2O53A

Crystal structure of apo-aspartoacylase from human brain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o53A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o53A01
3KGQA 5LRGA 3SI0A 4PXEA 1ZLHA 5LYDA 3KZWA 4MHYA 3N5FA 4Z65A 4P45A 3D7HA 2QJ8A 3FF3A 2Q4ZA 1XMBA 1EE3P 4OC5A 3NFZA 1M4LA 2IMOA 1KWMA 4R7MA 4A94A 1CP7A 4R76A 1FT7A 2ZEMA 4NJRA 2DEAA 2PJ4A 2PJ2A 2ZEHA 3RBUA 1ZLIA 3D67A 3WT4A 2BO9A 2VL1A 2AFWA 2PE3A 2GLJA 1TF8A 4R8FA 1XJOA 3WC5A 4NFRA 2EK9A 3B7IA 4IK2A 3D4UA 2AFOA 1JQGA 5I4MA 4MHNA 3FH4A 4ZYQA 1Y7EA 1ZG8A 5JM6A 1PYTB 4OC1A 1YMEA 2JBJA 7CPAA 4A37A 2EK8A 4OP4A 3IJ3A 2XEJA 4P6YA 4F8ZA 2RFHA 3MRUA 4WJBA 2ZEOA 3BHXA 2OR4A 2AFSA 5K8OA 2EWBA 3JRUA 4MCQA 3GLJA 3HUVA 2CF4A 5LYLA 2Q51A 5IB9A 3VARA 3VH9A 2QVPA 1CG2A 2O4HA 2V8HA 4OKOA 4P10A 1AMPA 2PJ1A 2ANPA 4P4DA 1LCPA 4YU9A 3IFEA 2CTBA 4ZY0A 3PFOA 2PJCA 3IC1A 1ARMA 4EFDA 4OIWA 3WC7A 5LYFA 4MRIA 1Z2LA 2ZOGA 3IEHA 1XRYA 1QQ9A 1LAMA 4UIAA 2POKA 1Y0YA 1AYEA 3PB4X 2PJ5A 1LOKA 1CX8A 3WABA 3D68A 2PJ7A 3SJEA 3WC6A 3MN8A 4MXUA 3D7DA 3V7ZA 3B3TA 1TKHA 2PCUA 4KSIA 1LFWA 3NH8A 2V8GA 4X2TA 4MHZA 2PVWA 1IY7A 4PQAA 2XEIA 1DE4C 2V8DA 2GU2A 5HVFA 4Q7AA 3FEDA 5LYIA 5DS0A 4X8IA 1HEEA 3B3WA 2PJ6A 4PXBA 3T8WA 3CT9A 4ZX9A 1XBUA 4W9YA 2HC9A 4NJQA 8CPAA 3K9TA 1ZG9A 1ZG7A 3SI2A 1DTDA 5JGFA 4UF4A 2NSMA 4NGTA 4P4JA 2IQ6A 2C6CA 3NH4A 5LRJA 3H8EA 1F2OA 2Q43A 4LQGA 3B3VA 2ZEPA 4EMEA 3KQZA 3H8GA 3BI1A 4PXDA 1BPMA 1Y0RA 2ZENA 4WWVA 4F9VA 3LWUA 3TX8A 4TNUA 2NYQA 1VHEA 4MMOA 1HDQA 2J9AA 3GB0A 4NGRA 3V38A 5K8PA 1QMUA 3SI1A 1GYTA 4YWYA 4DYOA 4EWTA 4BD9A 2AFXA 3ISZA 3S9LA 4TWEA 4OC0A 2AFUA 2C6PA 5D29A 1YW6A 4PXCA 3KR5A 4FUUA 3B2YA 2F7VA 4GM5A 2O53A 1F2PA 1R43A 2PVVA 2PRQA 2PJ9A 3RZAA 4OC4A 4ZY2A 3FVLA 4K3NA 2HB6A 3IWWA 5HVGA 4A38A 1F57A 1CPXA 1ARLA 2CIJA 1CBXA 4JYWA 4H2KA 4P4FA 1HDUA 3H8FA 1IGBA 2ZEDA 1YSJA 5LRKA 1BAVA 1OBRA 4NGPA 3LMSA 2JBKA 4IAVA 4O23A 3KHXA 1H8LA 3ISXA 4NGSA 3HLPA 2ZOFA 3FEEA 4RUHA 1UWYA 1TKJA 2PJ0A 1ELMP 2BCOA 4AXVA 3K2KA 2ZELA 4NGMA 5D8NA 2PJBA 4MCRA 5HVHA 3GUXA 2F8HA 2QYVA 4IHMA 3BI0A 2BOAA 1Q7LA 4G1PA 2CTCA 1LANA 1BPNA 1YLOA 3DGVA 3PB7X 4P4BA 1Z8LA 2G9DA 4MHPA 1ELLP 4OC2A 3KI9A 2WZNA 4B6ZA 3NH5A 3D7FA 2V77A 5CPAA 3SJGA 4NGQA 2V8VA 4OIDA 1TF9A 5F09A 4UEZA 3PBBA 3DLJA 3FECA 3S9MA 2JEWA 4MCSA 3VATA 1VHOA 1XFOA 4F9UA 1TKFA 2PJ8A 2PJAA 5THWA 4ONWA 3RAMA 3BXMA 1CP6A 3L2NA 2I3CA 4ZX8A 3FX6A 4P4IA 3D7GA 1VGYA 4NGNA 2WYRA 3PB6X 4OC3A 2C6GA 3TC8A 3NA6A 3CDXA 5J1QA 3FMCA 2IJZA 3IIBA 3D66A 3PBEA 2GREA 4P44A 1TXRA 3I1UA 1PCAA 1LAPA 2ABZA 3KL9A 2ZEEA 1Z5RA 3S9NA 2XEFA 1CPSA 2ZEFA 2RB7A 2PJ3A 3QNVA 2XEGA 4MCPA 5K8MA 2FVGA 5K8NA 1YW4A 4FWUA 4OMEA 4DJLA 3FJUA 3PFEA 3KR4A 5CBMA 3PB8X 1FNOA 2ZEGA 4P4EA 3PB9X 4PPZA 4R6TA 1RTQA 3IO1A 5JH9A 3CPXA 4ZI6A 3KHZA 1NSAA 3SJFA 2OOTA 3KASA 4DUKA 6CPAA 4X3RA 4FBEA 3KQXA 3CPAA 2C1CA 4UIBA 3SJXA 2PIZA 5HXDA 3B3SA 2PIYA 1VIXA 2AFZA 3PRTA 1R3NA 4JZ0A 4A39A 5ELYA 1BLLE 4UEEA 4UEFA 3B3CA 3PEIA 4FAIA 3B35A 4CPAA 2GLFA 4ZY1A 2AFMA
chains in the Genus database with same CATH superfamily
2CNTA 4PXEA 4CGLA 3KZWA 3HOWI 4HGYA 1YIJ1 3C26A 1VQ51 2K3RA 2Q7SA 4B13A 2Q4ZA 1Q861 1XMBA 4QUSA 2Z3NA 5A2Qf 4FD7A 3GY9A 3NE7A 1CP7A 2R98A 1FT7A 2QLVB 5IT9b 3ESWA 1S7FA 2DEAA 2QMLA 3NDJA 1YR0A 2AFWA 4R8FA 3WC5A 5AG5A 2OZKA 1PUAA 3D4UA 4A3FI 1JQGA 4MFKA 3FH4A 2O28A 1Y7EA 1ZG8A 2Q7BA 4RS4A 3CC71 1YMEA 4KZTA 2JBJA 2JIOA 7CPAA 3KIHA 1JWHC 4CGOA 3GTJI 1IOIA 4F8ZA 2ZEOA 2OR4A 3EO4A 5FLXf 3HKZA 2EWBA 3JRUA 3I07A 3GLJA 1Y1VI 1S7LA 1AA6A 3R96A 2Q51A 1IOFA 3CCMZ 2WAQA 5IB9A 3F3PC 3QWUA 2VPYA 5A28A 1YVKA 3QB8A 1M1K2 2NVXI 3P2FA 2PJ1A 4P4DA 2B58A 4YU9A 2ZW5A 2PSWA 5FVJA 4ZY0A 4DK1A 3IC1A 1ARMA 3I551 4NXYA 3WC7A 5LYFA 3IEHA 2QREB 1QQ9A 3S16I 4PV6A 3TFYA 1Y0YA 1Z9UA 2QKDA 2PJ5A 4C68A 1NJI2 2PJ7A 3SJEA 3WR7A 3WC6A 3MN8A 3D7DA 2Q4YA 4XPDB 3V7ZA 2PCUA 4KSIA 2DE6A 2JLMA 3R95A 1K8A1 2Z3OA 2GIVA 4MHZA 4UA3A 4NF1A 1M902 2PVWA 3U50C 2V8DA 5HVFA 3TDHB 5LYIA 1KZFA 4A3GI 1YIT1 4PXBA 1V0CA 3CT9A 4ZX9A 4UBRA 4Y49B 2AYDA 2JS4A 3CCJ1 4Q38A 1YIJZ 1W2BZ 1Y9WA 5LL6f 2P6GA 3HOXI 4KUBA 2NAPA 5C44I 4KOXA 1DTDA 2J8NA 4NSQA 5IV0A 3G71Z 4E8OA 2C6CA 3PO3I 4CAXA 1VQKZ 5LRJA 1RO0A 5J8FA 4Y49C 1BOBA 3BI1A 4M3SA 3SXNA 4E2AA 1BPMA 4WWVA 1YI2Z 3GB0A 1CM0A 4NGRA 3V38A 4RV9A 4DYOA 1K8A2 4MY0A 1SQHA 2OOYB 3TOAA 2AFXA 1QSNA 4OC0A 2J8RA 2AFUA 4E2ZA 2Z0ZA 2YNCA 1A2ZA 2X7BA 3J80b 2PVVA 2JIMA 4Y52I 3FVLA 4K3NA 4UCPA 3IWWA 2QIRA 5HVGA 2V8JA 1FDIA 2CIJA 1CPXA 1ARLA 1F57A 4JYWA 3T4NB 2BSWA 2H5MA 5C4JI 3CD61 1HDUA 1IGBA 4GXHA 2ZEDA 4NGPA 3OWCA 4CL1A 2OZHA 4IAVA 2Q44A 2VXKA 5F49A 2JIPA 4CYOA 4NH1C 4NGSA 3EFAA 2ZOFA 4HNWB 2OTLZ 1UWYA 1TKJA 1ELMP 3BJ8A 1P4NA 1Q16A 2ZELA 3VTNA 4NBFA 2FSRA 3CXSA 3GUXA 2QYVA 4MBUA 1NJI1 1RLYA 2WSAA 4II9A 4G1PA 1BPNA 2LEXA 4UCMA 3TO7A 1Z8LA 2QECA 3CCL1 2G9DA 4MHPA 5C82A 1X3WA 2R1IA 5AGEA 2ARHA 5H86A 1RQFA 2WZNA 3I9SA 3D7FA 4NGQA 2V8VA 1IYKA 3CXQA 4OIDA 5F09A 4UEZA 4A3JI 1R57A 2JEWA 3FQMA 1YJNZ 3D9XA 1KD11 2JA8I 5THWA 1OZPA 4QTUA 3RAMA 3IR7A 2REFA 4ZX8A 3TO6A 5A27A 3D7GA 2WYRA 3TC8A 3NA6A 2QA41 2YGWA 2D4PA 3D2PA 2V45A 5J1QA 1Y7RA 1YHQZ 4JXQA 3BG0B 3VB9A 1Z01A 3T9YA 4NOZA 1LAPA 3W91A 1Q822 4KVXA 3UY5A 5EC4A 2G3TA 2XEFA 5DWNA 4AB7A 3EC4A 2B63I 3QNVA 5EBVA 2FVGA 4MONA 4AG9A 4CGNA 5CBMA 3CCVZ 1FNOA 3IU2A 4PPZA 4P4EA 3IO1A 3CPXA 3KHZA 5ISVA 1WJ2A 2OTL1 3SJFA 3KASA 4YFJA 4DUKA 4HGZA 5KTAA 1YK3A 1VQOZ 6CPAA 1VQ81 1MK4A 2OTJZ 5C3EI 4LUAA 3FB3A 2RIQA 5JQ4A 1Q2YA 5HXDA 1ZB9A 3CD6Z 2KI7B 5BWAB 4OLLA 5F46A 3IFUA 2RT9A 3J80f 4JZ0A 5ELYA 1M1DA 3B3CA 4FAIA 3B35A 4JD6A 1XOVA 3KGQA 4R3KA 5LRGA 3SI0A 4R57A 