2O53A

Crystal structure of apo-aspartoacylase from human brain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o53A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o53A01
4R6TA 4MCPA 3WC5A 2CTBA 4NGPA 2AFXA 2EK8A 3CT9A 1UWYA 5HXDA 5LYFA 3D66A 4MMOA 1Y0RA 1XFOA 2JEWA 5HVGA 3MN8A 3KHXA 2ABZA 2ZEHA 4G1PA 3KQZA 3PBBA 5HVHA 4YU9A 2XEGA 2O4HA 2PJCA 3L2NA 3FMCA 1XMBA 4O23A 1ZLHA 1CPSA 4EFDA 1Z2LA 2V8DA 1ZG8A 2GLJA 1ZG9A 5JGFA 4FBEA 1XBUA 2AFMA 1HDUA 1TF9A 2CIJA 5I4MA 2PCUA 5JM6A 5LYIA 2C6GA 4ZYQA 1EE3P 1FNOA 4MCQA 4EMEA 4PXEA 4IHMA 3K9TA 3DLJA 3RBUA 2V8VA 3K2KA 2ZOGA 3BXMA 4ZY1A 3SJGA 2PRQA 4JZ0A 1TKJA 3I1UA 1ELMP 4IAVA 2PJ7A 3H8FA 4FUUA 5DS0A 5F09A 1DE4C 3SJEA 1ZG7A 3D4UA 4BD9A 2F7VA 1TXRA 1BPNA 1M4LA 4A94A 1AYEA 1KWMA 4B6ZA 8CPAA 3GUXA 1Z5RA 5LRGA 3BHXA 3SJXA 4CPAA 4PQAA 4RUHA 5IB9A 1LANA 4OIDA 3B35A 4H2KA 3CPAA 5J1QA 1ELLP 3CDXA 4OP4A 1XRYA 4PXCA 3BI1A 2DEAA 2PVWA 3PFEA 4TWEA 4W9YA 4P4JA 4OIWA 4NJQA 3V38A 4P4DA 3CPXA 4R76A 3T8WA 4NGTA 5LYDA 4NGSA 1YMEA 3IFEA 1LAMA 3SI1A 4MXUA 2WZNA 2JBKA 1BLLE 2CTCA 1BPMA 4MRIA 4UEFA 5K8NA 3KI9A 2XEJA 4UIBA 3RZAA 5K8PA 2AFZA 4A39A 3B2YA 2IMOA 4NJRA 3PB4X 3MRUA 3FH4A 3GLJA 2PJ1A 2C6CA 4P10A 4WWVA 3VH9A 2XEFA 1CP7A 2ZEEA 3N5FA 3D68A 2OOTA 5D29A 2QYVA 2ZEFA 4IK2A 3IJ3A 2V8HA 2ZEGA 4OC2A 1TF8A 4EWTA 4MCRA 3V7ZA 4GM5A 2PJBA 4NGRA 1TKFA 2POKA 3PEIA 5CBMA 4Q7AA 3KL9A 2PIZA 3FEEA 2RB7A 3D67A 1VHEA 4ZI6A 4P4IA 2PJ0A 1AMPA 1Y0YA 2CF4A 6CPAA 1QMUA 4X8IA 3D7HA 2ZOFA 2EK9A 4ZX8A 3IEHA 3WC7A 1Y7EA 3FECA 4OC5A 1FT7A 4NGMA 1YW6A 4MHNA 2WYRA 2C1CA 1PCAA 3B3CA 5D8NA 2XEIA 5LRKA 3S9NA 4MHZA 3WC6A 2HB6A 1HDQA 3PBEA 3WT4A 4NFRA 2PJ4A 4UEZA 1LOKA 3B3VA 3VARA 5ELYA 2ANPA 1CPXA 2HC9A 3IIBA 1F57A 3WABA 2AFWA 1ARLA 5LYLA 2OR4A 2Q43A 4P4EA 4ZY0A 3H8GA 3NH8A 3KHZA 3SJFA 4F8ZA 3IC1A 3SI0A 4KSIA 4ZX9A 3B3SA 4TNUA 2PIYA 2J9AA 3HLPA 3NA6A 3KZWA 4MCSA 2BCOA 3PB8X 5JH9A 1YSJA 1CP6A 4UEEA 5K8MA 1F2OA 3KR5A 2ZELA 4A38A 1XJOA 1VIXA 4P6YA 3S9LA 3FX6A 1VHOA 5THWA 2VL1A 4P45A 3IO1A 1YLOA 2PJ8A 4X2TA 3NFZA 4A37A 2IJZA 4OC4A 4JYWA 1ZLIA 5CPAA 3FVLA 4NGQA 3RAMA 4AXVA 4DUKA 3SI2A 2V77A 4ZY2A 2PJ5A 2BOAA 5HVFA 2GU2A 3PRTA 2AFSA 3FJUA 2AFOA 1CBXA 3H8EA 2Q51A 2JBJA 1R3NA 4OKOA 4UIAA 4YWYA 3LWUA 2C6PA 3KQXA 3ISXA 2RFHA 3KASA 2PJ6A 1H8LA 3B3TA 2I3CA 2F8HA 1BAVA 1F2PA 1GYTA 4OC3A 2PJAA 2QJ8A 4F9VA 1R43A 2G9DA 3PB6X 1VGYA 1TKHA 4OC0A 2GLFA 2QVPA 4NGNA 4MHPA 2PJ9A 3BI0A 4FAIA 2O53A 3JRUA 5K8OA 7CPAA 3VATA 4ONWA 4OC1A 3S9MA 4X3RA 4WJBA 3PB7X 2PJ3A 4DYOA 1Q7LA 4PXBA 3NH4A 2IQ6A 4MHYA 1DTDA 3FF3A 2PE3A 1YW4A 2FVGA 3D7DA 4K3NA 3KGQA 4F9UA 2NSMA 2PVVA 1QQ9A 3GB0A 1JQGA 3FEDA 3D7FA 2ZEMA 4R8FA 4P44A 4PXDA 3LMSA 1LFWA 3PFOA 3B3WA 2GREA 1CX8A 5LRJA 1NSAA 1Z8LA 2BO9A 2V8GA 3IWWA 3DGVA 3PB9X 1LCPA 4PPZA 4FWUA 3TC8A 1RTQA 2ZEDA 1IY7A 4LQGA 4P4FA 4P4BA 2PJ2A 2ZENA 1HEEA 1IGBA 3HUVA 2EWBA 3KR4A 3D7GA 1PYTB 3TX8A 4Z65A 1LAPA 4OMEA 2Q4ZA 3QNVA 1CG2A 2AFUA 2ZEOA 4UF4A 1OBRA 2ZEPA 4DJLA 2NYQA 3NH5A 3ISZA 1ARMA 4R7MA 3B7IA
chains in the Genus database with same CATH superfamily
4MCPA 3WC5A 3JAMb 4E32A 1VQPZ 2EK8A 2IV2X 4MJ8A 4UCPA 3H3VJ 3CMA1 1XFOA 1I3QI 3KHXA 2ABZA 1U6MA 2CXAA 1RO5A 2Q7BA 3KQZA 4L89A 3PBBA 5HVHA 1OZPA 2PJCA 1PUAA 4LX9A 4MD8A 1XMBA 3KKWA 4UWIA 3GTLI 2V8DA 3CCJ1 4A32A 4FBEA 2DE6A 3GCFA 4E2AA 4F0XA 4MY0A 2C6GA 1YVOA 4JWPA 3IX0A 3DLJA 4Y7NI 4UA3A 2ZOGA 4ZY1A 3J7A4 2V45A 3CXSA 2R6MA 2VZYA 3JVNA 4OAEA 1YHQ1 1IU8A 1IYKA 1ZG7A 3D4UA 2F7VA 1TXRA 2R7HA 1KWMA 8CPAA 2P6FA 5AG6A 4CPAA 4KUAA 4PQAA 5IB9A 4NSQA 3RZDI 4OIDA 2VI7A 5KTCA 1Q811 1Z8WA 5J1QA 1ELLP 3CDXA 1I1DA 4PXCA 3CCQZ 2JUBA 4TWEA 3U50C 3CZXA 4E30A 4W9YA 1I6HI 3R9GA 3GTJI 2Q7SA 1W2BY 3CPWY 4P4DA 3CPXA 3KIFA 2JBKA 4A3II 4NBHA 3JUWA 4UEFA 5K8NA 3EXNA 2XEJA 4B13A 3NE8A 2ZW6A 3QAHA 4ORFA 1RXTA 2IMOA 2R7ZI 4A95A 4MFPA 2E2JI 3PB4X 3K7AI 3MRUA 3FH4A 3GLJA 4NCZA 2C6CA 3GTQI 2GFQA 4A3FI 2G3AA 2XEFA 2ZEEA 1VQ7Z 3D68A 2OOTA 4IK2A 2Z0ZA 5H84A 3TOBA 2HUZA 4OC2A 3CCU1 4F0YA 4EWTA 3R1KA 3V7ZA 1M4GA 2Q0YA 1WK4A 1KC81 1P0HA 4Q7AA 3D3SA 2PIZA 1MK4A 4A33A 4B10A 4NXYA 2PJ0A 4J3GA 3ZJ0A 1TWCI 2CF4A 2BL1A 4HH4A 4NBGA 4YGOA 1SQHA 4NGMA 3LODA 5C82A 2YNEA 2JR6A 4NBFA 2LEXA 1PCAA 3B3CA 5D8NA 2VUGA 2NVTI 2QRCB 1TWAI 1Z01A 2XEIA 4II9A 3PBEA 2IL4A 3VWDA 1YIJZ 4RN7A 1YJ91 2WSAA 2QREB 4C2ZA 3IIBA 1F57A 3F3FC 1Z8XA 4X6AI 2PM9A 3I07A 3IWEA 2OR4A 1VQ8Z 1Y9WA 2EGTA 2PK7A 4F8ZA 4KORA 3B3SA 5KTDA 2PIYA 4XNHC 2J9AA 4Q36A 3NA6A 3HKZA 4LQ6A 2PMZA 2BCOA 3PB8X 2OZKA 1Z8TA 2RBLA 3GTPI 3FYNA 1K9M1 2JA6I 4HKFA 4QB9A 5AG7A 2Z3KA 1VHOA 5THWA 3I9SA 2FCKA 1FY7A 2PJ8A 4A37A 4JYWA 1ZLIA 5CPAA 4NGQA 5BWAB 1AA6A 1KUYA 4JXRA 4ZY2A 2PJ5A 4BXXI 4E2YA 4PSWA 1YI21 3FJUA 1P9NA 1YVKA 1CBXA 2VPYA 4H6ZA 1YGHA 4U9ZA 4IF5A 2JBJA 1X0TA 4BBRI 4JD6A 1N8R2 3ISXA 4KS9A 4XPDC 3B3TA 1QSMA 4QBJA 3PP9A 4E8OA 3HOVI 1GYTA 4UBRA 1S7FA 2PJAA 3J81b 1Z02A 5CNPA 5D1OA 4M6GA 1NP6A 2FL4A 4A3KI 2PSWA 4BY7I 1M1K2 1VQ4Z 3JRUA 1S7LA 4OC1A 3S9MA 4UFVA 4B12A 3PB7X 1Q7LA 4PXBA 3G711 3GTMS 2QLVB 3CCMZ 3CCE1 1QXFA 2DE5A 3SXOA 1YW4A 2Q4VA 2VF1A 3HOUI 3RZOI 4PV6A 1QQ9A 5A2Qb 1K9M2 3FEDA 2DPSA 2ZEMA 3TE5B 3QAYA 4PXDA 3DR6A 1TIQA 1VLAA 1M4IA 3I3GA 1JWQA 5LRJA 3G71Z 3IWWA 1IICA 3TT2A 1LCPA 1YJNZ 3TC8A 1VQ41 2JA7I 4LQGA 2ZENA 3CC21 1HEEA 3CC4Z 4L8AA 3CD6Z 3D7GA 3EFAA 4NH1C 2I00A 3BLNA 1LAPA 4RVGA 1FDIA 3IF8A 3S16I 2GTHA 2AFUA 4A93I 1QSOA 3CXQA 2NYQA 2G3TA 3ISZA 4CAEA 4A3MI 3FRMA 1WWZA 3B7IA 4QTTA 2LFUA 4EWCA 4BBSI 3G4S1 1VQLZ 4NGPA 2AFXA 2YU9I 5FLXf 2W03A 3D66A 4MMOA 4A2ZA 5JQ4A 1XOVA 2JEWA 3DSBA 2BUEA 4CAXA 4DGLA 2ZEHA 2OU2A 2B5GB 2NVYI 3H5ZA 4YU9A 1PFTA 4O23A 