2O53A

Crystal structure of apo-aspartoacylase from human brain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o53A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o53A01
5LYDA 5HVHA 1F57A 4X3RA 2JEWA 2PRQA 2C1CA 2PJBA 1HDUA 4MHYA 5F09A 1AMPA 3V38A 4MHZA 2CF4A 3NH5A 3WC7A 3BHXA 3MRUA 4UEZA 5HXDA 1ARLA 4P6YA 2AFXA 2C6GA 1HDQA 3SJGA 2AFZA 4EMEA 2HC9A 4X8IA 4OIDA 3NH4A 2CIJA 2FVGA 3WC5A 3ISXA 3H8FA 3PBBA 5K8MA 3IJ3A 8CPAA 3HUVA 2PIZA 4P4EA 4IK2A 1DE4C 1CP6A 3D7GA 4OIWA 4YU9A 4NJQA 3IWWA 4OC3A 4FWUA 2PJ4A 3KZWA 3I1UA 3KHXA 4CPAA 3WABA 1BPNA 3RZAA 3B35A 3FJUA 1FT7A 3VARA 1QQ9A 3D7HA 2ZELA 4IAVA 4YWYA 2XEGA 2I3CA 2PVWA 2EWBA 2G9DA 3ISZA 4UIBA 4MHPA 3PEIA 3IFEA 2V8DA 4F9UA 2IMOA 3PB6X 3D4UA 1ARMA 3D7DA 4OKOA 4P10A 5LYLA 4OC2A 4PXDA 4BD9A 4GM5A 4MRIA 1VHEA 4ZYQA 2Q51A 3DLJA 5CBMA 1YMEA 1M4LA 5K8NA 3GLJA 4Z65A 3SI1A 2PJCA 2JBKA 5JGFA 5LYIA 5I4MA 2WYRA 1KWMA 3N5FA 4JYWA 2PJ3A 2PJ1A 4FUUA 3NFZA 2ZEDA 2ZEOA 4OC0A 2ZOGA 4G1PA 4OC4A 3DGVA 2PIYA 3FX6A 4OC5A 2V8GA 2AFWA 2ZEPA 2PJ9A 3BXMA 1BLLE 3FVLA 2V8VA 1TF9A 3RAMA 2RB7A 4K3NA 5LYFA 3S9MA 4ZY1A 1RTQA 1CBXA 1ZLIA 1JQGA 1BPMA 3WT4A 2PJ8A 4R7MA 3B3VA 2BO9A 1ELLP 2O53A 1ELMP 4P45A 3BI0A 1AYEA 3JRUA 4WWVA 2XEFA 5CPAA 3IO1A 3PBEA 1XBUA 1XMBA 2AFMA 5J1QA 2BCOA 4PQAA 4IHMA 2RFHA 1GYTA 1Z5RA 2F8HA 1TKHA 1UWYA 4ZY2A 4DJLA 2PCUA 1ZLHA 1Y0RA 1Q7LA 4MCPA 3SI2A 4F9VA 1R43A 4MMOA 4P4JA 3SJFA 5D8NA 4W9YA 5HVGA 4OP4A 1PCAA 4F8ZA 2QJ8A 4UEEA 3S9NA 3FEDA 1CPSA 4NGPA 1EE3P 4NGSA 4DYOA 2IJZA 2DEAA 2PJ2A 4RUHA 3MN8A 3CT9A 3TC8A 1F2OA 4PXCA 3VH9A 1Y7EA 2GLJA 3WC6A 4LQGA 2XEIA 1Z2LA 2GU2A 2QVPA 1XJOA 3B3CA 2V8HA 4NFRA 2ZEMA 2ZEHA 3KASA 3PB8X 5HVFA 2ZEEA 3RBUA 2O4HA 1ZG8A 1Z8LA 4Q7AA 2BOAA 5IB9A 4PXEA 3BI1A 4NJRA 4NGQA 4PPZA 1OBRA 4KSIA 2ZEFA 4FBEA 4OMEA 2WZNA 4TNUA 4EFDA 1VIXA 4PXBA 2OR4A 3KQZA 2AFOA 1DTDA 3KI9A 4P4BA 3SI0A 3S9LA 4MCQA 1CPXA 3IC1A 4P4DA 4EWTA 3D68A 2C6CA 3PFOA 3KHZA 2PJ6A 1PYTB 2CTBA 4A38A 4MCSA 4TWEA 4JZ0A 3VATA 2ZOFA 4ZY0A 3NA6A 3FMCA 4MXUA 2ANPA 3B7IA 3GB0A 2CTCA 4X2TA 1LOKA 4NGNA 1ZG7A 4ZI6A 1YW6A 1YSJA 1YLOA 3FEEA 5K8OA 1ZG9A 1IGBA 4P44A 3KQXA 1TXRA 1LFWA 1R3NA 4FAIA 3FECA 3B3TA 1XRYA 5ELYA 2F7VA 1LAPA 2C6PA 1LCPA 2PE3A 3SJEA 4ONWA 5LRGA 1CG2A 4H2KA 2PJ5A 2AFSA 3PB7X 5JH9A 2ZEGA 1FNOA 3B2YA 3K2KA 2QYVA 5LRKA 1VHOA 4WJBA 3TX8A 4NGMA 4R6TA 2PJ7A 1H8LA 1VGYA 3HLPA 2PVVA 4DUKA 3B3WA 2JBJA 4A39A 1QMUA 2OOTA 5D29A 1Y0YA 3GUXA 1CX8A 3QNVA 4NGTA 3PB4X 2NSMA 2GLFA 3D67A 2IQ6A 1TKFA 2V77A 2POKA 4B6ZA 1NSAA 2EK9A 5LRJA 2Q43A 4UF4A 4MCRA 3IEHA 3SJXA 3PRTA 1LANA 1F2PA 3D7FA 4A37A 2ZENA 2XEJA 4R76A 4P4IA 3FF3A 5DS0A 2AFUA 3CPXA 3L2NA 3FH4A 4NGRA 1CP7A 1LAMA 4ZX8A 4A94A 2GREA 3NH8A 4AXVA 2NYQA 4ZX9A 3KR4A 1BAVA 1TKJA 3H8GA 3H8EA 1XFOA 3PFEA 4UIAA 1HEEA 1TF8A 2PJ0A 2PJAA 5JM6A 3KGQA 4R8FA 5THWA 3LWUA 2HB6A 3LMSA 3IIBA 4O23A 3B3SA 2VL1A 1IY7A 3CDXA 2ABZA 3PB9X 3V7ZA 4P4FA 3T8WA 6CPAA 2J9AA 3CPAA 5K8PA 3K9TA 3D66A 7CPAA 3KR5A 3KL9A 4UEFA 4OC1A 2Q4ZA 4MHNA 1YW4A 2EK8A
chains in the Genus database with same CATH superfamily
5HVHA 5G22A 3RZOI 4FD6A 2PRQA 2PJBA 3HKZA 2P3YA 2RIQA 4NEXA 4MHYA 4MHZA 2RC4A 3I56Z 2Q04A 3WC7A 3BHXA 3GTGI 2JA5I 1ARLA 2ZW5A 1QVGZ 2AFXA 2C6GA 3SJGA 4HKFA 3CCRZ 1Z8WA 3NH4A 2CIJA 3PZJA 2Q7BA 3G4S1 3WC5A 5K8MA 2EVNA 3IJ3A 2W03A 1L1OC 3I9SA 4IK2A 1N8R2 4GS4A 4CGNA 1YIT1 4NBFA 2E2II 4YU9A 4OC3A 4FWUA 2PJ4A 3KZWA 3RO0A 2VF1A 3G6E1 2Z3NA 3RZAA 1QVGY 1YVKA 3S6FA 4UFWA 2K3RA 3D7HA 2CNSA 3CCV1 2FT0A 2PVWA 3S16I 2EWBA 3VMHA 3ISZA 2DE5A 2H85A 3PB6X 3P2FA 1M1DA 1XE4A 3B8GA 2LIYA 4PXDA 4BD9A 4GM5A 3S1RI 4QB9A 3JAMf 4MRIA 2R7ZI 1KUVA 1VHEA 1XEBA 4HGZA 2Q51A 4Y7NI 3M3YI 1RNIA 4JLYA 2IL4A 4Z65A 5JGFA 3LUSA 1Y8CA 1KWMA 1OZPA 1VQ7Z 4A30A 4KOVA 4OC5A 2ZEPA 2PJ9A 4NCZA 1YI21 2GIVA 1BO4A 4A32A 3RAMA 1S3ZA 1RTQA 2ZAEB 3CC71 3CPWY 2R8VA 1VQKZ 4NXYA 3UY5A 1Y9WA 1LQLA 5GCNA 5DWNA 1ELLP 1QXFA 5IP7I 3S6KA 1ELMP 3I07A 4WWVA 4MFKA 2XEFA 2QA4Z 5CPAA 3PBEA 3RYOA 1XMBA 1M901 2BCOA 2OTJ1 2F8HA 3G8WA 1TKHA 2X7BA 4E2AA 2PCUA 1ZLHA 3ESWA 4CRYB 1VQL1 3CMEZ 1VLAA 4P4JA 3IFUA 1YLEA 5D8NA 3PO3S 5HVGA 3A9LA 2V45A 4OP4A 5AG7A 4CAEA 1PCAA 3D9XA 3S9NA 3FEDA 1EE3P 4DYOA 3R9GA 2PJ2A 3CPWZ 3KIHA 4A3LI 4CS0B 3TC8A 3G711 1Y7RA 1Y7EA 3WC6A 1U6MA 2XEIA 2GU2A 4R3KA 3F0AA 1NUIA 1S60A 4E2WA 2KI7B 3B3CA 4NFRA 2AJ6A 4CYQA 3KASA 1WWZA 1ZB8A 2ARHA 3FYNA 3W6SA 4A95A 4C7HA 4E2ZA 2JDDA 2NVXI 4YRHA 3S1NI 2FIWA 2JR6A 5HVFA 3TOBA 2O4HA 1ZG8A 1YR0A 1Z8LA 5IB9A 4RVFA 4HGYA 4KOSA 4KSIA 2ZEFA 4XNHB 2LEXA 3RZDI 3CCJ1 4C2XA 3TOAA 2AFOA 3TO7A 2WUUA 3TFYA 1CPXA 2AYDA 1Q822 1QSTA 3IC1A 4BBHA 3D68A 2EBJA 4MFQA 4Y49B 5A2Qf 2CTBA 4CYNA 1GHEA 4ZY0A 2EGTA 3FMCA 4CYOA 5LL6f 2E2HI 3T90A 3GTJI 3GB0A 3I4NI 4A3GI 2CTCA 2I00A 1Z03A 1VQPZ 1YJNZ 1ZG7A 2DXQA 3EC4A 1YJ9Z 3GTMI 4R3LA 1YLOA 5AG5A 2G3TA 4AVAA 1TXRA 1R3NA 1K8A2 2CY2A 3B3TA 1XRYA 2PE3A 4CAVA 2JMOA 4ONWA 4ONUA 3BLNA 3SHPA 3D2MA 5F46A 2PJ5A 2JA6I 3GYAA 2NVYI 5JH9A 2ZEGA 3CXCY 5T64A 5J8FA 4A3II 2QYVA 3FB3A 3F3FC 4UWIA 2PVVA 2B4DB 2FSRA 4KZTA 2JBJA 2ZW7A 2WAQA 1I6HI 3CD61 3PB4X 5IX3A 2NSMA 2B3VA 1I12A 2NMTA 2GTHA 2EK9A 5LRJA 4QTTA 1QVFY 1TWCI 3CQZI 2ZENA 2XEJA 1NJI1 1Q821 2CNMA 3FH4A 2E2JI 2JA8I 4A94A 5JPHA 5CM2M 3GTMS 1RQFA 4E0AA 2HQYA 2NYQA 1KD12 5BWAB 2OZUA 3H8GA 3H8EA 1TF8A 2PJ0A 2WB1A 3KGQA 4R8FA 2OTLZ 1KZFA 3VB9A 3IIBA 2Q44A 2VL1A 3GKRA 1NJI2 5F47A 1XF8A 2C27A 2ABZA 3CMAZ 3V7ZA 4BMHA 3SXOA 2A4NA 3K9TA 1Z8TA 2PR8A 5C3EI 4ZGYB 3T4NB 4X6AI 4BXXI 4MHNA 1YI2Z 1A2ZA 5LYDA 3IGRA 1F57A 2BEIA 4MONA 1VQOZ 1P0HA 5F09A 3G6EZ 5FLXf 1BOBA 3TO9A 3I3GA 1RO0A 3MRUA 5F48A 2VUGA 1HDQA 1Z4EA 2FL4A 