3EXNA 4MHYA 3N5FA 4ZBGA 3D7HA 2DPSA 4NBCA 1Z03A 2HV2A 4RVDA 4OC5A 3NFZA 1I21A 1M4LA 5G20A 4E33A 1WCMI 1KUYA 4NJRA 1USPB 2R7ZI 2ZEHA 4UFVA 3RBUA 3WT4A 3S6GA 2VL1A 2R6MA 3IGRA 3CME1 2PE3A 3CCEZ 3RYOA 1YUAA 3LODA 1XJOA 4B10A 3FQQA 1VQ7Z 1NE9A 3PZJA 2AFOA 4EVYA 3TCVA 4MHNA 1KQSZ 1QSMA 1VQLZ 2HUZA 3I55Z 4ZYQA 4A2ZA 1VQM1 3BLNA 1PYTB 4S1TA 2R8VA 4X5KA 4ORFA 2IV2X 3MONA 4OP4A 3IJ3A 1Q2DA 3FKII 4P6YA 3Q87A 2WB1A 4NBEA 4WJBA 2AFSA 5F48A 2FXFA 2ZPAA 4BBSI 4OAEA 3ZJ0A 4LQ6A 3GYAA 3PP9A 5LYLA 1YREA 3JAMb 2YNCC 3JTKA 2F4OA 1S7MA 3FXTA 3IWGA 3VH9A 2QVPA 1CJWA 3FIXA 1CG2A 4A3CI 4OKOA 4P10A 1LCPA 2IZ3A 3IFEA 3B8GA 2OZUA 4MI4A 2Z10A 3LUSA 3I56Z 1WW9A 1VQ71 1Z2LA 4XX2A 1IYLA 4H6ZA 3PGPA 4B12A 1LAMA 4UIAA 4BY7I 3PO3S 4CAVA 1P9NA 2VPWA 2AJ6A 5T6BA 4MXUA 2DE5A 2VI7A 3S2DI 3B3TA 2JNYA 1TKHA 4E31A 1IU8A 3NH8A 2V8GA 5E96A 1NUIA 2M48A 2FIWA 3CCS1 2CNSA 2XEIA 3I4NI 1DE4C 2B4DB 1I12A 2EBJA 4Q36A 2JIRA 1XBUA 4NBHA 4H89A 2HC9A 5IX3A 2OTJ1 2W04A 3K9TA 1ZG9A 1ZG7A 5JGFA 3CCR1 2NVTI 5T67A 1VQ91 2IQ6A 3F3FC 4RI1A 3H8EA 2IL4A 3B3VA 5CNPA 1M1K1 3W6XA 1MJAA 4EMEA 1YJ91 1QSOA 2K5TA 3H8GA 2KCWA 4XPKA 3TT2A 4BINA 2P28A 1Y0RA 4KSFA 5AG7A 3S1MI 2NYQA 1JJ2Z 2J9AA 1QMUA 3VMIA 3S1QI 4JLYA 1YI21 1WWZA 1XMTA 2VQYA 4KOWA 3H3VJ 5HH1A 1M44A 2LIYA 4HPSA 4NCZA 4PXCA 3KR5A 3B2YA 2F7VA 4KOVA 1F2PA 1R43A 2P6EA 2PRQA 4AVAA 2YNDA 2VUMI 3IU1A 2HB6A 4JJXA 1YJN1 1KUVA 3H8FA 1QSTA 5HMNA 1YSJA 1VLAA 3GTKI 1KC81 2PR8A 2VPZA 1B87A 3CZXA 2BEIA 4KVME 1H8LA 3CCSZ 4J3GA 1XF8A 1X0TA 5FLMI 1Q821 4DGLA 4CAWA 3GTMS 2EGTA 1ZO0A 3S14I 2WPWA 1QF8A 4NGMA 2YNEA 3CCLZ 5D8NA 4CGMA 1SFOI 2JIQA 2BOAA 5EMIA 1I1DA 1Z8WA 3D2LA 3CC41 4AVBA 1K83I 2Z3KA 4LX9A 4OC2A 3NE8A 2V8IA 1VQO1 3KI9A 1RO4A 2J6AA 2P6FA 3NH5A 2R93I 5CPAA 4MFPA 2PC1A 3K7AI 3I561 5G22A 2Q04A 3MZLB 4C7IA 1MJBA 2M6NA 3N7ZA 1VQPZ 1YJWZ 4A3KI 2QRCB 1VHOA 4F9UA 1TKFA 2PJ8A 1GHEA 2HF1A 1X10A 1VGYA 4NGNA 4XNHC 1IIDA 3CDXA 2IJZA 1VQL1 2V8KA 2GREA 4P44A 4B14A 4QBJA 1TXRA 1PCAA 2EVNA 2BJOA 5FLXb 4QB9A 1K9M2 3KL9A 2ZEEA 2ZEFA 4UFXA 1YW4A 4MY3A 3FJUA 3PFEA 1JJ2Y 5CM2M 3CPWY 2G3AA 3PB8X 3GTLI 4R6TA 4B5OA 2H85A 3CCE1 1LRZA 3M4OI 1Z8XA 1LQLA 2E2II 1XEBA 4FBEA 2OZGA 3KQXA 4ONUA 2Z11A 2ZW7A 2FS5A 1X3ZA 4M6GA 3SJXA 1VQ9Z 3B3SA 3ZZIA 2PIYA 4BXXI 3PRTA 4GS4A 4A39A 1L0CA 3R1KA 1BLLE 3RZDI 1Q7Y1 3CCU1 3EEDA 1ZLHA 3GKQA 4Z65A 1RNIA 4P45A 1L1OC 2QJ8A 2CNMA 3FF3A 3RNZA 5IP9I 5D1OB 1KUXA 1KWMA 2FE7A 4R7MA 2ZEMA 4U5YA 1YUKA 1P0HA 1VQ41 3FYNA 1IB1E 5A2Qb 1ZLIA 3D67A 3HOYI 4MFLA 2BO9A 2VZYA 2GLJA 1TF8A 5IP7I 2CXAA 3CCV1 1K732 2A4NA 5I4MA 2ZAEB 1YHQ1 1S7NA 1K4JA 1Y8CA 2EO8A 4QC6A 1VQ61 3DR6A 2RFHA 3MRUA 1Z4EA 4E2WA 5K8OA 3CMA1 4A3LI 5G21A 1YVOA 4MCQA 2K5RA 4MJ8A 1K9M1 2JMOA 1TFIA 3VARA 3GTPI 2ZW6A 1M4DA 2O4HA 2E9HA 2BL1A 2ANPA 3S6HA 2CTBA 5IT9f 2PJCA 2IZ4A 4EFDA 2J8MA 2PK7A 4OIWA 4DNCA 4MRIA 2G0BA 1XRYA 3G4SZ 1YGHA 3PB4X 3VWDA 4CYNA 3HOZI 3WABA 3D68A 2CY2A 3CCUZ 4NB8A 3PO2I 1LFWA 3CCJZ 2Y0MA 4X2TA 4XPDC 2QEX1 1IY7A 4PQAA 4E32A 4FD5A 2GU2A 4HNYB 4Q7AA 4C7HA 1FDOA 3S15I 5DS0A 2DPTA 5J8CA 3CCM1 2PJ6A 3CCQZ 3CXCZ 4M6IA 4CYQA 3GCFA 4NJQA 5C88A 4AG7A 3CCQ1 3SI2A 3CXCY 4UF4A 2NSMA 3TE4A 4P4JA 2VEZA 4CRZB 2Q43A 4LQGA 4JXRA 1Q812 2Z3MA 2QRDB 1VQ8Z 4PXDA 4BBHA 4FD4A 4F9VA 2W03A 3LWUA 1WK4A 4UFWA 4MMOA 1HDQA 4CAFA 2F4MA 5K8PA 1YLEA 2V3VA 1ZB8A 3SI1A 1NP6A 4EWTA 4E2XA 4AYBA 3ISZA 3QAYA 3P2HA 2QA4Z 4TWEA 4XNHB 3R9FA 2P3YA 1QXFA 4KVOE 5D29A 1YW6A 5I0CA 3S1NI 3RO0A 3HOVI 4HH4A 2O53A 1VQ5Z 4B5PA 2PJ9A 3RZAA 4OC4A 3R9GA 1KC82 1TWHI 3TE5B 4MD8A 1CBXA 4H2KA 4P4FA 2JBKA 3TO9A 1N2FA 4R9MA 4BBRI 2RBLA 1N8R1 2RC4A 3DR8A 3KHXA 3CC7Z 3HLPA 4C2YA 1B6BA 4RUHA 1PFTA 1VQ6Z 4C2XA 3GTGI 4HNXB 4K30A 3S17I 4KS9A 3NDIA 4AXVA 3K2KA 1Z02A 4KUAA 2PJBA 4MCRA 4R87A 5HVHA 2I00A 1Z4RA 4IHMA 2B4DA 1Q7LA 3I3GA 1MJ9A 2AE6A 2FIAA 1S721 1ELLP 3W6SA 3IF8A 4A32A 4MHDA 4NBGA 4B6ZA 1YITZ 1QVGZ 2V77A 3SJGA 2JDDA 5AG6A 2LFUA 3G6EZ 1TF9A 4RVGA 2GANA 3FBUA 5KTDA 4RS2A 3CCRZ 4MCSA 1XFOA 3GTMI 1QSRA 4KOSA 4E0AA 4QVTA 4CS0B 4U9ZA 1CP6A 3L2NA 2I3CA 4P4IA 3CPWZ 1N8R2 1Q7Y2 1RO5A 1VKCA 3J81f 2GTIA 1JWQA 1Q811 4F0YA 2VF1A 2GFQA 3FMCA 3IIBA 3PBEA 4BY1I 2PM9A 3I1UA 5F47A 3CMAZ 1Z5RA 1KQSY 1S72Z 3S9NA 3G3SA 2RB7A 4H6UA 3TTHA 4MCPA 5K8MA 3CC4Z 1Y1VS 1R9TI 1TWCI 2B3UA 1QYPA 2EUIA 5K8NA 4FWUA 4OMEA 4ZGYB 4UWJA 5JPHA 5JH9A 1RTQA 4A31A 3CQZI 1K731 3DSBA 2NVYI 3JUWA 2OOTA 5GCNA 4CAEA 2RHBA 4YGOA 1ML8A 4X3RA 1VQNZ 3CPAA 4AVCA 4UIBA 2AKLA 1S60A 1QVFZ 3G711 4MFZA 2PRBA 2VZZA 2AFZA 5D1OA 5C4XI 4UEEA 5DWMA 3J81b 3D6WA 3F5BA 3VMHA 5H84A 4A33A 4C2ZA 4CPAA 2GLFA 4ZY1A 2JDCA 3GIUA 5LYDA 2C27A 1M4IA 1N71A 3SXOA 1PU9A 4B11A 1TWGI 1EE3P 2IMOA 3T90A 4A94A 4R76A 2Y0SA 2G2KA 5IB0A 1NSLA 4RN7A 2PJ4A 2PJ2A 4NBDA 3EERA 4YRHA 3BJ7A 3LACA 1VQ4Z 1TWFI 4XPLA 1YJ9Z 4KSAA 2PDOA 2OB0A 4NFRA 3J7A4 2EK9A 3B7IA 4IK2A 1M901 3I4MI 2REEA 2ZXVA 5JM6A 1VHSA 4OC1A 4A37A 3H5ZA 2EK8A 2XEJA 4PSXA 3EY5A 2D4OA 4MFJA 3BHXA 4RVHA 2YU9I 3HUVA 2CF4A 1ZH1A 4X6AI 2JA5I 3V8IA 4A3BI 3S6KA 1Y9KA 4A3DI 5AG4A 2V8HA 1TIQA 2DXQA 1AMPA 2FT0A 4B5PB 4UWIA 3PFOA 2NMTA 3HOUI 4HKFA 1QVGY 1W2BY 1VQK1 1VQMZ 2FCKA 3D2MA 1VQP1 2ZOGA 4FD6A 4PSWA 2BUEA 3G6E1 2POKA 4NBAA 1AYEA 3S1RI 1LOKA 1CX8A 1I6HI 4U9YA 3MGDA 3H4QA 4NB9A 2B4BA 2PQ8A 2QR1B 1VQN1 2E7ZA 2ATRA 4A93I 1ON0A 4NBBA 3FEDA 3P5JB 3F8KA 4X8IA 1HEEA 1BO4A 3B3WA 5G1ZA 1USPA 3K9UA 3T8WA 4F6AA 1Y1WI 4W9YA 1WZNA 3DDDA 2JUBA 3RZOI 8CPAA 4A30A 4CYPA 4A3II 4EWCA 2Q4VA 3OW2Y 1U6MA 4NGTA 4E2YA 3NH4A 2WPXA 1F2OA 1YQEA 3D3SA 2HQYA 2ZEPA 2VBQA 3KKWA 1XIXA 3KQZA 3OW2Z 2P0WA 2JA6I 4L89A 5KTCA 3VWEA 2GTHA 2PR1A 2ZENA 3CMEZ 1Z8TA 3TX8A 