2OOYB 1CPSA 4AVAA 2GLJA 1ZG9A 5JGFA 1JJ2Z 1XBUA 2Z3PA 2CIJA 2FT0A 2K5TA 2E9HA 1Q822 1QVGY 4ZYQA 1EE3P 4MCQA 4A3DI 3BJ7A 4KOWA 3RBUA 2ZXVA 2V8VA 5IT9f 4NBDA 3S6GA 3SJGA 2CY2A 3I1UA 3CD61 1VQ81 1DL6A 4H89A 1ZB9A 1K8A1 4FUUA 4XNHB 1M4LA 3H4QA 4B6ZA 1YJ9Z 1V0CA 5FVJA 4RUHA 1YIJ1 3S6KA 3RO0A 3CCVZ 4R3LA 3B35A 2FS5A 4H2KA 2V8IA 4UCMA 2JA8I 3HOWI 3PZJA 5AG4A 4P4JA 4OIWA 4NF1A 1FDOA 3V38A 2DE7A 1QVFY 4HNWB 4M3SA 4NGTA 2REFA 3R9FA 1VQN1 1YMEA 3IFEA 3SI1A 4MXUA 1X12A 1X3ZA 1VQKZ 5C88A 2OZUA 5IT9b 2CTCA 5J8FA 4BINA 5C3EI 2AFZA 1N2FA 4RVDA 1WCMI 3GIUA 1RO0A 4H6UA 3CCS1 4R3KA 4RV9A 2WB1A 4WWVA 2F4MA 3JTKA 2K3RA 1RNIA 4NBAA 4AB7A 5G20A 1WJ2A 2RC4A 1TF8A 3CPWZ 3G6EZ 1YI2Z 4AG7A 4CAWA 3FKII 2POKA 3PEIA 5CBMA 2V8KA 1UFHA 4M6IA 3KL9A 5DWMA 1TFIA 4M85A 2WAQA 3QWUA 2RB7A 1BO4A 4HNXB 4ZI6A 3TO9A 2JIQA 5A28A 1AMPA 3FXTA 6CPAA 3D7HA 3RNZA 4AYBA 2X7BA 3MZKB 1M4DA 3TO6A 1Z4EA 2PDOA 1YK3A 1WIIA 1YW6A 4KOTA 3R96A 5IV0A 4AVBA 5C4JI 3GTGI 2HB6A 2PJ4A 1KD11 4UEZA 3B3VA 3VARA 2CNSA 2ANPA 2RHBA 1CPXA 4CRZB 2HC9A 5F47A 4KLVA 1ARLA 5LYLA 4OLLA 4A3EI 3GTOI 3H8GA 3NH8A 3SJFA 3CCLZ 2R8VA 2NAPA 3SI0A 4KSIA 4S1TA 4TNUA 4AG9A 4RI1A 1VQMZ 2BEIA 3KZWA 4R9MA 3OW2Y 1CP6A 4QC6A 5FLXb 2ZELA 1MJAA 3CCJZ 4QUSA 3OW2Z 2BJOA 1VQ51 3R9EA 2R92I 2NVQI 4A3CI 2OH1A 2R1IA 4DUKA 4YRHA 5DWNA 3SI2A 2V77A 3NE7A 3CMAZ 5HVFA 4XPDB 2F4OA 2AFSA 4Y49C 4PK3A 2AFOA 3H8EA 3NDJA 2DPTA 3D9XA 2VUMI 1K83I 3S1MI 4E31A 4A3BI 5J8CA 4RVHA 1F2PA 4A3LI 1XMTA 3W91A 2YNCA 4B5OA 4F9VA 5IP7I 4MFJA 4DQYB 3I55Z 1VGYA 2EBJA 4OC0A 3TFYA 2QVPA 4NGNA 4MHPA 4FD5A 4C7HA 3T4NB 4FAIA 7CPAA 2DXQA 4ONWA 1VQOZ 4MFLA 4X3RA 4WJBA 4Y52I 2QMLA 1S721 1K731 2E2HI 1M1DA 2PE3A 1Z03A 3D7DA 4K3NA 2NSMA 1IOIA 4KOSA 3EC4A 1MJBA 3T90A 4X5KA 4KOXA 4ZBGA 4AVCA 4KZTA 2KCWA 2ZW5A 2VEZA 4OADA 5G21A 4HPSA 4CGOA 2BO9A 4FD4A 4JXQA 2VXKA 4FWUA 2B4DA 3T9YA 2OOXB 3P2FA 1IY7A 3VWEA 5HMNA 1Q7Y2 1IGBA 3KR4A 2Z3OA 2FXFA 5D1OB 3ZZIA 1PYTB 5HH1A 4DK1A 1A2ZA 4Z65A 3DNSA 3S14I 2ZAEB 1WZNA 1TWGI 3QNVA 2YGWA 1CG2A 2ZEOA 1OBRA 2ZEPA 5E96A 1Q2YA 1TWHI 3NH5A 2JIMA 4MD7A 4LUAA 3EERA 4RVFA 3D8PA 4R6TA 3PGPA 3G3SA 5HXDA 5LYFA 1S7NA 2JMOA 2ZW4A 5JPHA 1IIDA 1Y0RA 1VHSA 4CYQA 3SHPA 5HVGA 3MN8A 2QKDA 2D4PA 4F6AA 2M6NA 4G1PA 2Z10A 1WW9A 3L2NA 3FMCA 1QF8A 2QA4Z 1Z2LA 3P5JB 4U5YA 1ZG8A 5I4MA 1TF9A 4CGPA 5JM6A 5LYIA 2REEA 2IZ4A 4EMEA 4PXEA 3K9TA 4BMHA 4UCNA 2H85A 3BXMA 4C2XA 1B6BA 4E2ZA 2QRDB 4JZ0A 4MBUA 1Y1WI 1ELMP 1YQEA 4IAVA 2PJ7A 4RS2A 1KC82 5F09A 2VBQA 4BD9A 1BPNA 4A94A 1AYEA 3GTMI 3GUXA 1Z5RA 3BHXA 3SJXA 2B5GA 1LANA 3W6SA 2Q44A 1NMTA 3CPAA 4CGLA 4OP4A 2K5RA 3BI1A 2DEAA 2PVWA 4Q38A 2B4BA 1I12A 1NSLA 2G0BA 1Y9KA 4NBCA 4MFZA 3FIXA 2C27A 1CJWA 3CCRZ 4KSAA 4NGSA 1LAMA 4XPKA 2WZNA 2OTLZ 4NB9A 2NMTA 4MRIA 4B11A 1LRZA 2QIRA 2KI7B 3S2DI 1XF8A 2WUUA 4BBHA 5IB0A 5C44I 5CM2M 2PJ1A 3MZLB 2YADA 2J8RA 5AGEA 2HQYA 2IZ3A 1YJN1 5D29A 3TOAA 2ODFA 1L1OC 4NB8A 2B3VA 2NVXI 1Z9UA 3RYOA 4GM5A 2PJBA 1TKFA 2Z3LA 3HOXI 3FEEA 1YIT1 2WPXA 4E2WA 2HU9A 4CYPA 1QYPA 4MHDA 3CCV1 1Q821 2QEXZ 4B5PB 3CCEZ 4X8IA 2P6GA 2EK9A 1VQ61 4ZX8A 3IEHA 3WC7A 4CYOA 1Y7EA 3VMGA 3KIHA 4GS4A 4OC5A 4PK2A 4XPLA 1FT7A 1ZB8A 4CGNA 1K8A2 3LUSA 4M6HA 3I4NI 2Z3MA 2C1CA 4MI4A 1K732 3S9NA 3WC6A 2J6AA 1HDQA 4KVOE 3F8KA 1VQ9Z 1S7MA 2HV2A 1ZH1A 3WABA 1NJI1 2JLMA 3CCR1 3F5BA 4CYNA 4C7IA 5A27A 2Q43A 3K9UA 4NBEA 2V3VA 1VQM1 5FLMI 3KHZA 1YJWZ 4U9YA 3IFUA 1KQSY 2RT9A 3HLPA 3J80f 5LL6f 4IUSA 4UEEA 1F2OA 1RO2A 1S5KA 4QVTA 3GKQA 3G4SZ 1VQL1 1XJOA 4P6YA 3S9LA 2ZPAA 3FX6A 4R87A 3IO1A 1KZFA 2WPWA 2P6EA 3NFZA 1VQ91 2IJZA 3RAMA 2CNMA 1B87A 4BY1I 2W04A 4A30A 3CXCZ 2B4DB 2PR8A 2P3YA 3BG1B 3PRTA 2PRBA 2Q4YA 2Q51A 1Y8CA 3M4OI 1Q2DA 3IWGA 1R3NA 3LWUA 1X10A 2AJ6A 1RQFA 1S7KA 3KQXA 3TTHA 3KASA 5ISVA 2PJ6A 1W2BZ 3G8WA 1H8LA 2I3CA 2F8HA 2R98A 3J80b 1M44A 4JLYA 2ARHA 2G9DA 3MGDA 4FD7A 4KOVA 3S2HI 2PJ9A 3BI0A 1I21A 5K8OA 3VATA 3TO7A 3PO3I 2PJ3A 4DYOA 4ZGYB 3CCM1 3M3YI 3NH4A 3GTKI 2A4NA 2IQ6A 2PC1A 4MHYA 3FF3A 2FVGA 2G2KA 3KGQA 1Y1VS 4F9UA 3EEDA 2PVVA 3GB0A 4CAVA 2GIVA 4KUBA 3EY5A 3S6FA 4K30A 3PO3S 4P44A 1LFWA 3PFOA 2GREA 4NOZA 1VQ5Z 1SFOI 1Z8LA 3D2MA 4KSFA 5F48A 2V8GA 2OTL1 3FNCA 3ESWA 3DGVA 3MONA 3VMHA 3PB9X 4PPZA 3J81f 1VQ71 5EMIA 2ZEDA 4MY3A 4CGMA 3BJ8A 4P4FA 2JS4A 1Q16A 2EWBA 3CME1 4DNCA 3FBUA 3S15I 3TX8A 1NUIA 3S1QI 1N8R1 1VKCA 4E0AA 4EVYA 2RPRA 4OMEA 3CQZI 4UF4A 5AG5A 3D2PA 4NBBA 4R7MA 1KQSZ 3WR7A 2R93I 5A2Qf 1RLYA 3FQQA 3S6HA 1USPB 2FSRA 2CTBA 4GXHA 3CT9A 1UWYA 4I49A 4C68A 3I551 5T6BA 4Y49B 1CM0A 2OZHA 1I50I 5T67A 1JWHC 1JJ2Y 3DR8A 3S1NI 2XEGA 2O4HA 3F0AA 2JIOA 5GCNA 1QVGZ 4CS0B 1ZLHA 4EFDA 4A3GI 1IB1E 1YHQZ 4A31A 2AFMA 5KTAA 1HDUA 2E7ZA 2PCUA 1S3ZA 2QA41 2P0WA 1FNOA 4IHMA 1YUAA 5G22A 3IR7A 1N71A 3V8IA 2QECA 3K2KA 1LQLA 4C2YA 2PRQA 1TKJA 2VQYA 3CMEZ 3H8FA 3G6E1 2OZGA 5DS0A 1KUXA 1DE4C 3SJEA 2KPIA 5LRGA 4R57A 1QVFZ 4ONUA 1XRYA 3B8GA 3DDDA 3CCSZ 3PFEA 4YFJA 4E33A 1ON0A 3TE4A 2PR1A 4NJQA 2GE3A 1ML8A 1Q7Y1 1Q862 3BG0B 4R76A 3T8WA 3CCUZ 5LYDA 1IOFA 2EO8A 3EO4A 1VQ6Z 1YUKA 1GHEA 1M901 1VQNZ 2Q04A 1BLLE 3CXPA 5T64A 4JJXA 1BPMA 1KD12 3Q87A 2FIAA 3KI9A 2VPZA 3P2HA 4UIBA 3RZAA 5K8PA 4CRYB 2BSWA 5F49A 3VTNA 4A39A 2YNDA 3B2YA 1YITZ 4NJRA 1USPA 2HF1A 4CL1A 3I56Z 4P10A 2EVNA 1R9TI 1KRLA 3VH9A 1CP7A 3N5FA 2GANA 2QYVA 2ZEFA 1S72Z 3IJ3A 4MONA 2V8HA 2ZEGA 2GTIA 3FQMA 1VQO1 4MCRA 1XEBA 4NGRA 1AUGA 2JA5I 1SIWA 3GYAA 3D67A 1VHEA 1YR0A 3SXNA 4P4IA 1Y0YA 1YX0A 1Y7RA 1XIXA 4KLWA 1QMUA 2ZOFA 3UY5A 4XX2A 3FECA 5IX3A 2JIRA 1M1K1 3IGRA 1BOBA 2Y0SA 4MHNA 5I0CA 2VZZA 4MFQA 2AYDA 2Z3NA 1X3WA 2WYRA 1ZO0A 4UFXA 2P28A 3D2LA 2FIWA 5LRKA 4MD9A 