2O53A

Crystal structure of apo-aspartoacylase from human brain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o53A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o53A01
1Y0RA 2BO9A 3NH5A 4OIDA 4LQGA 4OP4A 4X8IA 1CBXA 1ZG7A 3B3TA 3WT4A 5K8PA 1ZG8A 3PB9X 4OC2A 4OKOA 4PXEA 2C1CA 1XFOA 1F2PA 3KHZA 2XEGA 2AFWA 2ZEOA 3LMSA 3IFEA 2QVPA 3IEHA 1FNOA 4NGRA 1CX8A 4FAIA 2PJ1A 4FUUA 2PJ3A 3IJ3A 5LRGA 2Q4ZA 4Q7AA 4EMEA 2OR4A 1CP7A 2V8GA 3BI1A 1TKFA 5D29A 4EWTA 4IAVA 5CPAA 3IC1A 2GREA 1OBRA 2IQ6A 1LOKA 1CPXA 1VGYA 1HEEA 2G9DA 1F2OA 4UEFA 4P4EA 4P4JA 5LRKA 1DTDA 2CTCA 1ARMA 4A37A 3QNVA 3DLJA 4MHNA 3FVLA 4P45A 5K8MA 1Y7EA 3PBBA 2RB7A 2QJ8A 3BI0A 4TNUA 3B35A 1IGBA 2ZEPA 4MRIA 3B3WA 5LYIA 4OC1A 3NA6A 3N5FA 4ZX8A 5DS0A 2C6CA 3K2KA 3SJFA 1JQGA 2PVVA 4NGTA 4DUKA 3KL9A 1AYEA 4ZX9A 1LAMA 1Z2LA 1R43A 3FMCA 4GM5A 2V77A 3PB4X 2PJAA 4P4FA 3WC5A 2PCUA 4NJRA 3KR4A 3KI9A 3FECA 4MHPA 4YU9A 1XRYA 2ZOGA 4ZY0A 3D68A 2PVWA 4F9VA 2HC9A 1XMBA 4WWVA 3D7DA 3BHXA 4NGMA 4UF4A 2PJ2A 1YLOA 3H8FA 3RBUA 8CPAA 2NYQA 2PJ9A 2F7VA 4MHZA 1ARLA 4G1PA 2PJBA 4BD9A 4NFRA 3KGQA 2JEWA 4UIBA 3T8WA 1YW6A 3SJGA 2O53A 1HDQA 4WJBA 3S9MA 3KR5A 4YWYA 4PXCA 5LYFA 4NGQA 1TF8A 1QQ9A 2PIYA 3PB6X 1LCPA 5I4MA 3RZAA 2ZEFA 2NSMA 2I3CA 2VL1A 2PJ0A 3GUXA 2C6GA 3KZWA 3WC6A 4PQAA 3FJUA 2PJ5A 2PJ4A 3I1UA 3PFOA 3NFZA 2JBKA 3FEDA 4FBEA 3D67A 1ZLHA 1Y0YA 2AFSA 4MCRA 1HDUA 4P6YA 4X2TA 3V7ZA 3SI2A 2ZOFA 3VARA 5J1QA 3H8EA 2V8HA 1QMUA 3B7IA 5LRJA 4UEZA 4ZYQA 4R76A 2ANPA 2EWBA 3NH8A 2BCOA 1KWMA 4IHMA 5IB9A 3JRUA 3FF3A 3ISXA 1TXRA 2PE3A 2PRQA 4PPZA 5K8NA 3ISZA 3D7FA 1VHEA 3LWUA 4P4DA 4JYWA 4OC4A 3RAMA 4R7MA 3GB0A 2O4HA 3WABA 2POKA 1Z5RA 2J9AA 4NGPA 5LYDA 3NH4A 3D4UA 2QYVA 2WZNA 3GLJA 1EE3P 1LAPA 4UIAA 2ZEEA 3CPXA 4F8ZA 1XBUA 3B3CA 7CPAA 4A38A 2CTBA 4DYOA 2EK8A 5HXDA 4W9YA 1IY7A 3MN8A 5JGFA 3PB7X 2Q43A 2CF4A 5HVFA 4A94A 3B2YA 2JBJA 3FH4A 3MRUA 4OIWA 3PBEA 1H8LA 3CT9A 2PJ8A 2IMOA 1PCAA 2PJCA 3TC8A 1GYTA 4ONWA 3D7GA 4NJQA 2EK9A 5K8OA 3S9NA 4EFDA 2PJ6A 2HB6A 4IK2A 1CPSA 2OOTA 5THWA 4R6TA 3TX8A 1FT7A 1Z8LA 4NGSA 2AFZA 2AFXA 5F09A 4ZY1A 4R8FA 1PYTB 5HVHA 4JZ0A 3KASA 2BOAA 2AFUA 2CIJA 1LANA 2PIZA 2PJ7A 3PRTA 2XEIA 1XJOA 4K3NA 4B6ZA 4DJLA 3B3SA 3WC7A 2XEFA 4P4IA 3KHXA 4P10A 4H2KA 1CP6A 3PB8X 4PXDA 2ZEDA 3VATA 1YW4A 5JH9A 4NGNA 5CBMA 3SI1A 1Q7LA 2ZEHA 3V38A 2IJZA 3B3VA 4MHYA 3IIBA 3D7HA 3KQZA 2ZEMA 1ELLP 1DE4C 3H8GA 3IWWA 3D66A 1BAVA 1ELMP 4X3RA 4ZI6A 1BPMA 4ZY2A 1M4LA 1RTQA 3HLPA 1NSAA 4F9UA 4OC3A 3HUVA 1TKJA 3PFEA 3K9TA 6CPAA 5LYLA 2RFHA 5JM6A 4OMEA 3CPAA 5ELYA 5HVGA 1AMPA 4Z65A 2AFOA 1R3NA 4MCSA 5D8NA 4RUHA 1UWYA 1ZG9A 2V8VA 1LFWA 1TF9A 3IO1A 2GLFA 3SJEA 1CG2A 3KQXA 2GLJA 4UEEA 3SI0A 2C6PA 4OC0A 3DGVA 3L2NA 3S9LA 4KSIA 3FEEA 4MXUA 1ZLIA 4MCPA 3CDXA 4MCQA 3SJXA 4CPAA 2FVGA 2ZEGA 1F57A 2GU2A 2XEJA 1BLLE 1YSJA 4TWEA 2ABZA 1TKHA 2DEAA 2AFMA 1BPNA 4PXBA 4FWUA 1YMEA 2F8HA 1VIXA 2WYRA 4AXVA 2Q51A 1VHOA 4P4BA 3FX6A 4P44A 2ZELA 2ZENA 4OC5A 3PEIA 3BXMA 4A39A 2V8DA 4O23A 4MMOA 3VH9A
chains in the Genus database with same CATH superfamily
4AVCA 2JIMA 2E2II 4X8IA 4B12A 4XNHC 1CBXA 1YHQ1 3NDIA 3BJ7A 2D4OA 5K8PA 2C1CA 4MFQA 4CL1A 1F2PA 3KHZA 2XEGA 2PC1A 2PQ8A 1TWAI 4A3MI 3LMSA 4C2XA 3D2LA 1JJ2Z 3TO7A 5F46A 4FUUA 1PFTA 5LRGA 2LIYA 3CCLZ 4NEXA 2Q4ZA 3BI1A 3HOYI 4EWTA 1OBRA 4A33A 3S17I 2CTCA 3QNVA 3FVLA 4P45A 2R8VA 3H0GI 1S7KA 2RB7A 2QJ8A 1K8A2 3BI0A 5T6BA 4U5YA 1ON0A 3NA6A 2C6CA 1YUAA 2PVVA 2QA41 3KL9A 1AYEA 2Z3KA 3HOWI 3CQZI 4GM5A 2V77A 4Q38A 2PJAA 1RO0A 2R6MA 2ZOGA 3A9LA 2HC9A 2NVTI 1VKCA 3LACA 3D7DA 3ZJ0A 4UF4A 1YLOA 3K9UA 5G20A 3RBUA 3I56Z 4HGYA 4B5PB 4A2ZA 4MHZA 4H6UA 2PJBA 5IB0A 1YJW1 4UIBA 5F47A 3T8WA 4E31A 4XPLA 2EVNA 3FQMA 5EBVA 3S9MA 2YNEA 4CGPA 2PDOA 4PXCA 5LYFA 2PIYA 2YGWA 3GTKI 2NSMA 2PJ0A 2C6GA 1Z8XA 4CAWA 2GE3A 2PJ5A 4B10A 4NBBA 4JLYA 4MD9A 2JBKA 4FBEA 2AFSA 1HDUA 3SI2A 4X5KA 3G4S1 2V8HA 3TT2A 2QMLA 3KIHA 2Z3LA 3CCJZ 4YFJA 4BBRI 3HOZI 2VQYA 1KWMA 3IR7A 3S14I 1VQKZ 2KCWA 1N8R2 3GTMI 1B87A 4JD6A 1VHEA 4XX2A 4OLLA 4OC4A 2ZW7A 2WUUA 4R3LA 5FLXf 2O4HA 2OOYB 4U9ZA 3WABA 5IV0A 1I1DA 2PR8A 3H4QA 4NGPA 4BY7I 1U6MA 2R1IA 2QYVA 4J3GA 1VQ81 1BO4A 3GIUA 1Z8WA 3B8GA 2FL4A 4Q36A 4UIAA 1KC82 3CPXA 1RO2A 4XPDB 3IWEA 4QB9A 4RVHA 2CTBA 1M1K2 5HXDA 3FQQA 4KS9A 2Z3MA 2JIPA 3VMGA 3OW2Y 2VPZA 1YVOA 3G8WA 3CC71 3PBEA 4MD8A 1B6BA 1H8LA 3CT9A 4NOZA 3R1KA 4A95A 4NCZA 4RI1A 3TFYA 4NSQA 1VQ7Z 4MY3A 5K8OA 3JVNA 1YUKA 1VHSA 2FIWA 2HB6A 3TX8A 2G2KA 4AG9A 3VWEA 1Z8LA 1X3WA 2AFXA 1L1OC 1USPA 3CCQ1 1S3ZA 3MZKB 4JZ0A 4S1TA 1VQ41 1Z8TA 1RLYA 4A3BI 4MH4A 1S7LA 2XEIA 1YIT1 5A2Qb 1QVGZ 3B3SA 4R3KA 1NE9A 4FD5A 4P10A 4C7IA 3PO3S 4CAVA 4H2KA 5D1PA 1Q812 2ZEDA 3LUSA 3VATA 3F3FC 1NUIA 1S72Z 3CCS1 3R9FA 5HH1A 1Q7LA 2ZEHA 5IT9f 3V38A 1DE4C 3EC4A 3D66A 1YJNZ 4X3RA 1M901 1QYPA 4BBSI 4ZY2A 5CM2M 2V3VA 5JPHA 1NSAA 4II9A 2Z11A 3FYNA 3K9TA 2REEA 6CPAA 2WB1A 1YK3A 1P4NA 2RFHA 5JM6A 4F0YA 3CPAA 1QSRA 1V0CA 5AG6A 2FSRA 2QLVB 3CME1 1UWYA 1L0CA 4AVBA 2P3YA 4ZBGA 1LFWA 3CZXA 3SJEA 4KUBA 4UEEA 2VXKA 4L8AA 4UWIA 3L2NA 3S9LA 4KSIA 3FEEA 1Z9UA 3CCE1 4I49A 2DPSA 3TTHA 3CMAZ 1XOVA 3CDXA 4MCQA 2PMZA 3SJXA 1M4GA 2ZEGA 1BLLE 1YSJA 1Z4RA 3TE4A 2VF1A 2NVQI 3CD6Z 4PXBA 2R98A 5C3EI 2FIAA 2I79A 2ARHA 1VIXA 2KI7B 2Q0YA 1KUXA 3CC21 3CC41 5JQ4A 2Q51A 1VHOA 2Z3NA 4U9YA 3FX6A 4IF5A 4P44A 3M3YI 2ZELA 4NBFA 2REFA 3BXMA 4O23A 2QA4Z 3VH9A 1Y0RA 2EO8A 3R96A 4X6AI 3J7A4 1M44A 3NH5A 2VZYA 5G1ZA 5IP7I 3NE8A 1P9NA 1ZG8A 4PXEA 4F0XA 1XFOA 2R93I 2ZAEB 1YI2Z 3J80b 4F6AA 3MGDA 3KIFA 2QVPA 4NGRA 2QEX1 4UCNA 1CX8A 2Q4YA 2VPWA 2OTJZ 4EMEA 1CP7A 2O28A 1Q861 1AUGA 4M85A 2YNDA 