4TNUA 2I79A 1VHEA 3IWEA 1DL6A 4KOTA 1UFHA 1FY7A 2Z3PA 1RXTA 5AN9F 2VUGA 1GYTA 4YWYA 4BD9A 3S9LA 3R9EA 3QAHA 2RPRA 2VPXA 3TOBA 4CRYB 4IUSA 1QVFY 2C6PA 4FUUA 4KOYA 4GM5A 4MD7A 4ZY2A 2R7HA 2Q0YA 1IICA 4A38A 3S6FA 4MH4A 5LRKA 1BAVA 1OBRA 4A3MI 3LMSA 2JR6A 3LD2A 3D8PA 2F5IA 2FL4A 4BMHA 4O23A 3SHPA 1Q2CA 3CC2Z 3H0GI 3ISXA 4I49A 3M3YI 4KLVA 3FEEA 2PJ0A 1S5KA 1S7KA 2BCOA 3FNCA 1YX0A 2F8HA 3BI0A 1M4GA 2DF5A 2CTCA 1LANA 1YLOA 3PB7X 3DGVA 4M6HA 4P4BA 2QEXZ 2R92I 1KRLA 4L8AA 1RO2A 1J4JA 4RVFA 2KPIA 2OU2A 2OOXB 2JA7I 3G4S1 1SIWA 3GTQI 4PK3A 1TWAI 4Y7NI 3PBBA 1NMTA 3DLJA 3FECA 4A3EI 4NEXA 3S9MA 3VATA 1AUGA 3CC21 2PJAA 4ONWA 3BXMA 3GKRA 3FX6A 4IF5A 3G8WA 4CGPA 4MD9A 3PB6X 2B3VA 3BG1B 4OC3A 2C6GA 3DNSA 4A95A 1X12A 3IX0A 2ODFA 4M85A 2E2HI 3D66A 2DE7A 3CXPA 2GE3A 2ABZA 4KLWA 5T64A 4JWPA 3F0AA 5D1PA 3JAMf 1CPSA 2E2JI 3S2HI 3MZKB 1Q862 3FRMA 2PJ3A 2HU9A 2XEGA 2B5GA 4UCNA 4F0XA 2YADA 2OH1A 4DJLA 1I3QI 3KR4A 1YJW1 2PMZA 1S3ZA 4OADA 4DQYB 2ZEGA 3PB9X 4KORA 4KOUA 4ZI6A 1I50I 3KIFA 1NSAA 1WIIA 2NVQI 3E0KA 4QTTA 2B5GB 3JVNA 4R3LA 2C1CA 3GTOI 3A9LA 2PIZA 4MFQA 3VMGA 4PK2A 1VIXA 1R3NA 2Z3LA 1KD12 1XE4A 2WUUA 2JEVA 4UEFA 2ZW4A 3PEIA 4E30A 2AFMA
chains in the Genus database with same CATH topology
3KGQA 5LRGA 3EEDA 3SI0A 4PXEA 1ZLHA 3GKQA 5LYDA 3KZWA 3HOWI 4MHYA 3N5FA 4HGYA 1YIJ1 4Z65A 1RNIA 1VQ51 4P45A 2K3RA 1L1OC 3D7HA 2QJ8A 3FF3A 4NBCA 1TWGI 1Z03A 2Q4ZA 1Q861 1XMBA 5IP9I 1EE3P 4RVDA 5D1OB 4OC5A 5A2Qf 3NFZA 1M4LA 2IMOA 4E33A 1KWMA 1WCMI 4R7MA 4A94A 1CP7A 4R76A 2Y0SA 1FT7A 2ZEMA 2QLVB 4NJRA 5IT9b 3ESWA 1USPB 2G2KA 1YUKA 2R7ZI 1VQ41 2DEAA 2PJ4A 2PJ2A 2ZEHA 3RBUA 4NBDA 3EERA 5A2Qb 1ZLIA 3D67A 3HOYI 3NDJA 3WT4A 2BO9A 2VL1A 2R6MA 3CME1 2AFWA 2PE3A 2GLJA 3CCEZ 1VQ4Z 1YUAA 1TWFI 1TF8A 5IP7I 1YJ9Z 4R8FA 1XJOA 3WC5A 4NFRA 3J7A4 3CCV1 2EK9A 3FQQA 1VQ7Z 1K732 3B7IA 2OZKA 4IK2A 3D4UA 4A3FI 2AFOA 1M901 1JQGA 5I4MA 3I4MI 4MHNA 1KQSZ 2ZAEB 1YHQ1 1VQLZ 3FH4A 3I55Z 4ZYQA 1Y7EA 1ZG8A 5JM6A 1VQM1 4RS4A 1PYTB 4OC1A 3CC71 1YMEA 2JBJA 4S1TA 7CPAA 4A37A 2EK8A 3MONA 3KIHA 1VQ61 1JWHC 4OP4A 3IJ3A 3FKII 2XEJA 4P6YA 3GTJI 3Q87A 4F8ZA 2RFHA 3MRUA 2WB1A 4NBEA 4WJBA 2ZEOA 3BHXA 2OR4A 4E2WA 2AFSA 5FLXf 4BBSI 5K8OA 3CMA1 3HKZA 4A3LI 4RVHA 2EWBA 3JRUA 4MCQA 2YU9I 3I07A 3GLJA 1Y1VI 3HUVA 2CF4A 2K5RA 5LYLA 3JAMb 1ZH1A 2F4OA 2Q51A 1S7MA 1K9M1 4X6AI 3CCMZ 2WAQA 2JMOA 2JA5I 5IB9A 1TFIA 3VARA 3GTPI 3F3PC 4A3BI 3VH9A 3QWUA 2QVPA 1CG2A 2O4HA 4A3DI 4A3CI 2V8HA 1M1K2 4OKOA 2NVXI 4P10A 1AMPA 2PJ1A 2E9HA 2ANPA 4P4DA 1LCPA 2IZ3A 4YU9A 2CTBA 3IFEA 4ZY0A 4DK1A 5IT9f 3PFOA 2PJCA 2IZ4A 3IC1A 3HOUI 1ARMA 4EFDA 3I551 3LUSA 3I56Z 1WW9A 2PK7A 1VQMZ 1QVGY 1W2BY 1VQK1 4OIWA 3WC7A 1VQ71 1VQP1 5LYFA 4MRIA 1Z2LA 2ZOGA 4XX2A 3IEHA 1XRYA 2QREB 1QQ9A 3G4SZ 3G6E1 3S16I 1LAMA 4NBAA 4BY7I 1AYEA 3PO3S 1Y0YA 2POKA 3PB4X 4UIAA 2QKDA 3S1RI 1LOKA 2PJ5A 1CX8A 1P9NA 1NJI2 3HOZI 1I6HI 3WABA 3D68A 2PJ7A 5T6BA 3SJEA 3WC6A 3MN8A 4MXUA 2DE5A 4NB9A 3D7DA 3CCUZ 2QR1B 3S2DI 3B3TA 2JNYA 1TKHA 4NB8A 1VQN1 3PO2I 1LFWA 2DE6A 4E31A 2PCUA 4KSIA 1K8A1 3NH8A 3CCJZ 2V8GA 1NUIA 4X2TA 2M48A 4MHZA 3CCS1 2QEX1 1M902 2PVWA 3U50C 1IY7A 4A93I 4PQAA 4E32A 2XEIA 3I4NI 1DE4C 4GM5A 4NBBA 2V8DA 2GU2A 5HVFA 3TDHB 4Q7AA 3FEDA 3P5JB 3S15I 5LYIA 5DS0A 4X8IA 1HEEA 4A3GI 3CCM1 3B3WA 1YIT1 1USPA 2PJ6A 4PXBA 3T8WA 3CCQZ 3CXCZ 3CT9A 4ZX9A 2JS4A 3CCJ1 1XBUA 1Y1WI 1YIJZ 4NBHA 3GCFA 4W9YA 1W2BZ 2HC9A 4NJQA 5LL6f 2JUBA 2OTJ1 2W04A 3RZOI 8CPAA 3HOXI 3K9TA 1ZG9A 4A3II 5C44I 1ZG7A 4EWCA 3CCQ1 3OW2Y 3CXCY 1DTDA 3SI2A 5JGFA 4UF4A 2NSMA 4NGTA 3CCR1 2NVTI 4P4JA 5T67A 4E2YA 3G71Z 1VQ91 2IQ6A 3F3FC 2C6CA 3NH4A 3PO3I 1VQKZ 5LRJA 3H8EA 1F2OA 2Q43A 4LQGA 1RO0A 3B3VA 1M1K1 2ZEPA 1Q812 4EMEA 1YJ91 3KQZA 3OW2Z 2QRDB 3H8GA 3BI1A 1VQ8Z 4PXDA 2JA6I 2P28A 2GTHA 1BPMA 1Y0RA 2W03A 3CMEZ 2ZENA 4WWVA 3LWUA 1YI2Z 3S1MI 3TX8A 4F9VA 4TNUA 2NYQA 1JJ2Z 1VHEA 1DL6A 4MMOA 1HDQA 2J9AA 3GB0A 2F4MA 4NGRA 3V38A 5K8PA 1QMUA 1ZB8A 5AN9F 3SI1A 2VUGA 1NP6A 3VMIA 4E30A 1GYTA 4YWYA 3S1QI 4RV9A 4DYOA 4EWTA 1YI21 1K8A2 4E2XA 4AYBA 2OOYB 4BD9A 2AFXA 3ISZA 3S9LA 3H3VJ 2RPRA 2QA4Z 4TWEA 2P3YA 4OC0A 2AFUA 4E2ZA 1QVFY 2C6PA 5D29A 1YW6A 2LIYA 4PXCA 3S1NI 3KR5A 4FUUA 3B2YA 2F7VA 3J80b 3HOVI 4HH4A 2O53A 1F2PA 1R43A 1VQ5Z 2PVVA 4MD7A 2PRQA 2PJ9A 3RZAA 4OC4A 4Y52I 4ZY2A 2VUMI 3FVLA 4K3NA 2HB6A 3IWWA 5HVGA 1KC82 2V8JA 4A38A 1TWHI 1YJN1 3TE5B 4MD8A 1ARLA 1CPXA 3T4NB 1CBXA 1F57A 2CIJA 5C4JI 3CD61 4H2KA 1HDUA 4JYWA 4P4FA 3H8FA 1IGBA 2ZEDA 1YSJA 4MH4A 5LRKA 1BAVA 1VLAA 4A3MI 3GTKI 1OBRA 4NGPA 3LMSA 1KC81 2JBKA 2JR6A 4CL1A 4IAVA 1N2FA 4O23A 4BBRI 2RBLA 3CC2Z 1N8R1 4NH1C 3H0GI 3KHXA 1H8LA 3CCSZ 3ISXA 4NGSA 3CC7Z 3HLPA 1X0TA 3M3YI 2ZOFA 5FLMI 3FEEA 4RUHA 1Q821 4DGLA 2OTLZ 1PFTA 1VQ6Z 3GTMS 2EGTA 3GTGI 1TKJA 1UWYA 2PJ0A 1ELMP 3S17I 3S14I 2BCOA 3NDIA 4AXVA 3K2KA 1Z02A 2ZELA 1QF8A 3VTNA 4NGMA 4NBFA 3CCLZ 5D8NA 2PJBA 4MCRA 5HVHA 1SFOI 3GUXA 2F8HA 2QYVA 4IHMA 3BI0A 2BOAA 1NJI1 1RLYA 1Q7LA 4G1PA 2CTCA 1LANA 1BPNA 1YLOA 3DGVA 3PB7X 4P4BA 2QEXZ 2R92I 3CC41 1Z8LA 3CCL1 1KRLA 1S721 1RO2A 1K83I 2G9DA 4MHPA 1ELLP 1X3WA 4OC2A 3IF8A 2V8IA 4RVFA 2KPIA 1VQO1 3KI9A 1RO4A 1RQFA 2J6AA 2WZNA 4NBGA 4B6ZA 1YITZ 2OOXB 3NH5A 1QVGZ 2R93I 2V77A 3D7FA 5CPAA 3SJGA 2JA7I 2LFUA 3G4S1 3G6EZ 3GTQI 2V8VA 4NGQA 4OIDA 3K7AI 3I561 1TWAI 4Y7NI 3MZLB 1TF9A 5F09A 4UEZA 4RVGA 3PBBA 2M6NA 3DLJA 3FECA 4A3EI 4A3JI 1VQPZ 3S9MA 2JEWA 1YJWZ 3CCRZ 4MCSA 4A3KI 2QRCB 3VATA 3FQMA 1YJNZ 3D9XA 1VHOA 1XFOA 4F9UA 3GTMI 1KD11 1TKFA 2JA8I 3CC21 2PJAA 2PJ8A 5THWA 4QTUA 4ONWA 3RAMA 3BXMA 1CP6A 3L2NA 2I3CA 4ZX8A 2HF1A 3FX6A 4P4IA 3CPWZ 3D7GA 1N8R2 1Q7Y2 