4MHZA 4QTUA 4KOUA 3WT4A 4NFRA 3HOZI 1YJW1 4A3JI 1LOKA 3GY9A 5AN9F 2FE7A 2CNTA 1Q812 5ELYA 2QR1B 1VQK1 4HGZA 2JDDA 3H0GI 2AKLA 4KOYA 2Z11A 3HOYI 2AFWA 1QSNA 1Q2CA 1NE9A 5D1PA 1R57A 4P4EA 4ZY0A 1IYLA 3IC1A 4ZX9A 4B5PA 2AE6A 2D4OA 2OB0A 1Z4RA 2LIYA 1S60A 2O28A 4MCSA 3CCL1 5JH9A 5EC4A 4KVME 1YSJA 5K8MA 1VQP1 3KR5A 3TDHB 5EBVA 4A38A 1VIXA 2B3UA 4MFKA 4MH4A 2JNYA 2VL1A 4P45A 4KVXA 2QEX1 1YLOA 3A9LA 2J8NA 3R95A 3NDIA 1Y1VI 1K4JA 4NEXA 5C4XI 4HNYB 4X2TA 1P4NA 3S1RI 4OC4A 1TWFI 3FVLA 4AXVA 1YLEA 3IU1A 4RS4A 2VPXA 2BOAA 2VPWA 2GU2A 3CC71 2OTJ1 3I4MI 3E0KA 1YREA 2RIQA 5IP9I 1J4JA 4OKOA 4UIAA 4YWYA 2C6PA 1KUVA 2J8MA 2PQ8A 3D6WA 2RFHA 3PO2I 4PSXA 3LD2A 1BAVA 1RO4A 4OC3A 3VMIA 3GKRA 2QJ8A 1R43A 3LACA 3PB6X 1TKHA 2JIPA 2GLFA 4UFWA 4E2XA 3F3PC 2O53A 4CAFA 1QSTA 3VB9A 3QB8A 1PU9A 3TCVA 3CXCY 2M48A 2JEVA 1MJ9A 4HGYA 1DTDA 2DF5A 2F5IA 2H5MA 1L0CA 3N7ZA 1JQGA 3D7FA 4UWJA 1NJI2 3JAMf 4FD6A 4R8FA 1QSRA 2V8JA 3CC41 3OWCA 3CC2Z 3LMSA 2B63I 3B3WA 1CX8A 1NSAA 5H86A 1RTQA 2EUIA 4P4BA 2PJ2A 2ZW7A 1Q861 3S17I 3HUVA 2OTJZ 2YNCC 3I561 3CC7Z 2Y0MA 3CCQ1 5G1ZA 1M902 2JDCA 5F46A 2I79A 4B14A 2Q4ZA 2B58A 3W6XA 2E2II 3FB3A 4DJLA 3IU2A 2ATRA 3C26A 1XE4A 1ARMA
chains in the Genus database with same CATH topology
2LFUA 4EWCA 4BBSI 5A2Qf 2R93I 3G4S1 1RLYA 1VQLZ 4R6TA 4MCPA 3WC5A 3FQQA 1USPB 2CTBA 3JAMb 4NGPA 4E32A 1VQPZ 2AFXA 2EK8A 3CT9A 2YU9I 1UWYA 5FLXf 5HXDA 2W03A 3D66A 2JMOA 5LYFA 4MMOA 3H3VJ 1Y0RA 3CMA1 1XFOA 3I551 5T6BA 2JEWA 5HVGA 1I3QI 3MN8A 3KHXA 2ABZA 2QKDA 4DGLA 2ZEHA 1I50I 5T67A 2M6NA 3EERA 4G1PA 1JWHC 1JJ2Y 3KQZA 2NVYI 3PBBA 5HVHA 3S1NI 2XEGA 4YU9A 2O4HA 2PJCA 1WW9A 3L2NA 3FMCA 1PFTA 1QF8A 4MD8A 1XMBA 4O23A 1QVGZ 2OOYB 1ZLHA 2QA4Z 1CPSA 4EFDA 3GTLI 4A3GI 1Z2LA 3P5JB 3CCJ1 2V8DA 1ZG8A 2GLJA 1YHQZ 1ZG9A 5JGFA 4FBEA 1JJ2Z 1XBUA 2AFMA 2DE6A 1HDUA 1TF9A 2CIJA 5I4MA 3GCFA 2PCUA 2QA41 5JM6A 5LYIA 2E9HA 2C6GA 1Q822 1QVGY 4ZYQA 2IZ4A 1EE3P 1FNOA 4MCQA 4EMEA 4PXEA 4IHMA 4A3DI 3K9TA 1YUAA 3IX0A 3DLJA 3RBUA 4Y7NI 2V8VA 3K2KA 2ZOGA 2H85A 5IT9f 4NBDA 3BXMA 4ZY1A 1LQLA 3J7A4 4E2ZA 2QRDB 3SJGA 2PRQA 4JZ0A 2R6MA 1Y1WI 1TKJA 3I1UA 1ELMP 3CMEZ 1VQ81 3CD61 1DL6A 4IAVA 2PJ7A 1ZB9A 1K8A1 3H8FA 3G6E1 4FUUA 1KC82 5DS0A 5F09A 1DE4C 3SJEA 1YHQ1 1ZG7A 3D4UA 4BD9A 2F7VA 2KPIA 1TXRA 1BPNA 1M4LA 4A94A 1AYEA 1KWMA 3GTMI 4B6ZA 3GUXA 8CPAA 1YJ9Z 1Z5RA 5LRGA 3BHXA 3SJXA 4CPAA 4PQAA 4RUHA 1YIJ1 5IB9A 4R7MA 1LANA 3RZDI 4OIDA 3CCVZ 1Q811 3B35A 4H2KA 1QVFZ 3CPAA 2V8IA 5J1QA 1ELLP 3CDXA 4OP4A 2K5RA 1XRYA 2JA8I 4PXCA 3CCQZ 3BI1A 3HOWI 2JUBA 2DEAA 2PVWA 3CCSZ 3PFEA 4TWEA 3U50C 4E30A 4W9YA 1I6HI 4P4JA 4OIWA 4E33A 3GTJI 4NBCA 4NJQA 3V38A 2DE7A 1W2BY 3CPWY 1ML8A 1QVFY 4P4DA 1Q7Y1 1Q862 3CPXA 3BG0B 4R76A 3T8WA 4NGTA 3CCUZ 5LYDA 3CCRZ 4NGSA 1VQN1 1VQ6Z 1YMEA 3IFEA 1LAMA 3SI1A 1YUKA 3KIFA 4MXUA 1X3ZA 1VQKZ 1M901 1VQNZ 2JBKA 2WZNA 1BLLE 5IT9b 2OTLZ 4NB9A 5T64A 2CTCA 4A3II 4MRIA 4NBHA 1KD12 1BPMA 4UEFA 5K8NA 3Q87A 3KI9A 2XEJA 4UIBA 3RZAA 5K8PA 2KI7B 5C3EI 1N2FA 3S2DI 2AFZA 4RVDA 3VTNA 4A39A 1WCMI 1YITZ 2IMOA 3B2YA 2R7ZI 1USPA 4NJRA 1RO0A 2E2JI 2HF1A 4CL1A 3CCS1 3PB4X 4RV9A 2WB1A 3K7AI 3MRUA 3I56Z 3FH4A 3GLJA 5C44I 5CM2M 2PJ1A 2C6CA 4P10A 3MZLB 3GTQI 2YADA 1R9TI 1KRLA 4A3FI 4WWVA 3VH9A 2XEFA 2F4MA 1CP7A 1VQ7Z 2ZEEA 3N5FA 2IZ3A 1YJN1 3D68A 5D29A 2QYVA 2K3RA 2OOTA 2ZEFA 4IK2A 1RNIA 1S72Z 3IJ3A 4NBAA 4MONA 2V8HA 2ZEGA 1L1OC 2GTIA 3FQMA 4NB8A 4OC2A 1TF8A 1VQO1 3CCU1 4EWTA 3CPWZ 3G6EZ 4MCRA 2NVXI 3V7ZA 4GM5A 1YI2Z 2PJBA 4NGRA 1KC81 3FKII 1TKFA 2JA5I 2POKA 3PEIA 5CBMA 2V8KA 3HOXI 4Q7AA 3KL9A 1TFIA 2PIZA 3FEEA 1YIT1 2WAQA 3QWUA 2RB7A 3D67A 1VHEA 4E2WA 2HU9A 4ZI6A 4P4IA 2PJ0A 1AMPA 1QYPA 1Y0YA 3CCV1 1TWCI 1Q821 2CF4A 2QEXZ 6CPAA 3CCEZ 1QMUA 4X8IA 3D7HA 2ZOFA 2EK9A 4AYBA 1VQ61 4ZX8A 3IEHA 4HH4A 3MZKB 4XX2A 4NBGA 3WC7A 1Y7EA 3VMGA 3FECA 3KIHA 1WIIA 1M1K1 4OC5A 1FT7A 4NGMA 1YW6A 2Y0SA 1ZB8A 1K8A2 4MHNA 3LUSA 3I4NI 3WC6A 2JR6A 4NBFA 1X3WA 2WYRA 2C1CA 1PCAA 2P28A 3B3CA 5C4JI 5D8NA 2VUGA 2NVTI 3GTGI 2QRCB 1TWAI 1Z01A 2XEIA 1K732 5LRKA 3S9NA 4MD9A 4QTUA 4MHZA 2J6AA 1HDQA 2HB6A 3PBEA 4NFRA 2PJ4A 3HOZI 1KD11 1YJW1 4UEZA 3WT4A 1YIJZ 4A3JI 1VQ9Z 1LOKA 3B3VA 3B7IA 3VARA 1S7MA 5AN9F 1YJ91 2QREB 1Q812 5ELYA 2ANPA 2RHBA 1CPXA 2QR1B 1VQK1 4HGZA 1ZH1A 2HC9A 3IIBA 1F57A 3F3FC 3WABA 3H0GI 1NJI1 2AKLA 3CCR1 4X6AI 3HOYI 2AFWA 2PM9A 1ARLA 5LYLA 3I07A 5D1PA 2OR4A 2Q43A 1VQ8Z 4NBEA 4A3EI 4P4EA 3GTOI 4ZY0A 3H8GA 1VQM1 3NH8A 5FLMI 3KHZA 1YJWZ 2EGTA 3SJFA 2PK7A 3CCLZ 4F8ZA 3IC1A 3SI0A 3IFUA 1KQSY 4KSIA 4ZX9A 3B3SA 2RT9A 4S1TA 4TNUA 2PIYA 2J9AA 3HLPA 1VQMZ 3NA6A 2LIYA 3KZWA 3HKZA 3OW2Y 2PMZA 4MCSA 3CCL1 3J80f 2BCOA 3PB8X 5JH9A 2OZKA 5LL6f 1YSJA 1CP6A 4UEEA 5K8MA 2RBLA 1VQP1 3GTPI 5FLXb 1F2OA 1RO2A 3KR5A 3TDHB 2ZELA 4A38A 3GKQA 3G4SZ 1K9M1 1VQL1 1VIXA 1XJOA 3CCJZ 4P6YA 2JA6I 3S9LA 3OW2Z 3FX6A 1VHOA 5THWA 4MH4A 2JNYA 2VL1A 3IO1A 4P45A 2BJOA 2QEX1 1VQ51 1YLOA 2R92I 2NVQI 3NDIA 4A3CI 1Y1VI 2PJ8A 5C4XI 4X2TA 3NFZA 1VQ91 4A37A 3S1RI 2IJZA 4OC4A 4JYWA 1ZLIA 5CPAA 1TWFI 3FVLA 4NGQA 3RAMA 4AXVA 4DUKA 3SI2A 4RS4A 2V77A 4BY1I 2W04A 4ZY2A 2PJ5A 4BXXI 3CMAZ 2BOAA 5HVFA 3CXCZ 2GU2A 2P3YA 3BG1B 3CC71 2F4OA 4E2YA 2OTJ1 2AFSA 3PRTA 3I4MI 1YI21 3FJUA 1P9NA 2RIQA 2AFOA 1CBXA 3H8EA 5IP9I 2Q51A 3NDJA 3M4OI 3D9XA 2VUMI 1X0TA 1R3NA 1K83I 2JBJA 4OKOA 4UIAA 4BBRI 3LWUA 4YWYA 2C6PA 1N8R2 1RQFA 3S1MI 3D6WA 3ISXA 4E31A 2RFHA 3KQXA 3PO2I 3KASA 2PJ6A 1W2BZ 4A3BI 1H8LA 3B3TA 2I3CA 4RVHA 2F8HA 1BAVA 1F2PA 1RO4A 4A3LI 3HOVI 3J80b 1GYTA 4OC3A 3VMIA 2PJAA 3J81b 2QJ8A 4F9VA 1R43A 1Z02A 5IP7I 5D1OA 2G9DA 4DQYB 1NP6A 3I55Z 3PB6X 1VGYA 1TKHA 4A3KI 