2O50A

The crystal structure of toxoplasma gondii enoyl acyl carrier protein reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
290
Chain Sequence
PIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title Studies of Toxoplasma gondii and Plasmodium falciparum enoyl acyl carrier protein reductase and implications for the development of antiparasitic agents
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 95
structure length 290
sequence length 303
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o50A00
1SOVA 2IZ1A 3GNSA 3ZWCA 2W2LA 2EG9A 4NJMB 3DOOA 4JJFA 2HK8A 3O4RA 2PZJA 1R37A 4IDAA 4IXWA 3U4IA 4Z9XA 2VZ0A 1E0DA 2B37A 3SVTA 4YT4A 3F4LA 2FHSA 3ZNQA 2BRUA 1GU7A 1E3IA 1KY4A 4BO3A 2EKQA 2B35A 2E4AA 3IC5A 2YY7A 4QT0A 4RGBA 4CQLB 2CF6A 4IGEA 3I9KA 4WLEA 4JP2A 1NFFA 3H6KA 1C1XB 4F6LA 4FC7A 4CMCA 4EGFA 1IOLA 4AG3A 2CFCA 1VL0A 5F3RA 4MVJE 5CDYA 5T8KA 1A4UA 4CM9A 1DSSG 3TOXA 2WDZA 1VJTA 3F5SA 1E3JA 4E30A 2ZKLA 4W7IA 2W2KA 2VYND 3ZWYA 1HTBA 4DA9A 4CR8A 1YB4A 4I5EA 4J6FA 3SXPA 3WGGA 4OXNA 2BH9A 5KVCA 1BRMA 1NVGA 3U49A 3WGYA 4L8VA 4I9NA 4YBZA 2OBYA 4MVJM 4KDFA 5DCUA 5IG2A 2I3AA 4ALKA 1D8AA 1U7TA 1M66A 4D3FA 4E0BA 5IDWA 3X2FA 4YDRA 3QV1A 2NNLD 5DF1A 2GPTA 3IJRA 1GQQA 3JQAA 2W90A 2VZ9A 1PGOA 4CMBA 2EW8A 1GQ2A 3D3WA 3E18A 1QLJA 1HWYA 1Y81A 1CF2O 5CEEA 5I9NA 2HMWA 1N92A 1EBFA 2IDZA 4Z9FA 4PIVA 4BKOA 7ADHA 1UXGA 3BMNB 4AJOA 1O8CA 2WYUA 2X4GA 4IZIA 2P9CA 2VUTA 3VTZA 2Q3EA 2X1HA 3WB9A 1W6UA 3OIDA 4AJ1A 3GPIA 1K6IA 4IUYA 1I30A 3KRTA 1BW9B 4N7RA 1UUFA 4UVEA 4B7XA 4PLGA 1WXDA 1PGQA 2FP4A 3LSYA 1QSGA 2Y1DA 4N5NA 3RJ9A 1YQXA 3FNGA 5FF9A 1ID1A 3AK4A 4M1QA 2Y1FA 3G3EA 1ORRA 2HJSA 3F5QA 3SX2A 1ZH8A 1E3WA 4I5DA 4Z0HO 2VYVA 5AXBA 3RUAA 3W4IA 3TPCA 3B1FA 3NTRA 3QHAA 4MKZA 3OP4A 5I7SA 2OORA 4KQWA 1H6DA 4DIOA 1Q0LA 3HE3A 1YXMA 2X9NA 4ND3A 3AOEC 4NQZA 3F9IA 4JK3A 2G76A 3DBRB 4DPMA 2VUUA 4ND4A 2ZCUA 1Q7BA 4L4SA 3DZKA 1LDGA 3DFUA 1G0NA 2V65A 2CZCA 2FR1A 1E7YA 3DQPA 4A26A 5C7OO 1F0YA 5L9AA 1YVEI 1TA4A 3G1TA 3VDQA 3IP3A 4E21A 4CR6A 4RO0A 2VRBA 1EFLA 2HAEA 3CPSA 4YYZA 3V5NA 3BTOA 4J1SA 2O23A 4L4XA 1YOVA 4FGSA 2VRCA 5CPFA 3SLGA 4BO7A 3R0IA 1HZZA 3GPDG 2G17A 4JX8A 1X0VA 4L73A 4A73A 1UP7A 3JD0A 1O6ZA 3L4BA 3ZWOA 3LC1O 2JHGA 1ZW1A 2YDYA 5FFFA 1BVUA 3ZWPA 5DOVA 5U1PA 3IOYA 4D43A 1IZ0A 4OGWA 3KEOA 1H9AA 2BMAA 2GN4A 2O2SA 1XIVA 3N58A 4MO2A 4CM4B 4KTVE 4CLEA 5I9LA 4Z3KA 2UDPA 3WS7A 3QVXA 2B0JA 3ZHYA 3NEPX 3JD4A 1A27A 2HDHA 1CJCA 1NHWA 2E48A 1RKXA 2OGUA 2QRJA 1PJ4A 2JD2A 4RF2A 5EQFA 2EGHA 3SJ7A 2BFPA 3IAHA 5IZCA 3P19A 3QW2A 4GAEA 3UCEA 4GX1A 1B15A 2CDCA 5CPBA 3UGKA 5G0SA 1LDBA 1T25A 5G4LA 3BTSA 4FIZA 4IINA 3RKRA 3K5PA 3MJVA 5U4QA 4DRYA 2GF2A 2IZZA 4BO1A 1Y7TA 3GAZA 3FPLA 1X0XA 1N5DA 4YRDA 3WGTA 4NBTA 3RUFA 3OECA 1PJBA 4DWVA 4PLWA 4E2YA 4TRJA 1X14A 2P9EA 3QWIA 1BG6A 3CH6A 4GMGA 3S2GA 3C7CB 1B3RA 4LVUA 1YS4A 1YJ8A 3VPSA 2OP0A 1P3DA 2BI8A 1Z7BA 2JFGA 3ROQA 1NYTA 4GX2A 2GNAA 5DP2A 3PPIA 5ILOA 4EDFA 2P68A 4PG6A 3N74A 3D3WB 3LF2A 4NFHA 4W99A 2Q45A 1RM4A 2O50A 4A0SA 1PEDA 1E5QA 1PWZA 1GCUA 1UXHA 2W98A 3ZV6A 2EKPA 3HB4X 3KO8A 4OIMA 2I9PA 2C54A 3WMWA 1XR3A 4DGSA 1ADGA 3PWZA 3DZGA 1PS9A 2YW9A 3ZWAA 3E9MA 4BO5A 4JBIA 4TZTA 1T26A 2FSVA 2YHUA 2EV9A 4FQ8A 3VAZA 4BKQA 3P5SA 3KLPX 2X8LA 2P2SA 5HBRA 2Y0EA 3IP1A 2A94A 4R1UA 4CMAA 3P2YA 3H5NA 3H9UA 3GUCA 2BFAA 4HP8A 3MZ0A 3U4CA 3GVPA 1ISGA 2HMVA 3E1KA 3GEGA 1NWCA 5KKCA 2O4UX 1N7GA 1NFRA 4HV4A 3MWDB 3PHIA 2CUKA 2RHRA 1E3WB 1AHIA 2X0RA 4NBVA 5ITWA 4JNKA 5ILGA 4BNFA 3AUAA 4PRLA 1CYDA 2DLDA 3AUSA 1OC4A 2GDZA 3QP9A 4MOWA 4CMKA 1NPTO 1HYGA 5IZ4A 1GAEO 3ZWBA 5B4TA 4RZHA 1ZK1A 4XCVA 3QVWA 1ZZEA 4QO8A 2Q4EA 3CZRA 1HDGO 4GI2A 2B5WA 1L7EA 5JSFA 5HS6A 4GLLA 3K8ZA 4K1LA 5F1PA 3D1LA 1XEAA 3FNEA 5EESA 4BNTA 4JJGA 4CL3A 3O8QA 3NJ8A 2A35A 3PZRA 2J6IA 1DDOA 5TIIA 3JQFC 3ONDA 1XU9A 1PJTA 4ILKA 4NHEA 2AMFA 2AQ8A 5K0ZA 1QV6A 1XQ6A 2FN7A 2ZYGA 3G17A 5A3JA 2Y67A 3DFZA 4NMHA 1YOVB 3P7MA 2O48X 4J3FA 4B3HA 1PTJA 3Q0EA 1GTMA 5JMPA 3OIGA 2HMUA 4ND2A 1R66A 2DTXA 1L7DA 2AG5A 4Z9YA 2F00A 5BNTA 1NQOA 2YJZA 1VM6A 3H9JA 2B83A 3WQRA 4J1NA 5CEFA 5IAAA 3TOZA 1DXYA 4XD2A 1X1EA 3R3JA 4YRBA 2CVZA 5CP8A 2NVUA 1ZXBA 2X9GA 1PIWA 3OJLA 4RL6A 1VPDA 4FC6A 3VZRA 1S6YA 4GSLA 1OFGA 2VTEA 3Q2IA 1M75A 5IDYA 1V3VA 1MFPA 4G81A 1ZK2A 1HDCA 3NDRA 3H2ZA 3H65A 5JC8A 1D3AA 2J3KA 3OETA 1ZK0A 2Q2QA 4MIYA 2HK9A 3ZV5A 4H16A 4NH4A 1ZEMA 4NBUA 4Y6PA 1QLHA 1DLJA 4AJKA 2VWPA 4M87A 4YJHA 3ZWNA 1ENZA 1MG5A 2QYSA 3EYWA 1X15A 4KMSA 1AE1A 3W1VA 5TS3A 2GZ1A 1KERA 3FTNA 4DLAA 2PH5A 5JCJA 1DHTA 5DP1A 4JBGA 4CMIA 5TJ9A 4B8WA 1BWSA 3I1JA 2ZYDA 1KBZA 1PJSA 3D3EA 2UYYA 5CG2A 2GRAA 1IB6A 5CDSA 2AEJA 5A02A 5KJ6A 3GDFA 2PZMA 1EDOA 2YV3A 4L74A 1KYQA 4S1VA 4WLVA 5GMOA 4C7KA 4D3SA 5C7LO 1B14A 5G0UA 4E5NA 4WGGA 3ITKA 4F6CA 2PR2A 3LK7A 1D1SA 2BHLA 5KVVA 5JDIA 1P44A 3PHGA 2PK3A 4OO3A 3V1UA 1GEEA 3T4XA 3FNHA 2AE1A 1Z73A 4J2OA 1FDUA 2P9GA 3ENNA 3OEYA 5T8KC 4QEDA 3B6ZA 2IYPA 3VZPA 3WOHA 5CHEA 1GZ4A 3A14A 5T5QA 3JQBA 4B7UA 4Q39A 3LLSA 4U0KA 4FS3A 3U5TA 2X0JA 4L76A 3NT4A 3K73O 1O94A 3AUTA 3MJ4A 4NFYA 2Q46A 3PHLA 