4MD9A 1VGYA 4NGNA 2WYRA 3PB6X 3BG1B 4OC3A 2C6GA 3J81f 2GTIA 3TC8A 3NA6A 2QA41 1Q811 3IX0A 2VF1A 3CDXA 5J1QA 3FMCA 2IJZA 1YHQZ 1VQL1 2E2HI 3IIBA 2V8KA 3BG0B 3D66A 2DE7A 3VB9A 1Z01A 3PBEA 4BY1I 2PM9A 2GREA 4P44A 4NOZA 1TXRA 3I1UA 1PCAA 1LAPA 2ABZA 2BJOA 5FLXb 1Q822 1K9M2 3KL9A 3CMAZ 5T64A 1Z5RA 1KQSY 2ZEEA 1S72Z 3S9NA 5D1PA 3JAMf 2XEFA 1CPSA 2E2JI 3S2HI 3MZKB 1Q862 2ZEFA 2RB7A 2PJ3A 2B63I 2HU9A 2XEGA 3QNVA 4MCPA 5K8MA 3CC4Z 2AFMA 2YADA 1Y1VS 1R9TI 1TWCI 2FVGA 1QYPA 4MONA 5K8NA 1YW4A 4FWUA 4OMEA 4DJLA 3FJUA 3PFEA 1I3QI 3KR4A 1YJW1 2PMZA 5CBMA 1JJ2Y 5CM2M 3CPWY 3CCVZ 3PB8X 1FNOA 4DQYB 2ZEGA 3GTLI 3PB9X 4PPZA 1RTQA 3IO1A 4P4EA 3CPXA 4R6TA 5JH9A 2H85A 4ZI6A 1I50I 3CQZI 3KIFA 1K731 1NSAA 3KHZA 1WIIA 3CCE1 2OTL1 2NVYI 3SJFA 3M4OI 2OOTA 3KASA 2RHBA 4DUKA 4HGZA 2NVQI 6CPAA 1VQOZ 4QTTA 1LQLA 1ML8A 1VQ81 2E2II 4X3RA 4FBEA 2OTJZ 3KQXA 1VQNZ 3CPAA 5C3EI 2C1CA 1X3ZA 2RIQA 3GTOI 4UIBA 2AKLA 3SJXA 2PIZA 3V7ZA 1QVFZ 3G711 1VQ9Z 5HXDA 1ZB9A 3CD6Z 3B3SA 2KI7B 3VMGA 3IFUA 2RT9A 2PIYA 4BXXI 1VIXA 2AFZA 3PRTA 1R3NA 3J80f 4JZ0A 4A39A 1KD12 5D1OA 5ELYA 5C4XI 1BLLE 4UEEA 3RZDI 4UEFA 3J81b 3D6WA 3B3CA 3PEIA 3VMHA 4FAIA 3B35A 4CPAA 2GLFA 4ZY1A 1Q7Y1 3CCU1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KGQ A;  5LRG A;  3SI0 A;  4PXE A;  1ZLH A;  5LYD A;  3KZW A;  4MHY A;  3N5F A;  4Z65 A;  4P45 A;  3D7H A;  2QJ8 A;  3FF3 A;  2Q4Z A;  1XMB A;  1EE3 P;  4OC5 A;  3NFZ A;  1M4L A;  2IMO A;  1KWM A;  4R7M A;  4A94 A;  1CP7 A;  4R76 A;  1FT7 A;  2ZEM A;  4NJR A;  2DEA A;  2PJ4 A;  2PJ2 A;  2ZEH A;  3RBU A;  1ZLI A;  3D67 A;  3WT4 A;  2BO9 A;  2VL1 A;  2AFW A;  2PE3 A;  2GLJ A;  1TF8 A;  4R8F A;  1XJO A;  3WC5 A;  4NFR A;  2EK9 A;  3B7I A;  4IK2 A;  3D4U A;  2AFO A;  1JQG A;  5I4M A;  4MHN A;  3FH4 A;  4ZYQ A;  1Y7E A;  1ZG8 A;  5JM6 A;  1PYT B;  4OC1 A;  1YME A;  2JBJ A;  7CPA A;  4A37 A;  2EK8 A;  4OP4 A;  3IJ3 A;  2XEJ A;  4P6Y A;  4F8Z A;  2RFH A;  3MRU A;  4WJB A;  2ZEO A;  3BHX A;  2OR4 A;  2AFS A;  5K8O A;  2EWB A;  3JRU A;  4MCQ A;  3GLJ A;  3HUV A;  2CF4 A;  5LYL A;  2Q51 A;  5IB9 A;  3VAR A;  3VH9 A;  2QVP A;  1CG2 A;  2O4H A;  2V8H A;  4OKO A;  4P10 A;  1AMP A;  2PJ1 A;  2ANP A;  4P4D A;  1LCP A;  4YU9 A;  3IFE A;  2CTB A;  4ZY0 A;  3PFO A;  2PJC A;  3IC1 A;  1ARM A;  4EFD A;  4OIW A;  3WC7 A;  5LYF A;  4MRI A;  1Z2L A;  2ZOG A;  3IEH A;  1XRY A;  1QQ9 A;  1LAM A;  4UIA A;  2POK A;  1Y0Y A;  1AYE A;  3PB4 X;  2PJ5 A;  1LOK A;  1CX8 A;  3WAB A;  3D68 A;  2PJ7 A;  3SJE A;  3WC6 A;  3MN8 A;  4MXU A;  3D7D A;  3V7Z A;  3B3T A;  1TKH A;  2PCU A;  4KSI A;  1LFW A;  3NH8 A;  2V8G A;  4X2T A;  4MHZ A;  2PVW A;  1IY7 A;  4PQA A;  2XEI A;  1DE4 C;  2V8D A;  2GU2 A;  5HVF A;  4Q7A A;  3FED A;  5LYI A;  5DS0 A;  4X8I A;  1HEE A;  3B3W A;  2PJ6 A;  4PXB A;  3T8W A;  3CT9 A;  4ZX9 A;  1XBU A;  4W9Y A;  2HC9 A;  4NJQ A;  8CPA A;  3K9T A;  1ZG9 A;  1ZG7 A;  3SI2 A;  1DTD A;  5JGF A;  4UF4 A;  2NSM A;  4NGT A;  4P4J A;  2IQ6 A;  2C6C A;  3NH4 A;  5LRJ A;  3H8E A;  1F2O A;  2Q43 A;  4LQG A;  3B3V A;  2ZEP A;  4EME A;  3KQZ A;  3H8G A;  3BI1 A;  4PXD A;  1BPM A;  1Y0R A;  2ZEN A;  4WWV A;  4F9V A;  3LWU A;  3TX8 A;  4TNU A;  2NYQ A;  1VHE A;  4MMO A;  1HDQ A;  2J9A A;  3GB0 A;  4NGR A;  3V38 A;  5K8P A;  1QMU A;  3SI1 A;  1GYT A;  4YWY A;  4DYO A;  4EWT A;  4BD9 A;  2AFX A;  3ISZ A;  3S9L A;  4TWE A;  4OC0 A;  2AFU A;  2C6P A;  5D29 A;  1YW6 A;  4PXC A;  3KR5 A;  4FUU A;  3B2Y A;  2F7V A;  4GM5 A;  2O53 A;  1F2P A;  1R43 A;  2PVV A;  2PRQ A;  2PJ9 A;  3RZA A;  4OC4 A;  4ZY2 A;  3FVL A;  4K3N A;  2HB6 A;  3IWW A;  5HVG A;  4A38 A;  1F57 A;  1CPX A;  1ARL A;  2CIJ A;  1CBX A;  4JYW A;  4H2K A;  4P4F A;  1HDU A;  3H8F A;  1IGB A;  2ZED A;  1YSJ A;  5LRK A;  1BAV A;  1OBR A;  4NGP A;  3LMS A;  2JBK A;  4IAV A;  4O23 A;  3KHX A;  1H8L A;  3ISX A;  4NGS A;  3HLP A;  2ZOF A;  3FEE A;  4RUH A;  1UWY A;  1TKJ A;  2PJ0 A;  1ELM P;  2BCO A;  4AXV A;  3K2K A;  2ZEL A;  4NGM A;  5D8N A;  2PJB A;  4MCR A;  5HVH A;  3GUX A;  2F8H A;  2QYV A;  4IHM A;  3BI0 A;  2BOA A;  1Q7L A;  4G1P A;  2CTC A;  1LAN A;  1BPN A;  1YLO A;  3DGV A;  3PB7 X;  4P4B A;  1Z8L A;  2G9D A;  4MHP A;  1ELL P;  4OC2 A;  3KI9 A;  2WZN A;  4B6Z A;  3NH5 A;  3D7F A;  2V77 A;  5CPA A;  3SJG A;  4NGQ A;  2V8V A;  4OID A;  1TF9 A;  5F09 A;  4UEZ A;  3PBB A;  3DLJ A;  3FEC A;  3S9M A;  2JEW A;  4MCS A;  3VAT A;  1VHO A;  1XFO A;  4F9U A;  1TKF A;  2PJ8 A;  2PJA A;  5THW A;  4ONW A;  3RAM A;  3BXM A;  1CP6 A;  3L2N A;  2I3C A;  4ZX8 A;  3FX6 A;  4P4I A;  3D7G A;  1VGY A;  4NGN A;  2WYR A;  3PB6 X;  4OC3 A;  2C6G A;  3TC8 A;  3NA6 A;  3CDX A;  5J1Q A;  3FMC A;  2IJZ A;  3IIB A;  3D66 A;  3PBE A;  2GRE A;  4P44 A;  1TXR A;  3I1U A;  1PCA A;  1LAP A;  2ABZ A;  3KL9 A;  2ZEE A;  1Z5R A;  3S9N A;  2XEF A;  1CPS A;  2ZEF A;  2RB7 A;  2PJ3 A;  3QNV A;  2XEG A;  4MCP A;  5K8M A;  2FVG A;  5K8N A;  1YW4 A;  4FWU A;  4OME A;  4DJL A;  3FJU A;  3PFE A;  3KR4 A;  5CBM A;  3PB8 X;  1FNO A;  2ZEG A;  4P4E A;  3PB9 X;  4PPZ A;  4R6T A;  1RTQ A;  3IO1 A;  5JH9 A;  3CPX A;  4ZI6 A;  3KHZ A;  1NSA A;  3SJF A;  2OOT A;  3KAS A;  4DUK A;  6CPA A;  4X3R A;  4FBE A;  3KQX A;  3CPA A;  2C1C A;  4UIB A;  3SJX A;  2PIZ A;  5HXD A;  3B3S A;  2PIY A;  1VIX A;  2AFZ A;  3PRT A;  1R3N A;  4JZ0 A;  4A39 A;  5ELY A;  1BLL E;  4UEE A;  4UEF A;  3B3C A;  3PEI A;  4FAI A;  3B35 A;  4CPA A;  2GLF A;  4ZY1 A;  2AFM A; 
#chains in the Genus database with same CATH topology
