2O5WA

Structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase in complex with sm+3 and pyrophosphate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
147
Chain Sequence
b'KDKVYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFVIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dATP pyrophosphohydrolase
publication title Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.67: Dihydroneopterin triphosphate diphosphatase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2o5wA00
2G73A 2YVOA 2FKBA 1NQYA 3FFUA 5ANTA 3SMDA 2DHOA 5CFIA 3FJYA 1PUNA 5FSKA 5GHMA 3X0MA 1U20A 3I7VA 2B0VA 1VK6A 3J7Ye 1PPXA 2ICJA 2I8TA 1RYAA 1SOIA 1V8NA 1SJYA 3GZ5A 1NFSA 1Q27A 2VNQA 1V8UA 2O5FA 3DUPA 2I6KA 1Q54A 3P5TA 2DSCA 3Q1PA 1KTGA 3X0RA 5DPKA 3X0PA 3EESA 4IJXA 5ANWA 3ZR1A 3I9XA 1SZ3A 4S2XA 1JRKA 5IW4A 1V8LA 3L85A 3R03A 1KT9A 4DYWA 4K6EA 1KHZA 3A6VA 2A8PA 2B2KA 1NFZA 3FSPA 1MP2A 5LPGA 2YYHA 5ANVA 1MUTA 3ZR0A 3X0SA 3COUA 2A8QA 4N1TA 5FSLA 1VC8A 2A6TA 2GT4A 2YVPA 1MR2A 1V8IA 3CNGA 2YVNA 3X0QA 5C7QA 1I9AA 2I8UA 2PNYA 1F3YA 5GHQA 4ILQA 3EEUA 4MPOA 3SHDA 3WHWA 3BM4A 5HZXA 1IRYA 1PPVA 5DDGA 5DD4A 2A8RA 1MQWA 4HFQA 2G74A 2VNPA 5GHNA 2FVVA 3N77A 5FSMA 3HHJA 3U53A 3OGAA 1NQZA 3N9UA 1VHGA 3E57A 1XSCA 2J8QA 4KYXA 4V14A 1XSBA 3O8SA 2O1CA 3I7UA 3O6ZA 4KG4A 3X0NA 4JZSA 3AC9A 3O52A 2PQVA 5GHIA 4N1UA 3MCFA 5DEQA 3Q4IA 1TUMA 1VCDA 3ID9A 2ICKA 4S2YA 1XSAA 3EXQA 1MQEA 1GA7A 1VIQA 1JKNA 5FSOA 4C9XA 2KDVA 2GB5A 3H95A 5I8UA 4ZG0A 3BHOA 2O5WA 4JZVA 3QSJA 5ANUA 1R67A 1G0SA 5BS6A 3MDGA 5BONA 2QJOA 3MDIA 3A6UA 1RRQA 3BAPA 3F6AA 3GG6A 1V8RA 2QKMB 3GRNA 5GHOA 4C9WA 4HVYA 4YPHA 2KDWA 3O69A 2DUKA 3Q91A 5C8LA 3P6YA 1V8TA 1PVFA 5FSNA 3GWYA 3Q2SA 3GZ8A 2FMLA 3HYQA 3RH7A 4KTBA 5C7TA 3X0KA 5ANSA 4NFXA 5CFJA 1VHZA 1VIUA 2DSDA 2DSBA 3ACAA 3X0OA 3GZ6A 1V8MA 1V8WA 2CL3A 1HZTA 1V8VA 2RRKA 1X83A 3DKUA 1K2EA 5GHPA 3O61A 1X84A 4JZUA 1V8YA 1SU2A 1V8SA 3G0QA 2A8TA 4S2WA 1QVJA 3MGMA 3FK9A 4S2VA 3KVHA 1PUSA 2GT2A 4KG3A 1Q33A 1K26A 1VRLA 3Q2TA 4YPRA 3FCMA 1PPWA 4JZTA 3X0JA 1G9QA 2AZWA 2JVBA 2XSQA 3A6SA 2W4EA 2YVMA 2R5WA 2Q9PA 3SONA 3X0IA 3Q93A 5ISYA 1X51A 1HX3A 1OW2A 1PUQA 2QJTA 3EF5A 3X0LA 5IW5A 1VC9A 2B06A 2A8SA 1MK1A 4ICKA 5FSIA 1RRSA 3A6TA 3F13A 4YOQA 4NFWA 5GHJA