4IJVA 3WNVA 3VH2A 3KYDA 4RJTA 1VKNA 3E9QA 3SBOA 2PLAA 1ZUD1 3JYOA 2YFQA 4CV3A 1VE9A 3GVXA 1OAAA 4H3VA 2G82A 3CINA 1GYQA 5CFZA 4XR9A 2B4TO 4DYVA 5L4LA 3TF5A 1DIAA 5ICSA 2AEMA 3HZZA 2X7HA 2E82A 2R2GA 5EL0A 1Y1PA 1Q2XA 4RVGA 4I9HA 5DN9A 2B69A 4BGVA 3H5RA 1GEGA 4PG7A 5KVSA 1PJ2A 2X5OA 3GUYA 3PGJA 1PS0A 3Q3CA 1LX6A 4O1MA 1LSOA 3GDOA 1IUKA 2Z5LA 2ZJ1A 5COQA 2Y0CA 1G0OA 4EJMA 3PYLA 5JDCA 2HKIA 1NBOA 1QYCA 3FBTA 3PIDA 4DC0A 4ZQHA 4GSKA 4IM7A 3U4HA 1JKJA 4RVDA 5JY6A 2IE0A 2O3SA 1O95A 3STHA 1LLCA 5IN5A 1TXGA 1LJ8A 4TSKA 9LDTA 2NQ8A 3IKVA 6ADHA 1AGNA 3GRPA 3KLMX 3RUDA 1MXFA 2I5PO 1LDYA 2X23A 4XDYA 1DIHA 1EUCA 4XZ3A 3O8QB 2QQ5A 5CDGA 1EMDA 3LT0A 1EBUA 1Y8RA 3HDYA 2EXXA 3EY4A 3U9LA 3UVEA 4FDAA 2OZPA 1EK6A 4O5OA 1Z45A 1GQYA 4XA8A 3L6OO 5TNXA 4DIBA 1ZNQO 2YYYA 3EMKA 4MJLA 1ZVMA 3I83A 4N5LA 3PTZA 1GZ6A 4INAA 3OH8A 4C4OA 1C14A 1MFZA 2X86A 2W2LD 1OZAA 1MV8A 5TF4A 2GN8A 1A7KA 4NK5A 1LXCA 3C1AA 2RH8A 4Y8VA 2WEKA 2JL1A 2AXQA 5A3VA 5F5LA 2NVUB 1WNTA 4J9VA 5I8WA 4IQ8A 4OMUA 3NT5A 4WUVA 2FY8A 4J16A 2JFHA 5TC4A 4R1SA 4P4NA 5JY1A 2G5CA 3JQ7A 2WMDA 2DVMA 2Q99A 2JKVA 3JD3A 5ENVA 2DBRA 4DLBA 1NFQA 3WJ7A 4XQGA 2NU9A 3ROPA 1WZIA 2ZQZA 5HWSA 4YQZA 5F1OA 1E6EA 2RHCA 1PU2A 1SO8A 1GUZA 2JAPA 3I4CA 4IY1A 4PG5A 3TZQA 4BNZA 3HDHA 4QTZA 4XJSA 4B8ZA 3RBXA 3NTOA 4LRSB 5C7IO 4W4TA 3ABIA 1XELA 3L4BC 5BSGA 4CQMA 4YT2A 1RJWA 1LI4A 4BNIA 4OKNA 1JA9A 3LT1A 3H9EO 4NU5A 1I36A 3HUDA 4GQAA 3BMQA 1YH3A 4IDGA 3OBBA 1T2EA 2P4HX 1UP6A 4CMIB 1V3UA 4BNMA 3VOSA 3G49A 5H81A 3RBVA 3HG7A 1OI7A 2PD3A 3CXRA 3WYEA 4CLDA 2YDXA 3GAFA 3HB5X 1Y6JA 3TZCA 2UVDA 1PQUA 4QUKA 2ZK7A 4II2A 2GZ3A 1U1IA 3AFMA 3EK2A 3OJ0A 4YTEA 5DDIP 3SLKA 1I2BA 2DTEA 2DTDA 4EW6A 1M76A 1PX0A 1ENPA 1HF3A 1U3WA 5JLAA 4ZQGA 1B8PA 4XWYA 4YT5A 1HT0A 2V6GA 4ZRNA 4IQGA 5EJ2A 4OM8A 4ZD6A 1XQ1A 2ZB3A 1DAOA 1UAGA 4GH5A 4HADA 5AYVA 3RWBA 4WLNA 2JCYA 4XX0A 4BO8A 5IZCC 1ONNA 1VJ1A 3AI1A 5IXSA 2OFPA 5BT9A 3U0BA 4EUFA 4XQEA 1IYZA 4UUOA 1KETA 5KKAA 3VHRA 4L9RA 2CSUA 3OA0A 1T4DA 1U4SA 3E03A 4R3WA 4D42A 4NFSA 2YV2A 3TL3A 4AL4A 2TMDA 1Q7GA 4YQYA 1YONA 3KHUA 3ANMA 5F1KA 1N9GA 1X7GA 1ZJZA 4FFMA 2AHRA 3WGIA 1ARZA 3KYDB 5BNFA 4RVSA 3PFFA 1J6UA 1PJLA 5FEUA 3VH4A 4JP3A 4A5OA 4XEHA 1LNQA 4AJPA 1KEPA 3F46A 3GN2A 4J0EA 1H94A 3FI9A 2NV6A 4FJ1A 3WYBA 3PLNA 4O6VA 3WJAA 3DHNA 2GGSA 4FW8A 4Y9DA 2VYVD 4LGVA 4D0SA 5KIAA 8ADHA 1MC5A 3E48A 4HWKA 4HFRA 3CE6A 4UREA 2Q1WA 1JDJA 4PLFA 1C0KA 1B26A 1LLUA 4TRMA 3Q1LA 4DXHA 4A27A 4DTIA 1IPFA 3ROMA 3FF4A 1LEHA 3S1LA 1HE3A 4XB2A 3ZNPA 3RJ5A 1LDEA 4G65A 3RROA 5T6BA 5B1YA 2VOJA 1LU9A 2FPIA 1E1KA 1E5LA 2DAPA 2BGKA 4DVJA 4H15A 2DPGA 1P74A 1MC4A 3GR6A 3ITDA 4LISA 5TRTA 4KTTE 3W6UA 4RF4A 2FWMX 4GGPA 3KZVA 1HETA 2CVOA 4IGFA 1A71A 1W4ZA 1H2BA 1ZSNA 1VSVA 4XYGA 2PKRA 5L4NA 2NVBA 3GGOA 3WLFA 2IXBA 3CEAA 2GUGA 3C7DB 4C7JA 4TZKA 3ZV4A 3AI3A 2IRWA 1QXSA 2VWHA 4J7UA 4B4WA 2W4QA 1XHLA 3KUXA 2HCTA 3DMTC 3IL2A 1BGVA 4MIEA 4L0QA 5B37A 5THQA 1SEVA 3VPHA 5T57A 1P1HA 1HDYA 1PJCA 2CDBA 3KV3O 2P91A 4PLPA 3KM0A 4XR4A 3KYCA 3RVDA 4I08A 4M54A 3PLRA 3PJEA 2V6FA 2VUSA 4L75A 2QZ9A 3C8MA 5C5IA 3QY9A 2GERA 1DFIA 1ZBQA 2Z1NA 1X1TA 3HQ4O 1PWXA 1UXJA 2EEZA 2J5QA 1ISHA 3UF0A 2A9FA 5DZSA 2V6BA 1KC1A 3JQ7B 2NTJA 2Z1MA 3LLVA 3SC6A 1UDAA 1GV1A 4GX5A 2FZWA 4PZEA 2ZCVA 4PN3A 3F4BA 1DBVO 3OJFA 3RUCA 1O9BA 4ZQBA 3KEQA 4WLFA 4J49A 5AXCA 1JAXA 5KWEA 4RDIA 2B4QA 1ULUA 3NT2A 2O3RA 4KWIA 4J9UE 4MVJA 4CQMB 1GR0A 1OMOA 1MX3A 1I0ZA 4CLRA 4ALLA 2NU7A 4AJIA 2ZIZA 4WNCA 5HTOA 2PGJA 4NG5A 4FSHA 1LDMA 3VZQA 2YQ5A 1FK8A 3GVCA 3PHHA 3DMYA 3GDGA 1CQJA 4LSWA 3WGQA 4E32A 1UDCA 4DIFA 2DUUA 4DMLA 4P38A 4EEZA 1SBYA 2D8AA 4JBHA 4MP3A 1PJ3A 2RAFA 2Q2VA 2O2YA 3WMXA 2C07A 2H6EA 2NLOA 3B20A 2DKNA 4WCDA 1N1EA 1K6JA 1PGJA 4CLXA 1YDWA 4YEDA 4K6CA 2GLXA 3L6EA 4QQRA 3P2OA 3DBHA 1DPGA 1O5IA 3DDNA 1ZXLA 1H6AA 3VKVA 4ZJUA 2B5VA 1ZJYA 2FRDA 1Z7EA 3B70A 3RFTA 1AUPA 4RV9A 1SEPA 3RUEA 4DC1A 5JNLA 1E7WA 1JLLA 4J0FA 1GCOA 2WYVA 3ADOA 4ALNA 1JVSA 2EHDA 2PGDA 2VYNA 1IHXA 1ZK3A 3WIEA 2H5LA 1T2FA 4CM3A 1N9GB 1WW8A 3UFXA 3I6IA 3PHJA 1QYWA 3PXXA 4ROSA 1NPDA 3IUPA 3NUGA 4DQUA 1ZK4A 4WEOA 5JDIC 3WDSA 2PFGA 3DEYX 4D0RA 1QORA 4F45A 4EBFA 4BIIA 4DPKA 4ZQEA 3WSWA 3RSHA 4UEOA 2Y1OA 4J43A 1Y8QA 3OQBA 4E5PA 3TRIA 5I7FA 1K89A 3AM4A 3FSRA 2P5YA 1BDMA 1ZSYA 3MJCA 1NXQA 3FNFA 4BNNA 3JQBC 1P9LA 3JYPA 3PGXA 1PJQA 4D45A 1GFSA 3ZU4A 3FPCA 2D5CA 4U6SA 4EYEA 1V35A 4DLLA 1ADFA 9LDBA 4YCAA 1M2WA 3U4DA 2YFHA 2YZ7A 3V2UA 5GZ3A 1K6XA 1ZIDA 2HRBA 2B36A 3NGXA 4IPTA 4GVXA 3S8MA 2J8ZA 4IIUA 2LDXA 2W2KB 4D41A 1NQTA 5CDTA 1VSUA 2NTNA 1Z75A 5LDGA 2X6TA 4CL8A 5HS4A 1ISJA 3WBBA 1E77A 1P45A 1ISIA 5L40A 4RQUA 3V2HA 1UH5A 3HADA 3ZNOA 1HLPA 5A05A 3CMMA 4XYMA 5JDCC 3VKUA 2E6UX 1U8FO 4CV2A 4N5MA 1C0IA 3GY0A 3JQAB 3TQHA 4CMGA 1BHSA 1P33A 1V8BA 3D5TA 2C2YA 1GZ3A 4PLTA 2HSDA 5L4SA 4RDHA 4XB1A 2PKQO 3D5QA 2AE2A 2NWQA 5TSDA 1N2SA 3MOIA 2PH3A 1XG5A 3EVTA 3JYLA 4U5QA 4CJXA 5L45A 1B8UA 2E49A 4YJFA 5A5FA 1A9ZA 2I6TA 1LSJA 2XOXA 4ZRMA 2DC1A 3F1LA 5DULA 1C1DA 5ER9A 1YB5A 1QP8A 5IF3A 1ULSA 2O7QA 4FFRA 4U7WA 2ZJ0A 2ZTUA 3U62A 2HUNA 5JMWA 1NQAO 1XGKA 