2O53A

Crystal structure of apo-aspartoacylase from human brain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
b'EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o53A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o53A01
3FEEA 3RBUA 2F7VA 3K2KA 3KZWA 2G9DA 4Z65A 1TKHA 3VATA 4PXEA 3SJFA 5LRKA 3KGQA 3S9MA 4YWYA 5K8MA 2QJ8A 1M4LA 2DEAA 1CX8A 5IB9A 3CDXA 2O4HA 1BAVA 1FT7A 1GYTA 4UEEA 2WYRA 4NGMA 4ZYQA 3HUVA 4FAIA 3PB6X 3TX8A 3BI0A 4IAVA 4MCQA 3SI0A 2PJ6A 2PJ4A 3BI1A 3PFOA 3DGVA 2JBKA 1JQGA 2QYVA 4NGQA 3KQZA 2EK9A 2XEFA 2PJ3A 2ANPA 4ZI6A 1RTQA 4UIBA 1XRYA 5CPAA 7CPAA 4W9YA 4NGTA 4P4EA 1HDUA 2J9AA 3IFEA 3D7FA 3PBEA 2HB6A 3B35A 6CPAA 3B3CA 2AFZA 4ZY1A 3SI2A 2CIJA 3B2YA 2RFHA 1VGYA 4IK2A 1XJOA 4PQAA 3KASA 5J1QA 4MMOA 3L2NA 4MHYA 4MCPA 2GU2A 4ONWA 4CPAA 4A94A 1LAMA 2VL1A 3DLJA 4ZX8A 3VH9A 3SJGA 4MRIA 1PCAA 5JH9A 4ZY0A 1CBXA 2PJ8A 3FVLA 4KSIA 4FUUA 2BOAA 3LWUA 3IIBA 3KR5A 3B7IA 2PVWA 3KQXA 4OMEA 4IHMA 3KR4A 4F9UA 3B3WA 1KWMA 2JBJA 4OIDA 2ZEDA 2AFUA 3B3TA 2PJ7A 3PB8X 2ZEMA 5LYFA 3D68A 2C6GA 4A39A 2PJCA 2AFXA 2PJ0A 3PB7X 4RUHA 2ZOGA 3FX6A 1Y0YA 4F8ZA 1PYTB 4JZ0A 2OR4A 4P4FA 1Z5RA 1YW6A 1EE3P 4F9VA 2C6PA 3PRTA 4ZX9A 4DYOA 1VIXA 1FNOA 2PJ9A 1HDQA 2ZEHA 3QNVA 4NJQA 2NSMA 4K3NA 4NFRA 4P6YA 5HVHA 1NSAA 5LYDA 1AYEA 1F57A 4O23A 4P4BA 2PIYA 1CPXA 2EWBA 4YU9A 4LQGA 4OC0A 1CP7A 4P4DA 4A37A 1TF8A 1OBRA 4X3RA 5LYLA 1ZLHA 2OOTA 4OKOA 2HC9A 2C6CA 4ZY2A 1LCPA 2PJAA 3CPAA 3B3SA 4GM5A 3PEIA 1TF9A 1QMUA 2ZENA 3WABA 3GB0A 4MCSA 2Q51A 1H8LA 4JYWA 1F2OA 4OP4A 4MXUA 3KHZA 2QVPA 2O53A 2PCUA 2JEWA 2IJZA 3PB9X 1VHEA 4R6TA 2PE3A 3D67A 1TKFA 3D7GA 3V7ZA 1XMBA 1YLOA 3RAMA 1AMPA 1ARMA 1BPNA 2PJBA 1R3NA 3HLPA 4TNUA 3S9LA 2C1CA 4X2TA 3D7HA 4UEZA 4MHZA 3FEDA 2ZEGA 3NA6A 1DE4C 3MN8A 1CG2A 4EWTA 1ZLIA 3VARA 2EK8A 3JRUA 2AFOA 3BXMA 3SJEA 3D66A 2BO9A 4R7MA 3T8WA 2AFMA 2CTBA 2GREA 2Q43A 1CP6A 4P4JA 1Q7LA 3FMCA 2AFSA 4OC1A 5F09A 3B3VA 3FF3A 4NGPA 3N5FA 4OC2A 4EMEA 2GLJA 1ELMP 4NGNA 4PXDA 3GLJA 1XBUA 2PJ2A 2V8DA 3SJXA 3S9NA 2XEGA 2IMOA 3MRUA 2PRQA 3H8FA 3LMSA 3PFEA 3IJ3A 1XFOA 4TWEA 5K8PA 3NFZA 3KI9A 3GUXA 2XEIA 1LAPA 2RB7A 2AFWA 2GLFA 4OC3A 4DJLA 4OIWA 4PPZA 4AXVA 4MCRA 5JGFA 3CT9A 3H8EA 3KL9A 2BCOA 3IC1A 8CPAA 4P45A 2PJ1A 2V8VA 5DS0A 2POKA 4FWUA 4NJRA 3K9TA 1LFWA 1DTDA 1BLLE 1ZG8A 2F8HA 2ZEOA 3ISXA 1Z2LA 4R8FA 4MHPA 5LYIA 3NH4A 2ZEEA 3ISZA 2NYQA 3PBBA 4UIAA 5HXDA 2ZEFA 1CPSA 5K8OA 4WWVA 4EFDA 4Q7AA 3BHXA 4G1PA 1HEEA 2FVGA 3CPXA 4P44A 4UF4A 1YSJA 1UWYA 2CF4A 4PXBA 2XEJA 2ZOFA 2PJ5A 3FJUA 3IO1A 1ARLA 3RZAA 4OC5A 3WC7A 1LOKA 2CTCA 5K8NA 4BD9A 5ELYA 1IY7A 3H8GA 1VHOA 3I1UA 1LANA 2I3CA 4UEFA 2PVVA 2V77A 2Q4ZA 2PIZA 2ZELA 5LRJA 1F2PA 4FBEA 2ABZA 5JM6A 1TKJA 2V8HA 4B6ZA 5HVGA 1ELLP 4P10A 4A38A 1ZG7A 5THWA 3WC5A 3WC6A 3IEHA 3FECA 1Z8LA 2WZNA 4NGRA 3SI1A 5D29A 3D4UA 5D8NA 5HVFA 3WT4A 1YMEA 3NH8A 3NH5A 4PXCA 4WJBA 1TXRA 4NGSA 1R43A 3V38A 1Y0RA 2V8GA 1IGBA 4MHNA 5LRGA 3TC8A 4X8IA 1QQ9A 3KHXA 4OC4A 3IWWA 2IQ6A 4H2KA 1ZG9A 3FH4A 5CBMA 3D7DA 4P4IA 4R76A 1Y7EA 3PB4X 5I4MA 1BPMA 1YW4A 2ZEPA 4DUKA
chains in the Genus database with same CATH superfamily
1Y9WA 3H4QA 2B3VA 3FEEA 1NMTA 2ZW4A 2F7VA 3FXTA 3VATA 4PXEA 3IU2A 1IOFA 2QJ8A 5K8MA 2DEAA 5IB9A 4DGLA 1TWHI 1V0CA 4NGMA 4A31A 3HOVI 2LFUA 3HUVA 3VMGA 2WSAA 4A3JI 2Z3OA 1S5KA 4H6UA 3HOYI 2B4DA 2RPRA 3KQZA 4QC6A 2YU9I 2BJOA 2XEFA 4E0AA 2NVXI 4RN7A 2R92I 1XRYA 5CPAA 4W9YA 4KVME 4NGTA 4MFQA 1S721 2C27A 2J8RA 3RO0A 4BBRI 1Z9UA 2B58A 3S15I 2WPXA 3G8WA 2CY2A 2RFHA 3PO3S 2RHBA 3FRMA 1L0CA 1LRZA 1YJNZ 4MMOA 2DE5A 2R8VA 3L2NA 4ONWA 5IB0A 1LAMA 4ZX8A 3GKQA 1Q7Y1 2B4BA 2PJ8A 4ZBGA 1M4GA 3GTKI 2B5GB 4FD6A 3F3PC 1Q2CA 4OMEA 3TO6A 1B87A 4BBSI 1X3WA 4FD7A 2EO8A 3HOWI 3B3TA 3D68A 2YGWA 1YVOA 2AFXA 2PJ0A 2OTJ1 2E2JI 2JEVA 4R87A 1Y0YA 2FXFA 2E2HI 2OR4A 4PSXA 5EBVA 3GTMS 3S6GA 1YIJ1 1EE3P 4H6ZA 3PRTA 2VEZA 4NBCA 1AUGA 4NB8A 4ZX9A 4GS4A 1FNOA 2QEXZ 4C2XA 3GTPI 2ZEHA 2HF1A 2QKDA 4UFVA 3I55Z 3GKRA 1ZO0A 4CL1A 4XNHC 5FLXf 1ML8A 4A3CI 1F57A 4O23A 2PIYA 1CPXA 2RC4A 1KD12 2Z11A 3PO3I 4M6HA 1R57A 4OKOA 3S6HA 3GTJI 2C6CA 4QBJA 2Q7BA 3B3SA 4GM5A 4MFKA 3JVNA 3DR8A 1QMUA 2ZENA 2JIQA 1CM0A 4MCSA 3EY5A 3P2FA 5J8FA 1F2OA 2QVPA 1NUIA 4A3KI 2PCUA 2VUGA 4AG7A 3PB9X 1MJ9A 5H84A 4KLWA 3V7ZA 2JS4A 3GTMI 1JJ2Y 2OOXB 3HLPA 4TNUA 2J6AA 1SFOI 3CCSZ 1K4JA 4MFZA 4MHZA 4PK2A 1W2BZ 2ZEGA 3NA6A 3MN8A 1SIWA 2Q04A 2HUZA 4EWTA 2Q4YA 1OZPA 1Q812 1VQ71 2OB0A 3CXSA 3T8WA 1R9TI 3I4NI 1MK4A 3JAMb 4OC1A 4BMHA 1N71A 3J80b 3CCEZ 1Y1WI 1S7MA 1PU9A 1TWGI 4A95A 4EMEA 2GLJA 4NGNA 4PXDA 4QVTA 1CJWA 1KUYA 2V8DA 4CYNA 2IMOA 2PRQA 5D1OB 3FNCA 1KUVA 3H8FA 3EFAA 3PFEA 5FLMI 3CC2Z 2DE7A 1Q821 5K8PA 4DYOA 3KI9A 2AFWA 4OC3A 1WK4A 1PUAA 2EUIA 3H8EA 4KLVA 2ARHA 2JUBA 3IC1A 3F5BA 4H89A 1TFIA 2B4DB 3CC71 3K9TA 1ZG8A 4HGYA 1PFTA 5C4XI 3S1MI 1QSMA 3NE8A 4MHPA 4RS4A 3BJ8A 2ZEEA 1WZNA 2NYQA 3N7ZA 3NE7A 5HXDA 1CPSA 4WWVA 3DSBA 4IUSA 2PC1A 4EFDA 2ZPAA 4Q7AA 3CCQZ 1HEEA 1X3ZA 3GTOI 3CPXA 2IL4A 4UF4A 4Y49C 3MONA 2CF4A 4X6AI 3WR7A 2VBQA 4HPSA 3CCRZ 1Z4RA 3WC7A 2FL4A 5ELYA 2QRCB 2CXAA 2GTIA 4CAFA 1LANA 2I3CA 2Q7SA 2Q4ZA 3F0AA 1USPA 1YJWZ 5LRJA 2OOYB 1VQ81 1I3QI 1P9NA 2O28A 1TKJA 1QSOA 4RVHA 3G6EZ 1RO5A 4P10A 3CME1 1ZG7A 3WC6A 1KQSY 4OLLA 3FECA 3S1RI 2OZUA 2ZW7A 1Z8LA 2WZNA 4NGRA 3TO7A 3SI1A 2K5RA 4HNXB 3WT4A 3NH8A 1VKCA 4PXCA 1QVFY 4WJBA 4DNCA 1WCMI 3V38A 5AG5A 2AE6A 4NF1A 1M902 2FT0A 1XF8A 3I9SA 3TOAA 4A3FI 2ZXVA 4R57A 1YW4A 2OZHA 4CGLA 2WUUA 3BG1B 4EVYA 2V8JA 3MZKB 3RBUA 3LD2A 3CXCY 2G9DA 1TKHA 4KOWA 2D4PA 3SJFA 5LRKA 2QA4Z 3KGQA 1Z8TA 2NMTA 1VQK1 1U6MA 4KOXA 3FQMA 4YWYA 1JJ2Z 1Y9KA 2Q4VA 