4EMEA 2Z3LA 4X8IA 4R9MA 4OIDA 4XPDC 4MFLA 5G1ZA 8CPAA 2Z0ZA 4P4EA 1DE4C 2B5GA 4MY3A 3IU2A 1SIWA 5D1OA 3F5BA 1YK3A 2BSWA 3I55Z 4CPAA 3WABA 1CM0A 2DE7A 3HOWI 3B35A 4UCPA 1FT7A 2O28A 4A3KI 3PO3I 3CME1 4DNCA 3GTLI 1K9M1 2I3CA 4YGOA 4UIBA 4F9UA 2ATRA 1TFIA 3BJ8A 4B13A 5CBMA 1JJ2Y 1YMEA 4MBUA 5K8NA 2PJCA 3N5FA 1YGHA 4CGOA 5AGEA 3MZLB 1VQ81 2B63I 1S5KA 4C68A 4OC0A 4FD4A 5C44I 1YUAA 3DGVA 4C2YA 2QA41 3FX6A 1B87A 2V8GA 2AFWA 1MK4A 3GTPI 3DNSA 3BXMA 2AE6A 3S1QI 1AUGA 2YGWA 4H6UA 2RB7A 3HOUI 4K3NA 2P6FA 1TIQA 1CBXA 4A3CI 1IB1E 3I561 1WCMI 1BPMA 2JIQA 5IB0A 4B14A 2BO9A 1SFOI 4NSQA 2RPRA 4XPDB 4MI4A 4XNHC 2FCKA 2G2KA 1M4GA 1ON0A 1YITZ 4PQAA 3CCL1 1X0TA 4IHMA 4MH4A 4CRZB 3GKQA 4KORA 2DPSA 4DJLA 4B5PB 1YHQZ 1KQSZ 1Q7LA 2OB0A 3CXPA 3SI2A 1R43A 5G21A 1KRLA 2V3VA 4F8ZA 2RT9A 1NSLA 1N2FA 4II9A 4RVHA 1YJ91 2IJZA 5EBVA 2JLMA 3CT9A 1F2OA 3VH9A 4E2YA 3PGPA 2GLJA 5T67A 3H5ZA 3GTKI 3CCM1 4CYPA 1VQLZ 4A33A 4IF5A 2ZEMA 2ZEHA 1X3ZA 3PB8X 4MJ8A 3J80b 2VQYA 2YNCA 2ZEEA 3PP9A 3RBUA 4F0XA 4IUSA 4PXEA 1XMTA 4NJRA 3VMGA 1DL6A 1OBRA 2R7HA 4FBEA 1VQP1 4OMEA 4HH4A 2OR4A 2J8NA 1VQK1 1DTDA 4UA3A 3JTKA 5C4XI 3D6WA 2JDCA 3SI0A 3IX0A 1Q811 2Z3OA 2C6CA 4KVXA 4PK3A 1PYTB 2V8JA 2QRCB 4DGLA 1Q861 1MJBA 3VWDA 2B5GB 2ANPA 3B7IA 5A28A 1LOKA 4NGNA 3TE5B 2WSAA 2F4MA 1QSRA 1KC82 1YSJA 4A3EI 2VPYA 2D4OA 2CXAA 1JWHC 1FDOA 4P44A 2JIMA 3G71Z 1LFWA 1QF8A 1TWGI 1Y1WI 4Y52I 2Z10A 4NB9A 4KUBA 1Y1VS 4CAXA 1LAPA 3SJEA 1CG2A 1YX0A 2AFSA 3PB7X 1KD11 1FNOA 1VQ41 1V0CA 4HNWB 4FD7A 1VHOA 2HV2A 4WJBA 1RO5A 1KUYA 3TX8A 1H8LA 1QSNA 1VGYA 3HLPA 4NBCA 3K9UA 1NE9A 4A39A 1Z01A 1ZO0A 1QMUA 2OZHA 2OOTA 5IT9b 5D29A 3GUXA 1CX8A 3FNCA 3QNVA 4NGTA 1YVOA 3D67A 2V77A 4R87A 3CCEZ 3CXCZ 2Q43A 4UF4A 4MCRA 3QB8A 3J81b 1M1K2 1I50I 2GANA 4QTUA 2E7ZA 3FF3A 5DS0A 1S7KA 4UCMA 3L2NA 2J8RA 2IV2X 3CCJZ 5HH1A 1YREA 1Z9UA 2PSWA 4E31A 3GTQI 4RS2A 4MFPA 1K9M2 3MZKB 3DSBA 2F5IA 2GREA 5KTDA 2R1IA 2ZW4A 3NE8A 2H5MA 4NBAA 2B58A 1QVFZ 1XFOA 4GXHA 1HEEA 1Q2DA 2EO8A 4F6AA 2V8KA 3CCQ1 3LWUA 4RN7A 3R9EA 1I1DA 5G20A 4O23A 3B3SA 2REEA 2Q4VA 4M6GA 2ZW6A 3CDXA 1YJWZ 3CZXA 3C26A 3K7AI 4P4FA 3IR7A 2J9AA 3CPAA 1ZB9A 5K8PA 4UFVA 2QMLA 7CPAA 2Q4ZA 4NB8A 3KKWA 1P4NA 2VUMI 2OZKA 1USPA 1YW4A 2OZGA 4M3SA 3S2DI 2JEWA 4NF1A 2C1CA 3V38A 2R93I 2I79A 4UEZA 5HXDA 3QAYA 3QAHA 2OOXB 4P6YA 4OADA 3FBUA 4KLWA 2AFZA 2HC9A 3T9YA 2FVGA 5H86A 1VQ5Z 3PBBA 1PUAA 1S721 4M6IA 2DPTA 3ZJ0A 1UFHA 4NBBA 5FVJA 2VEZA 2YNEA 3D7GA 4A3FI 3IWWA 4KOWA 4HNYB 4E8OA 3I1UA 3KHXA 2IZ4A 3OW2Y 3FJUA 1FY7A 1LRZA 3VARA 4KOXA 2ZELA 3FRMA 3D3SA 1VHSA 4NBEA 3JAMb 3EXNA 1YIJZ 5C82A 2P6GA 3ZZIA 3Q87A 4PK2A 5H84A 3CCLZ 2V8DA 5C88A 4NH1C 3D4UA 1ARMA 2Y0SA 1VQ6Z 3D7DA 4OKOA 4NBDA 4P10A 4OC2A 2PK7A 1IOFA 2OTL1 4BINA 1M4IA 3I551 1TWHI 4PV6A 2JIPA 1MJ9A 1CJWA 2JBKA 5I4MA 4JYWA 3S6HA 4RV9A 3VTNA 4KLVA 2PJ1A 4HNXB 4FUUA 2ZEDA 4MHDA 2OH1A 2P6EA 1QSMA 4OC4A 2PIYA 2QECA 2ZPAA 4ZBGA 1BLLE 2NVQI 3HOXI 2V8VA 1TF9A 1IYKA 4MD7A 4K30A 5LYFA 4ZY1A 1VQO1 1ZLIA 2YADA 1JQGA 2NVTI 1YHQ1 4RVDA 1R57A 4JD6A 2O53A 4H89A 4U9ZA 3S6GA 3BI0A 1AYEA 1K732 3JRUA 1WW9A 2PRBA 2QIRA 3R1KA 2JS4A 2RFHA 1GYTA 2G0BA 3GCFA 1WZNA 1UWYA 4MFJA 1FDIA 2JIOA 5KTCA 4MCPA 4CGMA 4I49A 4MMOA 3SJFA 3S14I 4C2ZA 1Z02A 1P9NA 3I4MI 3LODA 1CPSA 2QKDA 1XIXA 2VI7A 1VQ8Z 3G4SZ 3M4OI 4QVTA 3MN8A 2R6MA 5I0CA 2R98A 2QEX1 2Q4YA 2JIRA 1Z2LA 2HUZA 2QVPA 5ISVA 1RLYA 5AG4A 3IU1A 1VQ91 2ZXVA 1RO2A 1Q7Y1 4MD9A 4E32A 2QREB 1VQM1 2Z11A 4BY1I 3CMA1 4B12A 1K83I 3CCVZ 4Q7AA 4KVME 4A2ZA 4NGQA 1I21A 4PPZA 1KQSY 1Q812 2WZNA 3HOVI 1KUXA 4EFDA 1VIXA 2PR1A 3KQZA 2D4PA 4KUAA 3CXSA 4P4BA 3S9LA 3KHZA 2PJ6A 4Q38A 2FIAA 2DE6A 4TWEA 5DWMA 3H4QA 3LACA 3BG1B 4M85A 1YJW1 5AG6A 1YW6A 1PU9A 4F0YA 4A3JI 1IGBA 4JJXA 3KQXA 3H0GI 4FAIA 4AVCA 2VPZA 4A3DI 5IP9I 5ELYA 3LD2A 2C6PA 3CCE1 4A31A 3F8KA 5LRGA 5CNPA 3DR6A 4MY0A 3S15I 2JEVA 3MONA 4S1TA 3BG0B 1IICA 2VZYA 3B2YA 3K2KA 5LRKA 2PQ8A 4NGMA 4R6TA 2CNTA 3CCMZ 1ZH1A 2PJ7A 4DQYB 1TWAI 4Y49C 2Q7SA 4RI1A 3KIFA 3EO4A 2OOYB 1Y0YA 1K731 3MGDA 1S7MA 5FLMI 2KCWA 3IWEA 2POKA 4B6ZA 5HMNA 2K5RA 1M4DA 3FQMA 3DR8A 3IEHA 3SJXA 3WR7A 3PRTA 4KSFA 3CCR1 3D7FA 1Y1VI 4LQ6A 4M6HA 1S72Z 5IT9f 1QYPA 2AFUA 1YIJ1 4HPSA 3CCUZ 2KPIA 1VQN1 1LAMA 3NH8A 3R96A 4AXVA 4MD8A 4ZX9A 1NP6A 4J3GA 5T6BA 1VKCA 1X3WA 2JNYA 1JJ2Z 2VBQA 4RVGA 4NBGA 4UFXA 2PJAA 2PDOA 4QUSA 2QR1B 5THWA 4LUAA 4CL1A 3E0KA 4AVBA 3D2PA 1R9TI 4B5OA 3PB9X 1S7NA 1Q7Y2 5E96A 1Q2CA 1IYLA 3S2HI 3D2LA 2G3AA 4H6ZA 3CC2Z 3CC4Z 1VQ4Z 2GTIA 3KR5A 3KL9A 3EFAA 4A3MI 4OC1A 4RS4A 2EUIA 2EK8A 3W91A 3DDDA 4X3RA 1HDUA 1QSOA 1AMPA 2CF4A 1I3QI 4YFJA 3NH5A 2PMZA 3V8IA 3H3VJ 4XPKA 3NDIA 1X12A 5A2Qb 4KVOE 1Q2YA 5JQ4A 3ISXA 3H8FA 3N7ZA 1TWFI 4OAEA 4E33A 2PIZA 3HUVA 3S1MI 1MJAA 1CP6A 2IZ3A 4OIWA 2VPXA 3S17I 4NJQA 2LFUA 5FLXb 4U9YA 1BPNA 3J80f 3CCQZ 3NDJA 1QQ9A 3EEDA 4IAVA 4CGLA 4YWYA 2XEGA 2G9DA 4MHPA 3PEIA 1N71A 3IFEA 3J7A4 2FXFA 1PFTA 3GTOI 2IMOA 2WPXA 2PM9A 1USPB 5LYLA 1B6BA 5F49A 3RNZA 3GY9A 1XOVA 4ZYQA 4E30A 3DLJA 1X10A 2BUEA 4KOTA 1M4LA 4B5PA 1K8A1 2AKLA 3GLJA 3SI1A 2QRDB 2V8IA 2RHBA 5LYIA 2WYRA 2YU9I 2RBLA 4L8AA 2PJ3A 4ORFA 4A93I 3NFZA 2E9HA 2ZEOA 2ZOGA 4G1PA 2QEXZ 3CCS1 3VWEA 1VQ51 2JUBA 2M6NA 3JUWA 3FVLA 3HOYI 3TT2A 3S9MA 1VQMZ 3WT4A 2PJ8A 4LX9A 4R7MA 3B3VA 4CGPA 4KSAA 4PSWA 4A3BI 3NE7A 3P2HA 4P45A 2OU2A 2B4BA 3IO1A 4L89A 3TTHA 1XBUA 2AFMA 5J1QA 1YJN1 2J6AA 4UBRA 1Z5RA 3CXQA 1IIDA 4ZY2A 4NBHA 3GIUA 1YUKA 2Z3KA 2M48A 4X5KA 1Y0RA 3EERA 4JWPA 2P28A 4F9VA 1KC81 1IU8A 1M44A 3J81f 4W9YA 3TCVA 4R57A 2QJ8A 4UEEA 2GE3A 3PO2I 2REFA 4KOYA 4NGPA 1RXTA 2B3UA 4NGSA 1VQ71 2DEAA 4RUHA 4CAFA 1N8R1 