3DNSA 1K4JA 5CPAA 4E2YA 1LOKA 1W2BZ 1CPXA 1S60A 4NF1A 2G9DA 1F2OA 1VQ9Z 2YNCA 4KLWA 2DE5A 2JUBA 1P0HA 3Q87A 4A37A 2BUEA 4MHNA 5K8MA 2IZ4A 4YRHA 3PBBA 3CCR1 4PSWA 3CXCZ 4TNUA 3B35A 2WSAA 2RPRA 2ZEPA 3B3WA 5LYIA 3S16I 3R9GA 4ZX8A 3EO4A 5DS0A 2QKDA 1JQGA 1Z2LA 2BJOA 3F0AA 1IOFA 3WC5A 4LUAA 3KR4A 3FECA 3SXOA 3D68A 4F9VA 4KVME 4WWVA 2RHBA 3BHXA 2VZZA 2PJ2A 4UFVA 2OTL1 4CRYB 5A27A 2NYQA 1Y7RA 4G1PA 1KZFA 2JIOA 4BD9A 4NFRA 1I21A 1YW6A 4NBEA 3SJGA 1HDQA 3H5ZA 2JIQA 2NAPA 3G71Z 4WJBA 3KR5A 3W6SA 4MD7A 1QQ9A 4A3EI 1XF8A 1LCPA 3G3SA 3CXSA 4KOXA 3WC6A 3I1UA 3PFOA 2Q7SA 4R87A 1ZLHA 4CGOA 2JEVA 3S1QI 1NP6A 4LX9A 4KVXA 1KQSZ 2JA5I 3CPWZ 1USPB 1VQO1 5C44I 3P2HA 2V8KA 4PSXA 4ZYQA 4R76A 1ZO0A 3NH8A 1WJ2A 4IHMA 3IF8A 4HH4A 3FF3A 3CXPA 5K8NA 4KOSA 5LL6f 2C27A 4P4DA 4JYWA 4OADA 1VQLZ 2X7BA 5J8CA 3GB0A 1Q7Y1 4NB8A 2V45A 2POKA 2Q04A 2ZW5A 3D4UA 2B63I 4E2XA 5BWAB 2EBJA 3UY5A 4A3II 1ZB9A 3CCVZ 1RO4A 4M6GA 2B3VA 3FRMA 1XBUA 5IX3A 2K5RA 2G0BA 4A38A 4DNCA 1A2ZA 1YJ91 3H3VJ 4BY1I 1IY7A 4KUAA 5JGFA 4QTTA 4AG7A 3FH4A 2Q7BA 4CRZB 1M902 4OIWA 1Y8CA 1Y9KA 2PJ8A 4M6HA 4NH1C 3QAHA 3JUWA 2Z0ZA 1PCAA 2JLMA 1GYTA 1K9M1 3U50C 3J81f 4KORA 5H86A 2QR1B 5AGEA 4EFDA 4CAFA 3MZLB 2P6EA 2AYDA 2FS5A 5THWA 3S6GA 1I3QI 3CCU1 3W6XA 4NGSA 3QB8A 4R8FA 2VEZA 1PYTB 4CGNA 2AFUA 4RV9A 1R57A 1Q821 4HNXB 2JA8I 4BMHA 1YQEA 4DJLA 3NDJA 1JJ2Y 3BG1B 1YLEA 3WC7A 3GTLI 1VQM1 3TCVA 2M48A 1MJAA 1KUVA 2JMOA 3PP9A 4M6IA 3SI1A 3VTNA 2ZXVA 4A3DI 1XIXA 2IJZA 3D7HA 3KQZA 1FDOA 1VQ6Z 4ZI6A 1XEBA 3FKII 4FD6A 4FD7A 1BPMA 4XPDC 1M4LA 2B4DA 3D6WA 1TKJA 3FIXA 2V8IA 2GFQA 2WPXA 1QF8A 5F48A 4OMEA 5ELYA 1AMPA 1PU9A 3DR6A 4Z65A 1RXTA 1R3NA 4RN7A 1Z01A 3G6EZ 2Z3OA 3D2MA 4MHDA 2QEXZ 2V8VA 2EGTA 3IO1A 2H5MA 2QRCB 1CG2A 3KQXA 5G22A 2FCKA 1Q862 4PK3A 3SI0A 2C6PA 4OC0A 1QVFZ 1X0TA 1ZLIA 4MCPA 2H85A 4CPAA 5FLMI 2ABZA 3CCMZ 1OZPA 2AFMA 1BPNA 2F4MA 4NBAA 3EERA 2Z10A 1MJBA 3I55Z 3JAMb 1YX0A 2A4NA 3M4OI 1IIDA 1NJI2 2R7ZI 3PEIA 3CCL1 1IYKA 2I00A 4A39A 2V8DA 3I07A 4MMOA 1YIJZ 2BO9A 1BOBA 4OIDA 4ONUA 3S1NI 1ZG7A 3BJ8A 2HUZA 1ZB8A 3WT4A 3PB9X 4OC2A 1RNIA 2P0WA 2G3TA 4KVOE 2AFWA 2ZEOA 4KZTA 4E8OA 3IFEA 5AG5A 3IEHA 1NMTA 1VQ5Z 2PJ3A 2OR4A 2R7HA 2V8GA 2OB0A 1TKFA 5D29A 2ZW4A 2BL1A 2BEIA 3IC1A 3S6KA 2IQ6A 2B5GA 2D4PA 4MFJA 3S1MI 1YHQZ 1VGYA 2OH1A 4P4EA 5GCNA 4RS4A 4CGMA 4C68A 5LRKA 1DTDA 5FLXb 1ARMA 3DLJA 2AKLA 2NMTA 3I561 1Y7EA 3TO6A 2LEXA 4FD4A 1VLAA 4L89A 4MBUA 1IU8A 4A3FI 5D1OA 2QREB 3N5FA 3LODA 3VMIA 3K2KA 3DSBA 4NGTA 2J6AA 2E2HI 4DUKA 4ZX9A 1LAMA 2F5IA 1R43A 3PB4X 2VPXA 4NJRA 1NSLA 4MHPA 4YU9A 4QUSA 5KTAA 4ZY0A 2JA6I 1XMBA 1SIWA 4MFZA 4A93I 1TIQA 1Q7Y2 3GTGI 1QSOA 1K731 4MFKA 2JDCA 2F7VA 3K7AI 4ZGYB 4A3KI 1WZNA 2O53A 2JA7I 3CCJ1 2ZW6A 5C82A 2NVYI 2Q44A 3VMHA 2QECA 4YWYA 1J4JA 1I50I 4BXXI 4NGQA 1VQK1 2EUIA 1KUYA 3QAYA 3RZAA 5J8FA 2ZEFA 2I3CA 2VL1A 3GUXA 2JIRA 3HOUI 3KZWA 3EY5A 3FJUA 1Q2YA 1GHEA 1QVGY 4KOUA 1Q16A 4AB7A 1K9M2 1Y0YA 4MCRA 4OAEA 4JJXA 3V7ZA 4KOVA 4CYQA 2ZOFA 3VARA 5J1QA 1YJWZ 5AG7A 3N7ZA 3GKQA 1M4IA 3V8IA 3B7IA 3S6HA 4UEZA 1AA6A 4Y7NI 2ANPA 4MFLA 1Y9WA 3FNCA 3JRUA 1Y1VS 2E9HA 1XE4A 4JWPA 3ISXA 2PE3A 2PRQA 3GKRA 3ISZA 5IT9b 3ESWA 3I9SA 4MONA 3HOXI 3PO2I 3DDDA 1Q822 1SQHA 1IICA 4EVYA 3VWDA 4JXQA 3VB9A 3WR7A 3SXNA 4CYNA 1LQLA 3NH4A 1VQ71 3G4SZ 4QBJA 2P6GA 2WZNA 3GLJA 1NJI1 1WK4A 1LAPA 4KSFA 2CY2A 1VQP1 4UCMA 5H84A 4DYOA 4B13A 2HV2A 3RNZA 2B4DB 2LFUA 5T67A 2K3RA 4C7HA 2CNMA 3PB7X 2JNYA 2CF4A 4A94A 3IU2A 5A28A 3MRUA 4YGOA 4RS2A 3T4NB 1Z02A 4KOTA 3TC8A 4KOWA 4ONWA 5AN9F 2EK9A 3T9YA 2OOXB 3TE5B 1VQ8Z 3D9XA 3PZJA 4IK2A 4GS4A 1CPSA 2P28A 2OOTA 4R6TA 2BSWA 1FT7A 4JXRA 2RT9A 2AFZA 1S721 5F09A 2M6NA 3KKWA 5C88A 2E2JI 5CNPA 5HVHA 2HQYA 3KASA 2BOAA 5EMIA 2CIJA 2PIZA 3C26A 2PJ7A 3CC7Z 3TOAA 1YJN1 4NBCA 1TWHI 1ZH1A 2AJ6A 3S2DI 2PR1A 3GTPI 4E2ZA 4B5OA 3W91A 2V8JA 1VQN1 2JS4A 4NXYA 1MK4A 2CNSA 4RVGA 3MONA 4P4IA 3I3GA 3PB8X 2RBLA 5JH9A 4NGNA 5CBMA 4XNHB 3CCQZ 1X12A 3GCFA 1K83I 2F4OA 3B3VA 4MHYA 1W2BY 1VQ4Z 3IWWA 4C2ZA 3IWGA 2HU9A 3CMA1 4F9UA 3I4NI 1YITZ 4OC3A 2GTIA 2IZ3A 4UWJA 3CXCY 5LYLA 2GIVA 3CD61 4E2AA 3PGPA 4AVAA 3TDHB 4C2YA 1YGHA 2AFOA 1TFIA 4KLVA 3RZOI 4RUHA 3CCSZ 1ZG9A 2B5GB 1TF9A 2NVXI 1TWFI 3EEDA 4A3CI 5EC4A 1WCMI 4A3GI 1Z4EA 3S2HI 2DPTA 4MXUA 3EFAA 2P6FA 3GTJI 2KPIA 3OW2Z 2FVGA 1F57A 2GU2A 2XEJA 1JWQA 3BLNA 5KTCA 5D1OB 1TKHA 1Q2DA 2DEAA 1YI21 4UFWA 2F8HA 2PSWA 2WYRA 3GTQI 4AXVA 5AG4A 3CMEZ 4P4BA 1M4DA 2ZENA 3JAMf 4MJ8A 1ML8A 2OTJ1 4Y52I 4A3LI 3IU1A 4UCPA 1YR0A 2OZHA 1I6HI 3CCEZ 5HMNA 4RVDA 4NB9A 2YADA 3R95A 4LQGA 4OP4A 1DL6A 3S6FA 4E0AA 1WIIA 1QSNA 3F8KA 5F49A 3B3TA 1VQ91 4OKOA 1WW9A 5A2Qf 1K732 1KQSY 1RQFA 3CPWY 4E32A 1CJWA 5I0CA 4A30A 1YREA 3TOBA 1R9TI 3CC2Z 3CC4Z 4DGLA 2Z3PA 1FNOA 4FAIA 2PJ1A 2E7ZA 3IJ3A 2B4BA 2ODFA 4Q7AA 1X3ZA 4IUSA 1Z03A 4IAVA 2GREA 2G3AA 3GTMS 1HEEA 2WPWA 4UEFA 1KD11 4P4JA 2YNCC 1TWGI 2W03A 4HKFA 2CXAA 1FDIA 3P2FA 2PK7A 1IGBA 2W04A 3TO9A 4MRIA 2QIRA 4OC1A 3RO0A 3QWUA 2FE7A 3SJFA 3G711 1LRZA 4BINA 3NE7A 3FMCA 2GANA 4P4FA 1QSMA 3IFUA 2PCUA 3KI9A 1XRYA 2PVWA 1S7NA 3GTOI 4QVTA 3ZZIA 4QTUA 4DQYB 4NGMA 1I12A 3E0KA 3H8FA 8CPAA 2PJ9A 3CCRZ 1ARLA 4CYPA 3J81b 4A31A 4GXHA 3KGQA 2JEWA 4R57A 4KSAA 1KRLA 3P5JB 5DWMA 3T90A 2RC4A 1VQPZ 1TF8A 3PB6X 5I4MA 1X10A 1Q2CA 2J8NA 2JR6A 1VQL1 4PQAA 2DXQA 2PJ4A 1IYLA 3PO3I 2OTLZ 3NFZA 3FEDA 3D67A 3S1RI 2DE6A 3J80f 4P6YA 4X2TA 1PUAA 4E33A 4ORFA 4MFPA 1K8A1 5E96A 2DE7A 3H8EA 4HGZA 1QMUA 1Y1WI 3IGRA 4NBGA 5LRJA 2EWBA 3CCV1 2BCOA 4A32A 5IB9A 1IB1E 2J8MA 4BBHA 1TXRA 4PPZA 3D7FA 4B11A 4LQ6A 3JTKA 2B3UA 3LWUA 3IX0A 2J8RA 2OZUA 4HPSA 2VI7A 3RAMA 