5ISVA 2O4HA 1BAVA 1FT7A 3GTQI 2Z0ZA 4UEEA 3F3FC 2G0BA 4MJ8A 1M901 2IZ4A 3PB6X 3BI0A 4IAVA 4MCQA 4KS9A 2RIQA 5A2Qf 3UY5A 3GY9A 1I1DA 2PJ4A 2EVNA 4A30A 3CCMZ 4C2ZA 2H5MA 3I561 2EK9A 2PJ3A 2ANPA 3J81b 1Z8XA 2K3RA 4XPLA 4P4EA 3IFEA 1VQOZ 3PBEA 6CPAA 1XEBA 3ESWA 3U50C 1Q2YA 1QVGY 3S17I 2Z3MA 4PQAA 5J1QA 4NCZA 1X12A 2R98A 5HH1A 4HH4A 1NJI2 2VL1A 3DLJA 3VH9A 3SJGA 4MRIA 2P6FA 4ZY0A 1Q861 4E2YA 4NBGA 2BOAA 2YNEA 2IV2X 4OIDA 3W6SA 2ZEDA 1VQM1 4MFPA 2I00A 2C6GA 4A39A 2PJCA 1QF8A 2ZOGA 1FY7A 3RZOI 1YR0A 3TE4A 1YITZ 4I49A 1TIQA 5FLXb 4F9VA 1NJI1 4PSWA 4NBDA 3CXPA 4CRYB 3CC4Z 1IB1E 4C7IA 1A2ZA 2CNTA 3BJ7A 4NJQA 1YI2Z 1RXTA 4K3NA 4P6YA 5HVHA 2OTJZ 4E2AA 4J3GA 4M6IA 1VQL1 2I79A 4B11A 4XNHB 1CP7A 4UBRA 4E30A 2VPZA 5LYLA 2WAQA 3EERA 4ZY2A 1LCPA 3CPAA 2W03A 3WABA 4CAVA 4MHDA 1Q7Y2 3DNSA 2LIYA 4UFXA 4JYWA 2DF5A 2Y0MA 4MH4A 4A3BI 2VXKA 3CCLZ 2CNMA 2JA6I 1KQSZ 4BINA 1VHEA 4MD7A 3D6WA 1NP6A 3QAYA 1VQ51 1FDIA 3D67A 3D7GA 3I3GA 1VQN1 2JIRA 1ARMA 3TFYA 1R3NA 1Y8CA 4RS2A 1VQ61 1USPB 5DWNA 1QVFZ 3CPWY 4X2TA 2JR6A 3IFUA 4E2WA 4E31A 4YGOA 5C3EI 3CMA1 4AB7A 2AFOA 3H0GI 3GCFA 4B10A 5AN9F 2G3AA 2Q43A 3EEDA 1CP6A 3ZJ0A 3CXCZ 4P4JA 3KIFA 4KSAA 2R93I 1IYLA 1YREA 4MD8A 3B3VA 3P5JB 4B13A 2GTHA 3N5FA 4KOSA 3DR6A 4DK1A 3QWUA 4Q36A 1VQ7Z 3CCVZ 2AKLA 4A2ZA 2M6NA 1Z8WA 4GXHA 2G2KA 2G3TA 3MRUA 1RO0A 1IIDA 3IJ3A 3G4SZ 5IT9f 1KC81 2BEIA 1YX0A 3GTGI 4TWEA 3NFZA 2XEIA 4M6GA 2RB7A 4PPZA 2H85A 4C2YA 2Z3LA 3FB3A 5F47A 3FBUA 5JGFA 3CT9A 3FIXA 2PJ1A 2POKA 3K9UA 4NJRA 1QVGZ 3LUSA 1BLLE 4M3SA 2F8HA 2ZEOA 4XX2A 2X7BA 1K8A1 3PBBA 4JJXA 3D2MA 1YGHA 2BUEA 2JNYA 2P3YA 4E2XA 4K30A 2FVGA 3S1NI 4RV9A 1YSJA 2HQYA 2PJ5A 2B63I 1YJN1 2PQ8A 4Y49B 2VZZA 3IO1A 4MFJA 4QTTA 4OC5A 4C7HA 4NBHA 3TT2A 2CTCA 5K8NA 3KIHA 3CZXA 4BD9A 3H8GA 1VHSA 1YJ9Z 3I1UA 4CYQA 4ORFA 1RO2A 1FDOA 2B3UA 4NSQA 2PIZA 2W04A 2ZELA 4PK3A 3S2HI 1ZB9A 1Q822 2ABZA 2KI7B 2V8HA 4B6ZA 3HOZI 3M4OI 4JD6A 5HVGA 1ELLP 3P2HA 1JWHC 3WC5A 4KUBA 2VQYA 5AG6A 1NE9A 1K9M1 3J7A4 4Y52I 5D8NA 1VQ8Z 2KCWA 5HVFA 4RVDA 3NH5A 4L89A 2V8GA 1IGBA 2M48A 4FD4A 3KHXA 2YNCC 1N2FA 2BL1A 2F4MA 3G3SA 2QMLA 2PDOA 4H2KA 3R1KA 5CBMA 3D7DA 1IOIA 4B5PA 1Y7EA 2BSWA 5I4MA 2D4OA 4DUKA 1RNIA 5I0CA 4Q38A 4HNYB 3K2KA 4JLYA 3KZWA 4Z65A 5KTAA 1Z4EA 2OZGA 4F6AA 3S9MA 5A2Qb 3HOXI 1M4LA 2Z3NA 4U5YA 3NDIA 4ZGYB 2JA7I 3CDXA 3SXNA 4CAXA 2Y0SA 1GYTA 3CPWZ 4E33A 4ZYQA 4NBFA 4U9ZA 3TX8A 1VQ41 2WB1A 1AA6A 4B12A 3PFOA 3DGVA 2JBKA 5EC4A 2P0WA 3S16I 1JQGA 2QYVA 1YHQ1 4ZI6A 3CCS1 2JA5I 4NH1C 3PZJA 2K5TA 2J9AA 1Y1VS 5C44I 2HB6A 3B35A 1RQFA 4ZY1A 1I6HI 2FE7A 3B2YA 3CCU1 3CCJ1 4MONA 1VGYA 4IK2A 1XJOA 4M85A 1K731 1B6BA 1M44A 3CXQA 4MHYA 5G22A 1SQHA 5D1PA 1VQ9Z 2FSRA 1WWZA 2FS5A 4CPAA 1PCAA 3FVLA 3LWUA 3IIBA 3KR5A 3B7IA 2PVWA 3KR4A 2J8MA 3R9GA 4R9MA 1Z03A 3B3WA 2PJ7A 2ZEMA 4MY3A 2Q0YA 2KPIA 1XMTA 4F8ZA 4JZ0A 2REFA 1QXFA 1TWAI 1Z5RA 1YUAA 3JAMf 3J80f 2E9HA 1VIXA 2PJ9A 4A3LI 1HDQA 5AG7A 3QNVA 2YNDA 3GTLI 1NSAA 1Q2DA 1Y1VI 4NBBA 3K7AI 2GANA 3VMHA 4P4BA 4NBEA 4II9A 3G71Z 2EWBA 2YNCA 4LQGA 4OC0A 4BBHA 4NEXA 3FYNA 4A37A 2VUMI 1TF8A 4X3RA 2OOTA 3RYOA 4HNWB 2ATRA 2HC9A 5DWMA 2PJAA 4ONUA 2QIRA 5EMIA 1TF9A 3GB0A 3LACA 3R95A 2EGTA 1Q862 4XPKA 4F0XA 4MBUA 2F4OA 4OP4A 4MXUA 5AGEA 2Z10A 3VWDA 1MJBA 4B14A 2JEWA 4A32A 2IJZA 4KUAA 2OU2A 1N8R1 2V8IA 5C4JI 1TKFA 3CD61 1YLOA 1AMPA 3JUWA 1YJW1 1P0HA 3MGDA 5G20A 2ZW6A 3B8GA 3IX0A 4UA3A 1Z02A 5G1ZA 3IF8A 2C1CA 3BG0B 4CS0B 4AVAA 4KOVA 2HU9A 4A3II 3FEDA 2PSWA 1S72Z 1L1OC 1IICA 1X10A 3VARA 1VQ5Z 3JRUA 5A27A 4AVBA 2NAPA 1VQ6Z 2CTBA 4CGMA 2RT9A 2AFSA 2JIMA 3FF3A 4NGPA 4XPDC 4UWJA 1JWQA 2R7ZI 4KOYA 2PR8A 3TDHB 3S9NA 1S7LA 4AVCA 2F5IA 4KORA 2QA41 3LMSA 4E8OA 1LQLA 3GUXA 1LAPA 5IP9I 2GLFA 4DJLA 4OIWA 5F46A 4AXVA 3S1QI 1YIJZ 4EWCA 2OTL1 3FKII 5D1OA 1XE4A 5DS0A 2NVQI 2FCKA 3IWEA 4JXQA 3CCM1 1DTDA 2REEA 2V3VA 1Z2LA 4R8FA 5LYIA 4UIAA 2DPTA 4QUSA 2ZEFA 5K8OA 1VQO1 1TWCI 3FQQA 3BHXA 4BXXI 1I21A 4RVGA 3VWEA 2FIWA 2QECA 3FJUA 1ARLA 3RZAA 3IR7A 4LX9A 2P28A 2VF1A 4HGZA 5JPHA 5JQ4A 3VMIA 2J8NA 1KRLA 2ZW5A 2LEXA 1IY7A 2IZ3A 3EXNA 3IGRA 4MFLA 4KSFA 4CAWA 2JLMA 4UEFA 4CGOA 2PVVA 5H86A 2CNSA 3J81f 4OADA 4A3MI 1M1DA 2NVTI 1KC82 4A3GI 4FBEA 1VQP1 5JM6A 5CNPA 5F49A 4A38A 2PK7A 5THWA 1Q16A 5IV0A 1YIT1 3IEHA 1YLEA 1S7KA 2R6MA 3CC41 2E2II 2WPWA 4C68A 2PMZA 1IYKA 5E96A 3D4UA 1ON0A 1M4DA 1YK3A 1YMEA 1YI21 4JWPA 1TXRA 4NOZA 1K8A2 3TC8A 1QQ9A 4BY7I 2JIOA 1QSTA 5IP7I 5IX3A 3BLNA 2RBLA 3PB4X 4RI1A 2ZEPA 2ZAEB 5F48A 4UCMA 1TWFI 4YFJA 3HOUI 4CGPA 1DL6A 1GHEA 3D9XA 5T6BA 2DE6A 3S14I 1CX8A 4UCPA 4AG9A 1IU8A 4F0YA 4AYBA 2V8KA 2WYRA 3CCL1 2Z3PA 4FAIA 4X5KA 4NXYA 3F8KA 2QLVB 3S6FA 3SI0A 2PJ6A 3SHPA 3BI1A 2DPSA 3CC7Z 4CAEA 4NGQA 1XIXA 2R7HA 2JA8I 4NBAA 1RTQA 4UIBA 7CPAA 4HKFA 3IU1A 1K9M2 1KZFA 5KTDA 1HDUA 3DDDA 3D7FA 4FD5A 1VQ4Z 3B3CA 2JMOA 2AFZA 1KD11 2HV2A 3SI2A 2CIJA 3QB8A 3SXOA 2QR1B 2GE3A 3KASA 1ZB8A 1YHQZ 3PP9A 4KVXA 4MCPA 2GU2A 4A94A 2P6GA 4UFWA 4CGNA 5JH9A 4LQ6A 1CBXA 4KSIA 4FUUA 1QSRA 1S7NA 2GFQA 3KQXA 4E2ZA 4IHMA 4F9UA 3CCUZ 3CCV1 3RNZA 1KWMA 3CCJZ 2JBJA 3LODA 2AFUA 4KOUA 2PM9A 3TCVA 2QEX1 4MI4A 3PB8X 4A3DI 5LYFA 3I551 3PB7X 3G4S1 4RUHA 3CMEZ 3FX6A 3ZZIA 1PYTB 1M1K2 4U9YA 4YRHA 4P4FA 3VTNA 3D2PA 1YW6A 2C6PA 2Z3KA 1XOVA 5KTCA 2E7ZA 1P4NA 3W6XA 2NSMA 1Q811 4NFRA 5BWAB 5LYDA 1YUKA 1AYEA 4KOTA 2OZKA 1RO4A 3CQZI 3TE5B 4YU9A 5AG4A 5HMNA 4R3LA 4P4DA 4QB9A 1QYPA 1OBRA 2YADA 1ZLHA 1M1K1 2V45A 3HKZA 5LL6f 1K732 4CYPA 1S7FA 1NSLA 3PEIA 3I4MI 3OW2Y 1VQKZ 1QSNA 2AYDA 2Q51A 3NDJA 1H8LA 3JTKA 3KHZA 1BO4A 5G21A 2O53A 3W91A 1YJ91 4R6TA 3C26A 2PE3A 2PRBA 2NVYI 1XMBA 4A33A 3RAMA 1WIIA 1BPNA 