3FWZA 1ENOA 3GZNA 1U3VA 3LC2O 4FFLA 1E92A 1LSUA 2VOEA 4BNJA 2Q49A 3GH3A 3VVBA 1C3VA 1DC6A 3H4VA 3AY6A 3ENKA 3PZBA 1HRDA 4HNGA 3CSDA 5F5NA 5A9SA 4MVJI 3MWEB 5ES3A 5K6AC 2AQKA 4LRTB 3ZW9A 1AHHA 4KDEA 2FSSA 4R5HA 1G1AA 3RBZA 2D5AA 4LMPA 1U28A 3D4NA 4CLRB 1I2CA 3ASUA 3GLQA 3IMFA 3QQPA 3DMTA 3EZLA 3JQGA 2NTVA 1XU7A 4GPD1 4B3IA 5A06A 4BO2A 1VKOA 1XKQA 3CZMA 1PQPA 3U3XA 4AJHA 2VCYA 1KIFA 4IJKA 4DQVA 1TB4A 6LDHA 4R1NA 4W9NA 1YB1A 3GFGA 4BO6A 4Y98A 1CEQA 1QKIA 1V6AA 2JHFA 4R68A 4WE3A 3BYZA 4CM6A 2AEFA 4BO4A 3A28A 1O0SA 3ZN2A 3LC7O 2OHXA 3KBOA 3BHJA 1I3NA 4CM8A 1Y5RA 2C2XA 4RORA 2ZB4A 1N8KA 2OO5A 5BSEA 4WJZA 4ZN6A 1E1LA 1P77A 5DT9A 3DBHB 1ISFA 4XRGA 2OP1A 4U8GA 1YL5A 1OOEA 1AN9A 2O3JA 1LC0A 4XJTA 1E6UA 2UUOA 3BIOA 3TZ6A 1PSDA 3MTGA 2XXBA 2D1YA 5I7VA 3EDMA 2A92A 3F3SA 1IULA 2FZEA 3SJUA 3S2IA 4BL5A 4CUJA 4PZDA 1GPDG 4W82A 3HN2A 3INGA 1UXKA 3GVHA 3DZJA 1DJNA 5TGDA 3ONFA 4XYEA 1EK5A 3UAGA 4BO9A 1NAIA 3AI2A 1LRKA 4JROA 1WLYA 3WTCA 1XDWA 4ZU3A 1H93A 2JD0A 5JYDA 4YVFA 3INTA 3MJSA 4PLHA 4BHTA 4TROA 1Y8QB 1LA2A 3ZV3A 4BKRA 5CAEA 1JAYA 3LVFO 3GQVA 3PP8A 4MKXA 4WECA 3RC2A 5AQ1A 1A9YA 1DO8A 1BTOA 1GADO 1W8DA 3O26A 1P1IA 3D0OA 2Q1SA 4J91A 5AVOA 2DUWA 5L7YA 3UCFA 3KYBA 1H9BA 4YA6A 4FN4A 4PCVA 1YGYA 1N1GA 1UJMA 4EZBA 2UV8A 3WX0A 4D3DA 4BMNA 1NAHA 4NI5A 4JGBA 1YBAA 1ENYA 3KSUA 2IEDA 3IQDB 5L95A 3NAQA 4PLZA 4MVJH 4PVDA 3ONEA 4OKIA 2NU8A 1XSEA 1M67A 1PL7A 2HK7A 5JO9A 4P22A 3JQ8A 1F8FA 5B4UA 1T1SA 2DT5A 3DTYA 4IMPA 3TFOA 3GRKA 4OL9A 5JBIA 4WK6A 3WWYA 1ZMTA 3WTBA 2QRLA 3BTUA 2FPPA 1E7RA 1Z74A 4LK3A 4R51A 1CWUA 3X2EA 1V3TA 4X54A 3TL2A 5LC1A 3S2EA 4QO7A 4YACA 3TN7A 1E3EA 1NX6A 3LF1A 1YJQA 2PKQP 4KUEA 1U2GA 1B3BA 4BNWA 2PZKA 5COAA 4WASA 3UICA 1JKIA 3JQCA 3N7UA 5CDUA 4BV9A 3VPXA 3WYCA 2OMEA 3ST7A 1GL3A 1XA0A 4QX6A 3UXYA 3E82A 1EUZA 4FCCA 2XPCA 1R12A 2AW5A 4F46A 2A4KA 3JCZA 2EJWA 4WPGA 3RC7A 5F21A 1KEWA 3QWAA 4R16A 1SB9A 3AOGA 5TQVA 2EF1A 3RFVA 3PRJA 3KSDO 4MVJF 4YJFB 3WG9A 4F3YA 4Y6SA 1KVSA 4PFJA 3UH1A 3FRJA 1C1DB 2WE7A 3RC1A 1JU9A 1U3UA 3CTMA 3OEWA 5A04A 5COBA 2BGMA 3IUSA 4J4HA 3RKUA 5DCWA 3C7AA 5KOIA 1LUAA 3QA9A 5EMHA 5IN4A 2EJVA 1QV7A 3GZNB 3LYLA 1B2LA 3V8BA 2HLPA 2Y1GA 5JS6A 1NNUA 4DBZA 1V9LA 4WNIA 5EPOA 5TJHA 1VL8A 2GN6A 4NZ9A 4TVOA 3EW7A 3R6DA 1X13A 5L51A 3L4SO 3AM5A 3NTQA 5A9SB 1I8TA 4YPOA 3I52A 5A9TA 1GYRA 3W6ZA 3DC2A 1SOWA 3BZUA 4KUHA 3T4EA 3HDQA 1U5CA 4E13A 4XKJA 3PYMA 4Z0PA 3JQGB 5J23A 1MUUA 5JAQA 4AJEA 4B79A 3JQEA 4YT8A 4OOEA 1R4NA 1UDBA 1F8GA 2XF8A 4WLUA 3HJAA 3EAGA 1DC4A 3B1KA 4N18A 3JD2A 4P4LA 1P1FA 1ISMA 3R3SA 1PZFA 2X9VA 1I33A 3BTVA 5T67A 2JFFA 2VT3A 5KNLA 1CETA 3JSAA 1IPEA 3WGZA 2JD1A 1X7DA 4CM8B 3UKOA 4RPLA 4D46A 4B4VA 5AXDA 1I24A 2C20A 5DCYA 1R0LA 1WP4A 4OQYA 4AFNA 2VT2A 1DB3A 3I9LA 4MP6A 1JN0A 3UN1A 3ZHBA 3K30A 3PQDA 1K0UA 2VHVA 2XXJA 1C0PA 1XYGA 3COSA 1PGPA 4RLHA 5K6AA 1PGNA 1EEHA 1RM5A 1JWBB 4OH1A 4DREA 5JC1A 1FJHA 1PR3A 3VH1A 4Z0TA 3D64A 2E37A 5A9RA 2SCUA 1U2DA 3PWSA 4OSPA 1KC3A 2OL4A 2IXAA 2ZYAA 4UULA 4WOKA 2G1UA 4YAIA 3IJPA 4TRNA 5BSHA 3GT0A 1MLDA 4WCFA 3AWDA 3OICA 3PIIA 2O4CA 3VDRA 4R4JA 1E7QA 3QVTA 1LRJA 1BSVA 3BMNA 1DRVA 3ZWVA 2ZB8A 3TDKA 3F47A 4OAQA 1JVBA 3MEQA 3FHLA 4NDNE 2RIRA 3AU9A 3DZFA 3ZGYA 3NDIA 2O3QA 2FOIA 4JQCA 4YJHB 3ZNNA 4CM9D 3KVOA 3RUHA 2HQ1A 4YJDA 3TSCA 1MXHA 3F6YA 1DFHA 3M6IA 3W4JA 4ZA2A 1HLDA 1MG0A 4QECA 3S2FA 2NACA 1KVQA 2AQHA 3C1TA 2AQIA 4UVDA 3I4FA 1P1KA 4ZICA 1R0SA 2Y68A 3E5MA 3D7LA 4XGKA 1U7HA 5JO0A 4CM5A 4G5HA 3OM9A 1NVMB 4R3NA 4HFMA 4LSMA 3VZSA 2EGGA 3WSVA 3DAGA 3H3FA 1HYEA 4J90A 4E2XA 4E2ZA 4R69A 1UZMA 5JFOA 1R0KA 2ZQYA 3W8EA 3JQAD 4B3JA 1B8VA 3T7CA 2CD9A 4IDBA 1H5QA 4RVHA 4CPDA 5IXYA 1Q0QA 1JTVA 1DC3A 4I9UA 3ETGA 1I32A 4UVHA 1FDSA 2PD6A 4KZPA 1NP3A 2OUIA 1LLDA 3WR5A 3PYXA 3O9ZA 3WGOA 4XQCA 3E9NA 4D79A 2EW2A 1RYEA 4PVCA 2D2IA 4TWRA 3I3OA 4QFDA 2C7GA 1DEHA 1G6KA 4DUPA 3ZCXA 5BQFA 4HY3A 3W8FA 4NR0A 2NM0A 1DJQA 3INRA 2Y93A 1J0XO 2GN9A 2ET6A 1EVIA 3DZHA 4IS2A 5FI5A 3OSUA 2DU8A 4BKUA 3ZU2A 1UP4A 3ZU3A 4N54A 4OJNA 4E12A 4K6FA 3PFWO 3RFXA 4H7PA 4CUZA 2NVWA 2Z95A 1BMDA 1Y9AA 3UUWA 3GMDA 4DPLA 1KOLA 5JYEA 4MDHA 1QR6A 3GG2A 1YL6A 4OXKA 4PG8A 3A1NA 5FYDA 4HFJA 1FDVA 4ZGWA 1TI7A 1CIVA 4Y67A 5C3MA 2HJRA 3F1KA 4WKGA 4UEJA 2P4QA 2EKLA 3C24A 5T64A 2ZTVA 4BGUA 2WE8A 3BHIA 4G2NA 1ZEJA 4CM4A 3FTPA 1HEUA 2QIOA 4YRAA 4IJWA 3RI3A 4HKTA 5EN4A 3WGHA 1DAPA 1WMBA 3GZ4A 3FR8A 5ENDA 5A03A 3EHEA 2WYWA 1DFGA 1R4NB 3H9GA 2BKAA 3CKYA 3TWOA 4JN6B 4RVUA 2DPHA 4KOAA 1O89A 4UAGA 3ZWWA 3DL2A 2VZ8A 5L53A 1LC3A 1AXEA 4I8XA 1BDBA 2VRCD 2V6MA 3WFIA 4TMFA 3QLJA 3GA0A 2ZTLA 4MKRA 4IS3A 2GCGA 2VHZA 1Y8RB 1HDOA 3RIHA 2DBQA 1F12A 1TLTA 2UUPA 5EERA 1P1RA 4M49A 4RPGA 5TX7A 4FJ0A 1T24A 1EDZA 3OHSX 1KEUA 4TVBA 3MJTA 4RQTA 3VPGA 3GNQA 1SB8A 3TZKA 3HFGA 4FOOA 3H3JA 4W9NC 1J4AA 1KEVA 2FR8A 4W6ZA 1XWFA 5DOZA 4TKMA 4J2HA 3UHAA 1P31A 4UUMA 3NRCA 2ZTMA 3EVNA 3M1AA 3BHMA 4BB5A 5EINA 3ZDFA 5GZ1A 5LCXA 2WWRA 1R4MA 5CG1A 5G4KA 1FF9A 4DBVO 4AVYA 2VTDA 3WQQA 1L1FA 4WCFB 3ANNA 3C1OA 2WSBA 4CMEA 4ND1A 4EJ0A 4J1QA 1EUDA 2BF7A 1C0LA 1HDRA 4Q9NA 5L3ZA 3ZH2A 3ZWXA 4CUKA 