chains in the Genus database with same CATH superfamily
2G73A 2YVOA 2FKBA 1NQYA 3FFUA 5ANTA 3SMDA 2DHOA 5CFIA 3FJYA 1PUNA 5FSKA 5GHMA 3X0MA 1U20A 3I7VA 2B0VA 1VK6A 3J7Ye 1PPXA 2ICJA 2I8TA 1RYAA 1SOIA 1V8NA 1SJYA 3GZ5A 1NFSA 1Q27A 2VNQA 1V8UA 2O5FA 3DUPA 2I6KA 1Q54A 3P5TA 2DSCA 3Q1PA 1KTGA 3X0RA 5DPKA 3X0PA 3EESA 4IJXA 5ANWA 3ZR1A 3I9XA 1SZ3A 4S2XA 1JRKA 5IW4A 1V8LA 3L85A 3R03A 1KT9A 4DYWA 4K6EA 1KHZA 3A6VA 2A8PA 2B2KA 1NFZA 3FSPA 1MP2A 5LPGA 2YYHA 5ANVA 1MUTA 3ZR0A 3X0SA 3COUA 2A8QA 4J7HA 4N1TA 5FSLA 1VC8A 2A6TA 2GT4A 2YVPA 1MR2A 1V8IA 3CNGA 2YVNA 3X0QA 5C7QA 1I9AA 2I8UA 2PNYA 1F3YA 5GHQA 4ILQA 3EEUA 4MPOA 3SHDA 3WHWA 3BM4A 5HZXA 1IRYA 1PPVA 5DDGA 5DD4A 2A8RA 1MQWA 4HFQA 2G74A 2VNPA 5GHNA 2FVVA 3N77A 5FSMA 3HHJA 3U53A 3OGAA 1NQZA 3N9UA 1VHGA 3E57A 1XSCA 2J8QA 4KYXA 4V14A 1XSBA 3O8SA 2O1CA 3I7UA 3O6ZA 4KG4A 3X0NA 4JZSA 3AC9A 3O52A 2PQVA 5GHIA 4J7GA 3MCFA 4N1UA 5DEQA 3Q4IA 1TUMA 1VCDA 2CZRA 3ID9A 2ICKA 4S2YA 1XSAA 3EXQA 1MQEA 1GA7A 1VIQA 1JKNA 5FSOA 4C9XA 2KDVA 2GB5A 3H95A 5I8UA 4ZG0A 3BHOA 2O5WA 4JZVA 3QSJA 5ANUA 1R67A 1G0SA 5BS6A 3MDGA 5BONA 2QJOA 3MDIA 3A6UA 1RRQA 3BAPA 3F6AA 3GG6A 1V8RA 2QKMB 3GRNA 5GHOA 4C9WA 4HVYA 4YPHA 2KDWA 3O69A 2DUKA 3Q91A 5C8LA 3P6YA 1V8TA 1PVFA 5FSNA 3GWYA 3Q2SA 3GZ8A 2FMLA 3HYQA 3RH7A 4KTBA 5C7TA 3X0KA 5ANSA 4NFXA 5CFJA 1VHZA 1VIUA 2DSDA 2DSBA 3ACAA 3X0OA 3GZ6A 1V8MA 1V8WA 2CL3A 1HZTA 1V8VA 2RRKA 1X83A 3DKUA 1K2EA 5GHPA 3O61A 1X84A 4JZUA 1V8YA 1SU2A 1V8SA 3G0QA 2A8TA 4S2WA 1QVJA 3MGMA 3FK9A 4S2VA 3KVHA 1PUSA 2GT2A 4KG3A 1Q33A 1K26A 1VRLA 3Q2TA 4YPRA 3FCMA 1PPWA 4JZTA 3X0JA 1G9QA 2AZWA 2JVBA 2XSQA 3A6SA 2W4EA 2YVMA 2R5WA 2Q9PA 3SONA 3X0IA 3Q93A 5ISYA 1X51A 1HX3A 1OW2A 1PUQA 2QJTA 3EF5A 3X0LA 5IW5A 1VC9A 2B06A 2A8SA 1MK1A 4ICKA 5FSIA 1RRSA 3A6TA 3F13A 4YOQA 4NFWA 5GHJA
chains in the Genus database with same CATH topology