2PJBA 3I56Z 2VPXA 1I12A 3S9LA 3T90A 3D7HA 3T9YA 4BY1I 4UEZA 4RVFA 3CCE1 1M4IA 5CM2M 1DE4C 1CG2A 1ZLIA 2EK8A 4MY0A 3BXMA 3SJEA 3CD6Z 3D66A 2BO9A 4R7MA 1RLYA 2GIVA 2AFMA 1BOBA 4CRZB 2GREA 3GYAA 2DXQA 1Q7LA 2FIAA 3FMCA 4B5OA 5F09A 2VPWA 3PO2I 3Q87A 3CC21 4OC2A 3EC4A 2B5GA 1X0TA 3D2LA 1ELMP 4XPDB 3GLJA 5T67A 1XBUA 2PJ2A 2R1IA 3E0KA 1VQMZ 1MJAA 3SJXA 4PV6A 2PR1A 2XEGA 4S1TA 1YQEA 3R9EA 3PGPA 1XFOA 5A28A 1S60A 1S3ZA 5T64A 1N8R2 5J8CA 2A4NA 4MCRA 4Y7NI 3KKWA 3A9LA 5C88A 3KL9A 2BCOA 8CPAA 3S2DI 4P45A 2V8VA 3VB9A 3H3VJ 3CCQ1 4FWUA 5C82A 3T4NB 1LFWA 4CYOA 2VPYA 3ISXA 4OAEA 1VQLZ 4LUAA 3R9FA 3TTHA 3NH4A 3ISZA 4L8AA 2ODFA 3CCR1 4R3KA 2JIPA 4A93I 3QAHA 2JDDA 1I50I 5FVJA 2OTLZ 3RZDI 4KVOE 4G1PA 4P44A 1UWYA 4PXBA 4E32A 4UCNA 2XEJA 1K83I 2ZOFA 1VLAA 3D8PA 3H5ZA 1WW9A 2QRDB 1VQ91 3R96A 3G6E1 3S6KA 1LOKA 2Q44A 2AJ6A 2P6EA 1VHOA 2QREB 4MD9A 1WJ2A 1VQNZ 2V77A 3GIUA 1F2PA 4IF5A 2VZYA 2OH1A 3TO9A 3MZLB 3I07A 4DQYB 4KZTA 4UWIA 3CMAZ 1UFHA 5IT9b 4NB9A 3M3YI 3OWCA 5D29A 1Z01A 4B5PB 1J4JA 2EBJA 1VQPZ 3EO4A 1YVKA 1KUXA 1ZH1A 4NGSA 1R43A 1Y7RA 1Y0RA 2JDCA 4MHNA 5LRGA 4X8IA 3OW2Z 4OC4A 1W2BY 5GCNA 3IWWA 4JXRA 3G711 3V8IA 2VI7A 4A3EI 2IQ6A 3D3SA 1ZG9A 3TOBA 3FH4A 4P4IA 4R76A 1BPMA 4QTUA 3IWGA
chains in the Genus database with same CATH topology
1RNIA 1TWFI 3BG1B 2V8JA 3FEEA 3MZKB 3RBUA 2F7VA 3K2KA 3KZWA 3CXCY 2G9DA 4Z65A 3HOUI 1TKHA 3VATA 4PXEA 3SJFA 5LRKA 2QA4Z 3KGQA 3S9MA 1VQK1 1DL6A 5A2Qb 3FQMA 4YWYA 5K8MA 2QJ8A 3HOXI 1M4LA 2DEAA 1JJ2Z 3D9XA 3NDIA 5T6BA 2DE6A 2JA7I 3S14I 1CX8A 3CDXA 5IB9A 2O4HA 4DGLA 1BAVA 1FT7A 3GTQI 2Y0SA 1GYTA 1TWHI 3CPWZ 4AYBA 2V8KA 4UEEA 2WYRA 3CCL1 4NGMA 3HOVI 3F3FC 4E33A 4ZYQA 2LFUA 4NBFA 3HUVA 1M901 2IZ4A 4FAIA 3VMGA 3PB6X 3TX8A 3BI0A 4IAVA 4MCQA 4A3JI 2RIQA 5A2Qf 2QLVB 2WB1A 1VQ41 3SI0A 2PJ6A 2PJ4A 3HOYI 3BI1A 3PFOA 3DGVA 2JBKA 2RPRA 3S16I 1JQGA 3CC7Z 3CCMZ 2QYVA 4NGQA 3KQZA 3I561 2YU9I 2EK9A 2JA8I 1YHQ1 2BJOA 2XEFA 2PJ3A 2ANPA 3CCS1 4NBAA 1RTQA 4ZI6A 2JA5I 2NVXI 2R92I 4UIBA 4NH1C 1XRYA 5CPAA 3J81b 7CPAA 4W9YA 2K3RA 1K9M2 4NGTA 4P4EA 1S721 1HDUA 1VQOZ 2J9AA 3D7FA 3IFEA 1Y1VS 5C44I 3PBEA 2HB6A 3B35A 6CPAA 1VQ4Z 4BBRI 3B3CA 2JMOA 3ESWA 1RQFA 2AFZA 3U50C 1KD11 1I6HI 3SI2A 4ZY1A 3S15I 2CIJA 3B2YA 3CCU1 2QR1B 3CCJ1 1QVGY 2RFHA 3S17I 4MONA 2RHBA 3PO3S 1VGYA 4IK2A 1XJOA 4PQAA 3KASA 5J1QA 1ZB8A 1YHQZ 1YJNZ 4MMOA 2DE5A 1K731 3L2NA 4MHYA 5D1PA 2GU2A 1VQ9Z 4MCPA 4HH4A 1NJI2 4ONWA 4A94A 1LAMA 4CPAA 2VL1A 3DLJA 4ZX8A 3VH9A 3SJGA 4MRIA 1PCAA 5JH9A 3GKQA 1Q7Y1 4ZY0A 1Q861 1CBXA 4E2YA 2PJ8A 3FVLA 4KSIA 4NBGA 4FUUA 2BOAA 3LWUA 3GTKI 3IIBA 3KR5A 3B7IA 3F3PC 2PVWA 3KQXA 4E2ZA 3KR4A 4IHMA 3CCUZ 4OMEA 4F9UA 3CCV1 1Z03A 4BBSI 1KWMA 3B3WA 1X3WA 3CCJZ 2JBJA 4OIDA 2ZEDA 2AFUA 1VQM1 2PM9A 3HOWI 2QEX1 3B3TA 2PJ7A 3PB8X 4A3DI 2ZEMA 5LYFA 3D68A 2C6GA 3I551 4A39A 2PJCA 1QF8A 2AFXA 2PJ0A 3PB7X 2OTJ1 3G4S1 2E2JI 2KPIA 4RUHA 3CMEZ 2ZOGA 3FX6A 1Y0YA 4F8ZA 1PYTB 4JZ0A 2E2HI 2OR4A 1M1K2 3RZOI 3GTMS 4P4FA 1TWAI 3VTNA 1YITZ 1YIJ1 1Z5RA 1YW6A 1EE3P 5FLXb 4F9VA 2C6PA 3PRTA 1NJI1 1YUAA 4NBDA 4NBCA 3JAMf 3CC4Z 4NB8A 4ZX9A 3J80f 4DYOA 2E9HA 1VIXA 1FNOA 2QEXZ 2PJ9A 4A3LI 1HDQA 3GTPI 2ZEHA 3QNVA 4NJQA 2HF1A 2QKDA 1YI2Z 2NSMA 1Q811 3I55Z 3GTLI 4K3NA 4NFRA 4P6YA 5HVHA 1NSAA 2OTJZ 5LYDA 1YUKA 1AYEA 4CL1A 2OZKA 1RO4A 5FLXf 1Y1VI 1ML8A 1VQL1 4NBBA 4A3CI 1F57A 3K7AI 4O23A 3VMHA 4P4BA 4NBEA 2PIYA 1CPXA 3CQZI 3TE5B 3G71Z 2EWBA 4YU9A 1KD12 4LQGA 3PO3I 4OC0A 1CP7A 4P4DA 4A37A 2VUMI 1QYPA 4E30A 1OBRA 1TF8A 2YADA 4X3RA 5LYLA 1ZLHA 2OOTA 2WAQA 1M1K1 3EERA 4OKOA 3HKZA 3GTJI 5LL6f 2HC9A 2C6CA 4ZY2A 1K732 1LCPA 2PJAA 3CPAA 3B3SA 4GM5A 3PEIA 2W03A 3I4MI 1TF9A 3OW2Y 1QMUA 2ZENA 3WABA 1VQKZ 3GB0A 1Q7Y2 2EGTA 1Q862 4MCSA 2LIYA 2F4OA 2Q51A 3NDJA 1H8LA 4JYWA 1F2OA 4OP4A 4MXUA 3KHZA 4MH4A 4A3BI 1NUIA 4A3KI 2O53A 2QVPA 3CCLZ 2JEWA 2VUGA 2PCUA 2IJZA 2JA6I 3PB9X 1KQSZ 1YJ91 1VHEA 4R6TA 2PE3A 4MD7A 1N8R1 2V8IA 3D6WA 1NP6A 5C4JI 1VQ51 3D67A 1TKFA 2NVYI 3D7GA 3V7ZA 1XMBA 1VQN1 3CD61 1YLOA 3RAMA 1AMPA 1WIIA 1YJW1 1ARMA 1BPNA 2PJBA 1R3NA 2JS4A 3GTMI 1VQ61 1JJ2Y 1USPB 2OOXB 3HLPA 3IX0A 4TNUA 3I56Z 1Z02A 1QVFZ 3IF8A 2J6AA 1SFOI 3CPWY 3S9LA 3CCSZ 2C1CA 3BG0B 4X2TA 3D7HA 4BY1I 2JR6A 4UEZA 2HU9A 3IFUA 4E2WA 4A3II 4MHZA 4RVFA 4E31A 3CCE1 3FEDA 1W2BZ 5CM2M 2ZEGA 3NA6A 1DE4C 1S72Z 3MN8A 5C3EI 1L1OC 1CG2A 4EWTA 3CMA1 1ZLIA 3VARA 1VQ5Z 2EK8A 3JRUA 2AFOA 3BXMA 1Q812 1VQ71 3SJEA 3CD6Z 3D66A 2BO9A 4R7MA 3H0GI 1RLYA 3T8WA 3GCFA 2AFMA 1R9TI 1VQ6Z 2CTBA 3I4NI 5AN9F 2GREA 2Q43A 3EEDA 1CP6A 3CXCZ 4P4JA 3KIFA 1Q7LA 3FMCA 2R93I 2RT9A 3JAMb 4MD8A 2AFSA 4OC1A 5F09A 3B3VA 3FF3A 3P5JB 3J80b 3PO2I 4NGPA 2GTHA 3N5FA 3CCEZ 1Y1WI 3Q87A 1S7MA 3CC21 1TWGI 4OC2A 4EMEA 4DK1A 3QWUA 1X0TA 2GLJA 1ELMP 4NGNA 4PXDA 1VQ7Z 2R7ZI 3GLJA 3CCVZ 2AKLA 5T67A 3TDHB 1XBUA 2PJ2A 2V8DA 1VQMZ 3SJXA 2M6NA 3S9NA 2XEGA 2G2KA 2IMOA 3MRUA 4S1TA 2PRQA 5D1OB 2QA41 3H8FA 1RO0A 3LMSA 3PFEA 5FLMI 3IJ3A 3G4SZ 5IT9f 1KC81 3CC2Z 1LQLA 2DE7A 1XFOA 3GTGI 4TWEA 1Q821 5K8PA 3NFZA 2XEIA 3GUXA 1LAPA 3KI9A 5IP9I 2AFWA 2GLFA 2RB7A 4OC3A 4DJLA 5T64A 4OIWA 4PPZA 4AXVA 2H85A 3S1QI 1N8R2 1YIJZ 4MCRA 4Y7NI 5JGFA 3CT9A 4EWCA 3H8EA 3KL9A 2BCOA 2OTL1 3FKII 2JUBA 3IC1A 8CPAA 3S2DI 5D1OA 4P45A 2PJ1A 2V8VA 3VB9A 3H3VJ 5DS0A 3CCQ1 2NVQI 2POKA 1TFIA 4FWUA 4NJRA 3T4NB 3CC71 3CCM1 1QVGZ 1LFWA 1DTDA 3LUSA 1BLLE 3K9TA 1ZG8A 2F8HA 4HGYA 2ZEOA 3ISXA 1Z2LA 1VQLZ 4R8FA 1PFTA 5C4XI 4XX2A 3S1MI 4MHPA 4RS4A 5LYIA 3NH4A 2ZEEA 3ISZA 2NYQA 3CCR1 1K8A1 4A93I 3PBBA 4UIAA 5HXDA 2ZEFA 1I50I 1CPSA 4WWVA 5K8OA 1VQO1 2OTLZ 3RZDI 1TWCI 4EFDA 3FQQA 2JNYA 2P3YA 4E2XA 4Q7AA 3BHXA 3CCQZ 