3FBGA 5ICMA 2LDBA 1D1TA 1PQWA 1E6WA 4NPCA 4GMFA 3DO5A 2TMGA 2J5KA 4GWKA 3FR7A 1XCBA 4IBOA 4GLOA 3FCOA 4WEQA 4YR9A 5U9CA 3OJOA 1HKUA 2VNAA 3I9MA 1BXKA 1S7CA 5JXWA 5JW6A 4PLVA 4U0JA 1E7MA 4CLHA 1DRWA 4HFNA 4BS9A 5AOVA 4IZHA 2PGLA 1UZNA 1BXGA 4R41A 2I66A 4MP8A 3GFBA 4BMSA 1N7HA 2CVQA 1ZMOA 5L7WA 4R9SA 3BMQB 3HHPA 4JJIA 1HYHA 3OQ6A 1ZFNA 2V7PA 3PI7A 1TT7A 3JV7A 4QFCA 3L6DA 2DQ4A 3D4OA 5L7TA 2Y1EA 3AUUA 4B4OA 1H6CA 2PZLA 3MJEA 5AXAA 1DHRA 4M8SA 3VVCA 4LW8A 3ETDA 3Q11A 3QRWA 3GHHA 4E5MA 1T2AA 2ILTA 1U4OA 4P4GA 1ZSVA 3LT2A 3LU1A 2Y05A 3JD1A 1SMKA 2I3GA 1ZKMA 3JYQA 2XAAA 3EUWA 3Q6IA 2QW8A 3RCBA 3K31A 3ON5A 3WXBA 3IIEA 2P5UA 4R9RA 3GMSA 3UW3A 5A4DA 2WJPA 4BNYA 3GN1A 2GYYA 1RPNA 2O3TA 2Y66A 3PK0A 2PD4A 1JQBA 3AJRA 3AFNA 4URFA 4EUEA 2YQ4A 4FPXA 4QXMA 2I76A 3DOJA 4DYDA 4FFOA 4HXYA 5IJZA 4BUCA 1MGOA 3KB6A 2HRZA 4IDCA 4MVJP 3S55A 1EVYA 1T2DA 4Q3CA 3O03A 4EI2A 4NBWA 1NHGA 2AA3A 2Y0DA 3BMOA 4CR7A 2C7VA 3T7EA 5ADHA 2WD7A 3DAPA 2GZ2A 4PZCA 4YJGA 3PJFA 1D7OA 3DZIA 3GEDA 4TQGA 4R01A 5DNAA 1EZ4A 1VJ0A 2Q4BA 1I2ZA 4DQXA 4A10A 4YAEA 1WMAA 3I9NA 1CDOA 4RF3A 2G0TA 3R1IA 1JKFA 4IMRA 1PL6A 4B4UA 1CQIA 5JAMA 1YO6A 4HUJA 5KJFA 2VWQA 3BAZA 1ONOA 1Y5MA 3BA1A 4NBRA 2D0IA 3K2BA 1YQGA 4JCOA 1DC5A 2J3HA 4E2WA 1E7SA 1FMCA 1K5HA 3G1UA 4WOJA 1PL8A 1XLTA 1NM5A 3IS3A 7MDHA 4A7PA 3JTMA 1JWAB 1H6BA 1B7GO 1DLIA 1IHYA 3AM3A 4EJ6A 1ZO8A 5DBIA 2IZ0A 3PJGA 4IDEA 1QYDA 2GR9A 3OF2A 4YAGA 4CLOA 2IODA 3GC6A 4KP7A 2J3IA 2EWMA 3OQ1A 1F14A 2OBNA 1J5PA 1A72A 3QSGA 4ALIA 2WM3A 1HE2A 2I65A 1MP0A 3ZWMA 4BV8A 4FB5A 5TLSA 3K2EA 3PDJA 1K2WA 2PWZA 4IDFA 4ESOA 2WD8A 1GV0A 2PA3A 4Q3DA 5TT0A 2Q50A 3WIDA 5JAIA 3C3XA 3QWHA 5K9ZA 4U6QA 5IFLA 1QYXA 3VH3A 4AJNA 4W7HA 3MTJA 3DB2A 4EUHA 1TEHA 2DBVO 2CF5A 1NR1A 4LCJA 3TJRA 4ALMA 4BNGA 3WNQA 4RPJA 4BNVA 5A5EA 1I01A 3KYCB 2ZB7A 3EC7A 2YHIA 3SC4A 2F1KA 2HU2A 2QX7A 3WBFA 4PLCA 2C5AA 1Y9EA 2X0NA 5GZ6A 4I5GA 4IXTA 3A9WA 1RYDA 2CNBA 4RCVA 1EE9A 2BFMA 3L9WA 1JW9B 3VC7A 3JQDA 3M2TA 2Y1CA 2HMTA 2BI7A 3LT4A 3UOGA 3OFSA 1R4MB 3RU7A 5G4KB 4E6PA 4IIVA 3HNPA 1BVRA 4AJLA 1T2CA 3H8VA 4L4RA 1OBFO 3K9QO 5I9MA 3KSZO 3O38A 1KY5A 3FN4A 4BNUA 4BQRA 5JCJD 1WPQA 3I9JA 4FGWA 4HX5A 4S3MA 5HRUA 4GKBA 1NASA 1HE4A 4Z6KA 3QVOA 4I5FA 3QE3A 1EQUA 4TKLA 3FWNA 1UAYA 4JXKA 4Q3NA 1FXSA 3A06A 5KJEA 2DBZA 3I6QA 1BXGB 4RF5A 2RCYA 4BNLA 1YBVA 4Q3AA 2OXIA 3RASA 2DFVA 1KVRA 1GDHA 1SPXA 4IQ0A 3GEMA 2J5RA 3DBVO 3BXXA 4GKVA 4LVCA 4BMVA 1ML3A 2D3TA 3NKLA 4BKPA 1Q0HA 4A03A 4WCFC 3H9QA 1BXZA 1SC6A 3M1LA 5KVQA 4KWHA 1F06A 3PDUA 4BO0A 5KTKA 4QSMA 3V2GA 5HA5A 2X22A 3NGLA 1F17A 3LDHA 3DAFA 1LSSA 1LQUA 2R00C 5TT1A 1NR7A 4AJJA 5ITVA 3DONA 3E5RA 1QYVA 1YQDA 4BQPA 5B12A 5LDHA 2JCXA 4PGFA 1SNYA 2DFDA 3NYWA 1WDKA 3VTFA 3OJEA 4LN1A 3JQ9C 3VPFA 2X5KO 4PG4A 4CV0A 2J3JA 1E3SA 1W0CA 1A4IA 1PS8A 4CODB 1CERA 1MB4A 3KOUA 3DZBA 1WVGA 1IY8A 3G0OA 4J7XA 1GYPA 1DIGA 3ZI0A 3WWZA 3BMCA 5JAZA 4EEXA 1E1NA 4J4BA 1M6HA 2GASA 2JJYA 4HNHA 1LTHR 1I3KA 1ONPA 3ZHXA 3BMOB 1QG6A 1PR9A 4KQXA 2WD7B 3GGGA 4XGNA 4YJGB 2NADA 4XGIA 5BR7A 4EITA 4BVAA 2O3UA 2H63A 4JLWA 1HSZA 3GOHA 1EFKA 4GWGA 1M6WA 3AU8A 1IZ9A 1X7HA 2YV1A 1A5ZA 1GD1O 3H2SA 1LDNA 4FR5A 3AY3A 5EIOA 5G2OA 1I5RA 5H82A 4OQZA 4LMRA 4XQ9A 2I67A 4Z3DA 2Q2WA 5IDXA 2QG4A 3NDJA 4FD3A 1HE5A 1LBEA 4R54A 1I3LA 3C85A 3AOEA 5C37A 1LQTA 1P0CA 2Y99A 3ASVA 3NV9A 1I3MA 4ZQFA 4RPKA 1GY8A 1U3TA 2HO5A 1NVTA 3GNTA 4CM1A 4PLYA 4MVJG 3QJ5A 3IDSA 4CLOB 4E3ZA 3TFQA 4O59O 5GY7A 2CMDA 1TT5A 5JE8A 4E5YA 2C0CA 2QYTA 3DBLA 5MGBA 1PZGA 4ND5A 3K96A 3KETA 1AXGA 4ZHSA 3K92A 4D44A 2FPGA 3WQSB 3GHYA 3ULKA 1MA0A 4DL9A 3Q2KA 3DHEA 2H9IA 2PTGA 5CEJA 4Q3EA 3AY7A 1P0FA 4BGEA 3E6AA 1U9JA 1VL6A 4OYRA 1U8XX 3ZZNA 1E1MA 1YRLA 2X5JO 1WAMA 3M2PA 3PQEA 3A4VA 4NNJA 1UXIA 3RC9A 5G0TA 4TRRA 2BELA 3Q9UA 4NIMA 2EIHA 3LQFA 3B1JA 2OOSA 1DOHA 3PJDA 1H0KA 3RD5A 1DRUA 1H2HA 3WICA 3MOGA 3QWFA 1SCUA 3CUKA 3W8DA 4O0LA 5I8ZA 1LRLA 3ZU5A 4CM7A 5H83A 3WFJA 3HWRA 2YHIB 3GF4A 3ORFA 4GL4A 3G79A 4A2CA 2BD0A 4B7CA 1U5AA 3WLEA 2VNSA 2DM6A 3ETEA 1GPJA 1VC2A 4P8RA 1IL0A 4YB8A 4XDZA 4R1TA 4NJOA 3HDJA 2YUTA 1QRRA 5I7EA 3ICCA 4FOSA 4BB6A 3RAJA 1Z6ZA 2FR0A 4J1TA 3EZYA 1ADBA 1NQ5A 4BNHA 5HM8A 1E3LA 3QVSA 4I1IA 1EE2A 4CQMD 2W8ZA 4AJ2A 4YXFA 2D59A 4ZVVA 4BGIA 4CMJA 5JCXA 2NU6A 3DXFA 1YBMA 3E8XA 1HZJA 3KTDA 3V1TC 4NJMA 1TVEA 2CDAA 3HSKA 4LCEA 1A7AA 2PY6A 4K9DA 1NTOA 3NX4A 4ONEA 1OC2A 3NJ4A 2QHXA 5KJCA 5KCZA 2RBEA 1YWGO 2R6JA 2FMUA 4M86A 1RM0A 4FFNA 2UAGA 4GX0A 3OA2A 1LLQA 4CV1A 2BFOA 4CQLA 4BNXA 3L77A 1EVJA 4OSOA 4MIOA 4UUNA 4JIGA 3GGPA 4IDDA 1J49A 1Q1NA 2C29D 3Q9NA 5THKA 5MDHA 4CMEC 5EQDA 1C1XA 4E5KA 2ZATA 1HSOA 3V1YA 1HL3A 3ADPA 3TZHA 3JQ6A 4ID9A 4GVLA 4RPHA 1WWKA 3FD8A 1R16A 1HXHA 4FFPA 3PVZA 2JAHA 3L0DA 3K6JA 4UVIA 4YAKA 4II3A 3H5AA 1CRWG 2VQ3A 3ZHZA 1DIBA 1KVUA 4O63O 5DBGA 3DTTA 3GG9A 3W4KA 4GBJA 2VHYA 2VHWA 3H7AA 1QMGA 3GK3A 2QRKA 2H1SA 2B4RO 1GUFA 3BMCB 4PRKA 4ITUA 4AICA 4UVGA 1B16A 2BLLA 1UZLA 3JYNA 4XYLA 1SAYA 3I23A 3HFSA 4GGOA 1ADCA 3RUIA 2D4AA 4WLOA 3LZ6A 3PEFA 4NK4A 4BNKA 1NWHA 2O7SA 3AW9A 2GSDA 3KXDA 5ER6A 3I9OA 2VWGA 4YAJA 1SZJG 2VN8A 