2Z3MA 5J8CA 4CAWA 4PXCA 4EWCA 3TE4A 4LQGA 5A27A 2QLVB 3EY5A 1XJOA 1L0CA 2V8HA 4UWJA 3TO6A 3JVNA 2VPWA 3FIXA 3CC7Z 4BBSI 5D1OB 1Z4RA 2WPWA 4B11A 4JXQA 2BOAA 3BI1A 2P0WA 5EC4A 1AA6A 4TNUA 4OLLA 1VQNZ 3HOZI 4PXBA 2OTJZ 4MFZA 3KI9A 5IV0A 1S7LA 4MCQA 3VMIA 4P4DA 4EWTA 3D8PA 3IWGA 2K5TA 3PFOA 1ML8A 5AN9F 2Q0YA 4A38A 1M1K1 2YNDA 4MCSA 4JZ0A 3VATA 2ZOFA 3NA6A 5D1PA 4MXUA 4EVYA 4NOZA 4X2TA 3W6XA 4KOUA 4BBRI 4ZI6A 3TDHB 4PSXA 2HF1A 1YQEA 3FEEA 1RO4A 3CC21 5K8OA 1ZG9A 4Q36A 1Q16A 3CD6Z 2FS5A 3FECA 4FD5A 3FQQA 4BY7I 2F7VA 1LCPA 2HU9A 3R95A 4XPLA 4E2XA 4H2KA 2VZZA 3FKII 2J8MA 2F4OA 1VQ61 3CCU1 4AG9A 4AG7A 2GFQA 1Q862 4DUKA 4JXRA 3B3WA 1VQ9Z 3IF8A 1W2BY 1Z8XA 2GLFA 4U5YA 2IQ6A 1TKFA 4KS9A 1K4JA 1NSAA 4B10A 4XX2A 3FXTA 2YNCC 1LANA 1F2PA 4A37A 1WIIA 4DK1A 2JA7I 4R76A 3OWCA 2R92I 4P4IA 4QBJA 3CPXA 4NGRA 1CP7A 4ZX8A 3CC41 1M902 2Y0MA 1W2BZ 2BJOA 3F3PC 3BJ7A 4AB7A 3KR4A 1BAVA 1TKJA 3U50C 3OW2Z 4C7IA 4UIAA 3PFEA 3G3SA 2VXKA 1NMTA 2BL1A 5JM6A 1WJ2A 5KTAA 2Z3PA 3P5JB 2HB6A 2W04A 3LMSA 3QWUA 4QC6A 5EMIA 1WK4A 1IY7A 1JWQA 2NAPA 5C4JI 4UCNA 1IOIA 2FE7A 3SXNA 3T8WA 2DF5A 6CPAA 1S7FA 3R9FA 2ODFA 3D66A 2B4DA 1J4JA 4UEFA 1Y9KA 4AYBA 1SQHA 2PC1A 3CCSZ
chains in the Genus database with same CATH topology
5LYDA 5HVHA 1F57A 3RZOI 3S2DI 4X3RA 2JEWA 2PRQA 2C1CA 2PJBA 3HKZA 1HDUA 2P3YA 2RIQA 4MONA 1VQOZ 4MHYA 5F09A 3G6EZ 5FLXf 1AMPA 4MHZA 3V38A 2CF4A 1I3QI 3I56Z 2R93I 3NH5A 3WC7A 2PMZA 1RO0A 3BHXA 3MRUA 3GTGI 4UEZA 3H3VJ 2VUGA 5HXDA 2JA5I 1ARLA 1QVGZ 2OOXB 4P6YA 2AFXA 2C6GA 3NDIA 1HDQA 5A2Qb 3SJGA 2AFZA 3CCRZ 4EMEA 2HC9A 4X8IA 4OIDA 3NH4A 2CIJA 2FVGA 3G4S1 3WC5A 1VQ5Z 3H8FA 3ISXA 1TWFI 3PBBA 5K8MA 1S721 3IJ3A 2W03A 8CPAA 4E33A 2PIZA 3HUVA 4P4EA 1L1OC 3S1MI 4IK2A 1N8R2 4NBBA 1DE4C 1YIT1 1CP6A 2IZ3A 4NBFA 3D7GA 4OIWA 2E2II 3S17I 5D1OA 4A3FI 4YU9A 4NJQA 3IWWA 4OC3A 4FWUA 2LFUA 2PJ4A 3KZWA 3I1UA 2VF1A 3KHXA 3G6E1 5FLXb 3I55Z 4CPAA 3WABA 2IZ4A 2DE7A 3HOWI 1BPNA 3RZAA 1QVGY 3OW2Y 3J80f 3B35A 3FJUA 1FT7A 4A3KI 3VARA 3CCQZ 3NDJA 2K3RA 3PO3I 3CME1 1QQ9A 2ZELA 3D7HA 3EEDA 4NBEA 3GTLI 3JAMb 4IAVA 1K9M1 3CCV1 4YWYA 2XEGA 2I3CA 2PVWA 3S16I 1YIJZ 2EWBA 2G9DA 3VMHA 3ISZA 2DE5A 4UIBA 3Q87A 4MHPA 3PEIA 3IFEA 3J7A4 3CCLZ 1PFTA 3GTOI 2V8DA 2H85A 4F9UA 2IMOA 3PB6X 4NH1C 3D4UA 1ARMA 2Y0SA 1VQ6Z 3D7DA 2PM9A 4OKOA 1USPB 4NBDA 2LIYA 4P10A 5LYLA 4OC2A 2PK7A 4PXDA 4BD9A 4GM5A 1TFIA 3S1RI 3JAMf 4MRIA 2R7ZI 1VHEA 4ZYQA 4HGZA 4E30A 2OTL1 2Q51A 4Y7NI 3M3YI 3DLJA 5CBMA 3I551 1TWHI 1RNIA 1JJ2Y 1YMEA 1M4LA 1K8A1 5K8NA 2AKLA 3GLJA 4Z65A 3SI1A 2PJCA 2JBKA 2QRDB 2V8IA 5JGFA 2RHBA 3LUSA 5LYIA 5I4MA 2WYRA 1KWMA 2YU9I 3N5FA 4JYWA 4RV9A 2RBLA 2PJ3A 3VTNA 4A93I 2PJ1A 4FUUA 3NFZA 1VQ7Z 2ZEDA 3MZLB 1VQ81 2E9HA 2ZEOA 2B63I 4OC0A 2ZOGA 4G1PA 4OC4A 5C44I 1YUAA 3DGVA 2PIYA 2QA41 2QEXZ 3FX6A 4OC5A 2V8GA 2AFWA 2ZEPA 2PJ9A 3GTPI 3CCS1 1VQ51 3BXMA 1YI21 2JUBA 2M6NA 3S1QI 1BLLE 2NVQI 3FVLA 3HOXI 2V8VA 3HOYI 1TF9A 3RAMA 2RB7A 4MD7A 3HOUI 4K3NA 5LYFA 3S9MA 4ZY1A 1RTQA 1VQO1 2ZAEB 3CC71 1CBXA 1ZLIA 4A3CI 3CPWY 2YADA 3I561 1WCMI 1JQGA 1VQMZ 2NVTI 1VQKZ 1YHQ1 1BPMA 3WT4A 4RVDA 2PJ8A 1LQLA 4R7MA 3B3VA 2BO9A 1ELLP 1SFOI 4A3BI 5IP7I 2O53A 1ELMP 3I07A 4P45A 2RPRA 3BI0A 1AYEA 1K732 3JRUA 4WWVA 2XEFA 2QA4Z 1WW9A 2G2KA 3IO1A 5CPAA 3PBEA 1XBUA 1XMBA 1M901 1YITZ 2AFMA 5J1QA 2BCOA 4PQAA 3CCL1 2JS4A 1X0TA 4IHMA 2RFHA 4MH4A 1YJN1 1GYTA 2J6AA 2OTJ1 1Z5RA 2F8HA 3GCFA 3GKQA 1TKHA 1UWYA 4ZY2A 4DJLA 4NBHA 2PCUA 1ZLHA 1YUKA 3ESWA 1YHQZ 1KQSZ 2M48A 1VQL1 1Y0RA 3EERA 1Q7LA 3CMEZ 4MCPA 2P28A 1VLAA 3SI2A 4F9VA 1R43A 1KC81 4MMOA 4P4JA 3SJFA 3IFUA 5D8NA 3J81f 3PO3S 4W9YA 1KRLA 3S14I 5HVGA 4OP4A 1Z02A 1PCAA 4F8ZA 2QJ8A 2RT9A 4UEEA 1P9NA 3PO2I 3I4MI 3D9XA 3S9NA 3FEDA 1N2FA 1CPSA 4NGPA 2QKDA 1EE3P 4RVHA 4NGSA 1YJ91 4DYOA 2IJZA 1VQ71 2DEAA 2PJ2A 4RUHA 3CPWZ 1VQ8Z 3KIHA 3G4SZ 3M4OI 1N8R1 4A3LI 3MN8A 3CT9A 3TC8A 2R6MA 1F2OA 4PXCA 4E2YA 4EWCA 3G711 2QEX1 5T67A 1Y7EA 2GLJA 3VH9A 3WC6A 4LQGA 3GTKI 2XEIA 1Z2LA 2GU2A 2QLVB 2QVPA 3CCM1 1NUIA 1XJOA 4E2WA 2KI7B 3B3CA 2V8HA 1VQLZ 4NFRA 1RLYA 1VQ91 2ZEMA 2ZEHA 3KASA 1X3ZA 3PB8X 1RO2A 1ZB8A 3CC7Z 1Q7Y1 4BBSI 4MD9A 3J80b 5D1OB 4E32A 2QREB 4E2ZA 1VQM1 2NVXI 3S1NI 2JR6A 5HVFA 2ZEEA 4BY1I 3RBUA 2O4HA 3CMA1 1ZG8A 1Z8LA 1K83I 3CCVZ 4Q7AA 2BOAA 5IB9A 4PXEA 3BI1A 4RVFA 4NJRA 3VMGA 1DL6A 4NGQA 4HGYA 4PPZA 1OBRA 4KSIA 1KQSY 2ZEFA 4FBEA 1VQP1 1Q812 4OMEA 2WZNA 3HOVI 4TNUA 4EFDA 3RZDI 3CCJ1 1VQNZ 3HOZI 4HH4A 1VIXA 4PXBA 2OR4A 3KQZA 2AFOA 2OTJZ 1VQK1 1DTDA 3KI9A 5C4XI 3D6WA 4P4BA 3SI0A 3S9LA 4MCQA 3VMIA 1CPXA 3IC1A 1Q822 3IX0A 4P4DA 4EWTA 3D68A 1Q811 2C6CA 3PFOA 3KHZA 1ML8A 5AN9F 2PJ6A 1PYTB 2V8JA 2DE6A 2QRCB 5A2Qf 4DGLA 2CTBA 1M1K1 4A38A 1Q861 4MCSA 4TWEA 4JZ0A 3VATA 2ZOFA 4ZY0A 3NA6A 2EGTA 5D1PA 3FMCA 4MXUA 5LL6f 2E2HI 2ANPA 3GTJI 3B7IA 3GB0A 3I4NI 4A3GI 3BG1B 2CTCA 2OOTA 1Z03A 1VQPZ 1YJNZ 4NOZA 1YJW1 4X2TA 1LOKA 4NGNA 3TE5B 1ZG7A 4BBRI 4ZI6A 1YW6A 2F4MA 3TDHB 1YJ9Z 3GTMI 1KC82 1YSJA 4A3EI 2HF1A 1YLOA 3FEEA 1RO4A 3CC21 5K8OA 1ZG9A 4A3JI 1JWHC 1IGBA 4P44A 3KQXA 3G71Z 1TXRA 1LFWA 3H0GI 1QF8A 1R3NA 3CD6Z 4FAIA 1K8A2 3FECA 1TWGI 1Y1WI 4Y52I 3B3TA 1XRYA 4A3DI 5IP9I 5ELYA 4NB9A 3FQQA 1Y1VS 4BY7I 2F7VA 1LAPA 2C6PA 1LCPA 2PE3A 3CCE1 2HU9A 3SJEA 2JMOA 4ONWA 5LRGA 1CG2A 4E2XA 4H2KA 3S15I 2PJ5A 2JA6I 2AFSA 3PB7X 2NVYI 3MONA 4S1TA 3BG0B 5JH9A 2ZEGA 3CXCY 5T64A 1KD11 1FNOA 3B2YA 3FKII 1VQ41 4A3II 3K2KA 2QYVA 5LRKA 2F4OA 1VQ61 1VHOA 4WJBA 3F3FC 3TX8A 3CCU1 4NGMA 4R6TA 3CCMZ 1ZH1A 2PJ7A 1H8LA 4DQYB 1VGYA 1TWAI 1Q862 3HLPA 4NBCA 2PVVA 4DUKA 3B3WA 3KIFA 1VQ9Z 2JBJA 4A39A 1Z01A 2WAQA 3IF8A 1QMUA 1I6HI 2OOYB 