4G1PA 1HEEA 2FVGA 1X3ZA 3GTOI 3CPXA 4P44A 4UF4A 3S1NI 3MONA 4RV9A 1YSJA 4BXXI 1UWYA 2CF4A 4PXBA 4E32A 2XEJA 1K83I 4RVGA 2PJ5A 2ZOFA 1VLAA 2B63I 4X6AI 1YJN1 3FJUA 3IO1A 3CCRZ 1WW9A 2QRDB 1ARLA 1VQ91 3RZAA 4QTTA 4OC5A 3WC7A 3G6E1 4NBHA 1LOKA 2CTCA 2P28A 2VF1A 4HGZA 5K8NA 3KIHA 3VMIA 4BD9A 1KRLA 5ELYA 2QRCB 1IY7A 3H8GA 2IZ3A 1YJ9Z 1VHOA 3I1UA 2QREB 2GTIA 4MD9A 1RO2A 1LANA 2I3CA 4UEFA 1VQNZ 2PVVA 3J81f 4A3MI 2V77A 2Q4ZA 2PIZA 1USPA 1YJWZ 2NVTI 2W04A 2ZELA 5LRJA 1KC82 2OOYB 4A3GI 1VQ81 1F2PA 4FBEA 1VQP1 3S2HI 1ZB9A 1Q822 2ABZA 1I3QI 1P9NA 5JM6A 1TKJA 2KI7B 2V8HA 4RVHA 3HOZI 3M4OI 4B6ZA 5HVGA 1ELLP 3G6EZ 4P10A 4A38A 3CME1 1ZG7A 2PK7A 5THWA 1JWHC 3WC5A 3MZLB 3I07A 3WC6A 1KQSY 4DQYB 1YIT1 3IEHA 3FECA 3CMAZ 3S1RI 1Z8LA 2WZNA 4NGRA 2R6MA 5IT9b 1K9M1 4NB9A 3CC41 2E2II 3J7A4 3M3YI 4Y52I 3SI1A 5D29A 2K5RA 2PMZA 1Z01A 3D4UA 1VQ8Z 5D8NA 5HVFA 1VQPZ 3WT4A 4RVDA 3NH8A 1YMEA 1YI21 3NH5A 4PXCA 1QVFY 4WJBA 1TXRA 4NGSA 1ZH1A 4NOZA 1WCMI 1R43A 1K8A2 3V38A 1Y0RA 2V8GA 1IGBA 4MHNA 5LRGA 3TC8A 2M48A 4X8IA 3OW2Z 1M902 1QQ9A 3KHXA 4OC4A 1N2FA 1W2BY 2F4MA 4BY7I 3IWWA 3G711 4A3EI 5IP7I 2IQ6A 4H2KA 1ZG9A 3FH4A 5CBMA 4A3FI 3D7DA 4P4IA 4R76A 1Y7EA 2RBLA 3PB4X 5I4MA 1BPMA 1YW4A 4QTUA 2ZEPA 2ZAEB 4DUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEE A;  3RBU A;  2F7V A;  3K2K A;  3KZW A;  2G9D A;  4Z65 A;  1TKH A;  3VAT A;  4PXE A;  3SJF A;  5LRK A;  3KGQ A;  3S9M A;  4YWY A;  5K8M A;  2QJ8 A;  1M4L A;  2DEA A;  1CX8 A;  5IB9 A;  3CDX A;  2O4H A;  1BAV A;  1FT7 A;  1GYT A;  4UEE A;  2WYR A;  4NGM A;  4ZYQ A;  3HUV A;  4FAI A;  3PB6 X;  3TX8 A;  3BI0 A;  4IAV A;  4MCQ A;  3SI0 A;  2PJ6 A;  2PJ4 A;  3BI1 A;  3PFO A;  3DGV A;  2JBK A;  1JQG A;  2QYV A;  4NGQ A;  3KQZ A;  2EK9 A;  2XEF A;  2PJ3 A;  2ANP A;  4ZI6 A;  1RTQ A;  4UIB A;  1XRY A;  5CPA A;  7CPA A;  4W9Y A;  4NGT A;  4P4E A;  1HDU A;  2J9A A;  3IFE A;  3D7F A;  3PBE A;  2HB6 A;  3B35 A;  6CPA A;  3B3C A;  2AFZ A;  4ZY1 A;  3SI2 A;  2CIJ A;  3B2Y A;  2RFH A;  1VGY A;  4IK2 A;  1XJO A;  4PQA A;  3KAS A;  5J1Q A;  4MMO A;  3L2N A;  4MHY A;  4MCP A;  2GU2 A;  4ONW A;  4CPA A;  4A94 A;  1LAM A;  2VL1 A;  3DLJ A;  4ZX8 A;  3VH9 A;  3SJG A;  4MRI A;  1PCA A;  5JH9 A;  4ZY0 A;  1CBX A;  2PJ8 A;  3FVL A;  4KSI A;  4FUU A;  2BOA A;  3LWU A;  3IIB A;  3KR5 A;  3B7I A;  2PVW A;  3KQX A;  4OME A;  4IHM A;  3KR4 A;  4F9U A;  3B3W A;  1KWM A;  2JBJ A;  4OID A;  2ZED A;  2AFU A;  3B3T A;  2PJ7 A;  3PB8 X;  2ZEM A;  5LYF A;  3D68 A;  2C6G A;  4A39 A;  2PJC A;  2AFX A;  2PJ0 A;  3PB7 X;  4RUH A;  2ZOG A;  3FX6 A;  1Y0Y A;  4F8Z A;  1PYT B;  4JZ0 A;  2OR4 A;  4P4F A;  1Z5R A;  1YW6 A;  1EE3 P;  4F9V A;  2C6P A;  3PRT A;  4ZX9 A;  4DYO A;  1VIX A;  1FNO A;  2PJ9 A;  1HDQ A;  2ZEH A;  3QNV A;  4NJQ A;  2NSM A;  4K3N A;  4NFR A;  4P6Y A;  5HVH A;  1NSA A;  5LYD A;  1AYE A;  1F57 A;  4O23 A;  4P4B A;  2PIY A;  1CPX A;  2EWB A;  4YU9 A;  4LQG A;  4OC0 A;  1CP7 A;  4P4D A;  4A37 A;  1TF8 A;  1OBR A;  4X3R A;  5LYL A;  1ZLH A;  2OOT A;  4OKO A;  2HC9 A;  2C6C A;  4ZY2 A;  1LCP A;  2PJA A;  3CPA A;  3B3S A;  4GM5 A;  3PEI A;  1TF9 A;  1QMU A;  2ZEN A;  3WAB A;  3GB0 A;  4MCS A;  2Q51 A;  1H8L A;  4JYW A;  1F2O A;  4OP4 A;  4MXU A;  3KHZ A;  2QVP A;  2O53 A;  2PCU A;  2JEW A;  2IJZ A;  3PB9 X;  1VHE A;  4R6T A;  2PE3 A;  3D67 A;  1TKF A;  3D7G A;  3V7Z A;  1XMB A;  1YLO A;  3RAM A;  1AMP A;  1ARM A;  1BPN A;  2PJB A;  1R3N A;  3HLP A;  4TNU A;  3S9L A;  2C1C A;  4X2T A;  3D7H A;  4UEZ A;  4MHZ A;  3FED A;  2ZEG A;  3NA6 A;  1DE4 C;  3MN8 A;  1CG2 A;  4EWT A;  1ZLI A;  3VAR A;  2EK8 A;  3JRU A;  2AFO A;  3BXM A;  3SJE A;  3D66 A;  2BO9 A;  4R7M A;  3T8W A;  2AFM A;  2CTB A;  2GRE A;  2Q43 A;  1CP6 A;  4P4J A;  1Q7L A;  3FMC A;  2AFS A;  4OC1 A;  5F09 A;  3B3V A;  3FF3 A;  4NGP A;  3N5F A;  4OC2 A;  4EME A;  2GLJ A;  1ELM P;  4NGN A;  4PXD A;  3GLJ A;  1XBU A;  2PJ2 A;  2V8D A;  3SJX A;  3S9N A;  2XEG A;  2IMO A;  3MRU A;  2PRQ A;  3H8F A;  3LMS A;  3PFE A;  3IJ3 A;  1XFO A;  4TWE A;  5K8P A;  3NFZ A;  3KI9 A;  3GUX A;  2XEI A;  1LAP A;  2RB7 A;  2AFW A;  2GLF A;  4OC3 A;  4DJL A;  4OIW A;  4PPZ A;  4AXV A;  4MCR A;  5JGF A;  3CT9 A;  3H8E A;  3KL9 A;  2BCO A;  3IC1 A;  8CPA A;  4P45 A;  2PJ1 A;  2V8V A;  5DS0 A;  2POK A;  4FWU A;  4NJR A;  3K9T A;  1LFW A;  1DTD A;  1BLL E;  1ZG8 A;  2F8H A;  2ZEO A;  3ISX A;  1Z2L A;  4R8F A;  4MHP A;  5LYI A;  3NH4 A;  2ZEE A;  3ISZ A;  2NYQ A;  3PBB A;  4UIA A;  5HXD A;  2ZEF A;  1CPS A;  5K8O A;  4WWV A;  4EFD A;  4Q7A A;  3BHX A;  4G1P A;  1HEE A;  2FVG A;  3CPX A;  4P44 A;  4UF4 A;  1YSJ A;  1UWY A;  2CF4 A;  4PXB A;  2XEJ A;  2ZOF A;  2PJ5 A;  3FJU A;  3IO1 A;  1ARL A;  3RZA A;  4OC5 A;  3WC7 A;  1LOK A;  2CTC A;  5K8N A;  4BD9 A;  5ELY A;  1IY7 A;  3H8G A;  1VHO A;  3I1U A;  1LAN A;  2I3C A;  4UEF A;  2PVV A;  2V77 A;  2Q4Z A;  2PIZ A;  2ZEL A;  5LRJ A;  1F2P A;  4FBE A;  2ABZ A;  5JM6 A;  1TKJ A;  2V8H A;  4B6Z A;  5HVG A;  1ELL P;  4P10 A;  4A38 A;  1ZG7 A;  5THW A;  3WC5 A;  3WC6 A;  3IEH A;  3FEC A;  1Z8L A;  2WZN A;  4NGR A;  3SI1 A;  5D29 A;  3D4U A;  5D8N A;  5HVF A;  3WT4 A;  1YME A;  3NH8 A;  3NH5 A;  4PXC A;  4WJB A;  1TXR A;  4NGS A;  1R43 A;  3V38 A;  1Y0R A;  2V8G A;  1IGB A;  4MHN A;  5LRG A;  3TC8 A;  4X8I A;  1QQ9 A;  3KHX A;  4OC4 A;  3IWW A;  2IQ6 A;  4H2K A;  1ZG9 A;  3FH4 A;  5CBM A;  3D7D A;  4P4I A;  4R76 A;  1Y7E A;  3PB4 X;  5I4M A;  1BPM A;  1YW4 A;  2ZEP A;  4DUK A; 
#chains in the Genus database with same CATH topology