1IOIA 2B58A 4R7MA 2CNTA 4XPKA 1Z5RA 3OWCA 2J9AA 5LYDA 4CS0B 1VQOZ 1JWHC 1VQNZ 3GY9A 5G21A 1EE3P 2OZKA 5C4XI 3FB3A 4B5PA 2ZEEA 4F8ZA 5ISVA 3B3CA 4CAEA 2JDDA 7CPAA 4UBRA 1MJ9A 2EK8A 1QVFY 4W9YA 4Y49C 4B14A 2ZPAA 3MN8A 2Q43A 5HVFA 1S7FA 3B2YA 2VUMI 2JBJA 3FXTA 3GYAA 4QC6A 2IMOA 1XMTA 1N71A 4CGLA 2PJCA 1QXFA 2PM9A 2YU9I 3D7GA 3F5BA 4NJQA 4Y49B 1FY7A 3S9NA 1UFHA 4M3SA 2PJ6A 4E2WA 4A3JI 2PRBA 3HKZA 5IP9I 1YJ9Z 1N8R1 4ZY1A 1CM0A 3F3PC 3D8PA 4CYOA 5C4JI 3CXQA 1LANA 1S7MA 3PRTA 1SFOI 1VQ61 1QSTA 1XJOA 4K3NA 4B6ZA 4PV6A 2Y0MA 2XEFA 1YVKA 3RZDI 2OZGA 1WWZA 3D2PA 2FT0A 3KHXA 2IV2X 1CP6A 4PXDA 3CCUZ 1Y1VI 4H6ZA 1YW4A 2FXFA 4E30A 2VUGA 3I4MI 2Q4VA 4HNWB 3G6E1 1KC81 3S15I 4EWCA 1M1K1 4NBHA 3DR8A 4HNYB 3IIBA 2ZEMA 2ATRA 1ELLP 3H8GA 2OU2A 1BAVA 1ELMP 1TWCI 1RTQA 3BG0B 4PK2A 3HLPA 3HUVA 3SHPA 4MY0A 3PFEA 3CCM1 5FVJA 1VQMZ 4RVFA 5HVGA 2WAQA 4R9MA 5KTDA 1M1DA 3EXNA 4NBDA 3RYOA 4MCSA 5D8NA 3I551 5T64A 2GLFA 2GTHA 1S5KA 2VBQA 2GLJA 2K5TA 2DF5A 3DGVA 4H89A 2VPYA 4AYBA 1YIJ1 2HF1A 1N2FA 2IL4A 3HOVI 3FBUA 4UA3A 4MI4A 1KD12 4TWEA 2Y0SA 4CAXA 3D3SA 2RIQA 4FWUA 1YMEA 2AE6A 1VQ51 1Q811 4UFXA 4OC5A 4KOYA 2QRDB 4DK1A 2R92I 3R9EA 5DWNA 4K30A 1RO5A 3LD2A
chains in the Genus database with same CATH topology
1Y0RA 1YIJZ 1I6HI 3J7A4 4X6AI 2BO9A 3CCEZ 3NH5A 4RVDA 4NB9A 4OIDA 2YADA 2E2II 5IP7I 4LQGA 4OP4A 3S1NI 4X8IA 1DL6A 1CBXA 1P9NA 1YHQ1 3NDIA 1WIIA 1ZG7A 3B3TA 3WT4A 1ZB8A 5K8PA 1ZG8A 3PB9X 1RNIA 1VQ91 1WW9A 2C1CA 4OKOA 4OC2A 5A2Qf 4PXEA 1K732 4CL1A 1KQSY 1XFOA 1F2PA 1RQFA 3CPWY 3KHZA 4E32A 2R93I 2ZAEB 2XEGA 1YI2Z 2AFWA 2ZEOA 1TWAI 4A3MI 3J80b 3LMSA 1R9TI 3KIFA 3CC2Z 3IFEA 3CC4Z 1JJ2Z 2QVPA 3IEHA 4DGLA 1VQ5Z 1FNOA 4NGRA 2QEX1 1CX8A 4FAIA 2PJ1A 4FUUA 1PFTA 2PJ3A 3IJ3A 5LRGA 2LIYA 3CCLZ 2OTJZ 2Q4ZA 4Q7AA 4EMEA 2OR4A 1X3ZA 1CP7A 1Q861 1Z03A 2V8GA 3BI1A 3HOYI 1TKFA 5D29A 4EWTA 4IAVA 5CPAA 3IC1A 2GREA 1OBRA 4E2YA 2IQ6A 1LOKA 3GTMS 3S1MI 1YHQZ 1W2BZ 1CPXA 1VGYA 1HEEA 2G9DA 1F2OA 1VQ9Z 4UEFA 4P4EA 1KD11 4RS4A 4P4JA 2DE5A 3S17I 2JUBA 1TWGI 1DTDA 5LRKA 3Q87A 5FLXb 2CTCA 1ARMA 4A37A 3QNVA 3DLJA 2AKLA 3FVLA 4MHNA 2W03A 4P45A 5K8MA 2IZ4A 3H0GI 3I561 1Y7EA 2RB7A 3PBBA 1VLAA 3CCR1 2QJ8A 1K8A2 3BI0A 5T6BA 3CXCZ 4TNUA 3B35A 2PK7A 1IGBA 2RPRA 2W04A 2ZEPA 4A3FI 4MRIA 5D1OA 2QREB 3S16I 3B3WA 3NA6A 4OC1A 3N5FA 4ZX8A 5LYIA 3VMIA 5DS0A 2C6CA 3K2KA 3QWUA 2QKDA 3SJFA 1JQGA 1YUAA 2PVVA 2J6AA 2E2HI 4NGTA 4DUKA 3G711 2QA41 1AYEA 3KL9A 4ZX9A 1LAMA 1Z2LA 3HOWI 3CQZI 1R43A 2BJOA 2V77A 3FMCA 4GM5A 3PB4X 2PJAA 1RO0A 4P4FA 3IFUA 3WC5A 2PCUA 2R6MA 4NJRA 3KR4A 3KI9A 3FECA 4MHPA 4YU9A 1XRYA 2ZOGA 4ZY0A 3D68A 2PVWA 4F9VA 2HC9A 2JA6I 3GTOI 1XMBA 4QTUA 4WWVA 2NVTI 2RHBA 4A93I 3D7DA 3BHXA 4DQYB 1Q7Y2 4NGMA 4UF4A 3GTGI 2PJ2A 1K731 2OTL1 1YLOA 3H8FA 3RBUA 8CPAA 3I56Z 2NYQA 2PJ9A 2F7VA 4HGYA 3K7AI 3CCRZ 1ARLA 4G1PA 3J81b 2PJBA 4MHZA 4A3KI 4BD9A 4NFRA 3KGQA 1YJW1 2JEWA 4UIBA 3T8WA 1YW6A 4NBEA 3SJGA 2O53A 4E31A 2JA7I 1HDQA 3CCJ1 1KRLA 2NVYI 3FQMA 3P5JB 3VMHA 3G71Z 4WJBA 3S9MA 3KR5A 4YWYA 4PXCA 1I50I 1VQPZ 4BXXI 4NGQA 5LYFA 1VQK1 1TF8A 4MD7A 1QQ9A 4A3EI 2PIYA 3PB6X 1LCPA 5I4MA 3GTKI 3RZAA 2ZEFA 2NSMA 2I3CA 2VL1A 2PJ0A 2JR6A 1VQL1 3GUXA 2C6GA 3HOUI 3KZWA 3WC6A 4PQAA 3FJUA 2PJ5A 2PJ4A 4NBBA 3I1UA 4MD9A 3PFOA 3PO3I 2OTLZ 3NFZA 2JBKA 1QVGY 3FEDA 4FBEA 3D67A 3S1RI 1K9M2 2DE6A 1ZLHA 1Y0YA 2AFSA 3J80f 4MCRA 1HDUA 4P6YA 3S1QI 1NP6A 4X2TA 3V7ZA 4E33A 3SI2A 1KQSZ 2JA5I 3CPWZ 1USPB 2ZOFA 1K8A1 1VQO1 3VARA 3G4S1 5J1QA 1YJWZ 2DE7A 3H8EA 2V8HA 4HGZA 3GKQA 1QMUA 3KIHA 5C44I 2V8KA 1Y1WI 3B7IA 4NBGA 5LRJA 3CCJZ 4UEZA 4BBRI 3I07A 4ZYQA 3HOZI 4Y7NI 2ANPA 4R76A 2EWBA 3CCV1 3NH8A 2BCOA 1KWMA 3S14I 1VQKZ 3IF8A 4HH4A 4IHMA 1N8R2 5IB9A 3JRUA 3FF3A 1Y1VS 2E9HA 3ISXA 1TXRA 3GTMI 2PE3A 2PRQA 4PPZA 5K8NA 3ISZA 3D7FA 5IT9b 5LL6f 3ESWA 1VHEA 3LWUA 4XX2A 4P4DA 3IX0A 4JYWA 1VQLZ 4MONA 4OC4A 3HOXI 3RAMA 3PO2I 1Q822 4R7MA 5FLXf 3GB0A 2O4HA 2OOYB 1Q7Y1 4NB8A 3WABA 2POKA 3VB9A 1Z5RA 2J9AA 4NGPA 4BY7I 5LYDA 1LQLA 3NH4A 3D4UA 1VQOZ 1JWHC 3G4SZ 1VQ71 2B63I 2QYVA 1VQNZ 4E2XA 2WZNA 1VQ81 3GLJA 1NJI1 4A3II 1EE3P 1ZB9A 2OZKA 1LAPA 5C4XI 3CCVZ 4UIAA 1RO4A 1VQP1 2ZEEA 1KC82 3CPXA 4F8ZA 1RO2A 1XBUA 3B3CA 7CPAA 2K5RA 4A38A 4RVHA 1YJ91 1M1K2 3H3VJ 2CTBA 3FQQA 4BY1I 1QVFY 2LFUA 2EK8A 4W9YA 5T67A 5HXDA 1IY7A 2K3RA 3MN8A 3VMGA 5JGFA 3PB7X 2Q43A 2JNYA 4QTTA 2CF4A 3OW2Y 5HVFA 4A94A 3B2YA 2VUMI 2JBJA 3FH4A 3MRUA 1M902 4OIWA 3T4NB 3CC71 3PBEA 4MD8A 1H8LA 1Z02A 3CT9A 2PJ8A 2IMOA 4NH1C 4NOZA 1PCAA 2PJCA 3TC8A 1GYTA 4ONWA 1K9M1 2PM9A 2YU9I 3U50C 3D7GA 5AN9F 3J81f 4NJQA 1VQ7Z 2EK9A 5K8OA 2OOXB 2QR1B 3TE5B 4EFDA 3S9NA 1VQ8Z 3D9XA 1YUKA 3MZLB 2PJ6A 4E2WA 2HB6A 4IK2A 1CPSA 2P28A 2OOTA 5THWA 4R6TA 2G2KA 3TX8A 1I3QI 1FT7A 3CCU1 4A3JI 2RT9A 1Z8LA 4NGSA 1X3WA 2AFZA 3HKZA 1S721 2AFXA 1L1OC 1USPA 5F09A 5IP9I 1YJ9Z 1N8R1 4ZY1A 2M6NA 3CCQ1 2E2JI 4R8FA 3MZKB 3F3PC 1PYTB 5HVHA 4JZ0A 5C4JI 3KASA 2BOAA 2AFUA 2CIJA 1LANA 4S1TA 1VQ41 2PIZA 1S7MA 4RV9A 2PJ7A 3PRTA 1RLYA 3CC7Z 1SFOI 1VQ61 1Q821 1YJN1 4NBCA 4DYOA 4A3BI 4MH4A 2JA8I 1TWHI 2XEIA 1ZH1A 1XJOA 4K3NA 4B6ZA 3S2DI 1YIT1 3GTPI 4E2ZA 2V8JA 4DJLA 5A2Qb 1VQN1 1QVGZ 3NDJA 1JJ2Y 2JS4A 3BG1B 3B3SA 3WC7A 2XEFA 3GTLI 1VQM1 3RZDI 4RVGA 3MONA 4P4IA 3KHXA 4P10A 2M48A 3PO3S 4H2KA 1CP6A 5D1PA 3PB8X 3CCUZ 1Y1VI 1Q812 2ZEDA 2RBLA 3LUSA 4PXDA 3VATA 1YW4A 5JH9A 3F3FC 4NGNA 4E30A 5CBMA 2VUGA 1NUIA 1S72Z 3I4MI 3G6E1 1KC81 3S15I 3CCS1 2JMOA 4EWCA 3CCQZ 3SI1A 1Q7LA 2ZEHA 5IT9f 1M1K1 3VTNA 3V38A 4A3DI 4NBHA 3GCFA 1K83I 2IJZA 2F4OA 3B3VA 4MHYA 3IIBA 3D7HA 3KQZA 1W2BY 1VQ4Z 2ZEMA 1ELLP 1DE4C 3H8GA 3IWWA 1VQ6Z 3D66A 1BAVA 