4OC0A 2GLFA 2QVPA 4E2XA 4MHPA 4NGNA 4BY7I 3F3PC 1M1K2 3S2HI 2PJ9A 3BI0A 3T4NB 4FAIA 2O53A 1VQ4Z 3JRUA 5K8OA 7CPAA 3VATA 4ONWA 3VB9A 4OC1A 3PO3I 3S9MA 1VQOZ 4X3RA 4WJBA 3PB7X 2PJ3A 4DYOA 1Q7LA 4PXBA 3G711 3CCM1 3GTMS 3M3YI 3NH4A 4Y52I 2QLVB 3GTKI 3CCMZ 3CCE1 3CXCY 2IQ6A 2M48A 1S721 1K731 4MHYA 2E2HI 4HGYA 1DTDA 3FF3A 2PE3A 2DE5A 1YW4A 2FVGA 1Z03A 3D7DA 2G2KA 4K3NA 3KGQA 1Y1VS 2NSMA 4F9UA 2VF1A 3HOUI 3RZOI 3EEDA 2PVVA 1QQ9A 5A2Qb 1K9M2 1JQGA 3FEDA 3GB0A 3D7FA 1NJI2 3JAMf 3PO3S 2ZEMA 4R8FA 2V8JA 3CC41 3TE5B 4P44A 3CC2Z 4PXDA 3LMSA 1LFWA 3PFOA 1VLAA 2B63I 3B3WA 2GREA 4NOZA 1VQ5Z 1CX8A 5LRJA 1SFOI 1NSAA 1Z8LA 2BO9A 3G71Z 2V8GA 2OTL1 3IWWA 3ESWA 3DGVA 3MONA 3VMHA 1LCPA 3PB9X 1YJNZ 4FWUA 3J81f 4PPZA 3TC8A 1VQ71 1RTQA 2OOXB 2ZEDA 1VQ41 2JA7I 1IY7A 4LQGA 4P4FA 4P4BA 2JS4A 2PJ2A 2ZENA 3CC21 1HEEA 1Q7Y2 1Q861 1IGBA 3CC4Z 3S17I 2EWBA 3HUVA 3CME1 3CD6Z 2OTJZ 3KR4A 3D7GA 3I561 3CC7Z 4NH1C 3CCQ1 5D1OB 3S15I 1PYTB 3TX8A 1NUIA 3S1QI 4DK1A 1N8R1 1M902 4Z65A 1LAPA 4RVGA 2RPRA 3S14I 2ZAEB 4OMEA 2Q4ZA 3IF8A 1TWGI 3QNVA 3S16I 3CQZI 2GTHA 1CG2A 2AFUA 2ZEOA 2E2II 4UF4A 4A93I 1OBRA 2ZEPA 4DJLA 1TWHI 2NYQA 3NH5A 3ISZA 4A3MI 1ARMA 4MD7A 4NBBA 1KQSZ 4RVFA 4QTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6T A;  4MCP A;  3WC5 A;  2CTB A;  4NGP A;  2AFX A;  2EK8 A;  3CT9 A;  1UWY A;  5HXD A;  5LYF A;  3D66 A;  4MMO A;  1Y0R A;  1XFO A;  2JEW A;  5HVG A;  3MN8 A;  3KHX A;  2ABZ A;  2ZEH A;  4G1P A;  3KQZ A;  3PBB A;  5HVH A;  4YU9 A;  2XEG A;  2O4H A;  2PJC A;  3L2N A;  3FMC A;  1XMB A;  4O23 A;  1ZLH A;  1CPS A;  4EFD A;  1Z2L A;  2V8D A;  1ZG8 A;  2GLJ A;  1ZG9 A;  5JGF A;  4FBE A;  1XBU A;  2AFM A;  1HDU A;  1TF9 A;  2CIJ A;  5I4M A;  2PCU A;  5JM6 A;  5LYI A;  2C6G A;  4ZYQ A;  1EE3 P;  1FNO A;  4MCQ A;  4EME A;  4PXE A;  4IHM A;  3K9T A;  3DLJ A;  3RBU A;  2V8V A;  3K2K A;  2ZOG A;  3BXM A;  4ZY1 A;  3SJG A;  2PRQ A;  4JZ0 A;  1TKJ A;  3I1U A;  1ELM P;  4IAV A;  2PJ7 A;  3H8F A;  4FUU A;  5DS0 A;  5F09 A;  1DE4 C;  3SJE A;  1ZG7 A;  3D4U A;  4BD9 A;  2F7V A;  1TXR A;  1BPN A;  1M4L A;  4A94 A;  1AYE A;  1KWM A;  4B6Z A;  8CPA A;  3GUX A;  1Z5R A;  5LRG A;  3BHX A;  3SJX A;  4CPA A;  4PQA A;  4RUH A;  5IB9 A;  1LAN A;  4OID A;  3B35 A;  4H2K A;  3CPA A;  5J1Q A;  1ELL P;  3CDX A;  4OP4 A;  1XRY A;  4PXC A;  3BI1 A;  2DEA A;  2PVW A;  3PFE A;  4TWE A;  4W9Y A;  4P4J A;  4OIW A;  4NJQ A;  3V38 A;  4P4D A;  3CPX A;  4R76 A;  3T8W A;  4NGT A;  5LYD A;  4NGS A;  1YME A;  3IFE A;  1LAM A;  3SI1 A;  4MXU A;  2WZN A;  2JBK A;  1BLL E;  2CTC A;  1BPM A;  4MRI A;  4UEF A;  5K8N A;  3KI9 A;  2XEJ A;  4UIB A;  3RZA A;  5K8P A;  2AFZ A;  4A39 A;  3B2Y A;  2IMO A;  4NJR A;  3PB4 X;  3MRU A;  3FH4 A;  3GLJ A;  2PJ1 A;  2C6C A;  4P10 A;  4WWV A;  3VH9 A;  2XEF A;  1CP7 A;  2ZEE A;  3N5F A;  3D68 A;  2OOT A;  5D29 A;  2QYV A;  2ZEF A;  4IK2 A;  3IJ3 A;  2V8H A;  2ZEG A;  4OC2 A;  1TF8 A;  4EWT A;  4MCR A;  3V7Z A;  4GM5 A;  2PJB A;  4NGR A;  1TKF A;  2POK A;  3PEI A;  5CBM A;  4Q7A A;  3KL9 A;  2PIZ A;  3FEE A;  2RB7 A;  3D67 A;  1VHE A;  4ZI6 A;  4P4I A;  2PJ0 A;  1AMP A;  1Y0Y A;  2CF4 A;  6CPA A;  1QMU A;  4X8I A;  3D7H A;  2ZOF A;  2EK9 A;  4ZX8 A;  3IEH A;  3WC7 A;  1Y7E A;  3FEC A;  4OC5 A;  1FT7 A;  4NGM A;  1YW6 A;  4MHN A;  2WYR A;  2C1C A;  1PCA A;  3B3C A;  5D8N A;  2XEI A;  5LRK A;  3S9N A;  4MHZ A;  3WC6 A;  2HB6 A;  1HDQ A;  3PBE A;  3WT4 A;  4NFR A;  2PJ4 A;  4UEZ A;  1LOK A;  3B3V A;  3VAR A;  5ELY A;  2ANP A;  1CPX A;  2HC9 A;  3IIB A;  1F57 A;  3WAB A;  2AFW A;  1ARL A;  5LYL A;  2OR4 A;  2Q43 A;  4P4E A;  4ZY0 A;  3H8G A;  3NH8 A;  3KHZ A;  3SJF A;  4F8Z A;  3IC1 A;  3SI0 A;  4KSI A;  4ZX9 A;  3B3S A;  4TNU A;  2PIY A;  2J9A A;  3HLP A;  3NA6 A;  3KZW A;  4MCS A;  2BCO A;  3PB8 X;  5JH9 A;  1YSJ A;  1CP6 A;  4UEE A;  5K8M A;  1F2O A;  3KR5 A;  2ZEL A;  4A38 A;  1XJO A;  1VIX A;  4P6Y A;  3S9L A;  3FX6 A;  1VHO A;  5THW A;  2VL1 A;  4P45 A;  3IO1 A;  1YLO A;  2PJ8 A;  4X2T A;  3NFZ A;  4A37 A;  2IJZ A;  4OC4 A;  4JYW A;  1ZLI A;  5CPA A;  3FVL A;  4NGQ A;  3RAM A;  4AXV A;  4DUK A;  3SI2 A;  2V77 A;  4ZY2 A;  2PJ5 A;  2BOA A;  5HVF A;  2GU2 A;  3PRT A;  2AFS A;  3FJU A;  2AFO A;  1CBX A;  3H8E A;  2Q51 A;  2JBJ A;  1R3N A;  4OKO A;  4UIA A;  4YWY A;  3LWU A;  2C6P A;  3KQX A;  3ISX A;  2RFH A;  3KAS A;  2PJ6 A;  1H8L A;  3B3T A;  2I3C A;  2F8H A;  1BAV A;  1F2P A;  1GYT A;  4OC3 A;  2PJA A;  2QJ8 A;  4F9V A;  1R43 A;  2G9D A;  3PB6 X;  1VGY A;  1TKH A;  4OC0 A;  2GLF A;  2QVP A;  4NGN A;  4MHP A;  2PJ9 A;  3BI0 A;  4FAI A;  2O53 A;  3JRU A;  5K8O A;  7CPA A;  3VAT A;  4ONW A;  4OC1 A;  3S9M A;  4X3R A;  4WJB A;  3PB7 X;  2PJ3 A;  4DYO A;  1Q7L A;  4PXB A;  3NH4 A;  2IQ6 A;  4MHY A;  1DTD A;  3FF3 A;  2PE3 A;  1YW4 A;  2FVG A;  3D7D A;  4K3N A;  3KGQ A;  4F9U A;  2NSM A;  2PVV A;  1QQ9 A;  3GB0 A;  1JQG A;  3FED A;  3D7F A;  2ZEM A;  4R8F A;  4P44 A;  4PXD A;  3LMS A;  1LFW A;  3PFO A;  3B3W A;  2GRE A;  1CX8 A;  5LRJ A;  1NSA A;  1Z8L A;  2BO9 A;  2V8G A;  3IWW A;  3DGV A;  3PB9 X;  1LCP A;  4PPZ A;  4FWU A;  3TC8 A;  1RTQ A;  2ZED A;  1IY7 A;  4LQG A;  4P4F A;  4P4B A;  2PJ2 A;  2ZEN A;  1HEE A;  1IGB A;  3HUV A;  2EWB A;  3KR4 A;  3D7G A;  1PYT B;  3TX8 A;  4Z65 A;  1LAP A;  4OME A;  2Q4Z A;  3QNV A;  1CG2 A;  2AFU A;  2ZEO A;  4UF4 A;  1OBR A;  2ZEP A;  4DJL A;  2NYQ A;  3NH5 A;  3ISZ A;  1ARM A;  4R7M A;  3B7I A; 
#chains in the Genus database with same CATH topology