3CD61 5IT9b 1W2BY 5D29A 1Y0YA 3GUXA 1CX8A 3QNVA 4NGTA 3PB4X 2NSMA 1K731 2GLFA 1S7MA 3D67A 2IQ6A 5FLMI 1TKFA 2V77A 2POKA 4B6ZA 3CCEZ 1NSAA 3CXCZ 2K5RA 2GTHA 4XX2A 2EK9A 5LRJA 3FQMA 2Q43A 4UF4A 4MCRA 3IEHA 4QTTA 1QVFY 3SJXA 3J81b 1TWCI 3PRTA 3CCR1 1LANA 1F2PA 1M1K2 3D7FA 1Y1VI 3CQZI 1I50I 4A37A 2ZENA 1WIIA 4DK1A 2JA7I 2XEJA 4R76A 1S72Z 2R92I 5IT9f 4QTUA 1NJI1 4P4IA 3FF3A 1QYPA 1Q821 5DS0A 2AFUA 3CPXA 1YIJ1 3L2NA 3CCUZ 3FH4A 2E2JI 4NGRA 2KPIA 3CCJZ 1VQN1 1CP7A 1LAMA 4E31A 3GTQI 2JA8I 4ZX8A 3CC41 1M902 1K9M2 4A94A 3MZKB 1W2BZ 2GREA 3NH8A 5CM2M 3GTMS 2BJOA 1RQFA 4AXVA 4MD8A 3F3PC 2NYQA 1KD12 4ZX9A 4NBAA 1NP6A 3KR4A 1BAVA 1TKJA 5T6BA 1QVFZ 3U50C 3OW2Z 1X3WA 2JNYA 1JJ2Z 1XFOA 3H8EA 3H8GA 3PFEA 4UIAA 4RVGA 1HEEA 4NBGA 1TF8A 2PJ0A 2PJAA 5JM6A 2WB1A 3KGQA 4R8FA 2V8KA 3CCQ1 2QR1B 2OTLZ 5THWA 3P5JB 3LWUA 2HB6A 2W04A 3LMSA 3QWUA 3VB9A 4CL1A 3IIBA 4O23A 3B3SA 2VL1A 1R9TI 1NJI2 1IY7A 3CDXA 5C4JI 1YJWZ 2ABZA 3PB9X 1Q7Y2 3CMAZ 3V7ZA 3K7AI 4P4FA 3T8WA 6CPAA 2J9AA 3CPAA 3S2HI 1ZB9A 5K8PA 3CC2Z 3CC4Z 1VQ4Z 3K9TA 3D66A 2GTIA 7CPAA 3KR5A 3KL9A 5C3EI 4UEFA 4A3MI 2Q4ZA 4OC1A 4NB8A 4AYBA 3T4NB 4X6AI 3CCSZ 4RS4A 4BXXI 2VUMI 2OZKA 4MHNA 1YI2Z 1USPA 1YW4A 2EK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LYD A;  5HVH A;  1F57 A;  4X3R A;  2JEW A;  2PRQ A;  2C1C A;  2PJB A;  1HDU A;  4MHY A;  5F09 A;  1AMP A;  3V38 A;  4MHZ A;  2CF4 A;  3NH5 A;  3WC7 A;  3BHX A;  3MRU A;  4UEZ A;  5HXD A;  1ARL A;  4P6Y A;  2AFX A;  2C6G A;  1HDQ A;  3SJG A;  2AFZ A;  4EME A;  2HC9 A;  4X8I A;  4OID A;  3NH4 A;  2CIJ A;  2FVG A;  3WC5 A;  3ISX A;  3H8F A;  3PBB A;  5K8M A;  3IJ3 A;  8CPA A;  3HUV A;  2PIZ A;  4P4E A;  4IK2 A;  1DE4 C;  1CP6 A;  3D7G A;  4OIW A;  4YU9 A;  4NJQ A;  3IWW A;  4OC3 A;  4FWU A;  2PJ4 A;  3KZW A;  3I1U A;  3KHX A;  4CPA A;  3WAB A;  1BPN A;  3RZA A;  3B35 A;  3FJU A;  1FT7 A;  3VAR A;  1QQ9 A;  3D7H A;  2ZEL A;  4IAV A;  4YWY A;  2XEG A;  2I3C A;  2PVW A;  2EWB A;  2G9D A;  3ISZ A;  4UIB A;  4MHP A;  3PEI A;  3IFE A;  2V8D A;  4F9U A;  2IMO A;  3PB6 X;  3D4U A;  1ARM A;  3D7D A;  4OKO A;  4P10 A;  5LYL A;  4OC2 A;  4PXD A;  4BD9 A;  4GM5 A;  4MRI A;  1VHE A;  4ZYQ A;  2Q51 A;  3DLJ A;  5CBM A;  1YME A;  1M4L A;  5K8N A;  3GLJ A;  4Z65 A;  3SI1 A;  2PJC A;  2JBK A;  5JGF A;  5LYI A;  5I4M A;  2WYR A;  1KWM A;  3N5F A;  4JYW A;  2PJ3 A;  2PJ1 A;  4FUU A;  3NFZ A;  2ZED A;  2ZEO A;  4OC0 A;  2ZOG A;  4G1P A;  4OC4 A;  3DGV A;  2PIY A;  3FX6 A;  4OC5 A;  2V8G A;  2AFW A;  2ZEP A;  2PJ9 A;  3BXM A;  1BLL E;  3FVL A;  2V8V A;  1TF9 A;  3RAM A;  2RB7 A;  4K3N A;  5LYF A;  3S9M A;  4ZY1 A;  1RTQ A;  1CBX A;  1ZLI A;  1JQG A;  1BPM A;  3WT4 A;  2PJ8 A;  4R7M A;  3B3V A;  2BO9 A;  1ELL P;  2O53 A;  1ELM P;  4P45 A;  3BI0 A;  1AYE A;  3JRU A;  4WWV A;  2XEF A;  5CPA A;  3IO1 A;  3PBE A;  1XBU A;  1XMB A;  2AFM A;  5J1Q A;  2BCO A;  4PQA A;  4IHM A;  2RFH A;  1GYT A;  1Z5R A;  2F8H A;  1TKH A;  1UWY A;  4ZY2 A;  4DJL A;  2PCU A;  1ZLH A;  1Y0R A;  1Q7L A;  4MCP A;  3SI2 A;  4F9V A;  1R43 A;  4MMO A;  4P4J A;  3SJF A;  5D8N A;  4W9Y A;  5HVG A;  4OP4 A;  1PCA A;  4F8Z A;  2QJ8 A;  4UEE A;  3S9N A;  3FED A;  1CPS A;  4NGP A;  1EE3 P;  4NGS A;  4DYO A;  2IJZ A;  2DEA A;  2PJ2 A;  4RUH A;  3MN8 A;  3CT9 A;  3TC8 A;  1F2O A;  4PXC A;  3VH9 A;  1Y7E A;  2GLJ A;  3WC6 A;  4LQG A;  2XEI A;  1Z2L A;  2GU2 A;  2QVP A;  1XJO A;  3B3C A;  2V8H A;  4NFR A;  2ZEM A;  2ZEH A;  3KAS A;  3PB8 X;  5HVF A;  2ZEE A;  3RBU A;  2O4H A;  1ZG8 A;  1Z8L A;  4Q7A A;  2BOA A;  5IB9 A;  4PXE A;  3BI1 A;  4NJR A;  4NGQ A;  4PPZ A;  1OBR A;  4KSI A;  2ZEF A;  4FBE A;  4OME A;  2WZN A;  4TNU A;  4EFD A;  1VIX A;  4PXB A;  2OR4 A;  3KQZ A;  2AFO A;  1DTD A;  3KI9 A;  4P4B A;  3SI0 A;  3S9L A;  4MCQ A;  1CPX A;  3IC1 A;  4P4D A;  4EWT A;  3D68 A;  2C6C A;  3PFO A;  3KHZ A;  2PJ6 A;  1PYT B;  2CTB A;  4A38 A;  4MCS A;  4TWE A;  4JZ0 A;  3VAT A;  2ZOF A;  4ZY0 A;  3NA6 A;  3FMC A;  4MXU A;  2ANP A;  3B7I A;  3GB0 A;  2CTC A;  4X2T A;  1LOK A;  4NGN A;  1ZG7 A;  4ZI6 A;  1YW6 A;  1YSJ A;  1YLO A;  3FEE A;  5K8O A;  1ZG9 A;  1IGB A;  4P44 A;  3KQX A;  1TXR A;  1LFW A;  1R3N A;  4FAI A;  3FEC A;  3B3T A;  1XRY A;  5ELY A;  2F7V A;  1LAP A;  2C6P A;  1LCP A;  2PE3 A;  3SJE A;  4ONW A;  5LRG A;  1CG2 A;  4H2K A;  2PJ5 A;  2AFS A;  3PB7 X;  5JH9 A;  2ZEG A;  1FNO A;  3B2Y A;  3K2K A;  2QYV A;  5LRK A;  1VHO A;  4WJB A;  3TX8 A;  4NGM A;  4R6T A;  2PJ7 A;  1H8L A;  1VGY A;  3HLP A;  2PVV A;  4DUK A;  3B3W A;  2JBJ A;  4A39 A;  1QMU A;  2OOT A;  5D29 A;  1Y0Y A;  3GUX A;  1CX8 A;  3QNV A;  4NGT A;  3PB4 X;  2NSM A;  2GLF A;  3D67 A;  2IQ6 A;  1TKF A;  2V77 A;  2POK A;  4B6Z A;  1NSA A;  2EK9 A;  5LRJ A;  2Q43 A;  4UF4 A;  4MCR A;  3IEH A;  3SJX A;  3PRT A;  1LAN A;  1F2P A;  3D7F A;  4A37 A;  2ZEN A;  2XEJ A;  4R76 A;  4P4I A;  3FF3 A;  5DS0 A;  2AFU A;  3CPX A;  3L2N A;  3FH4 A;  4NGR A;  1CP7 A;  1LAM A;  4ZX8 A;  4A94 A;  2GRE A;  3NH8 A;  4AXV A;  2NYQ A;  4ZX9 A;  3KR4 A;  1BAV A;  1TKJ A;  3H8G A;  3H8E A;  1XFO A;  3PFE A;  4UIA A;  1HEE A;  1TF8 A;  2PJ0 A;  2PJA A;  5JM6 A;  3KGQ A;  4R8F A;  5THW A;  3LWU A;  2HB6 A;  3LMS A;  3IIB A;  4O23 A;  3B3S A;  2VL1 A;  1IY7 A;  3CDX A;  2ABZ A;  3PB9 X;  3V7Z A;  4P4F A;  3T8W A;  6CPA A;  2J9A A;  3CPA A;  5K8P A;  3K9T A;  3D66 A;  7CPA A;  3KR5 A;  3KL9 A;  4UEF A;  4OC1 A;  2Q4Z A;  4MHN A;  1YW4 A;  2EK8 A; 
#chains in the Genus database with same CATH topology