1ELMP 1YJNZ 4X3RA 1M901 3FKII 4ZI6A 1QYPA 2HU9A 1TWCI 4BBSI 1BPMA 3CMA1 4ZY2A 1M4LA 1RTQA 5CM2M 3BG0B 3HLPA 3D6WA 3I4NI 1YITZ 1NSAA 4OC3A 3HUVA 4F9UA 1TKJA 3PFEA 2GTIA 3K9TA 2V8IA 6CPAA 2IZ3A 5LYLA 3CXCY 2WB1A 3CCM1 1QF8A 2RFHA 1VQMZ 3CD61 5JM6A 4OMEA 4RVFA 3TDHB 3CPAA 5ELYA 5HVGA 2WAQA 1AMPA 4Z65A 2AFOA 1TFIA 4NBDA 1R3NA 4MCSA 5D8NA 2QLVB 3RZOI 4RUHA 3CME1 1Z01A 1UWYA 3G6EZ 3CCSZ 3I551 2P3YA 5T64A 2QEXZ 1ZG9A 2EGTA 1LFWA 1TF9A 2V8VA 3IO1A 2GLFA 3SJEA 2QRCB 2GTHA 2NVXI 1CG2A 3KQXA 1TWFI 3EEDA 2GLJA 1Q862 4UEEA 4A3CI 3SI0A 2C6PA 4OC0A 3DGVA 1WCMI 4A3GI 3L2NA 3S9LA 4AYBA 4KSIA 1YIJ1 3FEEA 2HF1A 1QVFZ 1X0TA 1N2FA 3CCE1 3S2HI 3HOVI 4MXUA 1ZLIA 4MCPA 3CMAZ 3CDXA 3GTJI 2KPIA 4MCQA 2PMZA 2H85A 3OW2Z 3SJXA 4CPAA 2FVGA 1KD12 5FLMI 2GU2A 1F57A 2ZEGA 2XEJA 1BLLE 1YSJA 4TWEA 2Y0SA 2ABZA 5D1OB 1TKHA 2DEAA 3CCMZ 2AFMA 2VF1A 2NVQI 3CD6Z 1BPNA 2RIQA 1YI21 4FWUA 4PXBA 1YMEA 2F4MA 2F8HA 5C3EI 1VIXA 2KI7B 2WYRA 3GTQI 4AXVA 4NBAA 3EERA 3CC21 3CC41 2Q51A 1VHOA 3CMEZ 1VQ51 1Q811 4P4BA 3FX6A 3I55Z 3JAMb 4P44A 3M3YI 2ZELA 4NBFA 3M4OI 3JAMf 2ZENA 1NJI2 2R7ZI 3PEIA 3CCL1 1ML8A 2OTJ1 3BXMA 4OC5A 2QRDB 4DK1A 4Y52I 4A39A 2R92I 4A3LI 2V8DA 4O23A 2QA4Z 4MMOA 3VH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0R A;  2BO9 A;  3NH5 A;  4OID A;  4LQG A;  4OP4 A;  4X8I A;  1CBX A;  1ZG7 A;  3B3T A;  3WT4 A;  5K8P A;  1ZG8 A;  3PB9 X;  4OC2 A;  4OKO A;  4PXE A;  2C1C A;  1XFO A;  1F2P A;  3KHZ A;  2XEG A;  2AFW A;  2ZEO A;  3LMS A;  3IFE A;  2QVP A;  3IEH A;  1FNO A;  4NGR A;  1CX8 A;  4FAI A;  2PJ1 A;  4FUU A;  2PJ3 A;  3IJ3 A;  5LRG A;  2Q4Z A;  4Q7A A;  4EME A;  2OR4 A;  1CP7 A;  2V8G A;  3BI1 A;  1TKF A;  5D29 A;  4EWT A;  4IAV A;  5CPA A;  3IC1 A;  2GRE A;  1OBR A;  2IQ6 A;  1LOK A;  1CPX A;  1VGY A;  1HEE A;  2G9D A;  1F2O A;  4UEF A;  4P4E A;  4P4J A;  5LRK A;  1DTD A;  2CTC A;  1ARM A;  4A37 A;  3QNV A;  3DLJ A;  4MHN A;  3FVL A;  4P45 A;  5K8M A;  1Y7E A;  3PBB A;  2RB7 A;  2QJ8 A;  3BI0 A;  4TNU A;  3B35 A;  1IGB A;  2ZEP A;  4MRI A;  3B3W A;  5LYI A;  4OC1 A;  3NA6 A;  3N5F A;  4ZX8 A;  5DS0 A;  2C6C A;  3K2K A;  3SJF A;  1JQG A;  2PVV A;  4NGT A;  4DUK A;  3KL9 A;  1AYE A;  4ZX9 A;  1LAM A;  1Z2L A;  1R43 A;  3FMC A;  4GM5 A;  2V77 A;  3PB4 X;  2PJA A;  4P4F A;  3WC5 A;  2PCU A;  4NJR A;  3KR4 A;  3KI9 A;  3FEC A;  4MHP A;  4YU9 A;  1XRY A;  2ZOG A;  4ZY0 A;  3D68 A;  2PVW A;  4F9V A;  2HC9 A;  1XMB A;  4WWV A;  3D7D A;  3BHX A;  4NGM A;  4UF4 A;  2PJ2 A;  1YLO A;  3H8F A;  3RBU A;  8CPA A;  2NYQ A;  2PJ9 A;  2F7V A;  4MHZ A;  1ARL A;  4G1P A;  2PJB A;  4BD9 A;  4NFR A;  3KGQ A;  2JEW A;  4UIB A;  3T8W A;  1YW6 A;  3SJG A;  2O53 A;  1HDQ A;  4WJB A;  3S9M A;  3KR5 A;  4YWY A;  4PXC A;  5LYF A;  4NGQ A;  1TF8 A;  1QQ9 A;  2PIY A;  3PB6 X;  1LCP A;  5I4M A;  3RZA A;  2ZEF A;  2NSM A;  2I3C A;  2VL1 A;  2PJ0 A;  3GUX A;  2C6G A;  3KZW A;  3WC6 A;  4PQA A;  3FJU A;  2PJ5 A;  2PJ4 A;  3I1U A;  3PFO A;  3NFZ A;  2JBK A;  3FED A;  4FBE A;  3D67 A;  1ZLH A;  1Y0Y A;  2AFS A;  4MCR A;  1HDU A;  4P6Y A;  4X2T A;  3V7Z A;  3SI2 A;  2ZOF A;  3VAR A;  5J1Q A;  3H8E A;  2V8H A;  1QMU A;  3B7I A;  5LRJ A;  4UEZ A;  4ZYQ A;  4R76 A;  2ANP A;  2EWB A;  3NH8 A;  2BCO A;  1KWM A;  4IHM A;  5IB9 A;  3JRU A;  3FF3 A;  3ISX A;  1TXR A;  2PE3 A;  2PRQ A;  4PPZ A;  5K8N A;  3ISZ A;  3D7F A;  1VHE A;  3LWU A;  4P4D A;  4JYW A;  4OC4 A;  3RAM A;  4R7M A;  3GB0 A;  2O4H A;  3WAB A;  2POK A;  1Z5R A;  2J9A A;  4NGP A;  5LYD A;  3NH4 A;  3D4U A;  2QYV A;  2WZN A;  3GLJ A;  1EE3 P;  1LAP A;  4UIA A;  2ZEE A;  3CPX A;  4F8Z A;  1XBU A;  3B3C A;  7CPA A;  4A38 A;  2CTB A;  4DYO A;  2EK8 A;  5HXD A;  4W9Y A;  1IY7 A;  3MN8 A;  5JGF A;  3PB7 X;  2Q43 A;  2CF4 A;  5HVF A;  4A94 A;  3B2Y A;  2JBJ A;  3FH4 A;  3MRU A;  4OIW A;  3PBE A;  1H8L A;  3CT9 A;  2PJ8 A;  2IMO A;  1PCA A;  2PJC A;  3TC8 A;  1GYT A;  4ONW A;  3D7G A;  4NJQ A;  2EK9 A;  5K8O A;  3S9N A;  4EFD A;  2PJ6 A;  2HB6 A;  4IK2 A;  1CPS A;  2OOT A;  5THW A;  4R6T A;  3TX8 A;  1FT7 A;  1Z8L A;  4NGS A;  2AFZ A;  2AFX A;  5F09 A;  4ZY1 A;  4R8F A;  1PYT B;  5HVH A;  4JZ0 A;  3KAS A;  2BOA A;  2AFU A;  2CIJ A;  1LAN A;  2PIZ A;  2PJ7 A;  3PRT A;  2XEI A;  1XJO A;  4K3N A;  4B6Z A;  4DJL A;  3B3S A;  3WC7 A;  2XEF A;  4P4I A;  3KHX A;  4P10 A;  4H2K A;  1CP6 A;  3PB8 X;  4PXD A;  2ZED A;  3VAT A;  1YW4 A;  5JH9 A;  4NGN A;  5CBM A;  3SI1 A;  1Q7L A;  2ZEH A;  3V38 A;  2IJZ A;  3B3V A;  4MHY A;  3IIB A;  3D7H A;  3KQZ A;  2ZEM A;  1ELL P;  1DE4 C;  3H8G A;  3IWW A;  3D66 A;  1BAV A;  1ELM P;  4X3R A;  4ZI6 A;  1BPM A;  4ZY2 A;  1M4L A;  1RTQ A;  3HLP A;  1NSA A;  4F9U A;  4OC3 A;  3HUV A;  1TKJ A;  3PFE A;  3K9T A;  6CPA A;  5LYL A;  2RFH A;  5JM6 A;  4OME A;  3CPA A;  5ELY A;  5HVG A;  1AMP A;  4Z65 A;  2AFO A;  1R3N A;  4MCS A;  5D8N A;  4RUH A;  1UWY A;  1ZG9 A;  2V8V A;  1LFW A;  1TF9 A;  3IO1 A;  2GLF A;  3SJE A;  1CG2 A;  3KQX A;  2GLJ A;  4UEE A;  3SI0 A;  2C6P A;  4OC0 A;  3DGV A;  3L2N A;  3S9L A;  4KSI A;  3FEE A;  4MXU A;  1ZLI A;  4MCP A;  3CDX A;  4MCQ A;  3SJX A;  4CPA A;  2FVG A;  2ZEG A;  1F57 A;  2GU2 A;  2XEJ A;  1BLL E;  1YSJ A;  4TWE A;  2ABZ A;  1TKH A;  2DEA A;  2AFM A;  1BPN A;  4PXB A;  4FWU A;  1YME A;  2F8H A;  1VIX A;  2WYR A;  4AXV A;  2Q51 A;  1VHO A;  4P4B A;  3FX6 A;  4P44 A;  2ZEL A;  2ZEN A;  4OC5 A;  3PEI A;  3BXM A;  4A39 A;  2V8D A;  4O23 A;  4MMO A;  3VH9 A; 
#chains in the Genus database with same CATH topology