 2CNT A;  4PXE A;  4CGL A;  3KZW A;  3HOW I;  4HGY A;  1YIJ 1;  3C26 A;  1VQ5 1;  2K3R A;  2Q7S A;  4B13 A;  2Q4Z A;  1Q86 1;  1XMB A;  4QUS A;  2Z3N A;  5A2Q f;  4FD7 A;  3GY9 A;  3NE7 A;  1CP7 A;  2R98 A;  1FT7 A;  2QLV B;  5IT9 b;  3ESW A;  1S7F A;  2DEA A;  2QML A;  3NDJ A;  1YR0 A;  2AFW A;  4R8F A;  3WC5 A;  5AG5 A;  2OZK A;  1PUA A;  3D4U A;  4A3F I;  1JQG A;  4MFK A;  3FH4 A;  2O28 A;  1Y7E A;  1ZG8 A;  2Q7B A;  4RS4 A;  3CC7 1;  1YME A;  4KZT A;  2JBJ A;  2JIO A;  7CPA A;  3KIH A;  1JWH C;  4CGO A;  3GTJ I;  1IOI A;  4F8Z A;  2ZEO A;  2OR4 A;  3EO4 A;  5FLX f;  3HKZ A;  2EWB A;  3JRU A;  3I07 A;  3GLJ A;  1Y1V I;  1S7L A;  1AA6 A;  3R96 A;  2Q51 A;  1IOF A;  3CCM Z;  2WAQ A;  5IB9 A;  3F3P C;  3QWU A;  2VPY A;  5A28 A;  1YVK A;  3QB8 A;  1M1K 2;  2NVX I;  3P2F A;  2PJ1 A;  4P4D A;  2B58 A;  4YU9 A;  2ZW5 A;  2PSW A;  5FVJ A;  4ZY0 A;  4DK1 A;  3IC1 A;  1ARM A;  3I55 1;  4NXY A;  3WC7 A;  5LYF A;  3IEH A;  2QRE B;  1QQ9 A;  3S16 I;  4PV6 A;  3TFY A;  1Y0Y A;  1Z9U A;  2QKD A;  2PJ5 A;  4C68 A;  1NJI 2;  2PJ7 A;  3SJE A;  3WR7 A;  3WC6 A;  3MN8 A;  3D7D A;  2Q4Y A;  4XPD B;  3V7Z A;  2PCU A;  4KSI A;  2DE6 A;  2JLM A;  3R95 A;  1K8A 1;  2Z3O A;  2GIV A;  4MHZ A;  4UA3 A;  4NF1 A;  1M90 2;  2PVW A;  3U50 C;  2V8D A;  5HVF A;  3TDH B;  5LYI A;  1KZF A;  4A3G I;  1YIT 1;  4PXB A;  1V0C A;  3CT9 A;  4ZX9 A;  4UBR A;  4Y49 B;  2AYD A;  2JS4 A;  3CCJ 1;  4Q38 A;  1YIJ Z;  1W2B Z;  1Y9W A;  5LL6 f;  2P6G A;  3HOX I;  4KUB A;  2NAP A;  5C44 I;  4KOX A;  1DTD A;  2J8N A;  4NSQ A;  5IV0 A;  3G71 Z;  4E8O A;  2C6C A;  3PO3 I;  4CAX A;  1VQK Z;  5LRJ A;  1RO0 A;  5J8F A;  4Y49 C;  1BOB A;  3BI1 A;  4M3S A;  3SXN A;  4E2A A;  1BPM A;  4WWV A;  1YI2 Z;  3GB0 A;  1CM0 A;  4NGR A;  3V38 A;  4RV9 A;  4DYO A;  1K8A 2;  4MY0 A;  1SQH A;  2OOY B;  3TOA A;  2AFX A;  1QSN A;  4OC0 A;  2J8R A;  2AFU A;  4E2Z A;  2Z0Z A;  2YNC A;  1A2Z A;  2X7B A;  3J80 b;  2PVV A;  2JIM A;  4Y52 I;  3FVL A;  4K3N A;  4UCP A;  3IWW A;  2QIR A;  5HVG A;  2V8J A;  1FDI A;  2CIJ A;  1CPX A;  1ARL A;  1F57 A;  4JYW A;  3T4N B;  2BSW A;  2H5M A;  5C4J I;  3CD6 1;  1HDU A;  1IGB A;  4GXH A;  2ZED A;  4NGP A;  3OWC A;  4CL1 A;  2OZH A;  4IAV A;  2Q44 A;  2VXK A;  5F49 A;  2JIP A;  4CYO A;  4NH1 C;  4NGS A;  3EFA A;  2ZOF A;  4HNW B;  2OTL Z;  1UWY A;  1TKJ A;  1ELM P;  3BJ8 A;  1P4N A;  1Q16 A;  2ZEL A;  3VTN A;  4NBF A;  2FSR A;  3CXS A;  3GUX A;  2QYV A;  4MBU A;  1NJI 1;  1RLY A;  2WSA A;  4II9 A;  4G1P A;  1BPN A;  2LEX A;  4UCM A;  3TO7 A;  1Z8L A;  2QEC A;  3CCL 1;  2G9D A;  4MHP A;  5C82 A;  1X3W A;  2R1I A;  5AGE A;  2ARH A;  5H86 A;  1RQF A;  2WZN A;  3I9S A;  3D7F A;  4NGQ A;  2V8V A;  1IYK A;  3CXQ A;  4OID A;  5F09 A;  4UEZ A;  4A3J I;  1R57 A;  2JEW A;  3FQM A;  1YJN Z;  3D9X A;  1KD1 1;  2JA8 I;  5THW A;  1OZP A;  4QTU A;  3RAM A;  3IR7 A;  2REF A;  4ZX8 A;  3TO6 A;  5A27 A;  3D7G A;  2WYR A;  3TC8 A;  3NA6 A;  2QA4 1;  2YGW A;  2D4P A;  3D2P A;  2V45 A;  5J1Q A;  1Y7R A;  1YHQ Z;  4JXQ A;  3BG0 B;  3VB9 A;  1Z01 A;  3T9Y A;  4NOZ A;  1LAP A;  3W91 A;  1Q82 2;  4KVX A;  3UY5 A;  5EC4 A;  2G3T A;  2XEF A;  5DWN A;  4AB7 A;  3EC4 A;  2B63 I;  3QNV A;  5EBV A;  2FVG A;  4MON A;  4AG9 A;  4CGN A;  5CBM A;  3CCV Z;  1FNO A;  3IU2 A;  4PPZ A;  4P4E A;  3IO1 A;  3CPX A;  3KHZ A;  5ISV A;  1WJ2 A;  2OTL 1;  3SJF A;  3KAS A;  4YFJ A;  4DUK A;  4HGZ A;  5KTA A;  1YK3 A;  1VQO Z;  6CPA A;  1VQ8 1;  1MK4 A;  2OTJ Z;  5C3E I;  4LUA A;  3FB3 A;  2RIQ A;  5JQ4 A;  1Q2Y A;  5HXD A;  1ZB9 A;  3CD6 Z;  2KI7 B;  5BWA B;  4OLL A;  5F46 A;  3IFU A;  2RT9 A;  3J80 f;  4JZ0 A;  5ELY A;  1M1D A;  3B3C A;  4FAI A;  3B35 A;  4JD6 A;  1XOV A;  3KGQ A;  4R3K A;  5LRG A;  3SI0 A;  4R57 A;  3EXN A;  4MHY A;  3N5F A;  4ZBG A;  3D7H A;  2DPS A;  4NBC A;  1Z03 A;  2HV2 A;  4RVD A;  4OC5 A;  3NFZ A;  1I21 A;  1M4L A;  5G20 A;  4E33 A;  1WCM I;  1KUY A;  4NJR A;  1USP B;  2R7Z I;  2ZEH A;  4UFV A;  3RBU A;  3WT4 A;  3S6G A;  2VL1 A;  2R6M A;  3IGR A;  3CME 1;  2PE3 A;  3CCE Z;  3RYO A;  1YUA A;  3LOD A;  1XJO A;  4B10 A;  3FQQ A;  1VQ7 Z;  1NE9 A;  3PZJ A;  2AFO A;  4EVY A;  3TCV A;  4MHN A;  1KQS Z;  1QSM A;  1VQL Z;  2HUZ A;  3I55 Z;  4ZYQ A;  4A2Z A;  1VQM 1;  3BLN A;  1PYT B;  4S1T A;  2R8V A;  4X5K A;  4ORF A;  2IV2 X;  3MON A;  4OP4 A;  3IJ3 A;  1Q2D A;  3FKI I;  4P6Y A;  3Q87 A;  2WB1 A;  4NBE A;  4WJB A;  2AFS A;  5F48 A;  2FXF A;  2ZPA A;  4BBS I;  4OAE A;  3ZJ0 A;  4LQ6 A;  3GYA A;  3PP9 A;  5LYL A;  1YRE A;  3JAM b;  2YNC C;  3JTK A;  2F4O A;  1S7M A;  3FXT A;  3IWG A;  3VH9 A;  2QVP A;  1CJW A;  3FIX A;  1CG2 A;  4A3C I;  4OKO A;  4P10 A;  1LCP A;  2IZ3 A;  3IFE A;  3B8G A;  2OZU A;  4MI4 A;  2Z10 A;  3LUS A;  3I56 Z;  1WW9 A;  1VQ7 1;  1Z2L A;  4XX2 A;  1IYL A;  4H6Z A;  3PGP A;  4B12 A;  1LAM A;  4UIA A;  4BY7 I;  3PO3 S;  4CAV A;  1P9N A;  2VPW A;  2AJ6 A;  5T6B A;  4MXU A;  2DE5 A;  2VI7 A;  3S2D I;  3B3T A;  2JNY A;  1TKH A;  4E31 A;  1IU8 A;  3NH8 A;  2V8G A;  5E96 A;  1NUI A;  2M48 A;  2FIW A;  3CCS 1;  2CNS A;  2XEI A;  3I4N I;  1DE4 C;  2B4D B;  1I12 A;  2EBJ A;  4Q36 A;  2JIR A;  1XBU A;  4NBH A;  4H89 A;  2HC9 A;  5IX3 A;  2OTJ 1;  2W04 A;  3K9T A;  1ZG9 A;  1ZG7 A;  5JGF A;  3CCR 1;  2NVT I;  5T67 A;  1VQ9 1;  2IQ6 A;  3F3F C;  4RI1 A;  3H8E A;  2IL4 A;  3B3V A;  5CNP A;  1M1K 1;  3W6X A;  1MJA A;  4EME A;  1YJ9 1;  1QSO A;  2K5T A;  3H8G A;  2KCW A;  4XPK A;  3TT2 A;  4BIN A;  2P28 A;  1Y0R A;  4KSF A;  5AG7 A;  3S1M I;  2NYQ A;  1JJ2 Z;  2J9A A;  1QMU A;  3VMI A;  3S1Q I;  4JLY A;  