 1Y9W A;  3H4Q A;  2B3V A;  3FEE A;  1NMT A;  2ZW4 A;  2F7V A;  3FXT A;  3VAT A;  4PXE A;  3IU2 A;  1IOF A;  2QJ8 A;  5K8M A;  2DEA A;  5IB9 A;  4DGL A;  1TWH I;  1V0C A;  4NGM A;  4A31 A;  3HOV I;  2LFU A;  3HUV A;  3VMG A;  2WSA A;  4A3J I;  2Z3O A;  1S5K A;  4H6U A;  3HOY I;  2B4D A;  2RPR A;  3KQZ A;  4QC6 A;  2YU9 I;  2BJO A;  2XEF A;  4E0A A;  2NVX I;  4RN7 A;  2R92 I;  1XRY A;  5CPA A;  4W9Y A;  4KVM E;  4NGT A;  4MFQ A;  1S72 1;  2C27 A;  2J8R A;  3RO0 A;  4BBR I;  1Z9U A;  2B58 A;  3S15 I;  2WPX A;  3G8W A;  2CY2 A;  2RFH A;  3PO3 S;  2RHB A;  3FRM A;  1L0C A;  1LRZ A;  1YJN Z;  4MMO A;  2DE5 A;  2R8V A;  3L2N A;  4ONW A;  5IB0 A;  1LAM A;  4ZX8 A;  3GKQ A;  1Q7Y 1;  2B4B A;  2PJ8 A;  4ZBG A;  1M4G A;  3GTK I;  2B5G B;  4FD6 A;  3F3P C;  1Q2C A;  4OME A;  3TO6 A;  1B87 A;  4BBS I;  1X3W A;  4FD7 A;  2EO8 A;  3HOW I;  3B3T A;  3D68 A;  2YGW A;  1YVO A;  2AFX A;  2PJ0 A;  2OTJ 1;  2E2J I;  2JEV A;  4R87 A;  1Y0Y A;  2FXF A;  2E2H I;  2OR4 A;  4PSX A;  5EBV A;  3GTM S;  3S6G A;  1YIJ 1;  1EE3 P;  4H6Z A;  3PRT A;  2VEZ A;  4NBC A;  1AUG A;  4NB8 A;  4ZX9 A;  4GS4 A;  1FNO A;  2QEX Z;  4C2X A;  3GTP I;  2ZEH A;  2HF1 A;  2QKD A;  4UFV A;  3I55 Z;  3GKR A;  1ZO0 A;  4CL1 A;  4XNH C;  5FLX f;  1ML8 A;  4A3C I;  1F57 A;  4O23 A;  2PIY A;  1CPX A;  2RC4 A;  1KD1 2;  2Z11 A;  3PO3 I;  4M6H A;  1R57 A;  4OKO A;  3S6H A;  3GTJ I;  2C6C A;  4QBJ A;  2Q7B A;  3B3S A;  4GM5 A;  4MFK A;  3JVN A;  3DR8 A;  1QMU A;  2ZEN A;  2JIQ A;  1CM0 A;  4MCS A;  3EY5 A;  3P2F A;  5J8F A;  1F2O A;  2QVP A;  1NUI A;  4A3K I;  2PCU A;  2VUG A;  4AG7 A;  3PB9 X;  1MJ9 A;  5H84 A;  4KLW A;  3V7Z A;  2JS4 A;  3GTM I;  1JJ2 Y;  2OOX B;  3HLP A;  4TNU A;  2J6A A;  1SFO I;  3CCS Z;  1K4J A;  4MFZ A;  4MHZ A;  4PK2 A;  1W2B Z;  2ZEG A;  3NA6 A;  3MN8 A;  1SIW A;  2Q04 A;  2HUZ A;  4EWT A;  2Q4Y A;  1OZP A;  1Q81 2;  1VQ7 1;  2OB0 A;  3CXS A;  3T8W A;  1R9T I;  3I4N I;  1MK4 A;  3JAM b;  4OC1 A;  4BMH A;  1N71 A;  3J80 b;  3CCE Z;  1Y1W I;  1S7M A;  1PU9 A;  1TWG I;  4A95 A;  4EME A;  2GLJ A;  4NGN A;  4PXD A;  4QVT A;  1CJW A;  1KUY A;  2V8D A;  4CYN A;  2IMO A;  2PRQ A;  5D1O B;  3FNC A;  1KUV A;  3H8F A;  3EFA A;  3PFE A;  5FLM I;  3CC2 Z;  2DE7 A;  1Q82 1;  5K8P A;  4DYO A;  3KI9 A;  2AFW A;  4OC3 A;  1WK4 A;  1PUA A;  2EUI A;  3H8E A;  4KLV A;  2ARH A;  2JUB A;  3IC1 A;  3F5B A;  4H89 A;  1TFI A;  2B4D B;  3CC7 1;  3K9T A;  1ZG8 A;  4HGY A;  1PFT A;  5C4X I;  3S1M I;  1QSM A;  3NE8 A;  4MHP A;  4RS4 A;  3BJ8 A;  2ZEE A;  1WZN A;  2NYQ A;  3N7Z A;  3NE7 A;  5HXD A;  1CPS A;  4WWV A;  3DSB A;  4IUS A;  2PC1 A;  4EFD A;  2ZPA A;  4Q7A A;  3CCQ Z;  1HEE A;  1X3Z A;  3GTO I;  3CPX A;  2IL4 A;  4UF4 A;  4Y49 C;  3MON A;  2CF4 A;  4X6A I;  3WR7 A;  2VBQ A;  4HPS A;  3CCR Z;  1Z4R A;  3WC7 A;  2FL4 A;  5ELY A;  2QRC B;  2CXA A;  2GTI A;  4CAF A;  1LAN A;  2I3C A;  2Q7S A;  2Q4Z A;  3F0A A;  1USP A;  1YJW Z;  5LRJ A;  2OOY B;  1VQ8 1;  1I3Q I;  1P9N A;  2O28 A;  1TKJ A;  1QSO A;  4RVH A;  3G6E Z;  1RO5 A;  4P10 A;  3CME 1;  1ZG7 A;  3WC6 A;  1KQS Y;  4OLL A;  3FEC A;  3S1R I;  2OZU A;  2ZW7 A;  1Z8L A;  2WZN A;  4NGR A;  3TO7 A;  3SI1 A;  2K5R A;  4HNX B;  3WT4 A;  3NH8 A;  1VKC A;  4PXC A;  1QVF Y;  4WJB A;  4DNC A;  1WCM I;  3V38 A;  5AG5 A;  2AE6 A;  4NF1 A;  1M90 2;  2FT0 A;  1XF8 A;  3I9S A;  3TOA A;  4A3F I;  2ZXV A;  4R57 A;  1YW4 A;  2OZH A;  4CGL A;  2WUU A;  3BG1 B;  4EVY A;  2V8J A;  3MZK B;  3RBU A;  3LD2 A;  3CXC Y;  2G9D A;  1TKH A;  4KOW A;  2D4P A;  3SJF A;  5LRK A;  2QA4 Z;  3KGQ A;  1Z8T A;  2NMT A;  1VQK 1;  1U6M A;  4KOX A;  3FQM A;  4YWY A;  1JJ2 Z;  1Y9K A;  2Q4V A;  5ISV A;  2O4H A;  1BAV A;  1FT7 A;  3GTQ I;  2Z0Z A;  4UEE A;  3F3F C;  2G0B A;  4MJ8 A;  1M90 1;  2IZ4 A;  3PB6 X;  3BI0 A;  4IAV A;  4MCQ A;  4KS9 A;  2RIQ A;  5A2Q f;  3UY5 A;  3GY9 A;  1I1D A;  2PJ4 A;  2EVN A;  4A30 A;  3CCM Z;  4C2Z A;  2H5M A;  3I56 1;  2EK9 A;  2PJ3 A;  2ANP A;  3J81 b;  1Z8X A;  2K3R A;  4XPL A;  4P4E A;  3IFE A;  1VQO Z;  3PBE A;  6CPA A;  1XEB A;  3ESW A;  3U50 C;  1Q2Y A;  1QVG Y;  3S17 I;  2Z3M A;  4PQA A;  5J1Q A;  4NCZ A;  1X12 A;  2R98 A;  5HH1 A;  4HH4 A;  1NJI 2;  2VL1 A;  3DLJ A;  3VH9 A;  3SJG A;  4MRI A;  2P6F A;  4ZY0 A;  1Q86 1;  4E2Y A;  4NBG A;  2BOA A;  2YNE A;  2IV2 X;  4OID A;  3W6S A;  2ZED A;  1VQM 1;  4MFP A;  2I00 A;  2C6G A;  4A39 A;  2PJC A;  1QF8 A;  2ZOG A;  1FY7 A;  3RZO I;  1YR0 A;  3TE4 A;  1YIT Z;  4I49 A;  1TIQ A;  5FLX b;  4F9V A;  1NJI 1;  4PSW A;  4NBD A;  3CXP A;  4CRY B;  3CC4 Z;  1IB1 E;  4C7I A;  1A2Z A;  2CNT A;  3BJ7 A;  4NJQ A;  1YI2 Z;  1RXT A;  4K3N A;  4P6Y A;  5HVH A;  2OTJ Z;  4E2A A;  4J3G A;  4M6I A;  1VQL 1;  2I79 A;  4B11 A;  4XNH B;  1CP7 A;  4UBR A;  4E30 A;  2VPZ A;  5LYL A;  2WAQ A;  3EER A;  4ZY2 A;  1LCP A;  3CPA A;  2W03 A;  3WAB A;  4CAV A;  4MHD A;  1Q7Y 2;  3DNS A;  2LIY A;  4UFX A;  4JYW A;  2DF5 A;  2Y0M A;  4MH4 A;  4A3B I;  2VXK A;  3CCL Z;  2CNM A;  2JA6 I;  1KQS Z;  4BIN A;  1VHE A;  4MD7 A;  3D6W A;  1NP6 A;  3QAY A;  1VQ5 1;  1FDI A;  3D67 A;  3D7G A;  3I3G A;  1VQN 1;  2JIR A;  1ARM A;  3TFY A;  1R3N A;  1Y8C A;  4RS2 A;  1VQ6 1;  1USP B;  5DWN A;  1QVF Z;  3CPW Y;  4X2T A;  2JR6 A;  3IFU A;  4E2W A;  4E31 A;  4YGO A;  5C3E I;  3CMA 1;  4AB7 A;  2AFO A;  3H0G I;  3GCF A;  4B10 A;  5AN9 F;  2G3A A;  2Q43 A;  3EED A;  1CP6 A;  3ZJ0 A;  3CXC Z;  4P4J A;  3KIF A;  4KSA A;  2R93 I;  1IYL A;  1YRE A;  4MD8 A;  3B3V A;  3P5J B;  4B13 A;  2GTH A;  3N5F A;  4KOS A;  3DR6 A;  4DK1 A;  3QWU