 4MCP A;  3WC5 A;  3JAM b;  4E32 A;  1VQP Z;  2EK8 A;  2IV2 X;  4MJ8 A;  4UCP A;  3H3V J;  3CMA 1;  1XFO A;  1I3Q I;  3KHX A;  2ABZ A;  1U6M A;  2CXA A;  1RO5 A;  2Q7B A;  3KQZ A;  4L89 A;  3PBB A;  5HVH A;  1OZP A;  2PJC A;  1PUA A;  4LX9 A;  4MD8 A;  1XMB A;  3KKW A;  4UWI A;  3GTL I;  2V8D A;  3CCJ 1;  4A32 A;  4FBE A;  2DE6 A;  3GCF A;  4E2A A;  4F0X A;  4MY0 A;  2C6G A;  1YVO A;  4JWP A;  3IX0 A;  3DLJ A;  4Y7N I;  4UA3 A;  2ZOG A;  4ZY1 A;  3J7A 4;  2V45 A;  3CXS A;  2R6M A;  2VZY A;  3JVN A;  4OAE A;  1YHQ 1;  1IU8 A;  1IYK A;  1ZG7 A;  3D4U A;  2F7V A;  1TXR A;  2R7H A;  1KWM A;  8CPA A;  2P6F A;  5AG6 A;  4CPA A;  4KUA A;  4PQA A;  5IB9 A;  4NSQ A;  3RZD I;  4OID A;  2VI7 A;  5KTC A;  1Q81 1;  1Z8W A;  5J1Q A;  1ELL P;  3CDX A;  1I1D A;  4PXC A;  3CCQ Z;  2JUB A;  4TWE A;  3U50 C;  3CZX A;  4E30 A;  4W9Y A;  1I6H I;  3R9G A;  3GTJ I;  2Q7S A;  1W2B Y;  3CPW Y;  4P4D A;  3CPX A;  3KIF A;  2JBK A;  4A3I I;  4NBH A;  3JUW A;  4UEF A;  5K8N A;  3EXN A;  2XEJ A;  4B13 A;  3NE8 A;  2ZW6 A;  3QAH A;  4ORF A;  1RXT A;  2IMO A;  2R7Z I;  4A95 A;  4MFP A;  2E2J I;  3PB4 X;  3K7A I;  3MRU A;  3FH4 A;  3GLJ A;  4NCZ A;  2C6C A;  3GTQ I;  2GFQ A;  4A3F I;  2G3A A;  2XEF A;  2ZEE A;  1VQ7 Z;  3D68 A;  2OOT A;  4IK2 A;  2Z0Z A;  5H84 A;  3TOB A;  2HUZ A;  4OC2 A;  3CCU 1;  4F0Y A;  4EWT A;  3R1K A;  3V7Z A;  1M4G A;  2Q0Y A;  1WK4 A;  1KC8 1;  1P0H A;  4Q7A A;  3D3S A;  2PIZ A;  1MK4 A;  4A33 A;  4B10 A;  4NXY A;  2PJ0 A;  4J3G A;  3ZJ0 A;  1TWC I;  2CF4 A;  2BL1 A;  4HH4 A;  4NBG A;  4YGO A;  1SQH A;  4NGM A;  3LOD A;  5C82 A;  2YNE A;  2JR6 A;  4NBF A;  2LEX A;  1PCA A;  3B3C A;  5D8N A;  2VUG A;  2NVT I;  2QRC B;  1TWA I;  1Z01 A;  2XEI A;  4II9 A;  3PBE A;  2IL4 A;  3VWD A;  1YIJ Z;  4RN7 A;  1YJ9 1;  2WSA A;  2QRE B;  4C2Z A;  3IIB A;  1F57 A;  3F3F C;  1Z8X A;  4X6A I;  2PM9 A;  3I07 A;  3IWE A;  2OR4 A;  1VQ8 Z;  1Y9W A;  2EGT A;  2PK7 A;  4F8Z A;  4KOR A;  3B3S A;  5KTD A;  2PIY A;  4XNH C;  2J9A A;  4Q36 A;  3NA6 A;  3HKZ A;  4LQ6 A;  2PMZ A;  2BCO A;  3PB8 X;  2OZK A;  1Z8T A;  2RBL A;  3GTP I;  3FYN A;  1K9M 1;  2JA6 I;  4HKF A;  4QB9 A;  5AG7 A;  2Z3K A;  1VHO A;  5THW A;  3I9S A;  2FCK A;  1FY7 A;  2PJ8 A;  4A37 A;  4JYW A;  1ZLI A;  5CPA A;  4NGQ A;  5BWA B;  1AA6 A;  1KUY A;  4JXR A;  4ZY2 A;  2PJ5 A;  4BXX I;  4E2Y A;  4PSW A;  1YI2 1;  3FJU A;  1P9N A;  1YVK A;  1CBX A;  2VPY A;  4H6Z A;  1YGH A;  4U9Z A;  4IF5 A;  2JBJ A;  1X0T A;  4BBR I;  4JD6 A;  1N8R 2;  3ISX A;  4KS9 A;  4XPD C;  3B3T A;  1QSM A;  4QBJ A;  3PP9 A;  4E8O A;  3HOV I;  1GYT A;  4UBR A;  1S7F A;  2PJA A;  3J81 b;  1Z02 A;  5CNP A;  5D1O A;  4M6G A;  1NP6 A;  2FL4 A;  4A3K I;  2PSW A;  4BY7 I;  1M1K 2;  1VQ4 Z;  3JRU A;  1S7L A;  4OC1 A;  3S9M A;  4UFV A;  4B12 A;  3PB7 X;  1Q7L A;  4PXB A;  3G71 1;  3GTM S;  2QLV B;  3CCM Z;  3CCE 1;  1QXF A;  2DE5 A;  3SXO A;  1YW4 A;  2Q4V A;  2VF1 A;  3HOU I;  3RZO I;  4PV6 A;  1QQ9 A;  5A2Q b;  1K9M 2;  3FED A;  2DPS A;  2ZEM A;  3TE5 B;  3QAY A;  4PXD A;  3DR6 A;  1TIQ A;  1VLA A;  1M4I A;  3I3G A;  1JWQ A;  5LRJ A;  3G71 Z;  3IWW A;  1IIC A;  3TT2 A;  1LCP A;  1YJN Z;  3TC8 A;  1VQ4 1;  2JA7 I;  4LQG A;  2ZEN A;  3CC2 1;  1HEE A;  3CC4 Z;  4L8A A;  3CD6 Z;  3D7G A;  3EFA A;  4NH1 C;  2I00 A;  3BLN A;  1LAP A;  4RVG A;  1FDI A;  3IF8 A;  3S16 I;  2GTH A;  2AFU A;  4A93 I;  1QSO A;  3CXQ A;  2NYQ A;  2G3T A;  3ISZ A;  4CAE A;  4A3M I;  3FRM A;  1WWZ A;  3B7I A;  4QTT A;  2LFU A;  4EWC A;  4BBS I;  3G4S 1;  1VQL Z;  4NGP A;  2AFX A;  2YU9 I;  5FLX f;  2W03 A;  3D66 A;  4MMO A;  4A2Z A;  5JQ4 A;  1XOV A;  2JEW A;  3DSB A;  2BUE A;  4CAX A;  4DGL A;  2ZEH A;  2OU2 A;  2B5G B;  2NVY I;  3H5Z A;  4YU9 A;  1PFT A;  4O23 A;  2OOY B;  1CPS A;  4AVA A;  2GLJ A;  1ZG9 A;  5JGF A;  1JJ2 Z;  1XBU A;  2Z3P A;  2CIJ A;  2FT0 A;  2K5T A;  2E9H A;  1Q82 2;  1QVG Y;  4ZYQ A;  1EE3 P;  4MCQ A;  4A3D I;  3BJ7 A;  4KOW A;  3RBU A;  2ZXV A;  2V8V A;  5IT9 f;  4NBD A;  3S6G A;  3SJG A;  2CY2 A;  3I1U A;  3CD6 1;  1VQ8 1;  1DL6 A;  4H89 A;  1ZB9 A;  1K8A 1;  4FUU A;  4XNH B;  1M4L A;  3H4Q A;  4B6Z A;  1YJ9 Z;  1V0C A;  5FVJ A;  4RUH A;  1YIJ 1;  3S6K A;  3RO0 A;  3CCV Z;  4R3L A;  3B35 A;  2FS5 A;  4H2K A;  2V8I A;  4UCM A;  2JA8 I;  3HOW I;  3PZJ A;  5AG4 A;  4P4J A;  4OIW A;  4NF1 A;  1FDO A;  3V38 A;  2DE7 A;  1QVF Y;  4HNW B;  4M3S A;  4NGT A;  2REF A;  3R9F A;  1VQN 1;  1YME A;  3IFE A;  3SI1 A;  4MXU A;  1X12 A;  1X3Z A;  1VQK Z;  5C88 A;  2OZU A;  5IT9 b;  2CTC A;  5J8F A;  4BIN A;  5C3E I;  2AFZ A;  1N2F A;  4RVD A;  1WCM I;  3GIU A;  1RO0 A;  4H6U A;  3CCS 1;  4R3K A;  4RV9 A;  2WB1 A;  4WWV A;  2F4M A;  3JTK A;  2K3R A;  1RNI A;  4NBA A;  4AB7 A;  5G20 A;  1WJ2 A;  2RC4 A;  1TF8 A;  3CPW Z;  3G6E Z;  1YI2 Z;  4AG7 A;  4CAW A;  3FKI I;  2POK A;  3PEI A;  5CBM A;  2V8K A;  1UFH A;  4M6I A;  3KL9 A;  5DWM A;  1TFI A;  4M85 A;  2WAQ A;  3QWU A;  2RB7 A;  1BO4 A;  4HNX B;  4ZI6 A;  3TO9 A;  2JIQ A;  5A28 A;  1AMP A;  3FXT A;  6CPA A;  3D7H A;  3RNZ A;  4AYB A;  2X7B A;  3MZK B;  1M4D A;  3TO6 A;  1Z4E A;  2PDO A;  1YK3 A;  1WII A;  1YW6 A;  4KOT A;  3R96 A;  5IV0 A;  4AVB A;  5C4J I;  3GTG I;  2HB6 A;  2PJ4 A;  1KD1 1;  4UEZ A;  3B3V A;  3VAR A;  2CNS A;  2ANP A;  2RHB A;  1CPX A;  4CRZ B;  2HC9 A;  5F47 A;  4KLV A;  1ARL A;  5LYL A;  4OLL A;  4A3E I;  3GTO I;  3H8G A;  3NH8 A;  3SJF A;  3CCL Z;  2R8V A;  2NAP A;  3SI0 A;  4KSI A;  4S1T A;  4TNU A;  4AG9 A;  4RI1 A;  1VQM Z;  2BEI A;  3KZW A;  4R9M A;  3OW2 Y;  1CP6 A;  4QC6 A;  5FLX b;  2ZEL A;  