 5HVH A;  5G22 A;  3RZO I;  4FD6 A;  2PRQ A;  2PJB A;  3HKZ A;  2P3Y A;  2RIQ A;  4NEX A;  4MHY A;  4MHZ A;  2RC4 A;  3I56 Z;  2Q04 A;  3WC7 A;  3BHX A;  3GTG I;  2JA5 I;  1ARL A;  2ZW5 A;  1QVG Z;  2AFX A;  2C6G A;  3SJG A;  4HKF A;  3CCR Z;  1Z8W A;  3NH4 A;  2CIJ A;  3PZJ A;  2Q7B A;  3G4S 1;  3WC5 A;  5K8M A;  2EVN A;  3IJ3 A;  2W03 A;  1L1O C;  3I9S A;  4IK2 A;  1N8R 2;  4GS4 A;  4CGN A;  1YIT 1;  4NBF A;  2E2I I;  4YU9 A;  4OC3 A;  4FWU A;  2PJ4 A;  3KZW A;  3RO0 A;  2VF1 A;  3G6E 1;  2Z3N A;  3RZA A;  1QVG Y;  1YVK A;  3S6F A;  4UFW A;  2K3R A;  3D7H A;  2CNS A;  3CCV 1;  2FT0 A;  2PVW A;  3S16 I;  2EWB A;  3VMH A;  3ISZ A;  2DE5 A;  2H85 A;  3PB6 X;  3P2F A;  1M1D A;  1XE4 A;  3B8G A;  2LIY A;  4PXD A;  4BD9 A;  4GM5 A;  3S1R I;  4QB9 A;  3JAM f;  4MRI A;  2R7Z I;  1KUV A;  1VHE A;  1XEB A;  4HGZ A;  2Q51 A;  4Y7N I;  3M3Y I;  1RNI A;  4JLY A;  2IL4 A;  4Z65 A;  5JGF A;  3LUS A;  1Y8C A;  1KWM A;  1OZP A;  1VQ7 Z;  4A30 A;  4KOV A;  4OC5 A;  2ZEP A;  2PJ9 A;  4NCZ A;  1YI2 1;  2GIV A;  1BO4 A;  4A32 A;  3RAM A;  1S3Z A;  1RTQ A;  2ZAE B;  3CC7 1;  3CPW Y;  2R8V A;  1VQK Z;  4NXY A;  3UY5 A;  1Y9W A;  1LQL A;  5GCN A;  5DWN A;  1ELL P;  1QXF A;  5IP7 I;  3S6K A;  1ELM P;  3I07 A;  4WWV A;  4MFK A;  2XEF A;  2QA4 Z;  5CPA A;  3PBE A;  3RYO A;  1XMB A;  1M90 1;  2BCO A;  2OTJ 1;  2F8H A;  3G8W A;  1TKH A;  2X7B A;  4E2A A;  2PCU A;  1ZLH A;  3ESW A;  4CRY B;  1VQL 1;  3CME Z;  1VLA A;  4P4J A;  3IFU A;  1YLE A;  5D8N A;  3PO3 S;  5HVG A;  3A9L A;  2V45 A;  4OP4 A;  5AG7 A;  4CAE A;  1PCA A;  3D9X A;  3S9N A;  3FED A;  1EE3 P;  4DYO A;  3R9G A;  2PJ2 A;  3CPW Z;  3KIH A;  4A3L I;  4CS0 B;  3TC8 A;  3G71 1;  1Y7R A;  1Y7E A;  3WC6 A;  1U6M A;  2XEI A;  2GU2 A;  4R3K A;  3F0A A;  1NUI A;  1S60 A;  4E2W A;  2KI7 B;  3B3C A;  4NFR A;  2AJ6 A;  4CYQ A;  3KAS A;  1WWZ A;  1ZB8 A;  2ARH A;  3FYN A;  3W6S A;  4A95 A;  4C7H A;  4E2Z A;  2JDD A;  2NVX I;  4YRH A;  3S1N I;  2FIW A;  2JR6 A;  5HVF A;  3TOB A;  2O4H A;  1ZG8 A;  1YR0 A;  1Z8L A;  5IB9 A;  4RVF A;  4HGY A;  4KOS A;  4KSI A;  2ZEF A;  4XNH B;  2LEX A;  3RZD I;  3CCJ 1;  4C2X A;  3TOA A;  2AFO A;  3TO7 A;  2WUU A;  3TFY A;  1CPX A;  2AYD A;  1Q82 2;  1QST A;  3IC1 A;  4BBH A;  3D68 A;  2EBJ A;  4MFQ A;  4Y49 B;  5A2Q f;  2CTB A;  4CYN A;  1GHE A;  4ZY0 A;  2EGT A;  3FMC A;  4CYO A;  5LL6 f;  2E2H I;  3T90 A;  3GTJ I;  3GB0 A;  3I4N I;  4A3G I;  2CTC A;  2I00 A;  1Z03 A;  1VQP Z;  1YJN Z;  1ZG7 A;  2DXQ A;  3EC4 A;  1YJ9 Z;  3GTM I;  4R3L A;  1YLO A;  5AG5 A;  2G3T A;  4AVA A;  1TXR A;  1R3N A;  1K8A 2;  2CY2 A;  3B3T A;  1XRY A;  2PE3 A;  4CAV A;  2JMO A;  4ONW A;  4ONU A;  3BLN A;  3SHP A;  3D2M A;  5F46 A;  2PJ5 A;  2JA6 I;  3GYA A;  2NVY I;  5JH9 A;  2ZEG A;  3CXC Y;  5T64 A;  5J8F A;  4A3I I;  2QYV A;  3FB3 A;  3F3F C;  4UWI A;  2PVV A;  2B4D B;  2FSR A;  4KZT A;  2JBJ A;  2ZW7 A;  2WAQ A;  1I6H I;  3CD6 1;  3PB4 X;  5IX3 A;  2NSM A;  2B3V A;  1I12 A;  2NMT A;  2GTH A;  2EK9 A;  5LRJ A;  4QTT A;  1QVF Y;  1TWC I;  3CQZ I;  2ZEN A;  2XEJ A;  1NJI 1;  1Q82 1;  2CNM A;  3FH4 A;  2E2J I;  2JA8 I;  4A94 A;  5JPH A;  5CM2 M;  3GTM S;  1RQF A;  4E0A A;  2HQY A;  2NYQ A;  1KD1 2;  5BWA B;  2OZU A;  3H8G A;  3H8E A;  1TF8 A;  2PJ0 A;  2WB1 A;  3KGQ A;  4R8F A;  2OTL Z;  1KZF A;  3VB9 A;  3IIB A;  2Q44 A;  2VL1 A;  3GKR A;  1NJI 2;  5F47 A;  1XF8 A;  2C27 A;  2ABZ A;  3CMA Z;  3V7Z A;  4BMH A;  3SXO A;  2A4N A;  3K9T A;  1Z8T A;  2PR8 A;  5C3E I;  4ZGY B;  3T4N B;  4X6A I;  4BXX I;  4MHN A;  1YI2 Z;  1A2Z A;  5LYD A;  3IGR A;  1F57 A;  2BEI A;  4MON A;  1VQO Z;  1P0H A;  5F09 A;  3G6E Z;  5FLX f;  1BOB A;  3TO9 A;  3I3G A;  1RO0 A;  3MRU A;  5F48 A;  2VUG A;  1HDQ A;  1Z4E A;  2FL4 A;  4EME A;  2Z3L A;  4X8I A;  4R9M A;  4OID A;  4XPD C;  4MFL A;  5G1Z A;  8CPA A;  2Z0Z A;  4P4E A;  1DE4 C;  2B5G A;  4MY3 A;  3IU2 A;  1SIW A;  5D1O A;  3F5B A;  1YK3 A;  2BSW A;  3I55 Z;  4CPA A;  3WAB A;  1CM0 A;  2DE7 A;  3HOW I;  3B35 A;  4UCP A;  1FT7 A;  2O28 A;  4A3K I;  3PO3 I;  3CME 1;  4DNC A;  3GTL I;  1K9M 1;  2I3C A;  4YGO A;  4UIB A;  4F9U A;  2ATR A;  1TFI A;  3BJ8 A;  4B13 A;  5CBM A;  1JJ2 Y;  1YME A;  4MBU A;  5K8N A;  2PJC A;  3N5F A;  1YGH A;  4CGO A;  5AGE A;  3MZL B;  1VQ8 1;  2B63 I;  1S5K A;  4C68 A;  4OC0 A;  4FD4 A;  5C44 I;  1YUA A;  3DGV A;  4C2Y A;  2QA4 1;  3FX6 A;  1B87 A;  2V8G A;  2AFW A;  1MK4 A;  3GTP I;  3DNS A;  3BXM A;  2AE6 A;  3S1Q I;  1AUG A;  2YGW A;  4H6U A;  2RB7 A;  3HOU I;  4K3N A;  2P6F A;  1TIQ A;  1CBX A;  4A3C I;  1IB1 E;  3I56 1;  1WCM I;  1BPM A;  2JIQ A;  5IB0 A;  4B14 A;  2BO9 A;  1SFO I;  4NSQ A;  2RPR A;  4XPD B;  4MI4 A;  4XNH C;  2FCK A;  2G2K A;  1M4G A;  1ON0 A;  1YIT Z;  4PQA A;  3CCL 1;  1X0T A;  4IHM A;  4MH4 A;  4CRZ B;  3GKQ A;  4KOR A;  2DPS A;  4DJL A;  4B5P B;  1YHQ Z;  1KQS Z;  1Q7L A;  2OB0 A;  3CXP A;  3SI2 A;  1R43 A;  5G21 A;  1KRL A;  2V3V A;  4F8Z A;  2RT9 A;  1NSL A;  1N2F A;  4II9 A;  4RVH A;  1YJ9 1;  2IJZ A;  5EBV A;  2JLM A;  3CT9 A;  1F2O A;  3VH9 A;  4E2Y A;  3PGP A;  2GLJ A;  5T67 A;  3H5Z A;  3GTK I;  3CCM 1;  4CYP A;  1VQL Z;  4A33 A;  4IF5 A;  2ZEM A;  2ZEH A;  1X3Z A;  3PB8 X;  4MJ8 A;  3J80 b;  2VQY A;  2YNC A;  2ZEE A;  3PP9 A;  3RBU A;  4F0X A;  4IUS A;  4PXE A;  1XMT A;  4NJR A;  3VMG A;  1DL6 A;  1OBR A;  2R7H A;  4FBE A;  1VQP 1;  4OME A;  4HH4 A;  2OR4 A;  2J8N A;  1VQK 1;  1DTD A;  4UA3 A;  3JTK A;  5C4X I;  3D6W A;  2JDC A;  3SI0 A;  3IX0 A;  1Q81 1;  2Z3O A;  2C6C A;  4KVX A;  4PK3 A;  1PYT B;  2V8J A;  2QRC B;  4DGL A;  