 4AVC A;  2JIM A;  2E2I I;  4X8I A;  4B12 A;  4XNH C;  1CBX A;  1YHQ 1;  3NDI A;  3BJ7 A;  2D4O A;  5K8P A;  2C1C A;  4MFQ A;  4CL1 A;  1F2P A;  3KHZ A;  2XEG A;  2PC1 A;  2PQ8 A;  1TWA I;  4A3M I;  3LMS A;  4C2X A;  3D2L A;  1JJ2 Z;  3TO7 A;  5F46 A;  4FUU A;  1PFT A;  5LRG A;  2LIY A;  3CCL Z;  4NEX A;  2Q4Z A;  3BI1 A;  3HOY I;  4EWT A;  1OBR A;  4A33 A;  3S17 I;  2CTC A;  3QNV A;  3FVL A;  4P45 A;  2R8V A;  3H0G I;  1S7K A;  2RB7 A;  2QJ8 A;  1K8A 2;  3BI0 A;  5T6B A;  4U5Y A;  1ON0 A;  3NA6 A;  2C6C A;  1YUA A;  2PVV A;  2QA4 1;  3KL9 A;  1AYE A;  2Z3K A;  3HOW I;  3CQZ I;  4GM5 A;  2V77 A;  4Q38 A;  2PJA A;  1RO0 A;  2R6M A;  2ZOG A;  3A9L A;  2HC9 A;  2NVT I;  1VKC A;  3LAC A;  3D7D A;  3ZJ0 A;  4UF4 A;  1YLO A;  3K9U A;  5G20 A;  3RBU A;  3I56 Z;  4HGY A;  4B5P B;  4A2Z A;  4MHZ A;  4H6U A;  2PJB A;  5IB0 A;  1YJW 1;  4UIB A;  5F47 A;  3T8W A;  4E31 A;  4XPL A;  2EVN A;  3FQM A;  5EBV A;  3S9M A;  2YNE A;  4CGP A;  2PDO A;  4PXC A;  5LYF A;  2PIY A;  2YGW A;  3GTK I;  2NSM A;  2PJ0 A;  2C6G A;  1Z8X A;  4CAW A;  2GE3 A;  2PJ5 A;  4B10 A;  4NBB A;  4JLY A;  4MD9 A;  2JBK A;  4FBE A;  2AFS A;  1HDU A;  3SI2 A;  4X5K A;  3G4S 1;  2V8H A;  3TT2 A;  2QML A;  3KIH A;  2Z3L A;  3CCJ Z;  4YFJ A;  4BBR I;  3HOZ I;  2VQY A;  1KWM A;  3IR7 A;  3S14 I;  1VQK Z;  2KCW A;  1N8R 2;  3GTM I;  1B87 A;  4JD6 A;  1VHE A;  4XX2 A;  4OLL A;  4OC4 A;  2ZW7 A;  2WUU A;  4R3L A;  5FLX f;  2O4H A;  2OOY B;  4U9Z A;  3WAB A;  5IV0 A;  1I1D A;  2PR8 A;  3H4Q A;  4NGP A;  4BY7 I;  1U6M A;  2R1I A;  2QYV A;  4J3G A;  1VQ8 1;  1BO4 A;  3GIU A;  1Z8W A;  3B8G A;  2FL4 A;  4Q36 A;  4UIA A;  1KC8 2;  3CPX A;  1RO2 A;  4XPD B;  3IWE A;  4QB9 A;  4RVH A;  2CTB A;  1M1K 2;  5HXD A;  3FQQ A;  4KS9 A;  2Z3M A;  2JIP A;  3VMG A;  3OW2 Y;  2VPZ A;  1YVO A;  3G8W A;  3CC7 1;  3PBE A;  4MD8 A;  1B6B A;  1H8L A;  3CT9 A;  4NOZ A;  3R1K A;  4A95 A;  4NCZ A;  4RI1 A;  3TFY A;  4NSQ A;  1VQ7 Z;  4MY3 A;  5K8O A;  3JVN A;  1YUK A;  1VHS A;  2FIW A;  2HB6 A;  3TX8 A;  2G2K A;  4AG9 A;  3VWE A;  1Z8L A;  1X3W A;  2AFX A;  1L1O C;  1USP A;  3CCQ 1;  1S3Z A;  3MZK B;  4JZ0 A;  4S1T A;  1VQ4 1;  1Z8T A;  1RLY A;  4A3B I;  4MH4 A;  1S7L A;  2XEI A;  1YIT 1;  5A2Q b;  1QVG Z;  3B3S A;  4R3K A;  1NE9 A;  4FD5 A;  4P10 A;  4C7I A;  3PO3 S;  4CAV A;  4H2K A;  5D1P A;  1Q81 2;  2ZED A;  3LUS A;  3VAT A;  3F3F C;  1NUI A;  1S72 Z;  3CCS 1;  3R9F A;  5HH1 A;  1Q7L A;  2ZEH A;  5IT9 f;  3V38 A;  1DE4 C;  3EC4 A;  3D66 A;  1YJN Z;  4X3R A;  1M90 1;  1QYP A;  4BBS I;  4ZY2 A;  5CM2 M;  2V3V A;  5JPH A;  1NSA A;  4II9 A;  2Z11 A;  3FYN A;  3K9T A;  2REE A;  6CPA A;  2WB1 A;  1YK3 A;  1P4N A;  2RFH A;  5JM6 A;  4F0Y A;  3CPA A;  1QSR A;  1V0C A;  5AG6 A;  2FSR A;  2QLV B;  3CME 1;  1UWY A;  1L0C A;  4AVB A;  2P3Y A;  4ZBG A;  1LFW A;  3CZX A;  3SJE A;  4KUB A;  4UEE A;  2VXK A;  4L8A A;  4UWI A;  3L2N A;  3S9L A;  4KSI A;  3FEE A;  1Z9U A;  3CCE 1;  4I49 A;  2DPS A;  3TTH A;  3CMA Z;  1XOV A;  3CDX A;  4MCQ A;  2PMZ A;  3SJX A;  1M4G A;  2ZEG A;  1BLL E;  1YSJ A;  1Z4R A;  3TE4 A;  2VF1 A;  2NVQ I;  3CD6 Z;  4PXB A;  2R98 A;  5C3E I;  2FIA A;  2I79 A;  2ARH A;  1VIX A;  2KI7 B;  2Q0Y A;  1KUX A;  3CC2 1;  3CC4 1;  5JQ4 A;  2Q51 A;  1VHO A;  2Z3N A;  4U9Y A;  3FX6 A;  4IF5 A;  4P44 A;  3M3Y I;  2ZEL A;  4NBF A;  2REF A;  3BXM A;  4O23 A;  2QA4 Z;  3VH9 A;  1Y0R A;  2EO8 A;  3R96 A;  4X6A I;  3J7A 4;  1M44 A;  3NH5 A;  2VZY A;  5G1Z A;  5IP7 I;  3NE8 A;  1P9N A;  1ZG8 A;  4PXE A;  4F0X A;  1XFO A;  2R93 I;  2ZAE B;  1YI2 Z;  3J80 b;  4F6A A;  3MGD A;  3KIF A;  2QVP A;  4NGR A;  2QEX 1;  4UCN A;  1CX8 A;  2Q4Y A;  2VPW A;  2OTJ Z;  4EME A;  1CP7 A;  2O28 A;  1Q86 1;  1AUG A;  4M85 A;  2YND A;  3DNS A;  1K4J A;  5CPA A;  4E2Y A;  1LOK A;  1W2B Z;  1CPX A;  1S60 A;  4NF1 A;  2G9D A;  1F2O A;  1VQ9 Z;  2YNC A;  4KLW A;  2DE5 A;  2JUB A;  1P0H A;  3Q87 A;  4A37 A;  2BUE A;  4MHN A;  5K8M A;  2IZ4 A;  4YRH A;  3PBB A;  3CCR 1;  4PSW A;  3CXC Z;  4TNU A;  3B35 A;  2WSA A;  2RPR A;  2ZEP A;  3B3W A;  5LYI A;  3S16 I;  3R9G A;  4ZX8 A;  3EO4 A;  5DS0 A;  2QKD A;  1JQG A;  1Z2L A;  2BJO A;  3F0A A;  1IOF A;  3WC5 A;  4LUA A;  3KR4 A;  3FEC A;  3SXO A;  3D68 A;  4F9V A;  4KVM E;  4WWV A;  2RHB A;  3BHX A;  2VZZ A;  2PJ2 A;  4UFV A;  2OTL 1;  4CRY B;  5A27 A;  2NYQ A;  1Y7R A;  4G1P A;  1KZF A;  2JIO A;  4BD9 A;  4NFR A;  1I21 A;  1YW6 A;  4NBE A;  3SJG A;  1HDQ A;  3H5Z A;  2JIQ A;  2NAP A;  3G71 Z;  4WJB A;  3KR5 A;  3W6S A;  4MD7 A;  1QQ9 A;  4A3E I;  1XF8 A;  1LCP A;  3G3S A;  3CXS A;  4KOX A;  3WC6 A;  3I1U A;  3PFO A;  2Q7S A;  4R87 A;  1ZLH A;  4CGO A;  2JEV A;  3S1Q I;  1NP6 A;  4LX9 A;  4KVX A;  1KQS Z;  2JA5 I;  3CPW Z;  1USP B;  1VQO 1;  5C44 I;  3P2H A;  2V8K A;  4PSX A;  4ZYQ A;  4R76 A;  1ZO0 A;  3NH8 A;  1WJ2 A;  4IHM A;  3IF8 A;  4HH4 A;  3FF3 A;  3CXP A;  5K8N A;  4KOS A;  5LL6 f;  2C27 A;  4P4D A;  4JYW A;  4OAD A;  1VQL Z;  2X7B A;  5J8C A;  3GB0 A;  1Q7Y 1;  4NB8 A;  2V45 A;  2POK A;  2Q04 A;  2ZW5 A;  3D4U A;  2B63 I;  4E2X A;  5BWA B;  2EBJ A;  3UY5 A;  4A3I I;  1ZB9 A;  3CCV Z;  1RO4 A;  4M6G A;  2B3V A;  3FRM A;  1XBU A;  5IX3 A;  2K5R A;  2G0B A;  4A38 A;  4DNC A;  1A2Z A;  1YJ9 1;  3H3V J;  4BY1 I;  1IY7 A;  4KUA A;  5JGF A;  4QTT A;  4AG7 A;  3FH4 A;  2Q7B A;  4CRZ B;  1M90 2;  4OIW A;  1Y8C A;  1Y9K A;  2PJ8 A;  4M6H A;  4NH1 C;  3QAH A;  3JUW A;  2Z0Z A;  1PCA A;  2JLM A;  1GYT A;  1K9M 1;  3U50 C;  3J81 f;  4KOR A;  5H86 A;  2QR1 B;  5AGE A;  4EFD A;  4CAF A;  3MZL B;  2P6E A;  2AYD A;  