2Q1TA 1IE3A 4CMHA 4M55A 4BOYA 1NPYA 2C59A 2R00A 2HMSA 4E33A 3QWBA 2IEBA 4Y6RA 5DBFA 4K26A 2GO1A 1DIRA 3ICPA 5G0VA 1T4BA 3QIVA 4ALJA 1EVZA 5B4VA 1BW9A 3OIFA 3EGOA 1PZHA 3PQFA 2JCVA 4D7AA 3U09A 3GVIA 3DHYA 4FBGA 3DOCA 4E31A 3IKTA 3DR3A 3JQ9A 4K28A 2PNFA 4YWJA 2I99A 2NSDA 4NU6A 5G0WA 1R6DA 3UCXA 4E4YA 3CMCO 3D4PA 2C82A 4XRRA 3ZW8A 2C5EA 4XIYA 1TT5B 3JQ8B 4OXYA 3JQFA 4KUGA 2CY0A 3DBLB 2X58A 3MCVA 1Q7CA 2PV7A 4M89A 3CIFA 4DMMA 1YL7A 5A1TA 1WZEA 5KJ1A 3SEFA 3HN7A 1YKFA 1I10A 2QZZA 1FDTA 3RU9A 3DBRA 2NUAA 4UUPA 4RLSA 2Q1UA 1HDZA 2GD1O 3ANLA 1VRWA 4MINA 2VHXA 1YE3A 2IYOA 4HBGA 3I5MA 4J7CA 4Q3BA 4XYBA 4RVFA 3L07A 5IDQA 3PWKA 4R5MA 3RQSA 3OMLA 1PZEA 2WTBA 4OOFA 1ZCJA 2EP7A 2POQX 1B0AA 8LDHA 1P1JA 1R15A 1VLLA 1WDLA 1HDXA 4RZIA 5BSFA 3TNLA 2X0IA 4IJUA 3ROKA 4AJ4A 1RWBA 5FWNA 1V0JA 1VI2A 1K3TA 1UR5A 4XIJA 5JPIA 4OHUA 1RM3A 4FJ2A 5FI3A 1T1RA 1YDEA 1KS9A 2RH4A 3L9XA 3DWFA 1D4FA 4MPDA 4UEKA 1Z82A 2BGLA 5BNIA 1KVTA 1W73A 2EERA 1GUYA 4J4TA 4MVJD 2EP5A 1FDWA 1EQ2A 1WDMA 2AG8A 2NQTA
chains in the Genus database with same CATH superfamily
1MGPA 3ZHQA 4QDKA 3GNSA 4HAXA 2C9OA 1UPAA 2EZTA 3C7KA 1TRKA 3LUPA 3ZWCA 3DOOA 4QDZA 5JTTA 3O4RA 1R37A 4IDAA 2H2FA 3U4IA 4Z9XA 4OFZA 2DHDA 3G5UA 2R68A 1QC5B 3TTVA 4CKCA 2YTZA 4HLNA 1RAAA 1WKBA 2JFWA 1TF5A 4NE2A 2FHSA 3NUQA 4G0MA 2UZ3A 3LYUA 3S3TA 4BZQA 2PXXA 5ALOA 2ZJAA 1W30A 1KY4A 3T12A 4BO3A 5M7EA 4KHPB 2KHZA 5HXAA 2EKQA 2B35A 2E4AA 4EHAA 3EXFB 4KE6A 4YAWA 4IGEA 4H59A 3HBAA 2MYTA 2BFEB 4OHZA 1GUBA 3DDCA 5DTRA 3CNQS 4OL0A 3ZEAA 3OT5A 3AKZA 3UGTA 4RA9B 3MHTA 4CHGA 1U1DA 1GHTA 1NC1A 2XOKD 4RXTA 4EKDA 2R6CA 2I91A 4L8WB 4MS3A 5L8VA 3D6NB 2FWPA 4F2DA 1U0BB 4RK1A 4AG3A 2AVDA 2CFCA 1VL0A 2IU3A 4ARBA 3ZHTA 4TTTS 1JHZA 4JL6A 1RXYA 1SPBS 4O02B 2A3NA 5ALLA 5T8KA 3VR3A 2VS1A 5GGXA 5BSVA 1SU6A 4RHUA 2B82A 4YGXB 4CM9A 2DY1A 1S2NA 3PNLA 3KYJB 1VJTA 2AZTA 3G9XA 4RA6A 4X7BA 1MD9A 3TOXA 2ZKLA 3UKJA 3W7BA 2VYND 4MLZA 2D8MA 2HPAA 1HTBA 3ZWYA 5K8TA 1SXPA 4GHWA 4EGSA 2GXSA 1I4EB 3IH5A 5AFSA 1NATA 2VF4X 3VV3A 3RYHA 3TW8B 2PLRA 2NZUG 1J1UA 4G24A 1BOFA 4EA6A 3W5DA 3C6MA 1X1AA 2ECKA 4L8VA 1VCNA 5DCUA 2G8LA 4IV5A 5IG2A 3HB9A 5JADA 4C07A 2QN3A 1D8AA 1XRLA 4XIFA 4V1CA 1V8OA 2JJ2D 4OJYA 2W6IA 4DCMA 3SJAA 2YZMA 5JZVA 1PFKA 2EL9A 3DDHA 3IJRA 5B53A 1SA0B 1GQQA 1SQGA 2AJCA 2YIMA 4UMFA 1E5VA 2W90A 3S27A 1PGOA 1Q91A 1Z0ZA 1E0SA 1XD8A 2EW8A 1R5JA 2GMWA 3LGXA 4RVNA 1OT5A 2XMRA 2R7AA 4D4GA 4N7MA 5KTYA 1Y81A 1CF2O 1GRRA 1PT9A 2HMWA 3D2AA 3EGDA 5CEEA 4D82A 3HH8A 1V8PA 1J21A 1IEWA 1V4VA 1X7YB 2DR0A 1Y5IA 5CNMA 4KPUB 4Z9FA 2LCQA 2OZVA 3S1AB 4CYMA 4UZSA 5JRDS 1ESDA 3HCAA 2X4GA 3NU1A 4JL8A 2ZRBA 3UA4A 2YJ6A 1E64A 5L3QB 5HP4A 2OYSA 3H8WA 3L7OA 1WOYA 4R1OA 2WY2D 1EAMA 1JXAA 2JKYA 4J07A 1TYZA 1P62B 2Q6TA 4BQIA 3FCUB 4E1AA 2ZJYA 5AICA 2AT1A 2HU8A 1PGQA 2FP4A 2IHBA 2Y1DA 3L0ZA 4M7PA 1JIIA 2ZI4A 4LHYA 2VPQA 3KR0A 1IZ8A 3FY4A 3R41A 1EHIA 4NBKA 2Q0QA 2Y1FA 1N5LA 2VYFA 1U0NA 3N5KA 2COUA 2H3HA 3A36A 3NP9A 1N6HA 2R6R1 5I5GA 5HEKA 1FDOA 2HCFA 1K06A 3UAXA 3GH1A 3BXPA 5AO9A 1E9FA 3A2KA 3HUUA 3CA8A 1Z5NA 4I5DA 3VYUB 5JV5A 1SXGA 1GL9B 5LBTA 5AM1A 4RK5A 1G2QA 1PKXA 3QHAA 4MKZA 1UJCA 4CQNA 1ZC3A 2FA9A 1H6DA 4KQWA 1FFXA 1AKTA 4DIOA 3AF1A 2X9NA 1QFSA 4M9RA 4JK3A 2B61A 2PJZA 2VUUA 4YO7A 1BZYA 1Q7BA 2YMPA 4OHXA 4C0XA 1HX7A 4CGZA 2V65A 4AN4A 1QPZA 1QV9A 2ZREA 4URZR 3ZE6A 1ZRMA 3EPLA 3GRFA 3MLBA 4NEQA 2G4CA 3NG1A 3IAAA 2FJUA 4P4TA 2A84A 5CJPA 3ZV7A 2QJFA 1YVEI 3GRCA 3OIUA 1TA4A 3H05A 4O4IB 3DMPA 1EJBA 4NNPA 1QP4A 2R5NA 1FFHA 1MBZA 1TD9A 4JC8A 2IPAB 4M0LA 1YCGA 3BILA 3IQEA 1WXWA 2O23A 5AESA 2BHNA 3W1EA 1YOVA 4FGSA 3BX1A 4JVNA 4C0BA 4YCLA 4XCQA 3SLGA 4Z53A 1Y3IA 3WBKA 4PYOA 4OY3A 4NYJR 1U9CA 3SOZA 5BOSA 4CIBA 3SIXA 3OCWA 4JX8A 1X0VA 4QBHA 3RK0A 3U7JA 3BH6A 3A1VA 3DT9A 2WUEA 4A73A 2VLIA 2FKNA 2W6OA 4PNHA 3ZWOA 1CUCA 4KZKA 1ZW1A 4UM9D 3OZBA 3O2SB 4EWLA 2HA4A 2EQ5A 5FFFA 2M6KA 2ZBEA 2FFBA 2QTRA 1POWA 3OC6A 4DMHA 3MPUA 4RD3A 3NBQA 4MDYA 3K9WA 3VU9A 1Y9JA 3E8MA 2CJFA 5T4FA 5IKMA 2W5UA 2GWRA 4CKCB 2BHTA 2J7KA 1JTEA 4ZMBA 3QYAA 4KLRA 4DJEC 1VLHA 2GN4A 1XIVA 2O2SA 1PHRA 4AM8A 2C9YA 2JI9A 1T3LA 2VNHA 4Z3KA 3IUMA 3VJKA 4YJ2A 4L5IA 1FX1A 1GPWB 5FULA 1GCGA 2BJWA 2JZCA 1Z29A 2YVQA 3VAYA 2QN7A 5LN1A 4MI6A 5EIAA 1SVNA 5IASA 1EDEA 4MW4A 4J2TA 5LUAA 2L18A 1MV5A 2OGUA 3IT3A 4RF2A 1OKKA 1SH7A 3QUTA 1GG9A 1RRPA 2A5YB 4PF1A 3SJ7A 3LPCA 1RRCA 4MS3B 5IZCA 2ZWPA 1Y4SA 4B87A 2O7RA 4GAEA 1SQ6A 3LZDA 1FYWA 2OGSA 1C7IA 3RT9A 3T9BA 2CDCA 3VMFA 3FCCA 4OEHA 5AHKA 5G0SA 2TECE 3VU1A 4M9XA 3MMZA 5G4LA 3URMA 2ISQA 4DRYA 2IZZA 2VAMA 4RA6B 4BO1A 1P3JA 3LWNA 2KQUA 3GIDA 1X0XA 3LHDA 4KAXA 4YRDA 2HH9A 4KN9S 4BZZA 2Q9CA 4YXWD 1PJBA 2WFLA 2CJWA 2GM5A 4PLWA 4DWVA 4G1EB 3WK9A 1Z9BA 1AS3A 1CB0A 3RYHB 1HYBA 2LW7A 8AT1A 4L9WA 2MYPA 3LSTA 1TIPA 3C7CB 4UNNA 2DFTA 3KR1A 3VNQA 1YS4A 1RCUA 2FFHA 1P3DA 5G1OA 4X44A 4V1CB 4AJ9A 1MT3A 4BB0A 5C1OA 4UUBA 1YTUA 3FSEA 4P2GA 3LA8A 4CF3A 1ZXXA 4YX9A 4F1KA 4Q21A 2ODPA 2JFGA 4UUQA 5TARA 2GNAA 5ILOA 4PG6A 4WINA 1GN8A 1P80A 4EY7A 3N74A 4JYZA 4P81A 2J0QA 3PLAE 2G80A 2PBRA 3FPJA 1X39A 4H4DA 2Q45A 4Q6BA 1E5QA 1UXHA 1QIMA 2P8JA 1EUDB 4Q1EA 2DBYA 2VH5R 3HB4X 1UT5A 3KO8A 4OIMA 3KKEA 4KGXA 4F56A 5F23A 2C54A 1XR3A 2CXXA 4ZDWA 4EHBA 4DGSA 1ADGA 3U3JA 1ZN9A 3RRFA 2D2XA 2YW9A 3BSWA 3G2PA 5JAHA 4JBIA 2XKKA 2OM2A 1T26A 3HCBA 4JLOA 4K9KA 3TLYA 3WYFA 4CG1A 2BKUA 3ICWA 4NSNA 4BXOA 3T1NA 3Q8KA 3P5SA 3KLPX 2X8LA 2P2SA 1XVVA 3MJDA 1JDUA 5HBRA 4LMBA 3I2JA 2Q5OA 2FP4B 2AX3A 4M1YA 1E1CB 4WZZA 4H4EA 4LXUA 2BFAA 1KBOA 1RQNA 3WYNA 3U4CA 1RXEA 4DHWA 1NLYA 1ISGA 1CLEA 4KXLA 1TVCA 4OX9Y 3GEGA 5KKCA 1MTOA 3I64A 4OK6A 2HFJA 4X97A 5EE5B 5JBNA 4G41A 2RHRA 1GUAA 2PLFA 3MLAA 4EQ6A 4RTLA 4JNKA 5ITWA 5JNVA 4UOQA 1TZMA 1OLUA 4ZHQA 5I3ZA 3AUSA 3QP9A 4MOWA 4F9TA 4Q3LA 4FZ5A 4BV2A 1L8QA 4KXWA 1SD1A 3RFFA 2EYUA 1FFXB 3TLCA 5C32A 5IZ4A 5B4TA 1ZK1A 1PFGA 4EVRA 5LNK1 3WZ2A 4B84A 4PIMA 4NCIA 4P2BA 4AULA 3EBOA 5KCMA 1HDGO 2C3PA 1W94A 2RGXA 1ATIA 1IHPA 3A31A 4KQKA 1NT4A 3IAXA 1T9HA 5A7GA 2AN9A 3LPDA 5FFNA 1CE8A 1QTNA 1S02A 1Y33E 2XTAA 4NF2A 5EEGA 4W5NA 2IP4A 1AGYA 3LOPA 1CR4A 2A35A 1N5OX 4PTLA 5ES4B 1DDOA 5TIIA 3P0IA 1RBZA 3R3ZA 5ESXA 1XU9A 3GOQA 2C2MA 1QV6A 1RI1A 3BC1A 1XQ6A 1TK9A 3IPAA 1RZRA 2Y67A 3FDZA 1UMCA 3PPYA 1YOVB 1ZL0A 5EHQA 1NSYA 2O48X 4MWEA 3R5SA 3V7UA 5A3QA 2PYIA 2OPBA 1JQEA 1Y5NA 4GR4A 3RVNA 2P62A 1COWA 2I54A 5KNBD 3V32A 3FIUA 1BWRA 1MORA 4Z9YA 5BOSB 4UTNA 4AKGA 1NQOA 1PHPA 4B81A 2FPRA 4DKXA 2B83A 4J1NA 1OZHA 2JZNA 3CF4A 1C8VB 1DXYA 4IRXA 4O4HF 4ZOEA 3IIIA 1S2DA 4LHXA 4XD2A 3W2EA 4BJ1A 3R3JA 3I8SA 4ZALA 4I50A 3QOWA 3GW8A 1T8PA 4BFLA 1OWNA 3AL0C 2X9GA 1P2BA 2J5XA 2P75A 3PGA1 1P5JA 2G28A 1NOKA 4XIIA 3UFBA 2AYXA 5KYUA 3VZRA 1TU0A 2ACEA 3VU9B 3RQSA 4GSLA 1L5HA 1OFGA 5C7YA 1XB2A 3Q2IA 4RIEA 4R1MA 1YVUA 1UBNA 3WZMA 4YAUA 2NPIA 5JD4A 2AHOA 1V3VA 2DWQA 2J9XB 2HHHB 5IK2A 2K7ZA 2IPMA 4G8CA 1IZ7A 5KNCH 1J2RA 5E9AA 4YJ2B 1D2RA 1GNPA 1E2LA 1TPYA 1QFXA 1ZK0A 1M2FA 2J3KA 2OV2A 3K1YA 1KAGA 3QBTA 5AJUA 2EZ8A 2Q2QA 2A1TS 1ANKA 3TVDA 4NBUA 2P90A 1IY9A 3NASA 2JVIA 3C3EA 1RW4A 2X2PA 4YJHA 3ZWNA 4CDNA 1AGXA 6NULA 3I2KA 3EYWA 4KAFA 5EJFA 5CCDA 4IOJA 3W1VA 2OLKA 3FTNA 4DLAA 3ZK8A 1T5IA 5DW0A 1DO2A 2ZYWX 5DP1A 3CQ9A 4UTVA 1BWSA 2CLHB 2GI4A 2VNKA 2QRQA 2ZYDA 3JQQA 3NBXX 2A9PA 2HM7A 4JJAA 4MWDA 4QYXA 1U8EA 1C7JA 4F9GA 4N12A 4NV1A 5CVEA 2GRAA 4P5EA 1RYFA 5AM3A 2QTMA 1EFRA 1G6OA 4RM2A 5CDSA 3GDFA 1Z8HA 3K70D 1H69A 4ED9A 4HEJA 2A9VA 5IP5A 2GZRA 3RTDA 1KYQA 3AHDA 4S1VA 2WFLB 2CJWB 4WKBA 4L2IA 2QT1A 4TM8A 1KFJB 1FLVA 3K1TA 4C7KA 1XZNA 3K8OE 3IBTA 4F6CA 2PCLA 1W1WA 1NG9A 2BHLA 5KDLA 1XCJA 4LEIA 1V96A 1ZJ5A 5EQTA 4W5JA 3V1UA 2HU7A 4CI0B 3CUUA 1S2LA 2F3PA 3OKAA 1C7FA 2BUBA 4U63A 2O0HA 4A92A 1F9EA 2AE1A 1J42A 2QPTA 5EIBC 3AONB 4QU0A 2K2WA 4RTSA 1XEXA 2YWRA 2P9GA 3Q40A 2NV2B 4XFDA 4NDAA 3BVPA 3B6ZA 3HRKA 4IKEA 5IC6A 3TAUA 3ZQUA 4EBBA 5IT0A 2ZYUX 1T9DA 3VZPA 4BX9A 5T5QA 1GZ4A 5AMXA 5HYVA 4JQYA 5DGDA 3BIJA 4FS3A 2JGMA 1XNJA 3JRXA 2ES4A 4FQ7A 3B51X 3AUTA 3MNFA 3GXBA 3QVVA 3JYHA 2A5GA 2NXJA 5EKXA 2NZJA 3VH2A 4IG9A 3EGCA 3IMKA 2BZ0A 3E9QA 3RW9A 1XMOB 1ZUD1 2CNWD 5JALA 4MYUA 2YFQA 1VE9A 2ZBRA 1PV2A 4KR2A 1T4GA 2A7XA 1GYQA 4QOSA 1SHJA 4XR9A 5CFZA 4X60A 4Y1EA 5HW0A 4BXOB 3TIXB 2HIMA 5EWLA 2E3JA 2E82A 2QRVB 3EVEA 3TQSA 4Y1FA 1Q2XA 5EEHA 2BE7A 4RVGA 1K8QA 4MYSA 2FFQA 1GTG1 2SNIE 2AI3A 3H5RA 4PHCA 3WB0A 2PT5A 1VIMA 3V4VB 4BU0A 2QW0X 1EDBA 3ACCA 1LX6A 1URPA 2Z9BA 5IDVA 1EWKA 2ZR7A 2Z5LA 1UKAA 1VYUA 3C7TA 2PRJA 3FWYA 4MQMA 4Q01A 5C5EA 1P0IA 3TQRA 1G0OA 4EQ6B 5LKRA 1P9WA 2FZCA 3GGJA 5BWNA 1ZVVA 2HDOA 4GSKA 1OLUB 1QOQB 2QN9A 2ONJA 1JKJA 1JMKC 3AUFA 1XU4A 2R7KA 3OMWA 4JP8A 5CNKA 3CM0A 5CVUA 3FZEA 3U1TA 3EXAA 1PR2A 3QVGA 1I6WA 1USIA 5TGTA 4YROA 2F64A 3STHA 1LLCA 1D0SA 2IFTA 1E2JA 2CMFA 1LJ8A 3RHZA 2ERCA 2HLDD 1AF4A 1IG0A 2FI1A 4PU0A 1MXFA 2Q6VA 1IHDA 3WYDA 2XYGA 1Z4JA 3L84A 3LHKA 1YC2A 2X23A 4EGJA 4LNHA 3A4MA 1CE8B 1EUCA 3VQTA 3VDXA 5K3FA 1UKVY 2C4WA 2V7TA 4MGYR 4EVSA 4FVTA 5CDGA 1IUPA 2GHTA 3ANTA 3EF0A 1EBUA 1ZIXA 1CNMA 3ESYA 5HMMA 1MEEA 2XNHA 2ZETA 3DKPA 3EY4A 3Q0TA 4P53A 3UVEA 3LH5A 1OBVA 2OZPA 3BWCA 3H83A 1LTKA 2NAFA 4HSEA 3SR4A 3FDZB 1UMCB 1ZH0A 4GECA 1MDFA 4IFTA 5C18A 1ZNQO 2FN8A 4R1QA 1GZ6A 2QZSA 4OM7A 3ZCTA 3B1XA 1KPGA 5D1HA 4MR9A 5CU7A 5H9VA 4MW6A 2NXNA 1QP0A 4BVBA 3HB7A 5TF4A 3FW1A 3AHEA 5KEIA 4NK5A 4G8BA 1LXCA 3C1AA 1ICEA 4A1OA 3TKLA 1U3GA 5K8VA 4Y8VA 3GCWA 1MH9A 4M2LA 4NEGA 3STWA 1S96A 1PQ4A 4I50B 4YV7A 5ALKA 4EG1A 2VIIA 5B7QA 1J00A 2H06A 2REQA 2YXLA 4V2IA 3EDRA 5I8WA 4MUXA 4C01A 2GN2A 4UBKA 4TMXA 2N47A 4OMUA 4PBRA 5EGNA 4EH1A 5KYUB 1YAHA 1UPBA 1XMSA 2JFHA 5AI5A 4CKEB 3NH9A 1L5HB 3OZSA 1P7ZA 2WMDA 3EDCA 3W79A 2RHLA 5JRZA 1DAFA 2VLBA 4DLBA 1Z6QA 3WJ7A 5B2FA 3FXAA 1X8JA 4EKGA 3ROPA 2ETXA 3O95A 4INZA 4EMSA 2ZQZA 2YWEA 3DQZA 1F1JA 3BWXA 3NGMA 4U2DA 1HT3A 1RIFA 2I7VA 2JAPA 3BRCA 4X6UA 4BNZA 2WIDA 4QTZA 4XJSA 4HWSA 1DAIA 4AD8A 1P7YA 2JIZD 4C6SA 4P36A 4BX8A 4QPDA 1RQ7A 4CQMA 1RJWA 1LI4A 3W5SA 2C4NA 3H9EO 1L4LA 3A1UA 4H3KB 4XSVA 5IANA 3IP5A 4B7AA 1Q1AA 4IDNA 4B3SB 4M1WA 1T2EA 1COZA 1X1SA 2WJHA 2PV0A 2P9YA 3L18A 3VOSA 3G49A 3AETA 4CLDA 3CFYA 4EYQA 4AZSA 3ZQ4A 1F2TA 2FPWA 3D6MA 4AMYA 1XWWA 4ZVTA 