1Q86 1;  1MJB A;  3VWD A;  2B5G B;  2ANP A;  3B7I A;  5A28 A;  1LOK A;  4NGN A;  3TE5 B;  2WSA A;  2F4M A;  1QSR A;  1KC8 2;  1YSJ A;  4A3E I;  2VPY A;  2D4O A;  2CXA A;  1JWH C;  1FDO A;  4P44 A;  2JIM A;  3G71 Z;  1LFW A;  1QF8 A;  1TWG I;  1Y1W I;  4Y52 I;  2Z10 A;  4NB9 A;  4KUB A;  1Y1V S;  4CAX A;  1LAP A;  3SJE A;  1CG2 A;  1YX0 A;  2AFS A;  3PB7 X;  1KD1 1;  1FNO A;  1VQ4 1;  1V0C A;  4HNW B;  4FD7 A;  1VHO A;  2HV2 A;  4WJB A;  1RO5 A;  1KUY A;  3TX8 A;  1H8L A;  1QSN A;  1VGY A;  3HLP A;  4NBC A;  3K9U A;  1NE9 A;  4A39 A;  1Z01 A;  1ZO0 A;  1QMU A;  2OZH A;  2OOT A;  5IT9 b;  5D29 A;  3GUX A;  1CX8 A;  3FNC A;  3QNV A;  4NGT A;  1YVO A;  3D67 A;  2V77 A;  4R87 A;  3CCE Z;  3CXC Z;  2Q43 A;  4UF4 A;  4MCR A;  3QB8 A;  3J81 b;  1M1K 2;  1I50 I;  2GAN A;  4QTU A;  2E7Z A;  3FF3 A;  5DS0 A;  1S7K A;  4UCM A;  3L2N A;  2J8R A;  2IV2 X;  3CCJ Z;  5HH1 A;  1YRE A;  1Z9U A;  2PSW A;  4E31 A;  3GTQ I;  4RS2 A;  4MFP A;  1K9M 2;  3MZK B;  3DSB A;  2F5I A;  2GRE A;  5KTD A;  2R1I A;  2ZW4 A;  3NE8 A;  2H5M A;  4NBA A;  2B58 A;  1QVF Z;  1XFO A;  4GXH A;  1HEE A;  1Q2D A;  2EO8 A;  4F6A A;  2V8K A;  3CCQ 1;  3LWU A;  4RN7 A;  3R9E A;  1I1D A;  5G20 A;  4O23 A;  3B3S A;  2REE A;  2Q4V A;  4M6G A;  2ZW6 A;  3CDX A;  1YJW Z;  3CZX A;  3C26 A;  3K7A I;  4P4F A;  3IR7 A;  2J9A A;  3CPA A;  1ZB9 A;  5K8P A;  4UFV A;  2QML A;  7CPA A;  2Q4Z A;  4NB8 A;  3KKW A;  1P4N A;  2VUM I;  2OZK A;  1USP A;  1YW4 A;  2OZG A;  4M3S A;  3S2D I;  2JEW A;  4NF1 A;  2C1C A;  3V38 A;  2R93 I;  2I79 A;  4UEZ A;  5HXD A;  3QAY A;  3QAH A;  2OOX B;  4P6Y A;  4OAD A;  3FBU A;  4KLW A;  2AFZ A;  2HC9 A;  3T9Y A;  2FVG A;  5H86 A;  1VQ5 Z;  3PBB A;  1PUA A;  1S72 1;  4M6I A;  2DPT A;  3ZJ0 A;  1UFH A;  4NBB A;  5FVJ A;  2VEZ A;  2YNE A;  3D7G A;  4A3F I;  3IWW A;  4KOW A;  4HNY B;  4E8O A;  3I1U A;  3KHX A;  2IZ4 A;  3OW2 Y;  3FJU A;  1FY7 A;  1LRZ A;  3VAR A;  4KOX A;  2ZEL A;  3FRM A;  3D3S A;  1VHS A;  4NBE A;  3JAM b;  3EXN A;  1YIJ Z;  5C82 A;  2P6G A;  3ZZI A;  3Q87 A;  4PK2 A;  5H84 A;  3CCL Z;  2V8D A;  5C88 A;  4NH1 C;  3D4U A;  1ARM A;  2Y0S A;  1VQ6 Z;  3D7D A;  4OKO A;  4NBD A;  4P10 A;  4OC2 A;  2PK7 A;  1IOF A;  2OTL 1;  4BIN A;  1M4I A;  3I55 1;  1TWH I;  4PV6 A;  2JIP A;  1MJ9 A;  1CJW A;  2JBK A;  5I4M A;  4JYW A;  3S6H A;  4RV9 A;  3VTN A;  4KLV A;  2PJ1 A;  4HNX B;  4FUU A;  2ZED A;  4MHD A;  2OH1 A;  2P6E A;  1QSM A;  4OC4 A;  2PIY A;  2QEC A;  2ZPA A;  4ZBG A;  1BLL E;  2NVQ I;  3HOX I;  2V8V A;  1TF9 A;  1IYK A;  4MD7 A;  4K30 A;  5LYF A;  4ZY1 A;  1VQO 1;  1ZLI A;  2YAD A;  1JQG A;  2NVT I;  1YHQ 1;  4RVD A;  1R57 A;  4JD6 A;  2O53 A;  4H89 A;  4U9Z A;  3S6G A;  3BI0 A;  1AYE A;  1K73 2;  3JRU A;  1WW9 A;  2PRB A;  2QIR A;  3R1K A;  2JS4 A;  2RFH A;  1GYT A;  2G0B A;  3GCF A;  1WZN A;  1UWY A;  4MFJ A;  1FDI A;  2JIO A;  5KTC A;  4MCP A;  4CGM A;  4I49 A;  4MMO A;  3SJF A;  3S14 I;  4C2Z A;  1Z02 A;  1P9N A;  3I4M I;  3LOD A;  1CPS A;  2QKD A;  1XIX A;  2VI7 A;  1VQ8 Z;  3G4S Z;  3M4O I;  4QVT A;  3MN8 A;  2R6M A;  5I0C A;  2R98 A;  2QEX 1;  2Q4Y A;  2JIR A;  1Z2L A;  2HUZ A;  2QVP A;  5ISV A;  1RLY A;  5AG4 A;  3IU1 A;  1VQ9 1;  2ZXV A;  1RO2 A;  1Q7Y 1;  4MD9 A;  4E32 A;  2QRE B;  1VQM 1;  2Z11 A;  4BY1 I;  3CMA 1;  4B12 A;  1K83 I;  3CCV Z;  4Q7A A;  4KVM E;  4A2Z A;  4NGQ A;  1I21 A;  4PPZ A;  1KQS Y;  1Q81 2;  2WZN A;  3HOV I;  1KUX A;  4EFD A;  1VIX A;  2PR1 A;  3KQZ A;  2D4P A;  4KUA A;  3CXS A;  4P4B A;  3S9L A;  3KHZ A;  2PJ6 A;  4Q38 A;  2FIA A;  2DE6 A;  4TWE A;  5DWM A;  3H4Q A;  3LAC A;  3BG1 B;  4M85 A;  1YJW 1;  5AG6 A;  1YW6 A;  1PU9 A;  4F0Y A;  4A3J I;  1IGB A;  4JJX A;  3KQX A;  3H0G I;  4FAI A;  4AVC A;  2VPZ A;  4A3D I;  5IP9 I;  5ELY A;  3LD2 A;  2C6P A;  3CCE 1;  4A31 A;  3F8K A;  5LRG A;  5CNP A;  3DR6 A;  4MY0 A;  3S15 I;  2JEV A;  3MON A;  4S1T A;  3BG0 B;  1IIC A;  2VZY A;  3B2Y A;  3K2K A;  5LRK A;  2PQ8 A;  4NGM A;  4R6T A;  2CNT A;  3CCM Z;  1ZH1 A;  2PJ7 A;  4DQY B;  1TWA I;  4Y49 C;  2Q7S A;  4RI1 A;  3KIF A;  3EO4 A;  2OOY B;  1Y0Y A;  1K73 1;  3MGD A;  1S7M A;  5FLM I;  2KCW A;  3IWE A;  2POK A;  4B6Z A;  5HMN A;  2K5R A;  1M4D A;  3FQM A;  3DR8 A;  3IEH A;  3SJX A;  3WR7 A;  3PRT A;  4KSF A;  3CCR 1;  3D7F A;  1Y1V I;  4LQ6 A;  4M6H A;  1S72 Z;  5IT9 f;  1QYP A;  2AFU A;  1YIJ 1;  4HPS A;  3CCU Z;  2KPI A;  1VQN 1;  1LAM A;  3NH8 A;  3R96 A;  4AXV A;  4MD8 A;  4ZX9 A;  1NP6 A;  4J3G A;  5T6B A;  1VKC A;  1X3W A;  2JNY A;  1JJ2 Z;  2VBQ A;  4RVG A;  4NBG A;  4UFX A;  2PJA A;  2PDO A;  4QUS A;  2QR1 B;  5THW A;  4LUA A;  4CL1 A;  3E0K A;  4AVB A;  3D2P A;  1R9T I;  4B5O A;  3PB9 X;  1S7N A;  1Q7Y 2;  5E96 A;  1Q2C A;  1IYL A;  3S2H I;  3D2L A;  2G3A A;  4H6Z A;  3CC2 Z;  3CC4 Z;  1VQ4 Z;  2GTI A;  3KR5 A;  3KL9 A;  3EFA A;  4A3M I;  4OC1 A;  4RS4 A;  2EUI A;  2EK8 A;  3W91 A;  3DDD A;  4X3R A;  1HDU A;  1QSO A;  1AMP A;  2CF4 A;  1I3Q I;  4YFJ A;  3NH5 A;  2PMZ A;  3V8I A;  3H3V J;  4XPK A;  3NDI A;  1X12 A;  5A2Q b;  4KVO E;  1Q2Y A;  5JQ4 A;  3ISX A;  3H8F A;  3N7Z A;  1TWF I;  4OAE A;  4E33 A;  2PIZ A;  3HUV A;  3S1M I;  1MJA A;  1CP6 A;  2IZ3 A;  4OIW A;  2VPX A;  3S17 I;  4NJQ A;  2LFU A;  5FLX b;  4U9Y A;  1BPN A;  3J80 f;  3CCQ Z;  3NDJ A;  1QQ9 A;  3EED A;  4IAV A;  4CGL A;  4YWY A;  2XEG A;  2G9D A;  4MHP A;  3PEI A;  1N71 A;  3IFE A;  3J7A 4;  2FXF A;  1PFT A;  3GTO I;  2IMO A;  2WPX A;  2PM9 A;  1USP B;  5LYL A;  1B6B A;  5F49 A;  3RNZ A;  3GY9 A;  1XOV A;  4ZYQ A;  4E30 A;  3DLJ A;  1X10 A;  2BUE A;  4KOT A;  1M4L A;  4B5P A;  1K8A 1;  2AKL A;  3GLJ A;  3SI1 A;  2QRD B;  2V8I A;  2RHB A;  5LYI A;  2WYR A;  2YU9 I;  2RBL A;  4L8A A;  2PJ3 A;  4ORF A;  4A93 I;  3NFZ A;  2E9H A;  2ZEO A;  2ZOG A;  4G1P A;  2QEX Z;  3CCS 1;  3VWE A;  1VQ5 1;  2JUB A;  2M6N A;  3JUW A;  3FVL A;  3HOY I;  3TT2 A;  3S9M A;  1VQM Z;  3WT4 A;  2PJ8 A;  4LX9 A;  4R7M A;  3B3V A;  4CGP A;  4KSA A;  4PSW A;  4A3B I;  3NE7 A;  3P2H A;  4P45 A;  2OU2 A;  2B4B A;  3IO1 A;  4L89 A;  3TTH A;  1XBU A;  2AFM A;  5J1Q A;  1YJN 1;  2J6A A;  4UBR A;  1Z5R A;  3CXQ A;  1IID A;  4ZY2 A;  4NBH A;  3GIU A;  1YUK A;  2Z3K A;  2M48 A;  4X5K A;  1Y0R A;  3EER A;  4JWP A;  2P28 A;  4F9V A;  1KC8 1;  1IU8 A;  1M44 A;  3J81 f;  4W9Y A;  3TCV A;  4R57 A;  2QJ8 A;  4UEE A;  2GE3 A;  3PO2 I;  2REF A;  4KOY A;  4NGP A;  1RXT A;  2B3U A;  4NGS A;  1VQ7 1;  2DEA A;  4RUH A;  4CAF A;  1N8R 1;  2Z3M A;  5J8C A;  4CAW A;  4PXC A;  4EWC A;  3TE4 A;  4LQG A;  5A27 A;  2QLV B;  3EY5 A;  1XJO A;  1L0C A;  2V8H A;  4UWJ A;  3TO6 A;  3JVN A;  2VPW A;  3FIX A;  3CC7 Z;  4BBS I;  5D1O B;  1Z4R A;  2WPW A;  4B11 A;  4JXQ A;  2BOA A;  3BI1 A;  2P0W A;  5EC4 A;  1AA6 A;  4TNU A;  4OLL A;  1VQN Z;  3HOZ I;  4PXB A;  2OTJ Z;  4MFZ A;  3KI9 A;  5IV0 A;  1S7L A;  4MCQ A;  3VMI A;  4P4D A;  4EWT A;  3D8P A;  3IWG A;  2K5T A;  3PFO A;  1ML8 A;  5AN9 F;  2Q0Y A;  4A38 A;  1M1K 1;  2YND A;  4MCS A;  4JZ0 A;  3VAT A;  2ZOF A;  3NA6 A;  5D1P A;  4MXU A;  4EVY A;  4NOZ A;  4X2T A;  3W6X A;  4KOU A;  4BBR I;  4ZI6 A;  3TDH B;  4PSX A;  2HF1 A;  1YQE A;  3FEE A;  1RO4 A;  3CC2 1;  5K8O A;  1ZG9 A;  4Q36 A;  1Q16 A;  3CD6 Z;  2FS5 A;  3FEC A;  4FD5 A;  3FQQ A;  4BY7 I;  2F7V A;  1LCP A;  2HU9 A;  3R95 A;  4XPL A;  4E2X A;  4H2K A;  2VZZ A;  3FKI I;  2J8M A;  2F4O A;  1VQ6 1;  3CCU 1;  4AG9 A;  4AG7 A;  2GFQ A;  1Q86 2;  4DUK A;  4JXR A;  3B3W A;  1VQ9 Z;  3IF8 A;  1W2B Y;  1Z8X A;  2GLF A;  4U5Y A;  2IQ6 A;  1TKF A;  4KS9 A;  1K4J A;  1NSA A;  4B10 A;  4XX2 A;  3FXT A;  2YNC C;  1LAN A;  1F2P A;  4A37 A;  1WII A;  4DK1 A;  2JA7 I;  4R76 A;  3OWC A;  2R92 I;  4P4I A;  4QBJ A;  3CPX A;  4NGR A;  1CP7 A;  4ZX8 A;  3CC4 1;  1M90 2;  2Y0M A;  1W2B Z;  2BJO A;  3F3P C;  3BJ7 A;  4AB7 A;  3KR4 A;  1BAV A;  1TKJ A;  3U50 C;  3OW2 Z;  4C7I A;  4UIA A;  3PFE A;  3G3S A;  2VXK A;  1NMT A;  2BL1 A;  5JM6 A;  1WJ2 A;  5KTA A;  2Z3P A;  3P5J B;  2HB6 A;  2W04 A;  3LMS A;  3QWU A;  4QC6 A;  5EMI A;  1WK4 A;  1IY7 A;  1JWQ A;  2NAP A;  5C4J I;  4UCN A;  1IOI A;  2FE7 A;  3SXN A;  3T8W A;  2DF5 A;  6CPA A;  1S7F A;  3R9F A;  2ODF A;  3D66 A;  2B4D A;  1J4J A;  4UEF A;  1Y9K A;  4AYB A;  1SQH A;  2PC1 A;  3CCS Z; 
#chains in the Genus database with same CATH homology
 5LYD A;  5HVH A;  1F57 A;  3RZO I;  3S2D I;  4X3R A;  2JEW A;  2PRQ A;  2C1C A;  2PJB A;  3HKZ A;  1HDU A;  2P3Y A;  2RIQ A;  4MON A;  1VQO Z;  4MHY A;  5F09 A;  3G6E Z;  5FLX f;  1AMP A;  4MHZ A;  3V38 A;  2CF4 A;  1I3Q I;  3I56 Z;  2R93 I;  3NH5 A;  3WC7 A;  2PMZ A;  1RO0 A;  3BHX A;  3MRU A;  3GTG I;  4UEZ A;  3H3V J;  2VUG A;  5HXD A;  2JA5 I;  1ARL A;  1QVG Z;  2OOX B;  4P6Y A;  2AFX A;  2C6G A;  3NDI A;  1HDQ A;  5A2Q b;  3SJG A;  2AFZ A;  3CCR Z;  4EME A;  2HC9 A;  4X8I A;  4OID A;  3NH4 A;  2CIJ A;  2FVG A;  3G4S 1;  3WC5 A;  1VQ5 Z;  3H8F A;  3ISX A;  1TWF I;  3PBB A;  5K8M A;  1S72 1;  3IJ3 A;  2W03 A;  8CPA A;  4E33 A;  2PIZ A;  3HUV A;  4P4E A;  1L1O C;  3S1M I;  4IK2 A;  1N8R 2;  4NBB A;  1DE4 C;  1YIT 1;  1CP6 A;  2IZ3 A;  4NBF A;  3D7G A;  4OIW A;  2E2I I;  3S17 I;  5D1O A;  4A3F I;  4YU9 A;  4NJQ A;  3IWW A;  4OC3 A;  4FWU A;  2LFU A;  2PJ4 A;  3KZW A;  3I1U A;  2VF1 A;  3KHX A;  3G6E 1;  5FLX b;  3I55 Z;  4CPA A;  3WAB A;  2IZ4 A;  2DE7 A;  3HOW I;  1BPN A;  3RZA A;  1QVG Y;  3OW2 Y;  3J80 f;  3B35 A;  3FJU A;  1FT7 A;  4A3K I;  3VAR A;  3CCQ Z;  3NDJ A;  2K3R A;  3PO3 I;  3CME 1;  1QQ9 A;  2ZEL A;  3D7H A;  3EED A;  4NBE A;  3GTL I;  3JAM b;  4IAV A;  1K9M 1;  3CCV 1;  4YWY A;  2XEG A;  2I3C A;  2PVW A;  3S16 I;  1YIJ Z;  2EWB A;  2G9D A;  3VMH A;  3ISZ A;  2DE5 A;  4UIB A;  3Q87 A;  4MHP A;  3PEI A;  3IFE A;  3J7A 4;  3CCL Z;  1PFT A;  3GTO I;  2V8D A;  2H85 A;  4F9U A;  2IMO A;  3PB6 X;  4NH1 C;  3D4U A;  1ARM A;  2Y0S A;  1VQ6 Z;  3D7D A;  2PM9 A;  4OKO A;  1USP B;  4NBD A;  2LIY A;  4P10 A;  5LYL A;  4OC2 A;  2PK7 A;  4PXD A;  4BD9 A;  4GM5 A;  1TFI A;  3S1R I;  3JAM f;  4MRI A;  2R7Z I;  1VHE A;  4ZYQ A;  4HGZ A;  4E30 A;  2OTL 1;  2Q51 A;  4Y7N I;  3M3Y I;  3DLJ A;  5CBM A;  3I55 1;  1TWH I;  1RNI A;  1JJ2 Y;  1YME A;  1M4L A;  1K8A 1;  5K8N A;  2AKL A;  3GLJ A;  4Z65 A;  3SI1 A;  2PJC A;  2JBK A;  2QRD B;  2V8I A;  5JGF A;  2RHB A;  3LUS A;  5LYI A;  5I4M A;  2WYR A;  1KWM A;  2YU9 I;  3N5F A;  4JYW A;  4RV9 A;  2RBL A;  2PJ3 A;  3VTN A;  4A93 I;  2PJ1 A;  4FUU A;  3NFZ A;  1VQ7 Z;  2ZED A;  3MZL B;  1VQ8 1;  2E9H A;  2ZEO A;  2B63 I;  4OC0 A;  2ZOG A;  4G1P A;  4OC4 A;  5C44 I;  1YUA A;  3DGV A;  2PIY A;  2QA4 1;  2QEX Z;  3FX6 A;  4OC5 A;  2V8G A;  2AFW A;  2ZEP A;  2PJ9 A;  3GTP I;  3CCS 1;  1VQ5 1;  3BXM A;  1YI2 1;  2JUB A;  2M6N A;  3S1Q I;  1BLL E;  2NVQ I;  3FVL A;  3HOX I;  2V8V A;  3HOY I;  1TF9 A;  3RAM A;  2RB7 A;  4MD7 A;  3HOU I;  4K3N A;  5LYF A;  3S9M A;  4ZY1 A;  1RTQ A;  1VQO 1;  2ZAE B;  3CC7 1;  1CBX A;  1ZLI A;  4A3C I;  3CPW Y;  2YAD A;  3I56 1;  1WCM I;  1JQG A;  1VQM Z;  2NVT I;  1VQK Z;  1YHQ 1;  1BPM A;  3WT4 A;  4RVD A;  2PJ8 A;  1LQL A;  