1MJA A;  3CCJ Z;  4QUS A;  3OW2 Z;  2BJO A;  1VQ5 1;  3R9E A;  2R92 I;  2NVQ I;  4A3C I;  2OH1 A;  2R1I A;  4DUK A;  4YRH A;  5DWN A;  3SI2 A;  2V77 A;  3NE7 A;  3CMA Z;  5HVF A;  4XPD B;  2F4O A;  2AFS A;  4Y49 C;  4PK3 A;  2AFO A;  3H8E A;  3NDJ A;  2DPT A;  3D9X A;  2VUM I;  1K83 I;  3S1M I;  4E31 A;  4A3B I;  5J8C A;  4RVH A;  1F2P A;  4A3L I;  1XMT A;  3W91 A;  2YNC A;  4B5O A;  4F9V A;  5IP7 I;  4MFJ A;  4DQY B;  3I55 Z;  1VGY A;  2EBJ A;  4OC0 A;  3TFY A;  2QVP A;  4NGN A;  4MHP A;  4FD5 A;  4C7H A;  3T4N B;  4FAI A;  7CPA A;  2DXQ A;  4ONW A;  1VQO Z;  4MFL A;  4X3R A;  4WJB A;  4Y52 I;  2QML A;  1S72 1;  1K73 1;  2E2H I;  1M1D A;  2PE3 A;  1Z03 A;  3D7D A;  4K3N A;  2NSM A;  1IOI A;  4KOS A;  3EC4 A;  1MJB A;  3T90 A;  4X5K A;  4KOX A;  4ZBG A;  4AVC A;  4KZT A;  2KCW A;  2ZW5 A;  2VEZ A;  4OAD A;  5G21 A;  4HPS A;  4CGO A;  2BO9 A;  4FD4 A;  4JXQ A;  2VXK A;  4FWU A;  2B4D A;  3T9Y A;  2OOX B;  3P2F A;  1IY7 A;  3VWE A;  5HMN A;  1Q7Y 2;  1IGB A;  3KR4 A;  2Z3O A;  2FXF A;  5D1O B;  3ZZI A;  1PYT B;  5HH1 A;  4DK1 A;  1A2Z A;  4Z65 A;  3DNS A;  3S14 I;  2ZAE B;  1WZN A;  1TWG I;  3QNV A;  2YGW A;  1CG2 A;  2ZEO A;  1OBR A;  2ZEP A;  5E96 A;  1Q2Y A;  1TWH I;  3NH5 A;  2JIM A;  4MD7 A;  4LUA A;  3EER A;  4RVF A;  3D8P A;  4R6T A;  3PGP A;  3G3S A;  5HXD A;  5LYF A;  1S7N A;  2JMO A;  2ZW4 A;  5JPH A;  1IID A;  1Y0R A;  1VHS A;  4CYQ A;  3SHP A;  5HVG A;  3MN8 A;  2QKD A;  2D4P A;  4F6A A;  2M6N A;  4G1P A;  2Z10 A;  1WW9 A;  3L2N A;  3FMC A;  1QF8 A;  2QA4 Z;  1Z2L A;  3P5J B;  4U5Y A;  1ZG8 A;  5I4M A;  1TF9 A;  4CGP A;  5JM6 A;  5LYI A;  2REE A;  2IZ4 A;  4EME A;  4PXE A;  3K9T A;  4BMH A;  4UCN A;  2H85 A;  3BXM A;  4C2X A;  1B6B A;  4E2Z A;  2QRD B;  4JZ0 A;  4MBU A;  1Y1W I;  1ELM P;  1YQE A;  4IAV A;  2PJ7 A;  4RS2 A;  1KC8 2;  5F09 A;  2VBQ A;  4BD9 A;  1BPN A;  4A94 A;  1AYE A;  3GTM I;  3GUX A;  1Z5R A;  3BHX A;  3SJX A;  2B5G A;  1LAN A;  3W6S A;  2Q44 A;  1NMT A;  3CPA A;  4CGL A;  4OP4 A;  2K5R A;  3BI1 A;  2DEA A;  2PVW A;  4Q38 A;  2B4B A;  1I12 A;  1NSL A;  2G0B A;  1Y9K A;  4NBC A;  4MFZ A;  3FIX A;  2C27 A;  1CJW A;  3CCR Z;  4KSA A;  4NGS A;  1LAM A;  4XPK A;  2WZN A;  2OTL Z;  4NB9 A;  2NMT A;  4MRI A;  4B11 A;  1LRZ A;  2QIR A;  2KI7 B;  3S2D I;  1XF8 A;  2WUU A;  4BBH A;  5IB0 A;  5C44 I;  5CM2 M;  2PJ1 A;  3MZL B;  2YAD A;  2J8R A;  5AGE A;  2HQY A;  2IZ3 A;  1YJN 1;  5D29 A;  3TOA A;  2ODF A;  1L1O C;  4NB8 A;  2B3V A;  2NVX I;  1Z9U A;  3RYO A;  4GM5 A;  2PJB A;  1TKF A;  2Z3L A;  3HOX I;  3FEE A;  1YIT 1;  2WPX A;  4E2W A;  2HU9 A;  4CYP A;  1QYP A;  4MHD A;  3CCV 1;  1Q82 1;  2QEX Z;  4B5P B;  3CCE Z;  4X8I A;  2P6G A;  2EK9 A;  1VQ6 1;  4ZX8 A;  3IEH A;  3WC7 A;  4CYO A;  1Y7E A;  3VMG A;  3KIH A;  4GS4 A;  4OC5 A;  4PK2 A;  4XPL A;  1FT7 A;  1ZB8 A;  4CGN A;  1K8A 2;  3LUS A;  4M6H A;  3I4N I;  2Z3M A;  2C1C A;  4MI4 A;  1K73 2;  3S9N A;  3WC6 A;  2J6A A;  1HDQ A;  4KVO E;  3F8K A;  1VQ9 Z;  1S7M A;  2HV2 A;  1ZH1 A;  3WAB A;  1NJI 1;  2JLM A;  3CCR 1;  3F5B A;  4CYN A;  4C7I A;  5A27 A;  2Q43 A;  3K9U A;  4NBE A;  2V3V A;  1VQM 1;  5FLM I;  3KHZ A;  1YJW Z;  4U9Y A;  3IFU A;  1KQS Y;  2RT9 A;  3HLP A;  3J80 f;  5LL6 f;  4IUS A;  4UEE A;  1F2O A;  1RO2 A;  1S5K A;  4QVT A;  3GKQ A;  3G4S Z;  1VQL 1;  1XJO A;  4P6Y A;  3S9L A;  2ZPA A;  3FX6 A;  4R87 A;  3IO1 A;  1KZF A;  2WPW A;  2P6E A;  3NFZ A;  1VQ9 1;  2IJZ A;  3RAM A;  2CNM A;  1B87 A;  4BY1 I;  2W04 A;  4A30 A;  3CXC Z;  2B4D B;  2PR8 A;  2P3Y A;  3BG1 B;  3PRT A;  2PRB A;  2Q4Y A;  2Q51 A;  1Y8C A;  3M4O I;  1Q2D A;  3IWG A;  1R3N A;  3LWU A;  1X10 A;  2AJ6 A;  1RQF A;  1S7K A;  3KQX A;  3TTH A;  3KAS A;  5ISV A;  2PJ6 A;  1W2B Z;  3G8W A;  1H8L A;  2I3C A;  2F8H A;  2R98 A;  3J80 b;  1M44 A;  4JLY A;  2ARH A;  2G9D A;  3MGD A;  4FD7 A;  4KOV A;  3S2H I;  2PJ9 A;  3BI0 A;  1I21 A;  5K8O A;  3VAT A;  3TO7 A;  3PO3 I;  2PJ3 A;  4DYO A;  4ZGY B;  3CCM 1;  3M3Y I;  3NH4 A;  3GTK I;  2A4N A;  2IQ6 A;  2PC1 A;  4MHY A;  3FF3 A;  2FVG A;  2G2K A;  3KGQ A;  1Y1V S;  4F9U A;  3EED A;  2PVV A;  3GB0 A;  4CAV A;  2GIV A;  4KUB A;  3EY5 A;  3S6F A;  4K30 A;  3PO3 S;  4P44 A;  1LFW A;  3PFO A;  2GRE A;  4NOZ A;  1VQ5 Z;  1SFO I;  1Z8L A;  3D2M A;  4KSF A;  5F48 A;  2V8G A;  2OTL 1;  3FNC A;  3ESW A;  3DGV A;  3MON A;  3VMH A;  3PB9 X;  4PPZ A;  3J81 f;  1VQ7 1;  5EMI A;  2ZED A;  4MY3 A;  4CGM A;  3BJ8 A;  4P4F A;  2JS4 A;  1Q16 A;  2EWB A;  3CME 1;  4DNC A;  3FBU A;  3S15 I;  3TX8 A;  1NUI A;  3S1Q I;  1N8R 1;  1VKC A;  4E0A A;  4EVY A;  2RPR A;  4OME A;  3CQZ I;  4UF4 A;  5AG5 A;  3D2P A;  4NBB A;  4R7M A;  1KQS Z;  3WR7 A;  2R93 I;  5A2Q f;  1RLY A;  3FQQ A;  3S6H A;  1USP B;  2FSR A;  2CTB A;  4GXH A;  3CT9 A;  1UWY A;  4I49 A;  4C68 A;  3I55 1;  5T6B A;  4Y49 B;  1CM0 A;  2OZH A;  1I50 I;  5T67 A;  1JWH C;  1JJ2 Y;  3DR8 A;  3S1N I;  2XEG A;  2O4H A;  3F0A A;  2JIO A;  5GCN A;  1QVG Z;  4CS0 B;  1ZLH A;  4EFD A;  4A3G I;  1IB1 E;  1YHQ Z;  4A31 A;  2AFM A;  5KTA A;  1HDU A;  2E7Z A;  2PCU A;  1S3Z A;  2QA4 1;  2P0W A;  1FNO A;  4IHM A;  1YUA A;  5G22 A;  3IR7 A;  1N71 A;  3V8I A;  2QEC A;  3K2K A;  1LQL A;  4C2Y A;  2PRQ A;  1TKJ A;  2VQY A;  3CME Z;  3H8F A;  3G6E 1;  2OZG A;  5DS0 A;  1KUX A;  1DE4 C;  3SJE A;  2KPI A;  5LRG A;  4R57 A;  1QVF Z;  4ONU A;  1XRY A;  3B8G A;  3DDD A;  3CCS Z;  3PFE A;  4YFJ A;  4E33 A;  1ON0 A;  3TE4 A;  2PR1 A;  4NJQ A;  2GE3 A;  1ML8 A;  1Q7Y 1;  1Q86 2;  3BG0 B;  4R76 A;  3T8W