1QNLA 1PQUA 2EDAA 1GAQA 3FLMA 4QUKA 2P6OA 5DNVA 3PPWA 5B3LA 3R9KA 1C80A 1IZZA 2DTDA 3EGXA 5BY2A 1M76A 2ONKA 1ENPA 2Q6LA 1VP3A 3DVAA 4L2IB 4CFYA 4EF5A 3NANA 4EATA 1KE1A 3A58B 3C8HA 5JLAA 4KBFA 2QX4A 4YRLA 4YT5A 1B0PA 4CT4B 4DJ5X 5BN1A 1YZ3A 2V6GA 1Z4QA 3Q6MA 4IQGA 4D8TA 4WDRA 3IESA 4C7MA 3MERA 5LSAA 5AYVA 4FIDA 3RWBA 3BE4A 1X2BA 4XX0A 4GMDA 1YACA 3Q5EA 3G0CA 1ONNA 5FV7A 3SCZA 4U2EA 3KDSE 3I0MA 1Q6YA 1NV8A 1XEXB 3H8SA 3MWLA 5HCIA 3S70A 2C7BA 3II6X 1ZD8A 4URYR 4IIYA 1BXRA 1DUSA 3B12A 3T9EA 1QHHA 1OH5A 3VHRA 5CX1A 2CSUA 2DLNA 1C7QA 3E03A 3IIJA 4D42A 1YZQA 4DA0A 3RAFC 1Q7GA 4ZV4A 2CV2A 3OM8A 4L6AA 1CR1A 4MKGA 5FR2A 2HREA 1YVPA 3TZLA 5BW5A 2XXAA 1O6GA 2MT9A 4FFMA 3F98A 3CLUC 3FZGA 3G2MA 4PN7A 5BNFA 1CUWA 5DISB 3HL4A 2MSDB 4JP3A 5CK5A 4V2UA 3F46A 3D3NA 4G5SA 3G9QA 4J0EA 4CG3A 1IPHA 4AKHA 4FR2A 2QOEA 1MRSA 1C9MA 2DFLA 5EWLB 1Z12A 4IRMA 2FPOA 4N1AA 4RTPA 3RS5A 3G6WA 4K6MA 3D3JA 4O8ZA 4O6VA 5IUJC 1Q84A 4FW8A 3G13A 1CX9B 4PINA 4LGVA 2AUNA 3K4QA 5CFPA 2GJ4A 2UKDA 2GHIA 2IVFA 1KZ4A 2W9XA 4AZVA 3O1JC 4NCKA 4UREA 3TI9A 1NVKA 4L27A 4DXHA 3FWKA 3L1VA 4A27A 1P2VA 3ZS9A 3S1LA 3TNYA 1KMHA 3HWWA 2CHEA 1RWPA 3RJ5A 3ZNPA 3KQUA 2O8FA 1JKJB 2VKQA 2YFYA 1N2HA 1Z6YA 3L8CA 2FPIA 3ESXA 3DAOA 2LZ0A 3QVGB 2PMCA 5DWQA 4C08A 5IULC 2BGKA 2FWBA 3F90A 4IOKA 1ICIA 2C4VA 4YHBA 3SHOA 3MQ4A 1IVYA 3GR6A 1MC4A 4LISA 4NMLA 4BMXA 2VQFB 2AB0A 1MABB 4RF4A 4GGPA 2FW1A 2M1XA 3QFFA 2RSLA 2ZJ6A 2EBUA 4IGFA 4EZEA 1A71A 3OAAA 1W4ZA 2HQOA 4O4LA 1BMTA 3C43A 5BUCA 2Q3HA 3ISVA 3PNMA 2C00A 1VSVA 2R8XA 3KUDA 3W3AA 2MU1A 4X7PA 3SOPA 4TS4A 1KE2A 1EUCB 5TMBA 4COOA 1EVKA 4Q9AA 1MHTA 5EHZA 2PANA 5K3FB 3C8ZA 1DS6A 3LOUA 3GJ5A 2GNPA 1RR6A 1UDXA 2PJUA 1FFDA 3PNKA 5DHAA 1H8HA 4TS3A 5LQDA 1D6NA 3HDTA 3R8FA 4J7UA 2C2GA 3ZI7A 2Y6UA 2QRGA 3GFFA 1NXXA 4EX7A 2ZZKA 3KIPA 5LB4A 1XKTA 3VPHA 3ITNA 2V3WA 1ZN8A 1HDYA 1PK9A 4K2HA 5HKLA 1PVDA 4MR9B 4XR4A 5KTRA 1ETUA 1JJAA 3M1YA 5FJJA 1QU2A 2ACVA 2XX3A 1B0UA 1QAMA 2VUSA 3KB2A 1HV8A 1KEKA 3HR8A 2NX2A 3BDAA 3NTLA 2GERA 3H0KA 5FOSA 2D2FA 3WOVA 1XVLA 3VJRA 3FDJA 5IBPA 2MHCA 3HQ4O 4Q4CA 4M0MA 5TQ2A 3ILYA 2EEZA 2Q9UA 2REQB 2H5EA 1NY6A 1XZEA 2XWPA 1RXCA 3H3XA 3DSRA 4F86A 5BV7A 5CIYA 2A9FA 2GAAA 2PO7A 1W47A 1TOAA 1RWWA 1ZN2A 4GZ6A 3CX4A 3I9V6 1TPZA 3A32A 1JFFA 1QH1B 1XMIA 3LLVA 3OF3A 3AEQA 2IUYA 4YYEA 1GV1A 2BKLA 2FZWA 3UAYA 4PZEA 2CJYA 4DCCA 4B2LA 1N3YA 3C41J 2LRHA 3R5KA 4NZNA 4Q1FA 3MWEA 4WLFA 3DLAA 1EVQA 3OZDA 5AXCA 4R40A 3WLKX 2B4QA 4AY5A 1R1DA 2C2ZA 3PFHA 5HBGA 5EI5A 4TTIA 2O3RA 1EGAA 4J9UE 4KBYA 2XVMA 4CQMB 4LYGA 4D4KA 4CLRA 4K03A 2NU7A 5D86A 5EZYF 2QQFA 4CCWA 4WNCA 1RKUA 4Z7JA 5HTOA 1RQLA 4JLBA 4NG5A 4HB3A 2Q2NA 4P7JA 4FP9A 4FT2A 2ZI3A 2Q5CA 1ZA2A 3KZOA 1ZHHA 3DMYA 1Y1KE 1GPMA 1HG0A 2FK7A 2WJVA 1CQJA 3AETB 1NVXQ 4PC1A 4ROTA 2C88A 4GLJA 5IVPA 2FEKA 1DQNA 1F2TB 2OQ2A 1EWQA 4LTDA 1U11A 5FORA 1XZQA 3O75A 4J0KA 4RETA 4EEZA 4YP6A 1ZM3A 1PJ3A 2QSUA 3IV7A 2O2YA 4RLQA 3EGXB 2EJBA 1DMRA 2DSTA 3DVAB 1E2BA 3B20A 2H6EA 5KWSA 1D9XA 1O6BA 1PGJA 2BGIA 1YDWA 5HQTA 3R9XA 1ZA1A 3KTFA 3L6EA 2ZVJA 3KEGA 1QDEA 3HGTA 3RSFA 3UMCA 3P2OA 1I4OA 3DBHA 1DPGA 1RJDA 4LQCA 1P7WA 1D9ZA 1T5LA 3G23A 3L8FA 3NHZA 3OOYA 1VOTA 4XX0B 5ALHA 3FF1A 2R8PA 3LBIA 3MXOA 4MR7A 2B5VA 3OFJA 3T1HB 1FCJA 1BD3A 1YHYA 1KK2A 1QLWA 3R75A 4PAQA 3T5DA 2DP4E 2Y9MB 3RUEA 4DC1A 4L0CA 1QHHB 2FXVA 1G21A 2GARA 1DXQA 2RHBA 2WYVA 2ZT6A 2B8TA 3DEIA 4G1VA 4FX5A 5CX1B 4ALNA 2VYNA 4W9MC 3ZDEA 1AB6A 3MS2A 2Q7DA 4DILA 2H5LA 2QF7A 4CM3A 3EPHA 2XXAB 3UFXA 4OI4A 4EM6A 2JATA 2R8RA 3I6IA 4G1MB 1N0WA 4JHXA 4IHJF 1G3MA 3V3KA 2Z6AA 5DN6D 5F2EA 3IUPA 2FSUA 3N0TA 1XDZA 3EIOA 3NHMA 2NO1A 4NVRA 5JDIC 2LTAA 2OO3A 1H2AS 2PFGA 4OD0A 1K6MA 1SN7A 1Z2DA 2JJ2A 2BMVA 3IP6A 3FJOA 4MVCA 1QORA 2H4ZA 1WCV1 2QVCA 4V3CA 3S2UA 5C4MA 4NDZA 3P9KA 1VMAA 4NXNB 4ZAGA 3PD0A 1SUIA 1PDWA 2D2VA 3EXHC 3UG6A 3W9SA 3KJIA 4OBEA 1NF8A 3RRZA 1GGJA 3ZTTA 3CT6A 4ITVA 3DD5A 1VIAA 4QPZA 2IZOA 3FNFA 1RVDA 2WF6A 2O2JA 3T3DA 4BNNA 2JC3A 4RD0A 3RNOA 3T4PA 1Z35A 4FGKA 5J2TF 4U6SA 3SYKA 9LDBA 3U44A 4N9WA 2XE7A 1M2WA 1Y1LA 3QMWA 2YZ7A 1TTPB 1Q12A 1KMHB 1OXKB 2FHPA 1K6XA 2WSSD 3PFBA 2HRBA 4WJKB 2C7QA 3W8NA 3T5GA 5JFGA 2O8FB 4IPTA 4GVXA 3WLMA 2FPIB 2J8ZA 5FHQA 3IXLA 3ZHCA 3HKBA 4BWFB 3C8UA 1FZQA 4R2IA 1KYTA 1Q20A 4HWGA 3RU2A 1Z6TA 1Z4OA 1TKCA 3FNRA 4IIUA 1J24A 4DYHA 1YJ5A 4CU5A 5AVZA 5HFNA 3MIIA 1Z75A 4LYHA 4UXHA 4HG2A 5HS4A 5KHOC 3RVKA 4DLVA 1ES9A 5IMSA 4O4LB 4L8GA 2VK4A 3ROTA 4TLCA 4DA7A 1E77A 2NVOA 3EIHA 4GOKA 1CP2A 2AUTA 1LV8A 2B2NA 4NAHA 1Y8CA 1UH5A 3F6PA 3V2HA 1GRNA 4N0DA 4XYMA 3WGVA 2VPWA 2JLBA 3DE1X 4REMA 3HWX1 5DYWA 2ZTSA 2FZ5A 1PNOA 5BMOA 3GY0A 3JQAB 2J87A 1N6LA 4GEGA 4TTSA 5G1PA 4X63A 2HSDA 1O95C 2D5LA 2WVGA 4NV0A 821PA 6AT1A 4LPSA 1X8KA 2ZIGA 2X2FA 2AE2A 2NWQA 4RY9A 2BGGA 2RGWA 3SFZA 3MOIA 4ZTUB 4TVKA 4U5QA 2BOVA 2G8NA 4DNPA 1EJ2A 2Q0SA 3S1SA 4HRYA 4OLFA 2E49A 1F6BA 2P0AA 3WE7A 1XF9A 4ZARA 4D3ZA 3DV2A 3C6ZA 1YIOA 3Q7RA 4ZZ3A 3OT4A 3VPDA 5LXTA 3UV3A 2XDQA 1YB5A 4Z9AA 5TQ2B 1VLJA 4Z7NB 4ISBA 1ULSA 3M5PA 3ML1A 4HBZA 3RJMA 3HWSA 5FPHA 3E58A 2HUNA 1IBLB 2FK8A 3S2SA 4PPFA 1K97A 