4R7M A;  3B3V A;  2BO9 A;  1ELL P;  1SFO I;  4A3B I;  5IP7 I;  2O53 A;  1ELM P;  3I07 A;  4P45 A;  2RPR A;  3BI0 A;  1AYE A;  1K73 2;  3JRU A;  4WWV A;  2XEF A;  2QA4 Z;  1WW9 A;  2G2K A;  3IO1 A;  5CPA A;  3PBE A;  1XBU A;  1XMB A;  1M90 1;  1YIT Z;  2AFM A;  5J1Q A;  2BCO A;  4PQA A;  3CCL 1;  2JS4 A;  1X0T A;  4IHM A;  2RFH A;  4MH4 A;  1YJN 1;  1GYT A;  2J6A A;  2OTJ 1;  1Z5R A;  2F8H A;  3GCF A;  3GKQ A;  1TKH A;  1UWY A;  4ZY2 A;  4DJL A;  4NBH A;  2PCU A;  1ZLH A;  1YUK A;  3ESW A;  1YHQ Z;  1KQS Z;  2M48 A;  1VQL 1;  1Y0R A;  3EER A;  1Q7L A;  3CME Z;  4MCP A;  2P28 A;  1VLA A;  3SI2 A;  4F9V A;  1R43 A;  1KC8 1;  4MMO A;  4P4J A;  3SJF A;  3IFU A;  5D8N A;  3J81 f;  3PO3 S;  4W9Y A;  1KRL A;  3S14 I;  5HVG A;  4OP4 A;  1Z02 A;  1PCA A;  4F8Z A;  2QJ8 A;  2RT9 A;  4UEE A;  1P9N A;  3PO2 I;  3I4M I;  3D9X A;  3S9N A;  3FED A;  1N2F A;  1CPS A;  4NGP A;  2QKD A;  1EE3 P;  4RVH A;  4NGS A;  1YJ9 1;  4DYO A;  2IJZ A;  1VQ7 1;  2DEA A;  2PJ2 A;  4RUH A;  3CPW Z;  1VQ8 Z;  3KIH A;  3G4S Z;  3M4O I;  1N8R 1;  4A3L I;  3MN8 A;  3CT9 A;  3TC8 A;  2R6M A;  1F2O A;  4PXC A;  4E2Y A;  4EWC A;  3G71 1;  2QEX 1;  5T67 A;  1Y7E A;  2GLJ A;  3VH9 A;  3WC6 A;  4LQG A;  3GTK I;  2XEI A;  1Z2L A;  2GU2 A;  2QLV B;  2QVP A;  3CCM 1;  1NUI A;  1XJO A;  4E2W A;  2KI7 B;  3B3C A;  2V8H A;  1VQL Z;  4NFR A;  1RLY A;  1VQ9 1;  2ZEM A;  2ZEH A;  3KAS A;  1X3Z A;  3PB8 X;  1RO2 A;  1ZB8 A;  3CC7 Z;  1Q7Y 1;  4BBS I;  4MD9 A;  3J80 b;  5D1O B;  4E32 A;  2QRE B;  4E2Z A;  1VQM 1;  2NVX I;  3S1N I;  2JR6 A;  5HVF A;  2ZEE A;  4BY1 I;  3RBU A;  2O4H A;  3CMA 1;  1ZG8 A;  1Z8L A;  1K83 I;  3CCV Z;  4Q7A A;  2BOA A;  5IB9 A;  4PXE A;  3BI1 A;  4RVF A;  4NJR A;  3VMG A;  1DL6 A;  4NGQ A;  4HGY A;  4PPZ A;  1OBR A;  4KSI A;  1KQS Y;  2ZEF A;  4FBE A;  1VQP 1;  1Q81 2;  4OME A;  2WZN A;  3HOV I;  4TNU A;  4EFD A;  3RZD I;  3CCJ 1;  1VQN Z;  3HOZ I;  4HH4 A;  1VIX A;  4PXB A;  2OR4 A;  3KQZ A;  2AFO A;  2OTJ Z;  1VQK 1;  1DTD A;  3KI9 A;  5C4X I;  3D6W A;  4P4B A;  3SI0 A;  3S9L A;  4MCQ A;  3VMI A;  1CPX A;  3IC1 A;  1Q82 2;  3IX0 A;  4P4D A;  4EWT A;  3D68 A;  1Q81 1;  2C6C A;  3PFO A;  3KHZ A;  1ML8 A;  5AN9 F;  2PJ6 A;  1PYT B;  2V8J A;  2DE6 A;  2QRC B;  5A2Q f;  4DGL A;  2CTB A;  1M1K 1;  4A38 A;  1Q86 1;  4MCS A;  4TWE A;  4JZ0 A;  3VAT A;  2ZOF A;  4ZY0 A;  3NA6 A;  2EGT A;  5D1P A;  3FMC A;  4MXU A;  5LL6 f;  2E2H I;  2ANP A;  3GTJ I;  3B7I A;  3GB0 A;  3I4N I;  4A3G I;  3BG1 B;  2CTC A;  2OOT A;  1Z03 A;  1VQP Z;  1YJN Z;  4NOZ A;  1YJW 1;  4X2T A;  1LOK A;  4NGN A;  3TE5 B;  1ZG7 A;  4BBR I;  4ZI6 A;  1YW6 A;  2F4M A;  3TDH B;  1YJ9 Z;  3GTM I;  1KC8 2;  1YSJ A;  4A3E I;  2HF1 A;  1YLO A;  3FEE A;  1RO4 A;  3CC2 1;  5K8O A;  1ZG9 A;  4A3J I;  1JWH C;  1IGB A;  4P44 A;  3KQX A;  3G71 Z;  1TXR A;  1LFW A;  3H0G I;  1QF8 A;  1R3N A;  3CD6 Z;  4FAI A;  1K8A 2;  3FEC A;  1TWG I;  1Y1W I;  4Y52 I;  3B3T A;  1XRY A;  4A3D I;  5IP9 I;  5ELY A;  4NB9 A;  3FQQ A;  1Y1V S;  4BY7 I;  2F7V A;  1LAP A;  2C6P A;  1LCP A;  2PE3 A;  3CCE 1;  2HU9 A;  3SJE A;  2JMO A;  4ONW A;  5LRG A;  1CG2 A;  4E2X A;  4H2K A;  3S15 I;  2PJ5 A;  2JA6 I;  2AFS A;  3PB7 X;  2NVY I;  3MON A;  4S1T A;  3BG0 B;  5JH9 A;  2ZEG A;  3CXC Y;  5T64 A;  1KD1 1;  1FNO A;  3B2Y A;  3FKI I;  1VQ4 1;  4A3I I;  3K2K A;  2QYV A;  5LRK A;  2F4O A;  1VQ6 1;  1VHO A;  4WJB A;  3F3F C;  3TX8 A;  3CCU 1;  4NGM A;  4R6T A;  3CCM Z;  1ZH1 A;  2PJ7 A;  1H8L A;  4DQY B;  1VGY A;  1TWA I;  1Q86 2;  3HLP A;  4NBC A;  2PVV A;  4DUK A;  3B3W A;  3KIF A;  1VQ9 Z;  2JBJ A;  4A39 A;  1Z01 A;  2WAQ A;  3IF8 A;  1QMU A;  1I6H I;  2OOY B;  3CD6 1;  5IT9 b;  1W2B Y;  5D29 A;  1Y0Y A;  3GUX A;  1CX8 A;  3QNV A;  4NGT A;  3PB4 X;  2NSM A;  1K73 1;  2GLF A;  1S7M A;  3D67 A;  2IQ6 A;  5FLM I;  1TKF A;  2V77 A;  2POK A;  4B6Z A;  3CCE Z;  1NSA A;  3CXC Z;  2K5R A;  2GTH A;  4XX2 A;  2EK9 A;  5LRJ A;  3FQM A;  2Q43 A;  4UF4 A;  4MCR A;  3IEH A;  4QTT A;  1QVF Y;  3SJX A;  3J81 b;  1TWC I;  3PRT A;  3CCR 1;  1LAN A;  1F2P A;  1M1K 2;  3D7F A;  1Y1V I;  3CQZ I;  1I50 I;  4A37 A;  2ZEN A;  1WII A;  4DK1 A;  2JA7 I;  2XEJ A;  4R76 A;  1S72 Z;  2R92 I;  5IT9 f;  4QTU A;  1NJI 1;  4P4I A;  3FF3 A;  1QYP A;  1Q82 1;  5DS0 A;  2AFU A;  3CPX A;  1YIJ 1;  3L2N A;  3CCU Z;  3FH4 A;  2E2J I;  4NGR A;  2KPI A;  3CCJ Z;  1VQN 1;  1CP7 A;  1LAM A;  4E31 A;  3GTQ I;  2JA8 I;  4ZX8 A;  3CC4 1;  1M90 2;  1K9M 2;  4A94 A;  3MZK B;  1W2B Z;  2GRE A;  3NH8 A;  5CM2 M;  3GTM S;  2BJO A;  1RQF A;  4AXV A;  4MD8 A;  3F3P C;  2NYQ A;  1KD1 2;  4ZX9 A;  4NBA A;  1NP6 A;  3KR4 A;  1BAV A;  1TKJ A;  5T6B A;  1QVF Z;  3U50 C;  3OW2 Z;  1X3W A;  2JNY A;  1JJ2 Z;  1XFO A;  3H8E A;  3H8G A;  3PFE A;  4UIA A;  4RVG A;  1HEE A;  4NBG A;  1TF8 A;  2PJ0 A;  2PJA A;  5JM6 A;  2WB1 A;  3KGQ A;  4R8F A;  2V8K A;  3CCQ 1;  2QR1 B;  2OTL Z;  5THW A;  3P5J B;  3LWU A;  2HB6 A;  2W04 A;  3LMS A;  3QWU A;  3VB9 A;  4CL1 A;  3IIB A;  4O23 A;  3B3S A;  2VL1 A;  1R9T I;  1NJI 2;  1IY7 A;  3CDX A;  5C4J I;  1YJW Z;  2ABZ A;  3PB9 X;  1Q7Y 2;  3CMA Z;  3V7Z A;  3K7A I;  4P4F A;  3T8W A;  6CPA A;  2J9A A;  3CPA A;  3S2H I;  1ZB9 A;  5K8P A;  3CC2 Z;  3CC4 Z;  1VQ4 Z;  3K9T A;  3D66 A;  2GTI A;  7CPA A;  3KR5 A;  3KL9 A;  5C3E I;  4UEF A;  4A3M I;  2Q4Z A;  4OC1 A;  4NB8 A;  4AYB A;  3T4N B;  4X6A I;  3CCS Z;  4RS4 A;  4BXX I;  2VUM I;  2OZK A;  4MHN A;  1YI2 Z;  1USP A;  1YW4 A;  2EK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...