WU1A 4WY2A 3RUEA 2D00A 1ICIA 2OHIA 2RHGB 4FGZA 3TX6A 3JX9A 2XV1A 1F2DA 5DX1A 3ZY4A 1P7VA 2ZYWX 3AM5A 3C3BA 3CLVA 2BM9A 1B14A 3CE6A 3UY4A 2WSSA 3ACBA 5HRCA 3DMPA 3F46A 1IBRA 4GGOA 3BREA 3TAHA 3OX3A 2EHDA 2Q45A 4Y3UA 3HKBB 4LGYA 2D7DA 2HWKA 4NBRA 5EVCA 3MJRA 5JU6A 4YCSA 4YV1A 5ESRA 3UKJA 1ZN9A 2BFEA 1CP2A 2XH8A 3MCUA 2P0EA 1LFDB 1TQDA 1NHGA 3RQIA 5HHTA 3NHBA 1LLDA 1L6IA 5INTA 5JROA 4ZJUA 1G21E 2FG6C 3PNVA 2OPBA 2ZRCA 4KH1A 1NJ6A 5F3DA 3P0RA 5I4BA 1RXWA 1UC8A 4CV2A 1FFGA 4D4MA 4LF8B 3LCRA 2FRDA 1RC8A 3TTYA 4PLPA 4NP6A 3BMNA 5BNIA 4E15A 4HDSB 1NAHA 2IEIA 3WLJA 3M70A 4C9BA 2H11A 2IYEA 5PGMA 1K5PA 1TQ8A 3WIUA 1NU8A 2B5OA 3AUUA 5I3CA 1P33A 5ER9A 5H3LA 2XKAA 3UXEA 5J4YA 1NRXA 1NZFA 1G8SA 5GGYA 3H83A 1UKEA 4QLAA 5JDCC 4E7PA 5EUMA 1YD7A 1P2TA 3L8DA 3CUUA 4U39A 4J75A 3IIMA 4C78A 1XDUA 5JDCA 2JIDA 3VKHA 1B8OA 1ZITA 2W6ID 1RMTA 2IEYA 4A6XA 1PW5A 1ZGJA 4TVOA 4AYXA 3EOAI 3V1YA 1DO0A 1GADO 1VPEA 3AEYA 2ZBFA 1THTA 3IVMA 3ETHA