2FS5 A;  5THW A;  3S6G A;  1I3Q I;  3CCU 1;  3W6X A;  4NGS A;  3QB8 A;  4R8F A;  2VEZ A;  1PYT B;  4CGN A;  2AFU A;  4RV9 A;  1R57 A;  1Q82 1;  4HNX B;  2JA8 I;  4BMH A;  1YQE A;  4DJL A;  3NDJ A;  1JJ2 Y;  3BG1 B;  1YLE A;  3WC7 A;  3GTL I;  1VQM 1;  3TCV A;  2M48 A;  1MJA A;  1KUV A;  2JMO A;  3PP9 A;  4M6I A;  3SI1 A;  3VTN A;  2ZXV A;  4A3D I;  1XIX A;  2IJZ A;  3D7H A;  3KQZ A;  1FDO A;  1VQ6 Z;  4ZI6 A;  1XEB A;  3FKI I;  4FD6 A;  4FD7 A;  1BPM A;  4XPD C;  1M4L A;  2B4D A;  3D6W A;  1TKJ A;  3FIX A;  2V8I A;  2GFQ A;  2WPX A;  1QF8 A;  5F48 A;  4OME A;  5ELY A;  1AMP A;  1PU9 A;  3DR6 A;  4Z65 A;  1RXT A;  1R3N A;  4RN7 A;  1Z01 A;  3G6E Z;  2Z3O A;  3D2M A;  4MHD A;  2QEX Z;  2V8V A;  2EGT A;  3IO1 A;  2H5M A;  2QRC B;  1CG2 A;  3KQX A;  5G22 A;  2FCK A;  1Q86 2;  4PK3 A;  3SI0 A;  2C6P A;  4OC0 A;  1QVF Z;  1X0T A;  1ZLI A;  4MCP A;  2H85 A;  4CPA A;  5FLM I;  2ABZ A;  3CCM Z;  1OZP A;  2AFM A;  1BPN A;  2F4M A;  4NBA A;  3EER A;  2Z10 A;  1MJB A;  3I55 Z;  3JAM b;  1YX0 A;  2A4N A;  3M4O I;  1IID A;  1NJI 2;  2R7Z I;  3PEI A;  3CCL 1;  1IYK A;  2I00 A;  4A39 A;  2V8D A;  3I07 A;  4MMO A;  1YIJ Z;  2BO9 A;  1BOB A;  4OID A;  4ONU A;  3S1N I;  1ZG7 A;  3BJ8 A;  2HUZ A;  1ZB8 A;  3WT4 A;  3PB9 X;  4OC2 A;  1RNI A;  2P0W A;  2G3T A;  4KVO E;  2AFW A;  2ZEO A;  4KZT A;  4E8O A;  3IFE A;  5AG5 A;  3IEH A;  1NMT A;  1VQ5 Z;  2PJ3 A;  2OR4 A;  2R7H A;  2V8G A;  2OB0 A;  1TKF A;  5D29 A;  2ZW4 A;  2BL1 A;  2BEI A;  3IC1 A;  3S6K A;  2IQ6 A;  2B5G A;  2D4P A;  4MFJ A;  3S1M I;  1YHQ Z;  1VGY A;  2OH1 A;  4P4E A;  5GCN A;  4RS4 A;  4CGM A;  4C68 A;  5LRK A;  1DTD A;  5FLX b;  1ARM A;  3DLJ A;  2AKL A;  2NMT A;  3I56 1;  1Y7E A;  3TO6 A;  2LEX A;  4FD4 A;  1VLA A;  4L89 A;  4MBU A;  1IU8 A;  4A3F I;  5D1O A;  2QRE B;  3N5F A;  3LOD A;  3VMI A;  3K2K A;  3DSB A;  4NGT A;  2J6A A;  2E2H I;  4DUK A;  4ZX9 A;  1LAM A;  2F5I A;  1R43 A;  3PB4 X;  2VPX A;  4NJR A;  1NSL A;  4MHP A;  4YU9 A;  4QUS A;  5KTA A;  4ZY0 A;  2JA6 I;  1XMB A;  1SIW A;  4MFZ A;  4A93 I;  1TIQ A;  1Q7Y 2;  3GTG I;  1QSO A;  1K73 1;  4MFK A;  2JDC A;  2F7V A;  3K7A I;  4ZGY B;  4A3K I;  1WZN A;  2O53 A;  2JA7 I;  3CCJ 1;  2ZW6 A;  5C82 A;  2NVY I;  2Q44 A;  3VMH A;  2QEC A;  4YWY A;  1J4J A;  1I50 I;  4BXX I;  4NGQ A;  1VQK 1;  2EUI A;  1KUY A;  3QAY A;  3RZA A;  5J8F A;  2ZEF A;  2I3C A;  2VL1 A;  3GUX A;  2JIR A;  3HOU I;  3KZW A;  3EY5 A;  3FJU A;  1Q2Y A;  1GHE A;  1QVG Y;  4KOU A;  1Q16 A;  4AB7 A;  1K9M 2;  1Y0Y A;  4MCR A;  4OAE A;  4JJX A;  3V7Z A;  4KOV A;  4CYQ A;  2ZOF A;  3VAR A;  5J1Q A;  1YJW Z;  5AG7 A;  3N7Z A;  3GKQ A;  1M4I A;  3V8I A;  3B7I A;  3S6H A;  4UEZ A;  1AA6 A;  4Y7N I;  2ANP A;  4MFL A;  1Y9W A;  3FNC A;  3JRU A;  1Y1V S;  2E9H A;  1XE4 A;  4JWP A;  3ISX A;  2PE3 A;  2PRQ A;  3GKR A;  3ISZ A;  5IT9 b;  3ESW A;  3I9S A;  4MON A;  3HOX I;  3PO2 I;  3DDD A;  1Q82 2;  1SQH A;  1IIC A;  4EVY A;  3VWD A;  4JXQ A;  3VB9 A;  3WR7 A;  3SXN A;  4CYN A;  1LQL A;  3NH4 A;  1VQ7 1;  3G4S Z;  4QBJ A;  2P6G A;  2WZN A;  3GLJ A;  1NJI 1;  1WK4 A;  1LAP A;  4KSF A;  2CY2 A;  1VQP 1;  4UCM A;  5H84 A;  4DYO A;  4B13 A;  2HV2 A;  3RNZ A;  2B4D B;  2LFU A;  5T67 A;  2K3R A;  4C7H A;  2CNM A;  3PB7 X;  2JNY A;  2CF4 A;  4A94 A;  3IU2 A;  5A28 A;  3MRU A;  4YGO A;  4RS2 A;  3T4N B;  1Z02 A;  4KOT A;  3TC8 A;  4KOW A;  4ONW A;  5AN9 F;  2EK9 A;  3T9Y A;  2OOX B;  3TE5 B;  1VQ8 Z;  3D9X A;  3PZJ A;  4IK2 A;  4GS4 A;  1CPS A;  2P28 A;  2OOT A;  4R6T A;  2BSW A;  1FT7 A;  4JXR A;  2RT9 A;  2AFZ A;  1S72 1;  5F09 A;  2M6N A;  3KKW A;  5C88 A;  2E2J I;  5CNP A;  5HVH A;  2HQY A;  3KAS A;  2BOA A;  5EMI A;  2CIJ A;  2PIZ A;  3C26 A;  2PJ7 A;  3CC7 Z;  3TOA A;  1YJN 1;  4NBC A;  1TWH I;  1ZH1 A;  2AJ6 A;  3S2D I;  2PR1 A;  3GTP I;  4E2Z A;  4B5O A;  3W91 A;  2V8J A;  1VQN 1;  2JS4 A;  4NXY A;  1MK4 A;  2CNS A;  4RVG A;  3MON A;  4P4I A;  3I3G A;  3PB8 X;  2RBL A;  5JH9 A;  4NGN A;  5CBM A;  4XNH B;  3CCQ Z;  1X12 A;  3GCF A;  1K83 I;  2F4O A;  3B3V A;  4MHY A;  1W2B Y;  1VQ4 Z;  3IWW A;  4C2Z A;  3IWG A;  2HU9 A;  3CMA 1;  4F9U A;  3I4N I;  1YIT Z;  4OC3 A;  2GTI A;  2IZ3 A;  4UWJ A;  3CXC Y;  5LYL A;  2GIV A;  3CD6 1;  4E2A A;  3PGP A;  4AVA A;  3TDH B;  4C2Y A;  1YGH A;  2AFO A;  1TFI A;  4KLV A;  3RZO I;  4RUH A;  3CCS Z;  1ZG9 A;  2B5G B;  1TF9 A;  2NVX I;  1TWF I;  3EED A;  4A3C I;  5EC4 A;  1WCM I;  4A3G I;  1Z4E A;  3S2H I;  2DPT A;  4MXU A;  3EFA A;  2P6F A;  3GTJ I;  2KPI A;  3OW2 Z;  2FVG A;  1F57 A;  2GU2 A;  2XEJ A;  1JWQ A;  3BLN A;  5KTC A;  5D1O B;  1TKH A;  1Q2D A;  2DEA A;  1YI2 1;  4UFW A;  2F8H A;  2PSW A;  2WYR A;  3GTQ I;  4AXV A;  5AG4 A;  3CME Z;  4P4B A;  1M4D A;  2ZEN A;  3JAM f;  4MJ8 A;  1ML8 A;  2OTJ 1;  4Y52 I;  4A3L I;  3IU1 A;  4UCP A;  1YR0 A;  2OZH A;  1I6H I;  3CCE Z;  5HMN A;  4RVD A;  4NB9 A;  2YAD A;  3R95 A;  4LQG A;  4OP4 A;  1DL6 A;  3S6F A;  4E0A A;  1WII A;  1QSN A;  3F8K A;  5F49 A;  3B3T A;  1VQ9 1;  4OKO A;  1WW9 A;  5A2Q f;  1K73 2;  1KQS Y;  1RQF A;  3CPW Y;  4E32 A;  1CJW A;  5I0C A;  4A30 A;  1YRE A;  3TOB A;  1R9T I;  3CC2 Z;  3CC4 Z;  4DGL A;  2Z3P A;  1FNO A;  4FAI A;  2PJ1 A;  2E7Z A;  3IJ3 A;  2B4B A;  2ODF A;  4Q7A A;  1X3Z A;  4IUS A;  1Z03 A;  4IAV A;  2GRE A;  2G3A A;  3GTM S;  1HEE A;  2WPW A;  4UEF A;  1KD1 1;  4P4J A;  2YNC C;  1TWG I;  2W03 A;  4HKF A;  2CXA A;  1FDI A;  3P2F A;  2PK7 A;  1IGB A;  2W04 A;  3TO9 A;  4MRI A;  2QIR A;  4OC1 A;  3RO0 A;  3QWU A;  2FE7 A;  3SJF