2G73A 2YVOA 2FKBA 1NQYA 3FFUA 5ANTA 3SMDA 2DHOA 5CFIA 3FJYA 1PUNA 5FSKA 5GHMA 3X0MA 1U20A 3I7VA 2B0VA 1VK6A 3J7Ye 1PPXA 2ICJA 2I8TA 1RYAA 1SOIA 1V8NA 1SJYA 3GZ5A 1NFSA 1Q27A 2VNQA 1V8UA 2O5FA 3DUPA 2I6KA 1Q54A 3P5TA 2DSCA 3Q1PA 1KTGA 3X0RA 5DPKA 3X0PA 3EESA 4IJXA 5ANWA 3ZR1A 3I9XA 1SZ3A 4S2XA 1JRKA 5IW4A 1V8LA 3L85A 3R03A 1KT9A 4DYWA 4K6EA 1KHZA 3A6VA 2A8PA 2B2KA 1NFZA 3FSPA 1MP2A 5LPGA 2YYHA 5ANVA 1MUTA 3ZR0A 3X0SA 3COUA 2A8QA 4J7HA 4N1TA 5FSLA 1VC8A 2A6TA 2GT4A 2YVPA 1MR2A 1V8IA 3CNGA 2YVNA 3X0QA 5C7QA 1I9AA 2I8UA 2PNYA 1F3YA 5GHQA 4ILQA 3EEUA 4MPOA 3SHDA 3WHWA 3BM4A 5HZXA 1IRYA 1PPVA 5DDGA 5DD4A 2A8RA 1MQWA 4HFQA 2G74A 2VNPA 5GHNA 2FVVA 3N77A 5FSMA 3HHJA 3U53A 3OGAA 1NQZA 3N9UA 1VHGA 3E57A 1XSCA 2J8QA 4KYXA 4V14A 1XSBA 3O8SA 2O1CA 3I7UA 3O6ZA 4KG4A 3X0NA 4JZSA 3AC9A 3O52A 2PQVA 5GHIA 4J7GA 3MCFA 4N1UA 5DEQA 3Q4IA 1TUMA 1VCDA 2CZRA 3ID9A 2ICKA 4S2YA 1XSAA 3EXQA 1MQEA 1GA7A 1VIQA 1JKNA 5FSOA 4C9XA 2KDVA 2GB5A 3H95A 5I8UA 4ZG0A 3BHOA 2O5WA 4JZVA 3QSJA 5ANUA 1R67A 1G0SA 5BS6A 3MDGA 5BONA 2QJOA 3MDIA 3A6UA 1RRQA 3BAPA 3F6AA 3GG6A 1V8RA 2QKMB 3GRNA 5GHOA 4C9WA 4HVYA 4YPHA 2KDWA 3O69A 2DUKA 3Q91A 5C8LA 3P6YA 1V8TA 1PVFA 5FSNA 3GWYA 3Q2SA 3GZ8A 2FMLA 3HYQA 3RH7A 4KTBA 5C7TA 3X0KA 5ANSA 4NFXA 5CFJA 1VHZA 1VIUA 2DSDA 2DSBA 3ACAA 3X0OA 3GZ6A 1V8MA 1V8WA 2CL3A 1HZTA 1V8VA 2RRKA 1X83A 3DKUA 1K2EA 5GHPA 3O61A 1X84A 4JZUA 1V8YA 1SU2A 1V8SA 3G0QA 2A8TA 4S2WA 1QVJA 3MGMA 3FK9A 4S2VA 3KVHA 1PUSA 2GT2A 4KG3A 1Q33A 1K26A 1VRLA 3Q2TA 4YPRA 3FCMA 1PPWA 4JZTA 3X0JA 1G9QA 2AZWA 2JVBA 2XSQA 3A6SA 2W4EA 2YVMA 2R5WA 2Q9PA 3SONA 3X0IA 3Q93A 5ISYA 1X51A 1HX3A 1OW2A 1PUQA 2QJTA 3EF5A 3X0LA 5IW5A 1VC9A 2B06A 2A8SA 1MK1A 4ICKA 5FSIA 1RRSA 3A6TA 3F13A 4YOQA 4NFWA 5GHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G73 A;  2YVO A;  2FKB A;  1NQY A;  3FFU A;  5ANT A;  3SMD A;  2DHO A;  5CFI A;  3FJY A;  1PUN A;  5FSK A;  5GHM A;  3X0M A;  1U20 A;  3I7V A;  2B0V A;  1VK6 A;  3J7Y e;  1PPX A;  2ICJ A;  2I8T A;  1RYA A;  1SOI A;  1V8N A;  1SJY A;  3GZ5 A;  1NFS A;  1Q27 A;  2VNQ A;  1V8U A;  2O5F A;  3DUP A;  2I6K A;  1Q54 A;  3P5T A;  2DSC A;  3Q1P A;  1KTG A;  3X0R A;  5DPK A;  3X0P A;  3EES A;  4IJX A;  5ANW A;  3ZR1 A;  3I9X A;  1SZ3 A;  4S2X A;  1JRK A;  5IW4 A;  1V8L A;  3L85 A;  3R03 A;  1KT9 A;  4DYW A;  4K6E