A;  4Q36 A;  1VQ7 Z;  3CCV Z;  2AKL A;  4A2Z A;  2M6N A;  1Z8W A;  4GXH A;  2G2K A;  2G3T A;  3MRU A;  1RO0 A;  1IID A;  3IJ3 A;  3G4S Z;  5IT9 f;  1KC8 1;  2BEI A;  1YX0 A;  3GTG I;  4TWE A;  3NFZ A;  2XEI A;  4M6G A;  2RB7 A;  4PPZ A;  2H85 A;  4C2Y A;  2Z3L A;  3FB3 A;  5F47 A;  3FBU A;  5JGF A;  3CT9 A;  3FIX A;  2PJ1 A;  2POK A;  3K9U A;  4NJR A;  1QVG Z;  3LUS A;  1BLL E;  4M3S A;  2F8H A;  2ZEO A;  4XX2 A;  2X7B A;  1K8A 1;  3PBB A;  4JJX A;  3D2M A;  1YGH A;  2BUE A;  2JNY A;  2P3Y A;  4E2X A;  4K30 A;  2FVG A;  3S1N I;  4RV9 A;  1YSJ A;  2HQY A;  2PJ5 A;  2B63 I;  1YJN 1;  2PQ8 A;  4Y49 B;  2VZZ A;  3IO1 A;  4MFJ A;  4QTT A;  4OC5 A;  4C7H A;  4NBH A;  3TT2 A;  2CTC A;  5K8N A;  3KIH A;  3CZX A;  4BD9 A;  3H8G A;  1VHS A;  1YJ9 Z;  3I1U A;  4CYQ A;  4ORF A;  1RO2 A;  1FDO A;  2B3U A;  4NSQ A;  2PIZ A;  2W04 A;  2ZEL A;  4PK3 A;  3S2H I;  1ZB9 A;  1Q82 2;  2ABZ A;  2KI7 B;  2V8H A;  4B6Z A;  3HOZ I;  3M4O I;  4JD6 A;  5HVG A;  1ELL P;  3P2H A;  1JWH C;  3WC5 A;  4KUB A;  2VQY A;  5AG6 A;  1NE9 A;  1K9M 1;  3J7A 4;  4Y52 I;  5D8N A;  1VQ8 Z;  2KCW A;  5HVF A;  4RVD A;  3NH5 A;  4L89 A;  2V8G A;  1IGB A;  2M48 A;  4FD4 A;  3KHX A;  2YNC C;  1N2F A;  2BL1 A;  2F4M A;  3G3S A;  2QML A;  2PDO A;  4H2K A;  3R1K A;  5CBM A;  3D7D A;  1IOI A;  4B5P A;  1Y7E A;  2BSW A;  5I4M A;  2D4O A;  4DUK A;  1RNI A;  5I0C A;  4Q38 A;  4HNY B;  3K2K A;  4JLY A;  3KZW A;  4Z65 A;  5KTA A;  1Z4E A;  2OZG A;  4F6A A;  3S9M A;  5A2Q b;  3HOX I;  1M4L A;  2Z3N A;  4U5Y A;  3NDI A;  4ZGY B;  2JA7 I;  3CDX A;  3SXN A;  4CAX A;  2Y0S A;  1GYT A;  3CPW Z;  4E33 A;  4ZYQ A;  4NBF A;  4U9Z A;  3TX8 A;  1VQ4 1;  2WB1 A;  1AA6 A;  4B12 A;  3PFO A;  3DGV A;  2JBK A;  5EC4 A;  2P0W A;  3S16 I;  1JQG A;  2QYV A;  1YHQ 1;  4ZI6 A;  3CCS 1;  2JA5 I;  4NH1 C;  3PZJ A;  2K5T A;  2J9A A;  1Y1V S;  5C44 I;  2HB6 A;  3B35 A;  1RQF A;  4ZY1 A;  1I6H I;  2FE7 A;  3B2Y A;  3CCU 1;  3CCJ 1;  4MON A;  1VGY A;  4IK2 A;  1XJO A;  4M85 A;  1K73 1;  1B6B A;  1M44 A;  3CXQ A;  4MHY A;  5G22 A;  1SQH A;  5D1P A;  1VQ9 Z;  2FSR A;  1WWZ A;  2FS5 A;  4CPA A;  1PCA A;  3FVL A;  3LWU A;  3IIB A;  3KR5 A;  3B7I A;  2PVW A;  3KR4 A;  2J8M A;  3R9G A;  4R9M A;  1Z03 A;  3B3W A;  2PJ7 A;  2ZEM A;  4MY3 A;  2Q0Y A;  2KPI A;  1XMT A;  4F8Z A;  4JZ0 A;  2REF A;  1QXF A;  1TWA I;  1Z5R A;  1YUA A;  3JAM f;  3J80 f;  2E9H A;  1VIX A;  2PJ9 A;  4A3L I;  1HDQ A;  5AG7 A;  3QNV A;  2YND A;  3GTL I;  1NSA A;  1Q2D A;  1Y1V I;  4NBB A;  3K7A I;  2GAN A;  3VMH A;  4P4B A;  4NBE A;  4II9 A;  3G71 Z;  2EWB A;  2YNC A;  4LQG A;  4OC0 A;  4BBH A;  4NEX A;  3FYN A;  4A37 A;  2VUM I;  1TF8 A;  4X3R A;  2OOT A;  3RYO A;  4HNW B;  2ATR A;  2HC9 A;  5DWM A;  2PJA A;  4ONU A;  2QIR A;  5EMI A;  1TF9 A;  3GB0 A;  3LAC A;  3R95 A;  2EGT A;  1Q86 2;  4XPK A;  4F0X A;  4MBU A;  2F4O A;  4OP4 A;  4MXU A;  5AGE A;  2Z10 A;  3VWD A;  1MJB A;  4B14 A;  2JEW A;  4A32 A;  2IJZ A;  4KUA A;  2OU2 A;  1N8R 1;  2V8I A;  5C4J I;  1TKF A;  3CD6 1;  1YLO A;  1AMP A;  3JUW A;  1YJW 1;  1P0H A;  3MGD A;  5G20 A;  2ZW6 A;  3B8G A;  3IX0 A;  4UA3 A;  1Z02 A;  5G1Z A;  3IF8 A;  2C1C A;  3BG0 B;  4CS0 B;  4AVA A;  4KOV A;  2HU9 A;  4A3I I;  3FED A;  2PSW A;  1S72 Z;  1L1O C;  1IIC A;  1X10 A;  3VAR A;  1VQ5 Z;  3JRU A;  5A27 A;  4AVB A;  2NAP A;  1VQ6 Z;  2CTB A;  4CGM A;  2RT9 A;  2AFS A;  2JIM A;  3FF3 A;  4NGP A;  4XPD C;  4UWJ A;  1JWQ A;  2R7Z I;  4KOY A;  2PR8 A;  3TDH B;  3S9N A;  1S7L A;  4AVC A;  2F5I A;  4KOR A;  2QA4 1;  3LMS A;  4E8O A;  1LQL A;  3GUX A;  1LAP A;  5IP9 I;  2GLF A;  4DJL A;  4OIW A;  5F46 A;  4AXV A;  3S1Q I;  1YIJ Z;  4EWC A;  2OTL 1;  3FKI I;  5D1O A;  1XE4 A;  5DS0 A;  2NVQ I;  2FCK A;  3IWE A;  4JXQ A;  3CCM 1;  1DTD A;  2REE A;  2V3V A;  1Z2L A;  4R8F A;  5LYI A;  4UIA A;  2DPT A;  4QUS A;  2ZEF A;  5K8O A;  1VQO 1;  1TWC I;  3FQQ A;  3BHX A;  4BXX I;  1I21 A;  4RVG A;  3VWE A;  2FIW A;  2QEC A;  3FJU A;  1ARL A;  3RZA A;  3IR7 A;  4LX9 A;  2P28 A;  2VF1 A;  4HGZ A;  5JPH A;  5JQ4 A;  3VMI A;  2J8N A;  1KRL A;  2ZW5 A;  2LEX A;  1IY7 A;  2IZ3 A;  3EXN A;  3IGR A;  4MFL A;  4KSF A;  4CAW A;  2JLM A;  4UEF A;  4CGO A;  2PVV A;  5H86 A;  2CNS A;  3J81 f;  4OAD A;  4A3M I;  1M1D A;  2NVT I;  1KC8 2;  4A3G I;  4FBE A;  1VQP 1;  5JM6 A;  5CNP A;  5F49 A;  4A38 A;  2PK7 A;  5THW A;  1Q16 A;  5IV0 A;  1YIT 1;  3IEH A;  1YLE A;  1S7K A;  2R6M A;  3CC4 1;  2E2I I;  2WPW A;  4C68 A;  2PMZ A;  1IYK A;  5E96 A;  3D4U A;  1ON0 A;  1M4D A;  1YK3 A;  1YME A;  1YI2 1;  4JWP A;  1TXR A;  4NOZ A;  1K8A 2;  3TC8 A;  1QQ9 A;  4BY7 I;  2JIO A;  1QST A;  5IP7 I;  5IX3 A;  3BLN A;  2RBL A;  3PB4 X;  4RI1 A;  2ZEP A;  2ZAE B;  5F48 A;  4UCM A;  1TWF I;  4YFJ A;  3HOU I;  4CGP A;  1DL6 A;  1GHE A;  3D9X A;  5T6B A;  2DE6 A;  3S14 I;  1CX8 A;  4UCP A;  4AG9 A;  1IU8 A;  4F0Y A;  4AYB A;  2V8K A;  2WYR A;  3CCL 1;  2Z3P A;  4FAI A;  4X5K A;  4NXY A;  3F8K A;  2QLV B;  3S6F A;  3SI0 A;  2PJ6 A;  3SHP A;  3BI1 A;  2DPS A;  3CC7 Z;  4CAE A;  4NGQ A;  1XIX A;  2R7H A;  2JA8 I;  4NBA A;  1RTQ A;  4UIB A;  7CPA A;  4HKF A;  3IU1 A;  1K9M 2;  1KZF A;  5KTD A;  1HDU A;  3DDD A;  3D7F A;  4FD5 A;  1VQ4 Z;  3B3C A;  2JMO A;  2AFZ A;  1KD1 1;  2HV2 A;  3SI2 A;  2CIJ A;  3QB8 A;  3SXO A;  2QR1 B;  2GE3 A;  3KAS A;  1ZB8 A;  1YHQ Z;  3PP9 A;  4KVX A;  4MCP A;  2GU2 A;  4A94 A;  2P6G A;  4UFW A;  4CGN A;  5JH9 A;  4LQ6 A;  1CBX A;  4KSI A;  4FUU A;  1QSR A;  1S7N A;  2GFQ A;  3KQX A;  4E2Z A;  4IHM A;  4F9U A;  