A;  3G71 1;  1LRZ A;  4BIN A;  3NE7 A;  3FMC A;  2GAN A;  4P4F A;  1QSM A;  3IFU A;  2PCU A;  3KI9 A;  1XRY A;  2PVW A;  1S7N A;  3GTO I;  4QVT A;  3ZZI A;  4QTU A;  4DQY B;  4NGM A;  1I12 A;  3E0K A;  3H8F A;  8CPA A;  2PJ9 A;  3CCR Z;  1ARL A;  4CYP A;  3J81 b;  4A31 A;  4GXH A;  3KGQ A;  2JEW A;  4R57 A;  4KSA A;  1KRL A;  3P5J B;  5DWM A;  3T90 A;  2RC4 A;  1VQP Z;  1TF8 A;  3PB6 X;  5I4M A;  1X10 A;  1Q2C A;  2J8N A;  2JR6 A;  1VQL 1;  4PQA A;  2DXQ A;  2PJ4 A;  1IYL A;  3PO3 I;  2OTL Z;  3NFZ A;  3FED A;  3D67 A;  3S1R I;  2DE6 A;  3J80 f;  4P6Y A;  4X2T A;  1PUA A;  4E33 A;  4ORF A;  4MFP A;  1K8A 1;  5E96 A;  2DE7 A;  3H8E A;  4HGZ A;  1QMU A;  1Y1W I;  3IGR A;  4NBG A;  5LRJ A;  2EWB A;  3CCV 1;  2BCO A;  4A32 A;  5IB9 A;  1IB1 E;  2J8M A;  4BBH A;  1TXR A;  4PPZ A;  3D7F A;  4B11 A;  4LQ6 A;  3JTK A;  2B3U A;  3LWU A;  3IX0 A;  2J8R A;  2OZU A;  4HPS A;  2VI7 A;  3RAM A;  1IOI A;  2B58 A;  4R7M A;  2CNT A;  4XPK A;  1Z5R A;  3OWC A;  2J9A A;  5LYD A;  4CS0 B;  1VQO Z;  1JWH C;  1VQN Z;  3GY9 A;  5G21 A;  1EE3 P;  2OZK A;  5C4X I;  3FB3 A;  4B5P A;  2ZEE A;  4F8Z A;  5ISV A;  3B3C A;  4CAE A;  2JDD A;  7CPA A;  4UBR A;  1MJ9 A;  2EK8 A;  1QVF Y;  4W9Y A;  4Y49 C;  4B14 A;  2ZPA A;  3MN8 A;  2Q43 A;  5HVF A;  1S7F A;  3B2Y A;  2VUM I;  2JBJ A;  3FXT A;  3GYA A;  4QC6 A;  2IMO A;  1XMT A;  1N71 A;  4CGL A;  2PJC A;  1QXF A;  2PM9 A;  2YU9 I;  3D7G A;  3F5B A;  4NJQ A;  4Y49 B;  1FY7 A;  3S9N A;  1UFH A;  4M3S A;  2PJ6 A;  4E2W A;  4A3J I;  2PRB A;  3HKZ A;  5IP9 I;  1YJ9 Z;  1N8R 1;  4ZY1 A;  1CM0 A;  3F3P C;  3D8P A;  4CYO A;  5C4J I;  3CXQ A;  1LAN A;  1S7M A;  3PRT A;  1SFO I;  1VQ6 1;  1QST A;  1XJO A;  4K3N A;  4B6Z A;  4PV6 A;  2Y0M A;  2XEF A;  1YVK A;  3RZD I;  2OZG A;  1WWZ A;  3D2P A;  2FT0 A;  3KHX A;  2IV2 X;  1CP6 A;  4PXD A;  3CCU Z;  1Y1V I;  4H6Z A;  1YW4 A;  2FXF A;  4E30 A;  2VUG A;  3I4M I;  2Q4V A;  4HNW B;  3G6E 1;  1KC8 1;  3S15 I;  4EWC A;  1M1K 1;  4NBH A;  3DR8 A;  4HNY B;  3IIB A;  2ZEM A;  2ATR A;  1ELL P;  3H8G A;  2OU2 A;  1BAV A;  1ELM P;  1TWC I;  1RTQ A;  3BG0 B;  4PK2 A;  3HLP A;  3HUV A;  3SHP A;  4MY0 A;  3PFE A;  3CCM 1;  5FVJ A;  1VQM Z;  4RVF A;  5HVG A;  2WAQ A;  4R9M A;  5KTD A;  1M1D A;  3EXN A;  4NBD A;  3RYO A;  4MCS A;  5D8N A;  3I55 1;  5T64 A;  2GLF A;  2GTH A;  1S5K A;  2VBQ A;  2GLJ A;  2K5T A;  2DF5 A;  3DGV A;  4H89 A;  2VPY A;  4AYB A;  1YIJ 1;  2HF1 A;  1N2F A;  2IL4 A;  3HOV I;  3FBU A;  4UA3 A;  4MI4 A;  1KD1 2;  4TWE A;  2Y0S A;  4CAX A;  3D3S A;  2RIQ A;  4FWU A;  1YME A;  2AE6 A;  1VQ5 1;  1Q81 1;  4UFX A;  4OC5 A;  4KOY A;  2QRD B;  4DK1 A;  2R92 I;  3R9E A;  5DWN A;  4K30 A;  1RO5 A;  3LD2 A; 
#chains in the Genus database with same CATH homology
 1Y0R A;  1YIJ Z;  1I6H I;  3J7A 4;  4X6A I;  2BO9 A;  3CCE Z;  3NH5 A;  4RVD A;  4NB9 A;  4OID A;  2YAD A;  2E2I I;  5IP7 I;  4LQG A;  4OP4 A;  3S1N I;  4X8I A;  1DL6 A;  1CBX A;  1P9N A;  1YHQ 1;  3NDI A;  1WII A;  1ZG7 A;  3B3T A;  3WT4 A;  1ZB8 A;  5K8P A;  1ZG8 A;  3PB9 X;  1RNI A;  1VQ9 1;  1WW9 A;  2C1C A;  4OKO A;  4OC2 A;  5A2Q f;  4PXE A;  1K73 2;  4CL1 A;  1KQS Y;  1XFO A;  1F2P A;  1RQF A;  3CPW Y;  3KHZ A;  4E32 A;  2R93 I;  2ZAE B;  2XEG A;  1YI2 Z;  2AFW A;  2ZEO A;  1TWA I;  4A3M I;  3J80 b;  3LMS A;  1R9T I;  3KIF A;  3CC2 Z;  3IFE A;  3CC4 Z;  1JJ2 Z;  2QVP A;  3IEH A;  4DGL A;  1VQ5 Z;  1FNO A;  4NGR A;  2QEX 1;  1CX8 A;  4FAI A;  2PJ1 A;  4FUU A;  1PFT A;  2PJ3 A;  3IJ3 A;  5LRG A;  2LIY A;  3CCL Z;  2OTJ Z;  2Q4Z A;  4Q7A A;  4EME A;  2OR4 A;  1X3Z A;  1CP7 A;  1Q86 1;  1Z03 A;  2V8G A;  3BI1 A;  3HOY I;  1TKF A;  5D29 A;  4EWT A;  4IAV A;  5CPA A;  3IC1 A;  2GRE A;  1OBR A;  4E2Y A;  2IQ6 A;  1LOK A;  3GTM S;  3S1M I;  1YHQ Z;  1W2B Z;  1CPX A;  1VGY A;  1HEE A;  2G9D A;  1F2O A;  1VQ9 Z;  4UEF A;  4P4E A;  1KD1 1;  4RS4 A;  4P4J A;  2DE5 A;  3S17 I;  2JUB A;  1TWG I;  1DTD A;  5LRK A;  3Q87 A;  5FLX b;  2CTC A;  1ARM A;  4A37 A;  3QNV A;  3DLJ A;  2AKL A;  3FVL A;  4MHN A;  2W03 A;  4P45 A;  5K8M A;  2IZ4 A;  3H0G I;  3I56 1;  1Y7E A;  2RB7 A;  3PBB A;  1VLA A;  3CCR 1;  2QJ8 A;  1K8A 2;  3BI0 A;  5T6B A;  3CXC Z;  4TNU A;  3B35 A;  2PK7 A;  1IGB A;  2RPR A;  2W04 A;  2ZEP A;  4A3F I;  4MRI A;  5D1O A;  2QRE B;  3S16 I;  3B3W A;  3NA6 A;  4OC1 A;  3N5F A;  4ZX8 A;  5LYI A;  3VMI A;  5DS0 A;  2C6C A;  3K2K A;  3QWU A;  2QKD A;  3SJF A;  1JQG A;  1YUA A;  2PVV A;  2J6A A;  2E2H I;  4NGT A;  4DUK A;  3G71 1;  2QA4 1;  1AYE A;  3KL9 A;  4ZX9 A;  1LAM A;  1Z2L A;  3HOW I;  3CQZ I;  1R43 A;  2BJO A;  2V77 A;  3FMC A;  4GM5 A;  3PB4 X;  2PJA A;  1RO0 A;  4P4F A;  3IFU A;  3WC5 A;  2PCU A;  2R6M A;  4NJR A;  3KR4 A;  3KI9 A;  3FEC A;  4MHP A;  4YU9 A;  1XRY A;  2ZOG A;  4ZY0 A;  3D68 A;  2PVW A;  4F9V A;  2HC9 A;  2JA6 I;  3GTO I;  1XMB A;  4QTU A;  4WWV A;  2NVT I;  2RHB A;  4A93 I;  3D7D A;  3BHX A;  4DQY B;  1Q7Y 2;  4NGM A;  4UF4 A;  3GTG I;  2PJ2 A;  1K73 1;  2OTL 1;  1YLO A;  3H8F A;  3RBU A;  8CPA A;  3I56 Z;  2NYQ A;  2PJ9 A;  2F7V A;  4HGY A;  3K7A I;  3CCR Z;  1ARL A;  4G1P A;  3J81 b;  2PJB A;  4MHZ A;  4A3K I;  4BD9 A;  4NFR A;  3KGQ A;  1YJW 1;  2JEW A;  4UIB A;  3T8W A;  1YW6 A;  4NBE A;  3SJG A;  2O53 A;  4E31 A;  2JA7 I;  1HDQ A;  3CCJ 1;  1KRL A;  2NVY I;  3FQM A;  3P5J B;  3VMH A;  3G71 Z;  4WJB A;  3S9M A;  3KR5 A;  4YWY A;  4PXC A;  1I50 I;  1VQP Z;  4BXX I;  4NGQ A;  5LYF A;  1VQK 1;  1TF8 A;  4MD7 A;  1QQ9 A;  4A3E I;  2PIY A;  3PB6 X;  1LCP A;  5I4M A;  