A;  1KHZ A;  3A6V A;  2A8P A;  2B2K A;  1NFZ A;  3FSP A;  1MP2 A;  5LPG A;  2YYH A;  5ANV A;  1MUT A;  3ZR0 A;  3X0S A;  3COU A;  2A8Q A;  4N1T A;  5FSL A;  1VC8 A;  2A6T A;  2GT4 A;  2YVP A;  1MR2 A;  1V8I A;  3CNG A;  2YVN A;  3X0Q A;  5C7Q A;  1I9A A;  2I8U A;  2PNY A;  1F3Y A;  5GHQ A;  4ILQ A;  3EEU A;  4MPO A;  3SHD A;  3WHW A;  3BM4 A;  5HZX A;  1IRY A;  1PPV A;  5DDG A;  5DD4 A;  2A8R A;  1MQW A;  4HFQ A;  2G74 A;  2VNP A;  5GHN A;  2FVV A;  3N77 A;  5FSM A;  3HHJ A;  3U53 A;  3OGA A;  1NQZ A;  3N9U A;  1VHG A;  3E57 A;  1XSC A;  2J8Q A;  4KYX A;  4V14 A;  1XSB A;  3O8S A;  2O1C A;  3I7U A;  3O6Z A;  4KG4 A;  3X0N A;  4JZS A;  3AC9 A;  3O52 A;  2PQV A;  5GHI A;  4N1U A;  3MCF A;  5DEQ A;  3Q4I A;  1TUM A;  1VCD A;  3ID9 A;  2ICK A;  4S2Y A;  1XSA A;  3EXQ A;  1MQE A;  1GA7 A;  1VIQ A;  1JKN A;  5FSO A;  4C9X A;  2KDV A;  2GB5 A;  3H95 A;  5I8U A;  4ZG0 A;  3BHO A;  2O5W A;  4JZV A;  3QSJ A;  5ANU A;  1R67 A;  1G0S A;  5BS6 A;  3MDG A;  5BON A;  2QJO A;  3MDI A;  3A6U A;  1RRQ A;  3BAP A;  3F6A A;  3GG6 A;  1V8R A;  2QKM B;  3GRN A;  5GHO A;  4C9W A;  4HVY A;  4YPH A;  2KDW A;  3O69 A;  2DUK A;  3Q91 A;  5C8L A;  3P6Y A;  1V8T A;  1PVF A;  5FSN A;  3GWY A;  3Q2S A;  3GZ8 A;  2FML A;  3HYQ A;  3RH7 A;  4KTB A;  5C7T A;  3X0K A;  5ANS A;  4NFX A;  5CFJ A;  1VHZ A;  1VIU A;  2DSD A;  2DSB A;  3ACA A;  3X0O A;  3GZ6 A;  1V8M A;  1V8W A;  2CL3 A;  1HZT A;  1V8V A;  2RRK A;  1X83 A;  3DKU A;  1K2E A;  5GHP A;  3O61 A;  1X84 A;  4JZU A;  1V8Y A;  1SU2 A;  1V8S A;  3G0Q A;  2A8T A;  4S2W A;  1QVJ A;  3MGM A;  3FK9 A;  4S2V A;  3KVH A;  1PUS A;  2GT2 A;  4KG3 A;  1Q33 A;  1K26 A;  1VRL A;  3Q2T A;  4YPR A;  3FCM A;  1PPW A;  4JZT A;  3X0J A;  1G9Q A;  2AZW A;  2JVB A;  2XSQ A;  3A6S A;  2W4E A;  2YVM A;  2R5W A;  2Q9P A;  3SON A;  3X0I A;  3Q93 A;  5ISY A;  1X51 A;  1HX3 A;  1OW2 A;  1PUQ A;  2QJT A;  3EF5 A;  3X0L A;  5IW5 A;  1VC9 A;  2B06 A;  2A8S A;  1MK1 A;  4ICK A;  5FSI A;  1RRS A;  3A6T A;  3F13 A;  4YOQ A;  4NFW A;  5GHJ A; 
#chains in the Genus database with same CATH topology