3CCU Z;  3CCV 1;  3RNZ A;  1KWM A;  3CCJ Z;  2JBJ A;  3LOD A;  2AFU A;  4KOU A;  2PM9 A;  3TCV A;  2QEX 1;  4MI4 A;  3PB8 X;  4A3D I;  5LYF A;  3I55 1;  3PB7 X;  3G4S 1;  4RUH A;  3CME Z;  3FX6 A;  3ZZI A;  1PYT B;  1M1K 2;  4U9Y A;  4YRH A;  4P4F A;  3VTN A;  3D2P A;  1YW6 A;  2C6P A;  2Z3K A;  1XOV A;  5KTC A;  2E7Z A;  1P4N A;  3W6X A;  2NSM A;  1Q81 1;  4NFR A;  5BWA B;  5LYD A;  1YUK A;  1AYE A;  4KOT A;  2OZK A;  1RO4 A;  3CQZ I;  3TE5 B;  4YU9 A;  5AG4 A;  5HMN A;  4R3L A;  4P4D A;  4QB9 A;  1QYP A;  1OBR A;  2YAD A;  1ZLH A;  1M1K 1;  2V45 A;  3HKZ A;  5LL6 f;  1K73 2;  4CYP A;  1S7F A;  1NSL A;  3PEI A;  3I4M I;  3OW2 Y;  1VQK Z;  1QSN A;  2AYD A;  2Q51 A;  3NDJ A;  1H8L A;  3JTK A;  3KHZ A;  1BO4 A;  5G21 A;  2O53 A;  3W91 A;  1YJ9 1;  4R6T A;  3C26 A;  2PE3 A;  2PRB A;  2NVY I;  1XMB A;  4A33 A;  3RAM A;  1WII A;  1BPN A;  2PJB A;  3I56 Z;  2VPX A;  1I12 A;  3S9L A;  3T90 A;  3D7H A;  3T9Y A;  4BY1 I;  4UEZ A;  4RVF A;  3CCE 1;  1M4I A;  5CM2 M;  1DE4 C;  1CG2 A;  1ZLI A;  2EK8 A;  4MY0 A;  3BXM A;  3SJE A;  3CD6 Z;  3D66 A;  2BO9 A;  4R7M A;  1RLY A;  2GIV A;  2AFM A;  1BOB A;  4CRZ B;  2GRE A;  3GYA A;  2DXQ A;  1Q7L A;  2FIA A;  3FMC A;  4B5O A;  5F09 A;  2VPW A;  3PO2 I;  3Q87 A;  3CC2 1;  4OC2 A;  3EC4 A;  2B5G A;  1X0T A;  3D2L A;  1ELM P;  4XPD B;  3GLJ A;  5T67 A;  1XBU A;  2PJ2 A;  2R1I A;  3E0K A;  1VQM Z;  1MJA A;  3SJX A;  4PV6 A;  2PR1 A;  2XEG A;  4S1T A;  1YQE A;  3R9E A;  3PGP A;  1XFO A;  5A28 A;  1S60 A;  1S3Z A;  5T64 A;  1N8R 2;  5J8C A;  2A4N A;  4MCR A;  4Y7N I;  3KKW A;  3A9L A;  5C88 A;  3KL9 A;  2BCO A;  8CPA A;  3S2D I;  4P45 A;  2V8V A;  3VB9 A;  3H3V J;  3CCQ 1;  4FWU A;  5C82 A;  3T4N B;  1LFW A;  4CYO A;  2VPY A;  3ISX A;  4OAE A;  1VQL Z;  4LUA A;  3R9F A;  3TTH A;  3NH4 A;  3ISZ A;  4L8A A;  2ODF A;  3CCR 1;  4R3K A;  2JIP A;  4A93 I;  3QAH A;  2JDD A;  1I50 I;  5FVJ A;  2OTL Z;  3RZD I;  4KVO E;  4G1P A;  4P44 A;  1UWY A;  4PXB A;  4E32 A;  4UCN A;  2XEJ A;  1K83 I;  2ZOF A;  1VLA A;  3D8P A;  3H5Z A;  1WW9 A;  2QRD B;  1VQ9 1;  3R96 A;  3G6E 1;  3S6K A;  1LOK A;  2Q44 A;  2AJ6 A;  2P6E A;  1VHO A;  2QRE B;  4MD9 A;  1WJ2 A;  1VQN Z;  2V77 A;  3GIU A;  1F2P A;  4IF5 A;  2VZY A;  2OH1 A;  3TO9 A;  3MZL B;  3I07 A;  4DQY B;  4KZT A;  4UWI A;  3CMA Z;  1UFH A;  5IT9 b;  4NB9 A;  3M3Y I;  3OWC A;  5D29 A;  1Z01 A;  4B5P B;  1J4J A;  2EBJ A;  1VQP Z;  3EO4 A;  1YVK A;  1KUX A;  1ZH1 A;  4NGS A;  1R43 A;  1Y7R A;  1Y0R A;  2JDC A;  4MHN A;  5LRG A;  4X8I A;  3OW2 Z;  4OC4 A;  1W2B Y;  5GCN A;  3IWW A;  4JXR A;  3G71 1;  3V8I A;  2VI7 A;  4A3E I;  2IQ6 A;  3D3S A;  1ZG9 A;  3TOB A;  3FH4 A;  4P4I A;  4R76 A;  1BPM A;  4QTU A;  3IWG A; 
#chains in the Genus database with same CATH homology
 1RNI A;  1TWF I;  3BG1 B;  2V8J A;  3FEE A;  3MZK B;  3RBU A;  2F7V A;  3K2K A;  3KZW A;  3CXC Y;  2G9D A;  4Z65 A;  3HOU I;  1TKH A;  3VAT A;  4PXE A;  3SJF A;  5LRK A;  2QA4 Z;  3KGQ A;  3S9M A;  1VQK 1;  1DL6 A;  5A2Q b;  3FQM A;  4YWY A;  5K8M A;  2QJ8 A;  3HOX I;  1M4L A;  2DEA A;  1JJ2 Z;  3D9X A;  3NDI A;  5T6B A;  2DE6 A;  2JA7 I;  3S14 I;  1CX8 A;  3CDX A;  5IB9 A;  2O4H A;  4DGL A;  1BAV A;  1FT7 A;  3GTQ I;  2Y0S A;  1GYT A;  1TWH I;  3CPW Z;  4AYB A;  2V8K A;  4UEE A;  2WYR A;  3CCL 1;  4NGM A;  3HOV I;  3F3F C;  4E33 A;  4ZYQ A;  2LFU A;  4NBF A;  3HUV A;  1M90 1;  2IZ4 A;  4FAI A;  3VMG A;  3PB6 X;  3TX8 A;  3BI0 A;  4IAV A;  4MCQ A;  4A3J I;  2RIQ A;  5A2Q f;  2QLV B;  2WB1 A;  1VQ4 1;  3SI0 A;  2PJ6 A;  2PJ4 A;  3HOY I;  3BI1 A;  3PFO A;  3DGV A;  2JBK A;  2RPR A;  3S16 I;  1JQG A;  3CC7 Z;  3CCM Z;  2QYV A;  4NGQ A;  3KQZ A;  3I56 1;  2YU9 I;  2EK9 A;  2JA8 I;  1YHQ 1;  2BJO A;  2XEF A;  2PJ3 A;  2ANP A;  3CCS 1;  4NBA A;  1RTQ A;  4ZI6 A;  2JA5 I;  2NVX I;  2R92 I;  4UIB A;  4NH1 C;  1XRY A;  5CPA A;  3J81 b;  7CPA A;  4W9Y A;  2K3R A;  1K9M 2;  4NGT A;  4P4E A;  1S72 1;  1HDU A;  1VQO Z;  2J9A A;  3D7F A;  3IFE A;  1Y1V S;  5C44 I;  3PBE A;  2HB6 A;  3B35 A;  6CPA A;  1VQ4 Z;  4BBR I;  3B3C A;  2JMO A;  3ESW A;  1RQF A;  2AFZ A;  3U50 C;  1KD1 1;  1I6H I;  3SI2 A;  4ZY1 A;  3S15 I;  2CIJ A;  3B2Y A;  3CCU 1;  2QR1 B;  3CCJ 1;  1QVG Y;  2RFH A;  3S17 I;  4MON A;  2RHB A;  3PO3 S;  1VGY A;  4IK2 A;  1XJO A;  4PQA A;  3KAS A;  5J1Q A;  1ZB8 A;  1YHQ Z;  1YJN Z;  4MMO A;  2DE5 A;  1K73 1;  3L2N A;  4MHY A;  5D1P A;  2GU2 A;  1VQ9 Z;  4MCP A;  4HH4 A;  1NJI 2;  4ONW A;  4A94 A;  1LAM A;  4CPA A;  2VL1 A;  3DLJ A;  4ZX8 A;  3VH9 A;  3SJG A;  4MRI A;  1PCA A;  5JH9 A;  3GKQ A;  1Q7Y 1;  4ZY0 A;  1Q86 1;  1CBX A;  4E2Y A;  2PJ8 A;  3FVL A;  4KSI A;  4NBG A;  4FUU A;  2BOA A;  3LWU A;  3GTK I;  3IIB A;  3KR5 A;  3B7I A;  3F3P C;  2PVW A;  3KQX A;  4E2Z A;  3KR4 A;  4IHM A;  3CCU Z;  4OME A;  4F9U A;  3CCV 1;  1Z03 A;  4BBS I;  1KWM A;  3B3W A;  1X3W A;  3CCJ Z;  2JBJ A;  4OID A;  2ZED A;  2AFU A;  1VQM 1;  2PM9 A;  3HOW I;  2QEX 1;  3B3T A;  2PJ7 A;  3PB8 X;  4A3D I;  2ZEM A;  5LYF A;  3D68 A;  2C6G A;  3I55 1;  4A39 A;  2PJC A;  1QF8 A;  2AFX A;  2PJ0 A;  3PB7 X;  2OTJ 1;  3G4S 1;  2E2J I;  2KPI A;  4RUH A;  3CME Z;  2ZOG A;  3FX6 A;  1Y0Y A;  4F8Z A;  1PYT B;  4JZ0 A;  2E2H I;  2OR4 A;  1M1K 2;  3RZO I;  3GTM S;  4P4F A;  1TWA I;  3VTN A;  1YIT Z;  1YIJ 1;  1Z5R A;  1YW6 A;  1EE3 P;  5FLX b;  4F9V A;  2C6P A;  3PRT A;  1NJI 1;  1YUA A;  4NBD A;  4NBC A;  3JAM f;  3CC4 Z;  4NB8 A;  4ZX9 A;  3J80 f;  4DYO A;  2E9H A;  1VIX A;  1FNO A;  2QEX Z;  2PJ9 A;  4A3L I;  1HDQ A;  