1YI2 1;  1WWZ A;  1XMT A;  2VQY A;  4KOW A;  3H3V J;  5HH1 A;  1M44 A;  2LIY A;  4HPS A;  4NCZ A;  4PXC A;  3KR5 A;  3B2Y A;  2F7V A;  4KOV A;  1F2P A;  1R43 A;  2P6E A;  2PRQ A;  4AVA A;  2YND A;  2VUM I;  3IU1 A;  2HB6 A;  4JJX A;  1YJN 1;  1KUV A;  3H8F A;  1QST A;  5HMN A;  1YSJ A;  1VLA A;  3GTK I;  1KC8 1;  2PR8 A;  2VPZ A;  1B87 A;  3CZX A;  2BEI A;  4KVM E;  1H8L A;  3CCS Z;  4J3G A;  1XF8 A;  1X0T A;  5FLM I;  1Q82 1;  4DGL A;  4CAW A;  3GTM S;  2EGT A;  1ZO0 A;  3S14 I;  2WPW A;  1QF8 A;  4NGM A;  2YNE A;  3CCL Z;  5D8N A;  4CGM A;  1SFO I;  2JIQ A;  2BOA A;  5EMI A;  1I1D A;  1Z8W A;  3D2L A;  3CC4 1;  4AVB A;  1K83 I;  2Z3K A;  4LX9 A;  4OC2 A;  3NE8 A;  2V8I A;  1VQO 1;  3KI9 A;  1RO4 A;  2J6A A;  2P6F A;  3NH5 A;  2R93 I;  5CPA A;  4MFP A;  2PC1 A;  3K7A I;  3I56 1;  5G22 A;  2Q04 A;  3MZL B;  4C7I A;  1MJB A;  2M6N A;  3N7Z A;  1VQP Z;  1YJW Z;  4A3K I;  2QRC B;  1VHO A;  4F9U A;  1TKF A;  2PJ8 A;  1GHE A;  2HF1 A;  1X10 A;  1VGY A;  4NGN A;  4XNH C;  1IID A;  3CDX A;  2IJZ A;  1VQL 1;  2V8K A;  2GRE A;  4P44 A;  4B14 A;  4QBJ A;  1TXR A;  1PCA A;  2EVN A;  2BJO A;  5FLX b;  4QB9 A;  1K9M 2;  3KL9 A;  2ZEE A;  2ZEF A;  4UFX A;  1YW4 A;  4MY3 A;  3FJU A;  3PFE A;  1JJ2 Y;  5CM2 M;  3CPW Y;  2G3A A;  3PB8 X;  3GTL I;  4R6T A;  4B5O A;  2H85 A;  3CCE 1;  1LRZ A;  3M4O I;  1Z8X A;  1LQL A;  2E2I I;  1XEB A;  4FBE A;  2OZG A;  3KQX A;  4ONU A;  2Z11 A;  2ZW7 A;  2FS5 A;  1X3Z A;  4M6G A;  3SJX A;  1VQ9 Z;  3B3S A;  3ZZI A;  2PIY A;  4BXX I;  3PRT A;  4GS4 A;  4A39 A;  1L0C A;  3R1K A;  1BLL E;  3RZD I;  1Q7Y 1;  3CCU 1;  3EED A;  1ZLH A;  3GKQ A;  4Z65 A;  1RNI A;  4P45 A;  1L1O C;  2QJ8 A;  2CNM A;  3FF3 A;  3RNZ A;  5IP9 I;  5D1O B;  1KUX A;  1KWM A;  2FE7 A;  4R7M A;  2ZEM A;  4U5Y A;  1YUK A;  1P0H A;  1VQ4 1;  3FYN A;  1IB1 E;  5A2Q b;  1ZLI A;  3D67 A;  3HOY I;  4MFL A;  2BO9 A;  2VZY A;  2GLJ A;  1TF8 A;  5IP7 I;  2CXA A;  3CCV 1;  1K73 2;  2A4N A;  5I4M A;  2ZAE B;  1YHQ 1;  1S7N A;  1K4J A;  1Y8C A;  2EO8 A;  4QC6 A;  1VQ6 1;  3DR6 A;  2RFH A;  3MRU A;  1Z4E A;  4E2W A;  5K8O A;  3CMA 1;  4A3L I;  5G21 A;  1YVO A;  4MCQ A;  2K5R A;  4MJ8 A;  1K9M 1;  2JMO A;  1TFI A;  3VAR A;  3GTP I;  2ZW6 A;  1M4D A;  2O4H A;  2E9H A;  2BL1 A;  2ANP A;  3S6H A;  2CTB A;  5IT9 f;  2PJC A;  2IZ4 A;  4EFD A;  2J8M A;  2PK7 A;  4OIW A;  4DNC A;  4MRI A;  2G0B A;  1XRY A;  3G4S Z;  1YGH A;  3PB4 X;  3VWD A;  4CYN A;  3HOZ I;  3WAB A;  3D68 A;  2CY2 A;  3CCU Z;  4NB8 A;  3PO2 I;  1LFW A;  3CCJ Z;  2Y0M A;  4X2T A;  4XPD C;  2QEX 1;  1IY7 A;  4PQA A;  4E32 A;  4FD5 A;  2GU2 A;  4HNY B;  4Q7A A;  4C7H A;  1FDO A;  3S15 I;  5DS0 A;  2DPT A;  5J8C A;  3CCM 1;  2PJ6 A;  3CCQ Z;  3CXC Z;  4M6I A;  4CYQ A;  3GCF A;  4NJQ A;  5C88 A;  4AG7 A;  3CCQ 1;  3SI2 A;  3CXC Y;  4UF4 A;  2NSM A;  3TE4 A;  4P4J A;  2VEZ A;  4CRZ B;  2Q43 A;  4LQG A;  4JXR A;  1Q81 2;  2Z3M A;  2QRD B;  1VQ8 Z;  4PXD A;  4BBH A;  4FD4 A;  4F9V A;  2W03 A;  3LWU A;  1WK4 A;  4UFW A;  4MMO A;  1HDQ A;  4CAF A;  2F4M A;  5K8P A;  1YLE A;  2V3V A;  1ZB8 A;  3SI1 A;  1NP6 A;  4EWT A;  4E2X A;  4AYB A;  3ISZ A;  3QAY A;  3P2H A;  2QA4 Z;  4TWE A;  4XNH B;  3R9F A;  2P3Y A;  1QXF A;  4KVO E;  5D29 A;  1YW6 A;  5I0C A;  3S1N I;  3RO0 A;  3HOV I;  4HH4 A;  2O53 A;  1VQ5 Z;  4B5P A;  2PJ9 A;  3RZA A;  4OC4 A;  3R9G A;  1KC8 2;  1TWH I;  3TE5 B;  4MD8 A;  1CBX A;  4H2K A;  4P4F A;  2JBK A;  3TO9 A;  1N2F A;  4R9M A;  4BBR I;  2RBL A;  1N8R 1;  2RC4 A;  3DR8 A;  3KHX A;  3CC7 Z;  3HLP A;  4C2Y A;  1B6B A;  4RUH A;  1PFT A;  1VQ6 Z;  4C2X A;  3GTG I;  4HNX B;  4K30 A;  3S17 I;  4KS9 A;  3NDI A;  4AXV A;  3K2K A;  1Z02 A;  4KUA A;  2PJB A;  4MCR A;  4R87 A;  5HVH A;  2I00 A;  1Z4R A;  4IHM A;  2B4D A;  1Q7L A;  3I3G A;  1MJ9 A;  2AE6 A;  2FIA A;  1S72 1;  1ELL P;  3W6S A;  3IF8 A;  4A32 A;  4MHD A;  4NBG A;  4B6Z A;  1YIT Z;  1QVG Z;  2V77 A;  3SJG A;  2JDD A;  5AG6 A;  2LFU A;  3G6E Z;  1TF9 A;  4RVG A;  2GAN A;  3FBU A;  5KTD A;  4RS2 A;  3CCR Z;  4MCS A;  1XFO A;  3GTM I;  1QSR A;  4KOS A;  4E0A A;  4QVT A;  4CS0 B;  4U9Z A;  1CP6 A;  3L2N A;  2I3C A;  4P4I A;  3CPW Z;  1N8R 2;  1Q7Y 2;  1RO5 A;  1VKC A;  3J81 f;  2GTI A;  1JWQ A;  1Q81 1;  4F0Y A;  2VF1 A;  2GFQ A;  3FMC A;  3IIB A;  3PBE A;  4BY1 I;  2PM9 A;  3I1U A;  5F47 A;  3CMA Z;  1Z5R A;  1KQS Y;  1S72 Z;  3S9N A;  3G3S A;  2RB7 A;  4H6U A;  3TTH A;  4MCP A;  5K8M A;  3CC4 Z;  1Y1V S;  1R9T I;  1TWC I;  2B3U A;  1QYP A;  2EUI A;  5K8N A;  4FWU A;  4OME A;  4ZGY B;  4UWJ A;  5JPH A;  5JH9 A;  1RTQ A;  4A31 A;  3CQZ I;  1K73 1;  3DSB A;  2NVY I;  3JUW A;  2OOT A;  5GCN A;  4CAE A;  2RHB A;  4YGO A;  1ML8 A;  4X3R A;  1VQN Z;  3CPA A;  4AVC A;  4UIB A;  2AKL A;  1S60 A;  1QVF Z;  3G71 1;  4MFZ A;  2PRB A;  2VZZ A;  2AFZ A;  5D1O A;  5C4X I;  4UEE A;  5DWM A;  3J81 b;  3D6W A;  3F5B A;  3VMH A;  5H84 A;  4A33 A;  4C2Z A;  4CPA A;  2GLF A;  4ZY1 A;  2JDC A;  3GIU A;  5LYD A;  2C27 A;  1M4I A;  1N71 A;  3SXO A;  1PU9 A;  4B11 A;  1TWG I;  1EE3 P;  2IMO A;  3T90 A;  4A94 A;  4R76 A;  2Y0S A;  2G2K A;  5IB0 A;  1NSL A;  4RN7 A;  2PJ4 A;  2PJ2 A;  4NBD A;  3EER A;  4YRH A;  3BJ7 A;  3LAC A;  1VQ4 Z;  1TWF I;  4XPL A;  1YJ9 Z;  4KSA A;  2PDO A;  2OB0 A;  4NFR A;  3J7A 4;  2EK9 A;  3B7I A;  4IK2 A;  1M90 1;  3I4M I;  2REE A;  2ZXV A;  5JM6 A;  1VHS A;  4OC1 A;  4A37 A;  3H5Z A;  2EK8 A;  2XEJ A;  4PSX A;  3EY5 A;  2D4O A;  4MFJ A;  3BHX A;  4RVH A;  2YU9 I;  3HUV A;  2CF4 A;  1ZH1 A;  4X6A I;  2JA5 