A;  3CCU Z;  5LYD A;  1IOF A;  2EO8 A;  3EO4 A;  1VQ6 Z;  1YUK A;  1GHE A;  1M90 1;  1VQN Z;  2Q04 A;  1BLL E;  3CXP A;  5T64 A;  4JJX A;  1BPM A;  1KD1 2;  3Q87 A;  2FIA A;  3KI9 A;  2VPZ A;  3P2H A;  4UIB A;  3RZA A;  5K8P A;  4CRY B;  2BSW A;  5F49 A;  3VTN A;  4A39 A;  2YND A;  3B2Y A;  1YIT Z;  4NJR A;  1USP A;  2HF1 A;  4CL1 A;  3I56 Z;  4P10 A;  2EVN A;  1R9T I;  1KRL A;  3VH9 A;  1CP7 A;  3N5F A;  2GAN A;  2QYV A;  2ZEF A;  1S72 Z;  3IJ3 A;  4MON A;  2V8H A;  2ZEG A;  2GTI A;  3FQM A;  1VQO 1;  4MCR A;  1XEB A;  4NGR A;  1AUG A;  2JA5 I;  1SIW A;  3GYA A;  3D67 A;  1VHE A;  1YR0 A;  3SXN A;  4P4I A;  1Y0Y A;  1YX0 A;  1Y7R A;  1XIX A;  4KLW A;  1QMU A;  2ZOF A;  3UY5 A;  4XX2 A;  3FEC A;  5IX3 A;  2JIR A;  1M1K 1;  3IGR A;  1BOB A;  2Y0S A;  4MHN A;  5I0C A;  2VZZ A;  4MFQ A;  2AYD A;  2Z3N A;  1X3W A;  2WYR A;  1ZO0 A;  4UFX A;  2P28 A;  3D2L A;  2FIW A;  5LRK A;  4MD9 A;  4MHZ A;  4QTU A;  4KOU A;  3WT4 A;  4NFR A;  3HOZ I;  1YJW 1;  4A3J I;  1LOK A;  3GY9 A;  5AN9 F;  2FE7 A;  2CNT A;  1Q81 2;  5ELY A;  2QR1 B;  1VQK 1;  4HGZ A;  2JDD A;  3H0G I;  2AKL A;  4KOY A;  2Z11 A;  3HOY I;  2AFW A;  1QSN A;  1Q2C A;  1NE9 A;  5D1P A;  1R57 A;  4P4E A;  4ZY0 A;  1IYL A;  3IC1 A;  4ZX9 A;  4B5P A;  2AE6 A;  2D4O A;  2OB0 A;  1Z4R A;  2LIY A;  1S60 A;  2O28 A;  4MCS A;  3CCL 1;  5JH9 A;  5EC4 A;  4KVM E;  1YSJ A;  5K8M A;  1VQP 1;  3KR5 A;  3TDH B;  5EBV A;  4A38 A;  1VIX A;  2B3U A;  4MFK A;  4MH4 A;  2JNY A;  2VL1 A;  4P45 A;  4KVX A;  2QEX 1;  1YLO A;  3A9L A;  2J8N A;  3R95 A;  3NDI A;  1Y1V I;  1K4J A;  4NEX A;  5C4X I;  4HNY B;  4X2T A;  1P4N A;  3S1R I;  4OC4 A;  1TWF I;  3FVL A;  4AXV A;  1YLE A;  3IU1 A;  4RS4 A;  2VPX A;  2BOA A;  2VPW A;  2GU2 A;  3CC7 1;  2OTJ 1;  3I4M I;  3E0K A;  1YRE A;  2RIQ A;  5IP9 I;  1J4J A;  4OKO A;  4UIA A;  4YWY A;  2C6P A;  1KUV A;  2J8M A;  2PQ8 A;  3D6W A;  2RFH A;  3PO2 I;  4PSX A;  3LD2 A;  1BAV A;  1RO4 A;  4OC3 A;  3VMI A;  3GKR A;  2QJ8 A;  1R43 A;  3LAC A;  3PB6 X;  1TKH A;  2JIP A;  2GLF A;  4UFW A;  4E2X A;  3F3P C;  2O53 A;  4CAF A;  1QST A;  3VB9 A;  3QB8 A;  1PU9 A;  3TCV A;  3CXC Y;  2M48 A;  2JEV A;  1MJ9 A;  4HGY A;  1DTD A;  2DF5 A;  2F5I A;  2H5M A;  1L0C A;  3N7Z A;  1JQG A;  3D7F A;  4UWJ A;  1NJI 2;  3JAM f;  4FD6 A;  4R8F A;  1QSR A;  2V8J A;  3CC4 1;  3OWC A;  3CC2 Z;  3LMS A;  2B63 I;  3B3W A;  1CX8 A;  1NSA A;  5H86 A;  1RTQ A;  2EUI A;  4P4B A;  2PJ2 A;  2ZW7 A;  1Q86 1;  3S17 I;  3HUV A;  2OTJ Z;  2YNC C;  3I56 1;  3CC7 Z;  2Y0M A;  3CCQ 1;  5G1Z A;  1M90 2;  2JDC A;  5F46 A;  2I79 A;  4B14 A;  2Q4Z A;  2B58 A;  3W6X A;  2E2I I;  3FB3 A;  4DJL A;  3IU2 A;  2ATR A;  3C26 A;  1XE4 A;  1ARM A; 
#chains in the Genus database with same CATH homology
 2LFU A;  4EWC A;  4BBS I;  5A2Q f;  2R93 I;  3G4S 1;  1RLY A;  1VQL Z;  4R6T A;  4MCP A;  3WC5 A;  3FQQ A;  1USP B;  2CTB A;  3JAM b;  4NGP A;  4E32 A;  1VQP Z;  2AFX A;  2EK8 A;  3CT9 A;  2YU9 I;  1UWY A;  5FLX f;  5HXD A;  2W03 A;  3D66 A;  2JMO A;  5LYF A;  4MMO A;  3H3V J;  1Y0R A;  3CMA 1;  1XFO A;  3I55 1;  5T6B A;  2JEW A;  5HVG A;  1I3Q I;  3MN8 A;  3KHX A;  2ABZ A;  2QKD A;  4DGL A;  2ZEH A;  1I50 I;  5T67 A;  2M6N A;  3EER A;  4G1P A;  1JWH C;  1JJ2 Y;  3KQZ A;  2NVY I;  3PBB A;  5HVH A;  3S1N I;  2XEG A;  4YU9 A;  2O4H A;  2PJC A;  1WW9 A;  3L2N A;  3FMC A;  1PFT A;  1QF8 A;  4MD8 A;  1XMB A;  4O23 A;  1QVG Z;  2OOY B;  1ZLH A;  2QA4 Z;  1CPS A;  4EFD A;  3GTL I;  4A3G I;  1Z2L A;  3P5J B;  3CCJ 1;  2V8D A;  1ZG8 A;  2GLJ A;  1YHQ Z;  1ZG9 A;  5JGF A;  4FBE A;  1JJ2 Z;  1XBU A;  2AFM A;  2DE6 A;  1HDU A;  1TF9 A;  2CIJ A;  5I4M A;  3GCF A;  2PCU A;  2QA4 1;  5JM6 A;  5LYI A;  2E9H A;  2C6G A;  1Q82 2;  1QVG Y;  4ZYQ A;  2IZ4 A;  1EE3 P;  1FNO A;  4MCQ A;  4EME A;  4PXE A;  4IHM A;  4A3D I;  3K9T A;  1YUA A;  3IX0 A;  3DLJ A;  3RBU A;  4Y7N I;  2V8V A;  3K2K A;  2ZOG A;  2H85 A;  5IT9 f;  4NBD A;  3BXM A;  4ZY1 A;  1LQL A;  3J7A 4;  4E2Z A;  2QRD B;  3SJG A;  2PRQ A;  4JZ0 A;  2R6M A;  1Y1W I;  1TKJ A;  3I1U A;  1ELM P;  3CME Z;  1VQ8 1;  3CD6 1;  1DL6 A;  4IAV A;  2PJ7 A;  1ZB9 A;  1K8A 1;  3H8F A;  3G6E 1;  4FUU A;  1KC8 2;  5DS0 A;  5F09 A;  1DE4 C;  3SJE A;  1YHQ 1;  1ZG7 A;  3D4U A;  4BD9 A;  2F7V A;  2KPI A;  1TXR A;  1BPN A;  1M4L A;  4A94 A;  1AYE A;  1KWM A;  3GTM I;  4B6Z A;  3GUX A;  8CPA A;  1YJ9 Z;  1Z5R A;  5LRG A;  3BHX A;  3SJX A;  4CPA A;  4PQA A;  4RUH A;  1YIJ 1;  5IB9 A;  4R7M A;  1LAN A;  3RZD I;  4OID A;  3CCV Z;  1Q81 1;  3B35 A;  4H2K A;  1QVF Z;  3CPA A;  2V8I A;  5J1Q A;  1ELL P;  3CDX A;  4OP4 A;  2K5R A;  1XRY A;  2JA8 I;  4PXC A;  3CCQ Z;  3BI1 A;  3HOW I;  2JUB A;  2DEA A;  2PVW A;  3CCS Z;  3PFE A;  4TWE A;  3U50 C;  4E30 A;  4W9Y A;  1I6H I;  4P4J A;  4OIW A;  4E33 A;  3GTJ I;  4NBC A;  4NJQ A;  3V38 A;  2DE7 A;  1W2B Y;  3CPW Y;  1ML8 A;  1QVF Y;  4P4D A;  1Q7Y 1;  1Q86 2;  3CPX A;  3BG0 B;  4R76 A;  3T8W A;  4NGT A;  3CCU Z;  5LYD A;  3CCR Z;  4NGS A;  1VQN 1;  1VQ6 Z;  1YME A;  3IFE A;  1LAM A;  3SI1 A;  1YUK A;  3KIF A;  4MXU A;  1X3Z A;  1VQK Z;  1M90 1;  1VQN Z;  2JBK A;  2WZN A;  1BLL E;  5IT9 b;  2OTL Z;  4NB9 A;  5T64 A;  2CTC A;  4A3I I;  4MRI A;  4NBH A;  1KD1 2;  1BPM A;  4UEF A;  5K8N A;  3Q87 A;  3KI9 A;  2XEJ A;  4UIB A;  3RZA A;  5K8P A;  2KI7 B;  5C3E I;  1N2F A;  3S2D I;  2AFZ A;  4RVD A;  3VTN A;  4A39 A;  1WCM I;  1YIT Z;  2IMO A;  3B2Y A;  2R7Z I;  1USP A;  4NJR A;  1RO0 A;  2E2J I;  2HF1 A;  4CL1 A;  3CCS 1;  3PB4 X;  4RV9 A;  