 2G73 A;  2YVO A;  2FKB A;  1NQY A;  3FFU A;  5ANT A;  3SMD A;  2DHO A;  5CFI A;  3FJY A;  1PUN A;  5FSK A;  5GHM A;  3X0M A;  1U20 A;  3I7V A;  2B0V A;  1VK6 A;  3J7Y e;  1PPX A;  2ICJ A;  2I8T A;  1RYA A;  1SOI A;  1V8N A;  1SJY A;  3GZ5 A;  1NFS A;  1Q27 A;  2VNQ A;  1V8U A;  2O5F A;  3DUP A;  2I6K A;  1Q54 A;  3P5T A;  2DSC A;  3Q1P A;  1KTG A;  3X0R A;  5DPK A;  3X0P A;  3EES A;  4IJX A;  5ANW A;  3ZR1 A;  3I9X A;  1SZ3 A;  4S2X A;  1JRK A;  5IW4 A;  1V8L A;  3L85 A;  3R03 A;  1KT9 A;  4DYW A;  4K6E A;  1KHZ A;  3A6V A;  2A8P A;  2B2K A;  1NFZ A;  3FSP A;  1MP2 A;  5LPG A;  2YYH A;  5ANV A;  1MUT A;  3ZR0 A;  3X0S A;  3COU A;  2A8Q A;  4J7H A;  4N1T A;  5FSL A;  1VC8 A;  2A6T A;  2GT4 A;  2YVP A;  1MR2 A;  1V8I A;  3CNG A;  2YVN A;  3X0Q A;  5C7Q A;  1I9A A;  2I8U A;  2PNY A;  1F3Y A;  5GHQ A;  4ILQ A;  3EEU A;  4MPO A;  3SHD A;  3WHW A;  3BM4 A;  5HZX A;  1IRY A;  1PPV A;  5DDG A;  5DD4 A;  2A8R A;  1MQW A;  4HFQ A;  2G74 A;  2VNP A;  5GHN A;  2FVV A;  3N77 A;  5FSM A;  3HHJ A;  3U53 A;  3OGA A;  1NQZ A;  3N9U A;  1VHG A;  3E57 A;  1XSC A;  2J8Q A;  4KYX A;  4V14 A;  1XSB A;  3O8S A;  2O1C A;  3I7U A;  3O6Z A;  4KG4 A;  3X0N A;  4JZS A;  3AC9 A;  3O52 A;  2PQV A;  5GHI A;  4J7G A;  3MCF A;  4N1U A;  5DEQ A;  3Q4I A;  1TUM A;  1VCD A;  2CZR A;  3ID9 A;  2ICK A;  4S2Y A;  1XSA A;  3EXQ A;  1MQE A;  1GA7 A;  1VIQ A;  1JKN A;  5FSO A;  4C9X A;  2KDV A;  2GB5 A;  3H95 A;  5I8U A;  4ZG0 A;  3BHO A;  2O5W A;  4JZV A;  3QSJ A;  5ANU A;  1R67 A;  1G0S A;  5BS6 A;  3MDG A;  5BON A;  2QJO A;  3MDI A;  3A6U A;  1RRQ A;  3BAP A;  3F6A A;  3GG6 A;  1V8R A;  2QKM B;  3GRN A;  5GHO A;  4C9W A;  4HVY A;  4YPH A;  2KDW A;  3O69 A;  2DUK A;  3Q91 A;  5C8L A;  3P6Y A;  1V8T A;  1PVF A;  5FSN A;  3GWY A;  3Q2S A;  3GZ8 A;  2FML A;  3HYQ A;  3RH7 A;  4KTB A;  5C7T A;  3X0K A;  5ANS A;  4NFX A;  5CFJ A;  1VHZ A;  1VIU A;  2DSD A;  2DSB A;  3ACA A;  3X0O A;  3GZ6 A;  1V8M A;  1V8W A;  2CL3 A;  1HZT A;  1V8V A;  2RRK A;  1X83 A;  3DKU A;  1K2E A;  5GHP A;  3O61 A;  1X84 A;  4JZU A;  1V8Y A;  1SU2 A;  1V8S A;  3G0Q A;  2A8T A;  4S2W A;  1QVJ A;  3MGM A;  3FK9 A;  