I;  3V8I A;  4A3B I;  3S6K A;  1Y9K A;  4A3D I;  5AG4 A;  2V8H A;  1TIQ A;  2DXQ A;  1AMP A;  2FT0 A;  4B5P B;  4UWI A;  3PFO A;  2NMT A;  3HOU I;  4HKF A;  1QVG Y;  1W2B Y;  1VQK 1;  1VQM Z;  2FCK A;  3D2M A;  1VQP 1;  2ZOG A;  4FD6 A;  4PSW A;  2BUE A;  3G6E 1;  2POK A;  4NBA A;  1AYE A;  3S1R I;  1LOK A;  1CX8 A;  1I6H I;  4U9Y A;  3MGD A;  3H4Q A;  4NB9 A;  2B4B A;  2PQ8 A;  2QR1 B;  1VQN 1;  2E7Z A;  2ATR A;  4A93 I;  1ON0 A;  4NBB A;  3FED A;  3P5J B;  3F8K A;  4X8I A;  1HEE A;  1BO4 A;  3B3W A;  5G1Z A;  1USP A;  3K9U A;  3T8W A;  4F6A A;  1Y1W I;  4W9Y A;  1WZN A;  3DDD A;  2JUB A;  3RZO I;  8CPA A;  4A30 A;  4CYP A;  4A3I I;  4EWC A;  2Q4V A;  3OW2 Y;  1U6M A;  4NGT A;  4E2Y A;  3NH4 A;  2WPX A;  1F2O A;  1YQE A;  3D3S A;  2HQY A;  2ZEP A;  2VBQ A;  3KKW A;  1XIX A;  3KQZ A;  3OW2 Z;  2P0W A;  2JA6 I;  4L89 A;  5KTC A;  3VWE A;  2GTH A;  2PR1 A;  2ZEN A;  3CME Z;  1Z8T A;  3TX8 A;  4TNU A;  2I79 A;  1VHE A;  3IWE A;  1DL6 A;  4KOT A;  1UFH A;  1FY7 A;  2Z3P A;  1RXT A;  5AN9 F;  2VUG A;  1GYT A;  4YWY A;  4BD9 A;  3S9L A;  3R9E A;  3QAH A;  2RPR A;  2VPX A;  3TOB A;  4CRY B;  4IUS A;  1QVF Y;  2C6P A;  4FUU A;  4KOY A;  4GM5 A;  4MD7 A;  4ZY2 A;  2R7H A;  2Q0Y A;  1IIC A;  4A38 A;  3S6F A;  4MH4 A;  5LRK A;  1BAV A;  1OBR A;  4A3M I;  3LMS A;  2JR6 A;  3LD2 A;  3D8P A;  2F5I A;  2FL4 A;  4BMH A;  4O23 A;  3SHP A;  1Q2C A;  3CC2 Z;  3H0G I;  3ISX A;  4I49 A;  3M3Y I;  4KLV A;  3FEE A;  2PJ0 A;  1S5K A;  1S7K A;  2BCO A;  3FNC A;  1YX0 A;  2F8H A;  3BI0 A;  1M4G A;  2DF5 A;  2CTC A;  1LAN A;  1YLO A;  3PB7 X;  3DGV A;  4M6H A;  4P4B A;  2QEX Z;  2R92 I;  1KRL A;  4L8A A;  1RO2 A;  1J4J A;  4RVF A;  2KPI A;  2OU2 A;  2OOX B;  2JA7 I;  3G4S 1;  1SIW A;  3GTQ I;  4PK3 A;  1TWA I;  4Y7N I;  3PBB A;  1NMT A;  3DLJ A;  3FEC A;  4A3E I;  4NEX A;  3S9M A;  3VAT A;  1AUG A;  3CC2 1;  2PJA A;  4ONW A;  3BXM A;  3GKR A;  3FX6 A;  4IF5 A;  3G8W A;  4CGP A;  4MD9 A;  3PB6 X;  2B3V A;  3BG1 B;  4OC3 A;  2C6G A;  3DNS A;  4A95 A;  1X12 A;  3IX0 A;  2ODF A;  4M85 A;  2E2H I;  3D66 A;  2DE7 A;  3CXP A;  2GE3 A;  2ABZ A;  4KLW A;  5T64 A;  4JWP A;  3F0A A;  5D1P A;  3JAM f;  1CPS A;  2E2J I;  3S2H I;  3MZK B;  1Q86 2;  3FRM A;  2PJ3 A;  2HU9 A;  2XEG A;  2B5G A;  4UCN A;  4F0X A;  2YAD A;  2OH1 A;  4DJL A;  1I3Q I;  3KR4 A;  1YJW 1;  2PMZ A;  1S3Z A;  4OAD A;  4DQY B;  2ZEG A;  3PB9 X;  4KOR A;  4KOU A;  4ZI6 A;  1I50 I;  3KIF A;  1NSA A;  1WII A;  2NVQ I;  3E0K A;  4QTT A;  2B5G B;  3JVN A;  4R3L A;  2C1C A;  3GTO I;  3A9L A;  2PIZ A;  4MFQ A;  3VMG A;  4PK2 A;  1VIX A;  1R3N A;  2Z3L A;  1KD1 2;  1XE4 A;  2WUU A;  2JEV A;  4UEF A;  2ZW4 A;  3PEI A;  4E30 A;  2AFM A; 
#chains in the Genus database with same CATH homology
 3KGQ A;  5LRG A;  3EED A;  3SI0 A;  4PXE A;  1ZLH A;  3GKQ A;  5LYD A;  3KZW A;  3HOW I;  4MHY A;  3N5F A;  4HGY A;  1YIJ 1;  4Z65 A;  1RNI A;  1VQ5 1;  4P45 A;  2K3R A;  1L1O C;  3D7H A;  2QJ8 A;  3FF3 A;  4NBC A;  1TWG I;  1Z03 A;  2Q4Z A;  1Q86 1;  1XMB A;  5IP9 I;  1EE3 P;  4RVD A;  5D1O B;  4OC5 A;  5A2Q f;  3NFZ A;  1M4L A;  2IMO A;  4E33 A;  1KWM A;  1WCM I;  4R7M A;  4A94 A;  1CP7 A;  4R76 A;  2Y0S A;  1FT7 A;  2ZEM A;  2QLV B;  4NJR A;  5IT9 b;  3ESW A;  1USP B;  2G2K A;  1YUK A;  2R7Z I;  1VQ4 1;  2DEA A;  2PJ4 A;  2PJ2 A;  2ZEH A;  3RBU A;  4NBD A;  3EER A;  5A2Q b;  1ZLI A;  3D67 A;  3HOY I;  3NDJ A;  3WT4 A;  2BO9 A;  2VL1 A;  2R6M A;  3CME 1;  2AFW A;  2PE3 A;  2GLJ A;  3CCE Z;  1VQ4 Z;  1YUA A;  1TWF I;  1TF8 A;  5IP7 I;  1YJ9 Z;  4R8F A;  1XJO A;  3WC5 A;  4NFR A;  3J7A 4;  3CCV 1;  2EK9 A;  3FQQ A;  1VQ7 Z;  1K73 2;  3B7I A;  2OZK A;  4IK2 A;  3D4U A;  4A3F I;  2AFO A;  1M90 1;  1JQG A;  5I4M A;  3I4M I;  4MHN A;  1KQS Z;  2ZAE B;  1YHQ 1;  1VQL Z;  3FH4 A;  3I55 Z;  4ZYQ A;  1Y7E A;  1ZG8 A;  5JM6 A;  1VQM 1;  4RS4 A;  1PYT B;  4OC1 A;  3CC7 1;  1YME A;  2JBJ A;  4S1T A;  7CPA A;  4A37 A;  2EK8 A;  3MON A;  3KIH A;  1VQ6 1;  1JWH C;  4OP4 A;  3IJ3 A;  3FKI I;  2XEJ A;  4P6Y A;  3GTJ I;  3Q87 A;  4F8Z A;  2RFH A;  3MRU A;  2WB1 A;  4NBE A;  4WJB A;  2ZEO A;  3BHX A;  2OR4 A;  4E2W A;  2AFS A;  5FLX f;  4BBS I;  5K8O A;  3CMA 1;  3HKZ A;  4A3L I;  4RVH A;  2EWB A;  3JRU A;  4MCQ A;  2YU9 I;  3I07 A;  3GLJ A;  1Y1V I;  3HUV A;  2CF4 A;  2K5R A;  5LYL A;  3JAM b;  1ZH1 A;  2F4O A;  2Q51 A;  1S7M A;  1K9M 1;  4X6A I;  3CCM Z;  2WAQ A;  2JMO A;  2JA5 I;  5IB9 A;  1TFI A;  3VAR A;  3GTP I;  3F3P C;  4A3B I;  3VH9 A;  3QWU A;  2QVP A;  1CG2 A;  2O4H A;  4A3D I;  4A3C I;  2V8H A;  1M1K 2;  4OKO A;  2NVX I;  4P10 A;  1AMP A;  2PJ1 A;  2E9H A;  2ANP A;  4P4D A;  1LCP A;  2IZ3 A;  4YU9 A;  2CTB A;  3IFE A;  4ZY0 A;  4DK1 A;  5IT9 f;  3PFO A;  2PJC A;  2IZ4 A;  3IC1 A;  3HOU I;  1ARM A;  4EFD A;  3I55 1;  3LUS A;  3I56 Z;  1WW9 A;  2PK7 A;  1VQM Z;  1QVG Y;  1W2B Y;  1VQK 1;  4OIW A;  3WC7 A;  1VQ7 1;  1VQP 1;  5LYF A;  4MRI A;  1Z2L A;  2ZOG A;  4XX2 A;  3IEH A;  1XRY A;  2QRE B;  1QQ9 A;  3G4S Z;  3G6E 1;  3S16 I;  1LAM A;  4NBA A;  4BY7 I;  1AYE A;  3PO3 S;  1Y0Y A;  2POK A;  3PB4 X;  4UIA A;  2QKD A;  3S1R I;  1LOK A;  2PJ5 A;  1CX8 A;  1P9N A;  1NJI 2;  3HOZ I;  1I6H I;  3WAB A;  3D68 A;  2PJ7 A;  5T6B A;  3SJE A;  3WC6 A;  3MN8 A;  4MXU A;  2DE5 A;  4NB9 A;  3D7D A;  3CCU Z;  2QR1 B;  3S2D I;  3B3T A;  2JNY A;  1TKH A;  4NB8 A;  1VQN 1;  3PO2 I;  1LFW A;  2DE6 A;  4E31 A;  2PCU A;  4KSI A;  1K8A 1;  3NH8 A;  3CCJ Z;  2V8G A;  1NUI A;  4X2T A;  2M48 A;  4MHZ A;  3CCS 1;  2QEX 1;  