3GTP I;  2ZEH A;  3QNV A;  4NJQ A;  2HF1 A;  2QKD A;  1YI2 Z;  2NSM A;  1Q81 1;  3I55 Z;  3GTL I;  4K3N A;  4NFR A;  4P6Y A;  5HVH A;  1NSA A;  2OTJ Z;  5LYD A;  1YUK A;  1AYE A;  4CL1 A;  2OZK A;  1RO4 A;  5FLX f;  1Y1V I;  1ML8 A;  1VQL 1;  4NBB A;  4A3C I;  1F57 A;  3K7A I;  4O23 A;  3VMH A;  4P4B A;  4NBE A;  2PIY A;  1CPX A;  3CQZ I;  3TE5 B;  3G71 Z;  2EWB A;  4YU9 A;  1KD1 2;  4LQG A;  3PO3 I;  4OC0 A;  1CP7 A;  4P4D A;  4A37 A;  2VUM I;  1QYP A;  4E30 A;  1OBR A;  1TF8 A;  2YAD A;  4X3R A;  5LYL A;  1ZLH A;  2OOT A;  2WAQ A;  1M1K 1;  3EER A;  4OKO A;  3HKZ A;  3GTJ I;  5LL6 f;  2HC9 A;  2C6C A;  4ZY2 A;  1K73 2;  1LCP A;  2PJA A;  3CPA A;  3B3S A;  4GM5 A;  3PEI A;  2W03 A;  3I4M I;  1TF9 A;  3OW2 Y;  1QMU A;  2ZEN A;  3WAB A;  1VQK Z;  3GB0 A;  1Q7Y 2;  2EGT A;  1Q86 2;  4MCS A;  2LIY A;  2F4O A;  2Q51 A;  3NDJ A;  1H8L A;  4JYW A;  1F2O A;  4OP4 A;  4MXU A;  3KHZ A;  4MH4 A;  4A3B I;  1NUI A;  4A3K I;  2O53 A;  2QVP A;  3CCL Z;  2JEW A;  2VUG A;  2PCU A;  2IJZ A;  2JA6 I;  3PB9 X;  1KQS Z;  1YJ9 1;  1VHE A;  4R6T A;  2PE3 A;  4MD7 A;  1N8R 1;  2V8I A;  3D6W A;  1NP6 A;  5C4J I;  1VQ5 1;  3D67 A;  1TKF A;  2NVY I;  3D7G A;  3V7Z A;  1XMB A;  1VQN 1;  3CD6 1;  1YLO A;  3RAM A;  1AMP A;  1WII A;  1YJW 1;  1ARM A;  1BPN A;  2PJB A;  1R3N A;  2JS4 A;  3GTM I;  1VQ6 1;  1JJ2 Y;  1USP B;  2OOX B;  3HLP A;  3IX0 A;  4TNU A;  3I56 Z;  1Z02 A;  1QVF Z;  3IF8 A;  2J6A A;  1SFO I;  3CPW Y;  3S9L A;  3CCS Z;  2C1C A;  3BG0 B;  4X2T A;  3D7H A;  4BY1 I;  2JR6 A;  4UEZ A;  2HU9 A;  3IFU A;  4E2W A;  4A3I I;  4MHZ A;  4RVF A;  4E31 A;  3CCE 1;  3FED A;  1W2B Z;  5CM2 M;  2ZEG A;  3NA6 A;  1DE4 C;  1S72 Z;  3MN8 A;  5C3E I;  1L1O C;  1CG2 A;  4EWT A;  3CMA 1;  1ZLI A;  3VAR A;  1VQ5 Z;  2EK8 A;  3JRU A;  2AFO A;  3BXM A;  1Q81 2;  1VQ7 1;  3SJE A;  3CD6 Z;  3D66 A;  2BO9 A;  4R7M A;  3H0G I;  1RLY A;  3T8W A;  3GCF A;  2AFM A;  1R9T I;  1VQ6 Z;  2CTB A;  3I4N I;  5AN9 F;  2GRE A;  2Q43 A;  3EED A;  1CP6 A;  3CXC Z;  4P4J A;  3KIF A;  1Q7L A;  3FMC A;  2R93 I;  2RT9 A;  3JAM b;  4MD8 A;  2AFS A;  4OC1 A;  5F09 A;  3B3V A;  3FF3 A;  3P5J B;  3J80 b;  3PO2 I;  4NGP A;  2GTH A;  3N5F A;  3CCE Z;  1Y1W I;  3Q87 A;  1S7M A;  3CC2 1;  1TWG I;  4OC2 A;  4EME A;  4DK1 A;  3QWU A;  1X0T A;  2GLJ A;  1ELM P;  4NGN A;  4PXD A;  1VQ7 Z;  2R7Z I;  3GLJ A;  3CCV Z;  2AKL A;  5T67 A;  3TDH B;  1XBU A;  2PJ2 A;  2V8D A;  1VQM Z;  3SJX A;  2M6N A;  3S9N A;  2XEG A;  2G2K A;  2IMO A;  3MRU A;  4S1T A;  2PRQ A;  5D1O B;  2QA4 1;  3H8F A;  1RO0 A;  3LMS A;  3PFE A;  5FLM I;  3IJ3 A;  3G4S Z;  5IT9 f;  1KC8 1;  3CC2 Z;  1LQL A;  2DE7 A;  1XFO A;  3GTG I;  4TWE A;  1Q82 1;  5K8P A;  3NFZ A;  2XEI A;  3GUX A;  1LAP A;  3KI9 A;  5IP9 I;  2AFW A;  2GLF A;  2RB7 A;  4OC3 A;  4DJL A;  5T64 A;  4OIW A;  4PPZ A;  4AXV A;  2H85 A;  3S1Q I;  1N8R 2;  1YIJ Z;  4MCR A;  4Y7N I;  5JGF A;  3CT9 A;  4EWC A;  3H8E A;  3KL9 A;  2BCO A;  2OTL 1;  3FKI I;  2JUB A;  3IC1 A;  8CPA A;  3S2D I;  5D1O A;  4P45 A;  2PJ1 A;  2V8V A;  3VB9 A;  3H3V J;  5DS0 A;  3CCQ 1;  2NVQ I;  2POK A;  1TFI A;  4FWU A;  4NJR A;  3T4N B;  3CC7 1;  3CCM 1;  1QVG Z;  1LFW A;  1DTD A;  3LUS A;  1BLL E;  3K9T A;  1ZG8 A;  2F8H A;  4HGY A;  2ZEO A;  3ISX A;  1Z2L A;  1VQL Z;  4R8F A;  1PFT A;  5C4X I;  4XX2 A;  3S1M I;  4MHP A;  4RS4 A;  5LYI A;  3NH4 A;  2ZEE A;  3ISZ A;  2NYQ A;  3CCR 1;  1K8A 1;  4A93 I;  3PBB A;  4UIA A;  5HXD A;  2ZEF A;  1I50 I;  1CPS A;  4WWV A;  5K8O A;  1VQO 1;  2OTL Z;  3RZD I;  1TWC I;  4EFD A;  3FQQ A;  2JNY A;  2P3Y A;  4E2X A;  4Q7A A;  3BHX A;  3CCQ Z;  4G1P A;  1HEE A;  2FVG A;  1X3Z A;  3GTO I;  3CPX A;  4P44 A;  4UF4 A;  3S1N I;  3MON A;  4RV9 A;  1YSJ A;  4BXX I;  1UWY A;  2CF4 A;  4PXB A;  4E32 A;  2XEJ A;  1K83 I;  4RVG A;  2PJ5 A;  2ZOF A;  1VLA A;  2B63 I;  4X6A I;  1YJN 1;  3FJU A;  3IO1 A;  3CCR Z;  1WW9 A;  2QRD B;  1ARL A;  1VQ9 1;  3RZA A;  4QTT A;  4OC5 A;  3WC7 A;  3G6E 1;  4NBH A;  1LOK A;  2CTC A;  2P28 A;  2VF1 A;  4HGZ A;  5K8N A;  3KIH A;  3VMI A;  4BD9 A;  1KRL A;  5ELY A;  2QRC B;  1IY7 A;  3H8G A;  2IZ3 A;  1YJ9 Z;  1VHO A;  3I1U A;  2QRE B;  2GTI A;  4MD9 A;  1RO2 A;  1LAN A;  2I3C A;  4UEF A;  1VQN Z;  2PVV A;  3J81 f;  4A3M I;  2V77 A;  2Q4Z A;  2PIZ A;  1USP A;  1YJW Z;  2NVT I;  2W04 A;  2ZEL A;  5LRJ A;  1KC8 2;  2OOY B;  4A3G I;  1VQ8 1;  1F2P A;  4FBE A;  1VQP 1;  3S2H I;  1ZB9 A;  1Q82 2;  2ABZ A;  1I3Q I;  1P9N A;  5JM6 A;  1TKJ A;  2KI7 B;  2V8H A;  4RVH A;  3HOZ I;  3M4O I;  4B6Z A;  5HVG A;  1ELL P;  3G6E Z;  4P10 A;  4A38 A;  3CME 1;  1ZG7 A;  2PK7 A;  5THW A;  1JWH C;  3WC5 A;  3MZL B;  3I07 A;  3WC6 A;  1KQS Y;  4DQY B;  1YIT 1;  3IEH A;  3FEC A;  3CMA Z;  3S1R I;  1Z8L A;  2WZN A;  4NGR A;  2R6M A;  5IT9 b;  1K9M 1;  4NB9 A;  3CC4 1;  2E2I I;  3J7A 4;  3M3Y I;  4Y52 I;  3SI1 A;  5D29 A;  2K5R A;  2PMZ A;  1Z01 A;  3D4U A;  1VQ8 Z;  5D8N A;  5HVF A;  1VQP Z;  3WT4 A;  4RVD A;  3NH8 A;  1YME A;  1YI2 1;  3NH5 A;  4PXC A;  1QVF Y;  4WJB A;  1TXR A;  4NGS A;  1ZH1 A;  4NOZ A;  1WCM I;  1R43 A;  1K8A 2;  3V38 A;  1Y0R A;  2V8G A;  1IGB A;  4MHN A;  5LRG A;  3TC8 A;  2M48 A;  4X8I A;  3OW2 Z;  1M90 2;  1QQ9 A;  3KHX A;  4OC4 A;  1N2F A;  1W2B Y;  2F4M A;  4BY7 I;  3IWW A;  3G71 1;  4A3E I;  5IP7 I;  2IQ6 A;  4H2K A;  1ZG9 A;  3FH4 A;  5CBM A;  4A3F I;  3D7D A;  4P4I A;  4R76 A;  1Y7E A;  2RBL A;  3PB4 X;  5I4M A;  1BPM A;  1YW4 A;  4QTU A;  2ZEP A;  2ZAE B;  4DUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...