5SYMA 1JKMA 1YNOA 2EFYA 2PXHA 3K8YA 4IO0A 1PYGA 1FQKA 1JFFB 3AEQB 4BNJA 5BN4A 2BM9A 4HCJA 1A5BB 3H4VA 2CXTA 2OV1A 3F6RA 4MI9A 3PZBA 4UAVA 2Q4TA 3TUIC 4CG0A 4KR3A 1Y1SA 3PR3A 3MWEB 3O4HA 5ES3A 2AQKA 4MCHA 2XCTB 1TX4B 1VE7A 2AMLA 3ZW9A 3CTPA 4OP1A 4HLCA 4E03A 1T9AA 1GCAA 1JDPA 1L1QA 2D5AA 2FLWA 3JRWA 3K0AA 2OESA 2JHAA 3NOQA 4B3CA 4M83A 1CNFA 1G64A 1P9RA 2P2ZA 2I7CA 3EVZA 1ZU5A 3BAFA 2P65A 3JQGA 2NTVA 1XU7A 4M99A 3U48A 1SHUX 1N33B 5A06A 1EX1A 2OXRA 1K3UB 1RJ9A 2I29A 1LPAB 3U3XA 2FN9A 1EUYA 4AJHA 4XIGS 4K1XA 1CQJB 1ZOLA 5KX5A 4W9NA 5CXXA 4K9MA 4L85A 1AB5A 4YK7A 4BO6A 4Y98A 1N2ZA 4ZREA 5GIOE 1JEJA 1V6AA 4G2TA 4R68A 3LQ1A 3K1AB 4KQMA 4TM7A 4WE3A 4XJVA 4R6WA 1G7TA 3V2IA 4RZUA 3A28A 3VX4A 2I4IA 5JI2E 1SUFA 2X77A 3OQNA 2ZDQA 3LC7O 4TMKA 3TPFA 3X1KA 3KBOA 4MUMA 5J47A 3MWYW 3BMXA 1Z0KA 2C2XA 5C34B 3EPRA 4MK4A 3R9XB 4CQJA 4WJZA 2QZJA 4RJLA 4CU2A 1SQ0A 3USES 1T9CA 3DBHB 2BEUA 1JLKA 5LPNA 4FNOA 1YFKA 10MHA 4XB6B 4HB4A 3X1WA 3U4AA 4TYWA 1YL5A 3GP5A 1FTYA 1AN9A 4MR7B 1LW6E 2IITA 1EX6A 3E15A 4HXFB 1XL0A 4LZZA 4PYRA 1A88A 2XCLA 1VCOA 4NLLA 1FSPA 1PSDA 3P2IA 1VHLA 3HKDA 1T9BA 4UPDA 2XXBA 1G21B 1J09A 4EARA 5LZ2A 1KFKB 2N46A 3LWZA 2A92A 5D3KA 1IULA 3K4PA 3OU7A 4K5QA 4CUJA 4ZV7A 4YXWA 1GPDG 3NHFA 4W82A 2PX0A 3ESBA 4Q12A 3GVHA 3UFXB 2OBMA 3QUQA 4HS9A 1DJNA 3LDFA 5ALRA 1KP3A 5TGDA 3W77A 5CVJA 4NYMR 1N2OA 2QM3A 4LZJA 1K7FB 1FE8A 4Y2HA 1ZVQA 3DOFA 3G7NA 1WLYA 5DK4A 2BY4A 1XDWA 4MHOA 2F9MA 3RTGA 4PLHA 5A0FA 4F2WA 4QJBA 3EG5A 1TZKA 1B41A 2OHFA 4WBXC 2ZR9A 1LA2A 3O8BA 3B89A 4FLFA 4RUKA 1ODFA 5ALIA 3ZV3A 3GQVA 5CAEA 4WECA 3ASYA 1IATA 2QRPA 3KAQA 4UCWA 1DDGA 4Z5XA 4WN9B 2LCIA 1A9YA 2XUHA 3OZFA 5AQ1A 3UCFA 2GPNA 5AVOA 2JNWA 2Q1SA 2IYAA 2RJNA 3FYTA 1H9BA 1RQPA 4FN4A 3RSOA 4TMVA 2D7DA 1N1GA 4EZBA 3I0ZA 3QOFA 2UV8A 4Q19A 3SNHA 3U44B 2EIXA 4JGBA 2XBLA 2C5LA 2O52A 1YBAA 2PGAA 4YALA 3C3DA 1R5BA 3N2GB 3M83A 1M1XB 1P4AA 4FT4A 4RAQA 1I7DA 1YZTA 1EX7A 2VG8A 3JXEA 2HL6A 1WD5A 4RZ2A 2CEKA 2PVPA 3HKBB 3ONEA 4XM2A 5ITZB 1M67A 2HK7A 3PFNA 1RPJA 3PITA 2PX5A 4PQGA 3TDMA 2QYOA 2QAGA 5C0OE 3D6VA 3S6JA 4FMPA 2VDLB 1R9NA 2RGDA 1QX3A 4TLAA 4CFSA 4G0UA 5JCOC 3X2EA 1V3TA 4X54A 3GD7A 2H1OA 3OFVA 5D51S 5DIZA 1VLQA 1TKAA 4QO7A 4YACA 3EULA 3D0QA 5F2NA 1RLUA 4J94A 1NE7A 4IHKA 4B2YA 3IOMA 4Q7LA 1O9GA 4XVUA 1B3BA 4BNWA 1CQPA 4A8JC 1XNQB 5COAA 1OLXA 4UHJA 4WASA 3MCZA 3TOZA 1NVUQ 3UICA 1FUYB 4EOGA 4AROA 3VPXA 2GBLC 2RBKA 4BV9A 3WYCA 5LOVA 4L02A 1XA0A 4Y2PA 5CB0A 3GLHE 3OO0A 3LD9A 3WKDA 1UAAA 1T9GR 5ERYA 2AW5A 4F46A 2A4KA 1TYDE 2OCBA 3EG9A 1XD9A 2EJWA 1NN3A 3AVPA 5BWBA 4U7JA 4WN9A 2JLVA 4UBOA 4GS5A 2EF1A 4N9QA 3ZVNA 3PF8A 3KSDO 1PD1A 3ZUPA 3ECAA 3GA7A 4GF5A 4ZGGA 2X6RA 1QONA 2AG6A 4XWOA 3DOUA 4C6RA 3UGJA 2AXEA 3M34A 2NV0A 2XDQB 1L3CA 3KJHA 2CXOA 4YREA 1U3UA 4X0EA 4E09A 3QLVC 2UUAB 1V5FA 2IF2A 2VZEA 4R7ZA 1KS2A 2HA6A 4PFSA 5COBA 3RKUA 3NBMA 3C7AA 5DCWA 4FEAA 1T9KA 4RC9A 2E4VA 1KDZA 3SM9A 4CDGA 5BV2P 5KOIA 1OB5A 5IN4A 3VKFA 1K7YA 1SOUA 3Q2OA 1EDDA 3BD7A 4P3OA 1JR3D 1D4OA 4PXSA 3RDPA 1ODIA 1B2LA 3V8BA 5B2EA 2OSVA 5ITSA 2PO5A 1E2UA 2WMNB 4FNMA 5BN4B 3GYGA 3K35A 1WV0A 1RE0A 4PNEA 4F9EA 5IBQA 4QWWA 5KNBA 2I6QA 4OGKA 4ZO9A 2HLNA 3NTQA 5ICCA 2QLFA 3U3DA 3BRQA 4Q5IA 3LL4A 4YPOA 3VC1A 2XY4A 4XASA 3D6AA 2GBGA 3E2PA 4ZCTA 4JXZA 4YUZA 2Z09A 5IAEA 1EFDN 3FDXA 4TV8F 4UM9B 3IURA 4BTVA 1BN6A 3K0AB 2WTXA 4XKJA 4J3JA 1TM5E 5E6RB 1Q3KA 3JQGB 1AO3A 3PQCA 1UPXA 4BECA 2HB6A 4LF9B 5GM2A 3SZ3A 2OTCA 1E79D 1RJ9B 4MWGA 5EMMA 3V4FA 4EL5A 3V1MA 5EUBA 2KI5A 2FV8A 4QYWA 4Y2GA 1UDBA 3AG6A 3FYSA 5KX5B 5HKBA 3HJAA 3LGAA 1IXRC 4P4LA 2VDKB 5AJZA 1ISMA 3LFTA 5EJ7A 4PIPA 2X9VA 1VBNA 5T67A 1FUKA 1CETA 2G6BA 3JSAA 2QRNA 2JD1A 3K15A 1ZICA 2J30A 4QDUA 2J3DA 1LVHA 5DNYB 1ZMBA 4MVYA 1L4KA 1T43A 2YRXA 4N6GA 4C9BA 3DFFA 3UK7A 4TTQA 4RNDB 3D7MA 1YDHA 4JXXA 2BEUB 4KJZA 4AFNA 3LPLA 4MRAA 2RDMA 3UN1A 1JN0A 1TQHA 4YASA 2YWGA 3PUKA 1OJ7A 4FLEA 2WG2A 1K0UA 1O6CA 1R0YA 4MV5A 3WI7A 3ZG6A 2VJBA 2BM8A 1PGPA 1IONA 1U0HC 2VJDA 4IHAA 3HKDB 4B83A 1KKUA 4N49A 1RM5A 2H31A 4DDHA 5K45A 3J80A 4UTPA 1MNAA 4DREA 3ORHA 3QIAA 1I1NA 2VHTA 3D64A 3CCBA 4DM7A 4AO6A 5A9RA 4F2HA 1U2DA 3CUWA 2J46A 2XA9A 1D6SA 3PWSA 1CZKA 2BFBA 1VXRA 3CW2A 1DVRA 2WJ4A 2G5TA 4WKPA 4GC5A 3D1JA 2WFAA 3NBAA 1AH2A 1RRGA 2NZXA 4WCFA 2KMLA 3AJ8A 1UANA 3PIIA 3EVAA 2QL7A 1L7MA 5DIFA 5A4AA 1JIKA 1E69A 2D1RA 4D98A 2O1EA 3I9FA 1E7QA 1ZGJA 1LRJA 1BSVA 1IH8A 2EKDA 1Y1TA 3BMNA 4XUCA 3W7VA 3TDKA 4CCYB 3E27A 3MEQA 2VP3A 4KE7A 4H60A 4JR1A 3PVCA 4UHFA 5F5XA 3OOSA 1DOZA 3SZGA 3ZGYA 5KKNB 3HM2A 4KGDA 1VJCA 3C3JA 1HFEL 1DKQA 1QZZA 2NOAA 3DKRA 2HQ1A 2HFKA 4LFCB 2C03A 1JU4A 3P94A 5GADl 3TSCA 1DG1G 2HYIC 1FW8A 1OPXA 4PICA 1C8KA 5BQXA 1DFHA 2C1XA 3M6IA 5HSGA 3DTVD 2CNWA 3LJKA 4HQ6A 3UK2A 3WRXA 2JEYA 2AQIA 3MPOA 3I4FA 3OCUA 1DEAA 3KHTA 4OLHA 4ZICA 1R0SA 3F8TA 4JSTA 5JO0A 4CM5A 3I0NA 4WXYB 4PAWA 3V00A 2QAGB 4RKRA 3CLTD 3UV6A 1KIAA 3VU8A 1J0EA 4FE3A 1G42A 3OLYA 5CFMA 4TZ6A 2EGGA 1E9RA 3E7WA 3SSOA 3WSVA 4J90A 1GSHA 3EMBA 1GDDA 1V37A 1AOXA 3O9MA 3VR0A 3W8EA 2RI1A 5CGZA 5IBRA 1HDIA 3T7CA 3W5UA 2YC2C 2Z2JA 4IDBA