1M90 2;  2PVW A;  3U50 C;  1IY7 A;  4A93 I;  4PQA A;  4E32 A;  2XEI A;  3I4N I;  1DE4 C;  4GM5 A;  4NBB A;  2V8D A;  2GU2 A;  5HVF A;  3TDH B;  4Q7A A;  3FED A;  3P5J B;  3S15 I;  5LYI A;  5DS0 A;  4X8I A;  1HEE A;  4A3G I;  3CCM 1;  3B3W A;  1YIT 1;  1USP A;  2PJ6 A;  4PXB A;  3T8W A;  3CCQ Z;  3CXC Z;  3CT9 A;  4ZX9 A;  2JS4 A;  3CCJ 1;  1XBU A;  1Y1W I;  1YIJ Z;  4NBH A;  3GCF A;  4W9Y A;  1W2B Z;  2HC9 A;  4NJQ A;  5LL6 f;  2JUB A;  2OTJ 1;  2W04 A;  3RZO I;  8CPA A;  3HOX I;  3K9T A;  1ZG9 A;  4A3I I;  5C44 I;  1ZG7 A;  4EWC A;  3CCQ 1;  3OW2 Y;  3CXC Y;  1DTD A;  3SI2 A;  5JGF A;  4UF4 A;  2NSM A;  4NGT A;  3CCR 1;  2NVT I;  4P4J A;  5T67 A;  4E2Y A;  3G71 Z;  1VQ9 1;  2IQ6 A;  3F3F C;  2C6C A;  3NH4 A;  3PO3 I;  1VQK Z;  5LRJ A;  3H8E A;  1F2O A;  2Q43 A;  4LQG A;  1RO0 A;  3B3V A;  1M1K 1;  2ZEP A;  1Q81 2;  4EME A;  1YJ9 1;  3KQZ A;  3OW2 Z;  2QRD B;  3H8G A;  3BI1 A;  1VQ8 Z;  4PXD A;  2JA6 I;  2P28 A;  2GTH A;  1BPM A;  1Y0R A;  2W03 A;  3CME Z;  2ZEN A;  4WWV A;  3LWU A;  1YI2 Z;  3S1M I;  3TX8 A;  4F9V A;  4TNU A;  2NYQ A;  1JJ2 Z;  1VHE A;  1DL6 A;  4MMO A;  1HDQ A;  2J9A A;  3GB0 A;  2F4M A;  4NGR A;  3V38 A;  5K8P A;  1QMU A;  1ZB8 A;  5AN9 F;  3SI1 A;  2VUG A;  1NP6 A;  3VMI A;  4E30 A;  1GYT A;  4YWY A;  3S1Q I;  4RV9 A;  4DYO A;  4EWT A;  1YI2 1;  1K8A 2;  4E2X A;  4AYB A;  2OOY B;  4BD9 A;  2AFX A;  3ISZ A;  3S9L A;  3H3V J;  2RPR A;  2QA4 Z;  4TWE A;  2P3Y A;  4OC0 A;  2AFU A;  4E2Z A;  1QVF Y;  2C6P A;  5D29 A;  1YW6 A;  2LIY A;  4PXC A;  3S1N I;  3KR5 A;  4FUU A;  3B2Y A;  2F7V A;  3J80 b;  3HOV I;  4HH4 A;  2O53 A;  1F2P A;  1R43 A;  1VQ5 Z;  2PVV A;  4MD7 A;  2PRQ A;  2PJ9 A;  3RZA A;  4OC4 A;  4Y52 I;  4ZY2 A;  2VUM I;  3FVL A;  4K3N A;  2HB6 A;  3IWW A;  5HVG A;  1KC8 2;  2V8J A;  4A38 A;  1TWH I;  1YJN 1;  3TE5 B;  4MD8 A;  1ARL A;  1CPX A;  3T4N B;  1CBX A;  1F57 A;  2CIJ A;  5C4J I;  3CD6 1;  4H2K A;  1HDU A;  4JYW A;  4P4F A;  3H8F A;  1IGB A;  2ZED A;  1YSJ A;  4MH4 A;  5LRK A;  1BAV A;  1VLA A;  4A3M I;  3GTK I;  1OBR A;  4NGP A;  3LMS A;  1KC8 1;  2JBK A;  2JR6 A;  4CL1 A;  4IAV A;  1N2F A;  4O23 A;  4BBR I;  2RBL A;  3CC2 Z;  1N8R 1;  4NH1 C;  3H0G I;  3KHX A;  1H8L A;  3CCS Z;  3ISX A;  4NGS A;  3CC7 Z;  3HLP A;  1X0T A;  3M3Y I;  2ZOF A;  5FLM I;  3FEE A;  4RUH A;  1Q82 1;  4DGL A;  2OTL Z;  1PFT A;  1VQ6 Z;  3GTM S;  2EGT A;  3GTG I;  1TKJ A;  1UWY A;  2PJ0 A;  1ELM P;  3S17 I;  3S14 I;  2BCO A;  3NDI A;  4AXV A;  3K2K A;  1Z02 A;  2ZEL A;  1QF8 A;  3VTN A;  4NGM A;  4NBF A;  3CCL Z;  5D8N A;  2PJB A;  4MCR A;  5HVH A;  1SFO I;  3GUX A;  2F8H A;  2QYV A;  4IHM A;  3BI0 A;  2BOA A;  1NJI 1;  1RLY A;  1Q7L A;  4G1P A;  2CTC A;  1LAN A;  1BPN A;  1YLO A;  3DGV A;  3PB7 X;  4P4B A;  2QEX Z;  2R92 I;  3CC4 1;  1Z8L A;  3CCL 1;  1KRL A;  1S72 1;  1RO2 A;  1K83 I;  2G9D A;  4MHP A;  1ELL P;  1X3W A;  4OC2 A;  3IF8 A;  2V8I A;  4RVF A;  2KPI A;  1VQO 1;  3KI9 A;  1RO4 A;  1RQF A;  2J6A A;  2WZN A;  4NBG A;  4B6Z A;  1YIT Z;  2OOX B;  3NH5 A;  1QVG Z;  2R93 I;  2V77 A;  3D7F A;  5CPA A;  3SJG A;  2JA7 I;  2LFU A;  3G4S 1;  3G6E Z;  3GTQ I;  2V8V A;  4NGQ A;  4OID A;  3K7A I;  3I56 1;  1TWA I;  4Y7N I;  3MZL B;  1TF9 A;  5F09 A;  4UEZ A;  4RVG A;  3PBB A;  2M6N A;  3DLJ A;  3FEC A;  4A3E I;  4A3J I;  1VQP Z;  3S9M A;  2JEW A;  1YJW Z;  3CCR Z;  4MCS A;  4A3K I;  2QRC B;  3VAT A;  3FQM A;  1YJN Z;  3D9X A;  1VHO A;  1XFO A;  4F9U A;  3GTM I;  1KD1 1;  1TKF A;  2JA8 I;  3CC2 1;  2PJA A;  2PJ8 A;  5THW A;  4QTU A;  4ONW A;  3RAM A;  3BXM A;  1CP6 A;  3L2N A;  2I3C A;  4ZX8 A;  2HF1 A;  3FX6 A;  4P4I A;  3CPW Z;  3D7G A;  1N8R 2;  1Q7Y 2;  4MD9 A;  1VGY A;  4NGN A;  2WYR A;  3PB6 X;  3BG1 B;  4OC3 A;  2C6G A;  3J81 f;  2GTI A;  3TC8 A;  3NA6 A;  2QA4 1;  1Q81 1;  3IX0 A;  2VF1 A;  3CDX A;  5J1Q A;  3FMC A;  2IJZ A;  1YHQ Z;  1VQL 1;  2E2H I;  3IIB A;  2V8K A;  3BG0 B;  3D66 A;  2DE7 A;  3VB9 A;  1Z01 A;  3PBE A;  4BY1 I;  2PM9 A;  2GRE A;  4P44 A;  4NOZ A;  1TXR A;  3I1U A;  1PCA A;  1LAP A;  2ABZ A;  2BJO A;  5FLX b;  1Q82 2;  1K9M 2;  3KL9 A;  3CMA Z;  5T64 A;  1Z5R A;  1KQS Y;  2ZEE A;  1S72 Z;  3S9N A;  5D1P A;  3JAM f;  2XEF A;  1CPS A;  2E2J I;  3S2H I;  3MZK B;  1Q86 2;  2ZEF A;  2RB7 A;  2PJ3 A;  2B63 I;  2HU9 A;  2XEG A;  3QNV A;  4MCP A;  5K8M A;  3CC4 Z;  2AFM A;  2YAD A;  1Y1V S;  1R9T I;  1TWC I;  2FVG A;  1QYP A;  4MON A;  5K8N A;  1YW4 A;  4FWU A;  4OME A;  4DJL A;  3FJU A;  3PFE A;  1I3Q I;  3KR4 A;  1YJW 1;  2PMZ A;  5CBM A;  1JJ2 Y;  5CM2 M;  3CPW Y;  3CCV Z;  3PB8 X;  1FNO A;  4DQY B;  2ZEG A;  3GTL I;  3PB9 X;  4PPZ A;  1RTQ A;  3IO1 A;  4P4E A;  3CPX A;  4R6T A;  5JH9 A;  2H85 A;  4ZI6 A;  1I50 I;  3CQZ I;  3KIF A;  1K73 1;  1NSA A;  3KHZ A;  1WII A;  3CCE 1;  2OTL 1;  2NVY I;  3SJF A;  3M4O I;  2OOT A;  3KAS A;  2RHB A;  4DUK A;  4HGZ A;  2NVQ I;  6CPA A;  1VQO Z;  4QTT A;  1LQL A;  1ML8 A;  1VQ8 1;  2E2I I;  4X3R A;  4FBE A;  2OTJ Z;  3KQX A;  1VQN Z;  3CPA A;  5C3E I;  2C1C A;  1X3Z A;  2RIQ A;  3GTO I;  4UIB A;  2AKL A;  3SJX A;  2PIZ A;  3V7Z A;  1QVF Z;  3G71 1;  1VQ9 Z;  5HXD A;  1ZB9 A;  3CD6 Z;  3B3S A;  2KI7 B;  3VMG A;  3IFU A;  2RT9 A;  2PIY A;  4BXX I;  1VIX A;  2AFZ A;  3PRT A;  1R3N A;  3J80 f;  4JZ0 A;  4A39 A;  1KD1 2;  5D1O A;  5ELY A;  5C4X I;  1BLL E;  4UEE A;  3RZD I;  4UEF A;  3J81 b;  3D6W A;  3B3C A;  3PEI A;  3VMH A;  4FAI A;  3B35 A;  4CPA A;  2GLF A;  4ZY1 A;  1Q7Y 1;  3CCU 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...