3GTK I;  3RZA A;  2ZEF A;  2NSM A;  2I3C A;  2VL1 A;  2PJ0 A;  2JR6 A;  1VQL 1;  3GUX A;  2C6G A;  3HOU I;  3KZW A;  3WC6 A;  4PQA A;  3FJU A;  2PJ5 A;  2PJ4 A;  4NBB A;  3I1U A;  4MD9 A;  3PFO A;  3PO3 I;  2OTL Z;  3NFZ A;  2JBK A;  1QVG Y;  3FED A;  4FBE A;  3D67 A;  3S1R I;  1K9M 2;  2DE6 A;  1ZLH A;  1Y0Y A;  2AFS A;  3J80 f;  4MCR A;  1HDU A;  4P6Y A;  3S1Q I;  1NP6 A;  4X2T A;  3V7Z A;  4E33 A;  3SI2 A;  1KQS Z;  2JA5 I;  3CPW Z;  1USP B;  2ZOF A;  1K8A 1;  1VQO 1;  3VAR A;  3G4S 1;  5J1Q A;  1YJW Z;  2DE7 A;  3H8E A;  2V8H A;  4HGZ A;  3GKQ A;  1QMU A;  3KIH A;  5C44 I;  2V8K A;  1Y1W I;  3B7I A;  4NBG A;  5LRJ A;  3CCJ Z;  4UEZ A;  4BBR I;  3I07 A;  4ZYQ A;  3HOZ I;  4Y7N I;  2ANP A;  4R76 A;  2EWB A;  3CCV 1;  3NH8 A;  2BCO A;  1KWM A;  3S14 I;  1VQK Z;  3IF8 A;  4HH4 A;  4IHM A;  1N8R 2;  5IB9 A;  3JRU A;  3FF3 A;  1Y1V S;  2E9H A;  3ISX A;  1TXR A;  3GTM I;  2PE3 A;  2PRQ A;  4PPZ A;  5K8N A;  3ISZ A;  3D7F A;  5IT9 b;  5LL6 f;  3ESW A;  1VHE A;  3LWU A;  4XX2 A;  4P4D A;  3IX0 A;  4JYW A;  1VQL Z;  4MON A;  4OC4 A;  3HOX I;  3RAM A;  3PO2 I;  1Q82 2;  4R7M A;  5FLX f;  3GB0 A;  2O4H A;  2OOY B;  1Q7Y 1;  4NB8 A;  3WAB A;  2POK A;  3VB9 A;  1Z5R A;  2J9A A;  4NGP A;  4BY7 I;  5LYD A;  1LQL A;  3NH4 A;  3D4U A;  1VQO Z;  1JWH C;  3G4S Z;  1VQ7 1;  2B63 I;  2QYV A;  1VQN Z;  4E2X A;  2WZN A;  1VQ8 1;  3GLJ A;  1NJI 1;  4A3I I;  1EE3 P;  1ZB9 A;  2OZK A;  1LAP A;  5C4X I;  3CCV Z;  4UIA A;  1RO4 A;  1VQP 1;  2ZEE A;  1KC8 2;  3CPX A;  4F8Z A;  1RO2 A;  1XBU A;  3B3C A;  7CPA A;  2K5R A;  4A38 A;  4RVH A;  1YJ9 1;  1M1K 2;  3H3V J;  2CTB A;  3FQQ A;  4BY1 I;  1QVF Y;  2LFU A;  2EK8 A;  4W9Y A;  5T67 A;  5HXD A;  1IY7 A;  2K3R A;  3MN8 A;  3VMG A;  5JGF A;  3PB7 X;  2Q43 A;  2JNY A;  4QTT A;  2CF4 A;  3OW2 Y;  5HVF A;  4A94 A;  3B2Y A;  2VUM I;  2JBJ A;  3FH4 A;  3MRU A;  1M90 2;  4OIW A;  3T4N B;  3CC7 1;  3PBE A;  4MD8 A;  1H8L A;  1Z02 A;  3CT9 A;  2PJ8 A;  2IMO A;  4NH1 C;  4NOZ A;  1PCA A;  2PJC A;  3TC8 A;  1GYT A;  4ONW A;  1K9M 1;  2PM9 A;  2YU9 I;  3U50 C;  3D7G A;  5AN9 F;  3J81 f;  4NJQ A;  1VQ7 Z;  2EK9 A;  5K8O A;  2OOX B;  2QR1 B;  3TE5 B;  4EFD A;  3S9N A;  1VQ8 Z;  3D9X A;  1YUK A;  3MZL B;  2PJ6 A;  4E2W A;  2HB6 A;  4IK2 A;  1CPS A;  2P28 A;  2OOT A;  5THW A;  4R6T A;  2G2K A;  3TX8 A;  1I3Q I;  1FT7 A;  3CCU 1;  4A3J I;  2RT9 A;  1Z8L A;  4NGS A;  1X3W A;  2AFZ A;  3HKZ A;  1S72 1;  2AFX A;  1L1O C;  1USP A;  5F09 A;  5IP9 I;  1YJ9 Z;  1N8R 1;  4ZY1 A;  2M6N A;  3CCQ 1;  2E2J I;  4R8F A;  3MZK B;  3F3P C;  1PYT B;  5HVH A;  4JZ0 A;  5C4J I;  3KAS A;  2BOA A;  2AFU A;  2CIJ A;  1LAN A;  4S1T A;  1VQ4 1;  2PIZ A;  1S7M A;  4RV9 A;  2PJ7 A;  3PRT A;  1RLY A;  3CC7 Z;  1SFO I;  1VQ6 1;  1Q82 1;  1YJN 1;  4NBC A;  4DYO A;  4A3B I;  4MH4 A;  2JA8 I;  1TWH I;  2XEI A;  1ZH1 A;  1XJO A;  4K3N A;  4B6Z A;  3S2D I;  1YIT 1;  3GTP I;  4E2Z A;  2V8J A;  4DJL A;  5A2Q b;  1VQN 1;  1QVG Z;  3NDJ A;  1JJ2 Y;  2JS4 A;  3BG1 B;  3B3S A;  3WC7 A;  2XEF A;  3GTL I;  1VQM 1;  3RZD I;  4RVG A;  3MON A;  4P4I A;  3KHX A;  4P10 A;  2M48 A;  3PO3 S;  4H2K A;  1CP6 A;  5D1P A;  3PB8 X;  3CCU Z;  1Y1V I;  1Q81 2;  2ZED A;  2RBL A;  3LUS A;  4PXD A;  3VAT A;  1YW4 A;  5JH9 A;  3F3F C;  4NGN A;  4E30 A;  5CBM A;  2VUG A;  1NUI A;  1S72 Z;  3I4M I;  3G6E 1;  1KC8 1;  3S15 I;  3CCS 1;  2JMO A;  4EWC A;  3CCQ Z;  3SI1 A;  1Q7L A;  2ZEH A;  5IT9 f;  1M1K 1;  3VTN A;  3V38 A;  4A3D I;  4NBH A;  3GCF A;  1K83 I;  2IJZ A;  2F4O A;  3B3V A;  4MHY A;  3IIB A;  3D7H A;  3KQZ A;  1W2B Y;  1VQ4 Z;  2ZEM A;  1ELL P;  1DE4 C;  3H8G A;  3IWW A;  1VQ6 Z;  3D66 A;  1BAV A;  1ELM P;  1YJN Z;  4X3R A;  1M90 1;  3FKI I;  4ZI6 A;  1QYP A;  2HU9 A;  1TWC I;  4BBS I;  1BPM A;  3CMA 1;  4ZY2 A;  1M4L A;  1RTQ A;  5CM2 M;  3BG0 B;  3HLP A;  3D6W A;  3I4N I;  1YIT Z;  1NSA A;  4OC3 A;  3HUV A;  4F9U A;  1TKJ A;  3PFE A;  2GTI A;  3K9T A;  2V8I A;  6CPA A;  2IZ3 A;  5LYL A;  3CXC Y;  2WB1 A;  3CCM 1;  1QF8 A;  2RFH A;  1VQM Z;  3CD6 1;  5JM6 A;  4OME A;  4RVF A;  3TDH B;  3CPA A;  5ELY A;  5HVG A;  2WAQ A;  1AMP A;  4Z65 A;  2AFO A;  1TFI A;  4NBD A;  1R3N A;  4MCS A;  5D8N A;  2QLV B;  3RZO I;  4RUH A;  3CME 1;  1Z01 A;  1UWY A;  3G6E Z;  3CCS Z;  3I55 1;  2P3Y A;  5T64 A;  2QEX Z;  1ZG9 A;  2EGT A;  1LFW A;  1TF9 A;  2V8V A;  3IO1 A;  2GLF A;  3SJE A;  2QRC B;  2GTH A;  2NVX I;  1CG2 A;  3KQX A;  1TWF I;  3EED A;  2GLJ A;  1Q86 2;  4UEE A;  4A3C I;  3SI0 A;  2C6P A;  4OC0 A;  3DGV A;  1WCM I;  4A3G I;  3L2N A;  3S9L A;  4AYB A;  4KSI A;  1YIJ 1;  3FEE A;  2HF1 A;  1QVF Z;  1X0T A;  1N2F A;  3CCE 1;  3S2H I;  3HOV I;  4MXU A;  1ZLI A;  4MCP A;  3CMA Z;  3CDX A;  3GTJ I;  2KPI A;  4MCQ A;  2PMZ A;  2H85 A;  3OW2 Z;  3SJX A;  4CPA A;  2FVG A;  1KD1 2;  5FLM I;  2GU2 A;  1F57 A;  2ZEG A;  2XEJ A;  1BLL E;  1YSJ A;  4TWE A;  2Y0S A;  2ABZ A;  5D1O B;  1TKH A;  2DEA A;  3CCM Z;  2AFM A;  2VF1 A;  2NVQ I;  3CD6 Z;  1BPN A;  2RIQ A;  1YI2 1;  4FWU A;  4PXB A;  1YME A;  2F4M A;  2F8H A;  5C3E I;  1VIX A;  2KI7 B;  2WYR A;  3GTQ I;  4AXV A;  4NBA A;  3EER A;  3CC2 1;  3CC4 1;  2Q51 A;  1VHO A;  3CME Z;  1VQ5 1;  1Q81 1;  4P4B A;  3FX6 A;  3I55 Z;  3JAM b;  4P44 A;  3M3Y I;  2ZEL A;  4NBF A;  3M4O I;  3JAM f;  2ZEN A;  1NJI 2;  2R7Z I;  3PEI A;  3CCL 1;  1ML8 A;  2OTJ 1;  3BXM A;  4OC5 A;  2QRD B;  4DK1 A;  4Y52 I;  4A39 A;  2R92 I;  4A3L I;  2V8D A;  4O23 A;  2QA4 Z;  4MMO A;  3VH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...