2WB1 A;  3K7A I;  3MRU A;  3I56 Z;  3FH4 A;  3GLJ A;  5C44 I;  5CM2 M;  2PJ1 A;  2C6C A;  4P10 A;  3MZL B;  3GTQ I;  2YAD A;  1R9T I;  1KRL A;  4A3F I;  4WWV A;  3VH9 A;  2XEF A;  2F4M A;  1CP7 A;  1VQ7 Z;  2ZEE A;  3N5F A;  2IZ3 A;  1YJN 1;  3D68 A;  5D29 A;  2QYV A;  2K3R A;  2OOT A;  2ZEF A;  4IK2 A;  1RNI A;  1S72 Z;  3IJ3 A;  4NBA A;  4MON A;  2V8H A;  2ZEG A;  1L1O C;  2GTI A;  3FQM A;  4NB8 A;  4OC2 A;  1TF8 A;  1VQO 1;  3CCU 1;  4EWT A;  3CPW Z;  3G6E Z;  4MCR A;  2NVX I;  3V7Z A;  4GM5 A;  1YI2 Z;  2PJB A;  4NGR A;  1KC8 1;  3FKI I;  1TKF A;  2JA5 I;  2POK A;  3PEI A;  5CBM A;  2V8K A;  3HOX I;  4Q7A A;  3KL9 A;  1TFI A;  2PIZ A;  3FEE A;  1YIT 1;  2WAQ A;  3QWU A;  2RB7 A;  3D67 A;  1VHE A;  4E2W A;  2HU9 A;  4ZI6 A;  4P4I A;  2PJ0 A;  1AMP A;  1QYP A;  1Y0Y A;  3CCV 1;  1TWC I;  1Q82 1;  2CF4 A;  2QEX Z;  6CPA A;  3CCE Z;  1QMU A;  4X8I A;  3D7H A;  2ZOF A;  2EK9 A;  4AYB A;  1VQ6 1;  4ZX8 A;  3IEH A;  4HH4 A;  3MZK B;  4XX2 A;  4NBG A;  3WC7 A;  1Y7E A;  3VMG A;  3FEC A;  3KIH A;  1WII A;  1M1K 1;  4OC5 A;  1FT7 A;  4NGM A;  1YW6 A;  2Y0S A;  1ZB8 A;  1K8A 2;  4MHN A;  3LUS A;  3I4N I;  3WC6 A;  2JR6 A;  4NBF A;  1X3W A;  2WYR A;  2C1C A;  1PCA A;  2P28 A;  3B3C A;  5C4J I;  5D8N A;  2VUG A;  2NVT I;  3GTG I;  2QRC B;  1TWA I;  1Z01 A;  2XEI A;  1K73 2;  5LRK A;  3S9N A;  4MD9 A;  4QTU A;  4MHZ A;  2J6A A;  1HDQ A;  2HB6 A;  3PBE A;  4NFR A;  2PJ4 A;  3HOZ I;  1KD1 1;  1YJW 1;  4UEZ A;  3WT4 A;  1YIJ Z;  4A3J I;  1VQ9 Z;  1LOK A;  3B3V A;  3B7I A;  3VAR A;  1S7M A;  5AN9 F;  1YJ9 1;  2QRE B;  1Q81 2;  5ELY A;  2ANP A;  2RHB A;  1CPX A;  2QR1 B;  1VQK 1;  4HGZ A;  1ZH1 A;  2HC9 A;  3IIB A;  1F57 A;  3F3F C;  3WAB A;  3H0G I;  1NJI 1;  2AKL A;  3CCR 1;  4X6A I;  3HOY I;  2AFW A;  2PM9 A;  1ARL A;  5LYL A;  3I07 A;  5D1P A;  2OR4 A;  2Q43 A;  1VQ8 Z;  4NBE A;  4A3E I;  4P4E A;  3GTO I;  4ZY0 A;  3H8G A;  1VQM 1;  3NH8 A;  5FLM I;  3KHZ A;  1YJW Z;  2EGT A;  3SJF A;  2PK7 A;  3CCL Z;  4F8Z A;  3IC1 A;  3SI0 A;  3IFU A;  1KQS Y;  4KSI A;  4ZX9 A;  3B3S A;  2RT9 A;  4S1T A;  4TNU A;  2PIY A;  2J9A A;  3HLP A;  1VQM Z;  3NA6 A;  2LIY A;  3KZW A;  3HKZ A;  3OW2 Y;  2PMZ A;  4MCS A;  3CCL 1;  3J80 f;  2BCO A;  3PB8 X;  5JH9 A;  2OZK A;  5LL6 f;  1YSJ A;  1CP6 A;  4UEE A;  5K8M A;  2RBL A;  1VQP 1;  3GTP I;  5FLX b;  1F2O A;  1RO2 A;  3KR5 A;  3TDH B;  2ZEL A;  4A38 A;  3GKQ A;  3G4S Z;  1K9M 1;  1VQL 1;  1VIX A;  1XJO A;  3CCJ Z;  4P6Y A;  2JA6 I;  3S9L A;  3OW2 Z;  3FX6 A;  1VHO A;  5THW A;  4MH4 A;  2JNY A;  2VL1 A;  3IO1 A;  4P45 A;  2BJO A;  2QEX 1;  1VQ5 1;  1YLO A;  2R92 I;  2NVQ I;  3NDI A;  4A3C I;  1Y1V I;  2PJ8 A;  5C4X I;  4X2T A;  3NFZ A;  1VQ9 1;  4A37 A;  3S1R I;  2IJZ A;  4OC4 A;  4JYW A;  1ZLI A;  5CPA A;  1TWF I;  3FVL A;  4NGQ A;  3RAM A;  4AXV A;  4DUK A;  3SI2 A;  4RS4 A;  2V77 A;  4BY1 I;  2W04 A;  4ZY2 A;  2PJ5 A;  4BXX I;  3CMA Z;  2BOA A;  5HVF A;  3CXC Z;  2GU2 A;  2P3Y A;  3BG1 B;  3CC7 1;  2F4O A;  4E2Y A;  2OTJ 1;  2AFS A;  3PRT A;  3I4M I;  1YI2 1;  3FJU A;  1P9N A;  2RIQ A;  2AFO A;  1CBX A;  3H8E A;  5IP9 I;  2Q51 A;  3NDJ A;  3M4O I;  3D9X A;  2VUM I;  1X0T A;  1R3N A;  1K83 I;  2JBJ A;  4OKO A;  4UIA A;  4BBR I;  3LWU A;  4YWY A;  2C6P A;  1N8R 2;  1RQF A;  3S1M I;  3D6W A;  3ISX A;  4E31 A;  2RFH A;  3KQX A;  3PO2 I;  3KAS A;  2PJ6 A;  1W2B Z;  4A3B I;  1H8L A;  3B3T A;  2I3C A;  4RVH A;  2F8H A;  1BAV A;  1F2P A;  1RO4 A;  4A3L I;  3HOV I;  3J80 b;  1GYT A;  4OC3 A;  3VMI A;  2PJA A;  3J81 b;  2QJ8 A;  4F9V A;  1R43 A;  1Z02 A;  5IP7 I;  5D1O A;  2G9D A;  4DQY B;  1NP6 A;  3I55 Z;  3PB6 X;  1VGY A;  1TKH A;  4A3K I;  4OC0 A;  2GLF A;  2QVP A;  4E2X A;  4MHP A;  4NGN A;  4BY7 I;  3F3P C;  1M1K 2;  3S2H I;  2PJ9 A;  3BI0 A;  3T4N B;  4FAI A;  2O53 A;  1VQ4 Z;  3JRU A;  5K8O A;  7CPA A;  3VAT A;  4ONW A;  3VB9 A;  4OC1 A;  3PO3 I;  3S9M A;  1VQO Z;  4X3R A;  4WJB A;  3PB7 X;  2PJ3 A;  4DYO A;  1Q7L A;  4PXB A;  3G71 1;  3CCM 1;  3GTM S;  3M3Y I;  3NH4 A;  4Y52 I;  2QLV B;  3GTK I;  3CCM Z;  3CCE 1;  3CXC Y;  2IQ6 A;  2M48 A;  1S72 1;  1K73 1;  4MHY A;  2E2H I;  4HGY A;  1DTD A;  3FF3 A;  2PE3 A;  2DE5 A;  1YW4 A;  2FVG A;  1Z03 A;  3D7D A;  2G2K A;  4K3N A;  3KGQ A;  1Y1V S;  2NSM A;  4F9U A;  2VF1 A;  3HOU I;  3RZO I;  3EED A;  2PVV A;  1QQ9 A;  5A2Q b;  1K9M 2;  1JQG A;  3FED A;  3GB0 A;  3D7F A;  1NJI 2;  3JAM f;  3PO3 S;  2ZEM A;  4R8F A;  2V8J A;  3CC4 1;  3TE5 B;  4P44 A;  3CC2 Z;  4PXD A;  3LMS A;  1LFW A;  3PFO A;  1VLA A;  2B63 I;  3B3W A;  2GRE A;  4NOZ A;  1VQ5 Z;  1CX8 A;  5LRJ A;  1SFO I;  1NSA A;  1Z8L A;  2BO9 A;  3G71 Z;  2V8G A;  2OTL 1;  3IWW A;  3ESW A;  3DGV A;  3MON A;  3VMH A;  1LCP A;  3PB9 X;  1YJN Z;  4FWU A;  3J81 f;  4PPZ A;  3TC8 A;  1VQ7 1;  1RTQ A;  2OOX B;  2ZED A;  1VQ4 1;  2JA7 I;  1IY7 A;  4LQG A;  4P4F A;  4P4B A;  2JS4 A;  2PJ2 A;  2ZEN A;  3CC2 1;  1HEE A;  1Q7Y 2;  1Q86 1;  1IGB A;  3CC4 Z;  3S17 I;  2EWB A;  3HUV A;  3CME 1;  3CD6 Z;  2OTJ Z;  3KR4 A;  3D7G A;  3I56 1;  3CC7 Z;  4NH1 C;  3CCQ 1;  5D1O B;  3S15 I;  1PYT B;  3TX8 A;  1NUI A;  3S1Q I;  4DK1 A;  1N8R 1;  1M90 2;  4Z65 A;  1LAP A;  4RVG A;  2RPR A;  3S14 I;  2ZAE B;  4OME A;  2Q4Z A;  3IF8 A;  1TWG I;  3QNV A;  3S16 I;  3CQZ I;  2GTH A;  1CG2 A;  2AFU A;  2ZEO A;  2E2I I;  4UF4 A;  4A93 I;  1OBR A;  2ZEP A;  4DJL A;  1TWH I;  2NYQ A;  3NH5 A;  3ISZ A;  4A3M I;  1ARM A;  4MD7 A;  4NBB A;  1KQS Z;  4RVF A;  4QTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...