4S2V A;  3KVH A;  1PUS A;  2GT2 A;  4KG3 A;  1Q33 A;  1K26 A;  1VRL A;  3Q2T A;  4YPR A;  3FCM A;  1PPW A;  4JZT A;  3X0J A;  1G9Q A;  2AZW A;  2JVB A;  2XSQ A;  3A6S A;  2W4E A;  2YVM A;  2R5W A;  2Q9P A;  3SON A;  3X0I A;  3Q93 A;  5ISY A;  1X51 A;  1HX3 A;  1OW2 A;  1PUQ A;  2QJT A;  3EF5 A;  3X0L A;  5IW5 A;  1VC9 A;  2B06 A;  2A8S A;  1MK1 A;  4ICK A;  5FSI A;  1RRS A;  3A6T A;  3F13 A;  4YOQ A;  4NFW A;  5GHJ A; 
#chains in the Genus database with same CATH homology
 2G73 A;  2YVO A;  2FKB A;  1NQY A;  3FFU A;  5ANT A;  3SMD A;  2DHO A;  5CFI A;  3FJY A;  1PUN A;  5FSK A;  5GHM A;  3X0M A;  1U20 A;  3I7V A;  2B0V A;  1VK6 A;  3J7Y e;  1PPX A;  2ICJ A;  2I8T A;  1RYA A;  1SOI A;  1V8N A;  1SJY A;  3GZ5 A;  1NFS A;  1Q27 A;  2VNQ A;  1V8U A;  2O5F A;  3DUP A;  2I6K A;  1Q54 A;  3P5T A;  2DSC A;  3Q1P A;  1KTG A;  3X0R A;  5DPK A;  3X0P A;  3EES A;  4IJX A;  5ANW A;  3ZR1 A;  3I9X A;  1SZ3 A;  4S2X A;  1JRK A;  5IW4 A;  1V8L A;  3L85 A;  3R03 A;  1KT9 A;  4DYW A;  4K6E A;  1KHZ A;  3A6V A;  2A8P A;  2B2K A;  1NFZ A;  3FSP A;  1MP2 A;  5LPG A;  2YYH A;  5ANV A;  1MUT A;  3ZR0 A;  3X0S A;  3COU A;  2A8Q A;  4J7H A;  4N1T A;  5FSL A;  1VC8 A;  2A6T A;  2GT4 A;  2YVP A;  1MR2 A;  1V8I A;  3CNG A;  2YVN A;  3X0Q A;  5C7Q A;  1I9A A;  2I8U A;  2PNY A;  1F3Y A;  5GHQ A;  4ILQ A;  3EEU A;  4MPO A;  3SHD A;  3WHW A;  3BM4 A;  5HZX A;  1IRY A;  1PPV A;  5DDG A;  5DD4 A;  2A8R A;  1MQW A;  4HFQ A;  2G74 A;  2VNP A;  5GHN A;  2FVV A;  3N77 A;  5FSM A;  3HHJ A;  3U53 A;  3OGA A;  1NQZ A;  3N9U A;  1VHG A;  3E57 A;  1XSC A;  2J8Q A;  4KYX A;  4V14 A;  1XSB A;  3O8S A;  2O1C A;  3I7U A;  3O6Z A;  4KG4 A;  3X0N A;  4JZS A;  3AC9 A;  3O52 A;  2PQV A;  5GHI A;  4J7G A;  3MCF A;  4N1U A;  5DEQ A;  3Q4I A;  1TUM A;  1VCD A;  2CZR A;  3ID9 A;  2ICK A;  4S2Y A;  1XSA A;  3EXQ A;  1MQE A;  1GA7 A;  1VIQ A;  1JKN A;  5FSO A;  4C9X A;  2KDV A;  2GB5 A;  3H95 A;  5I8U A;  4ZG0 A;  3BHO A;  2O5W A;  4JZV A;  3QSJ A;  5ANU A;  1R67 A;  1G0S A;  5BS6 A;  3MDG A;  5BON A;  2QJO A;  3MDI A;  3A6U A;  1RRQ A;  3BAP A;  3F6A A;  3GG6 A;  1V8R A;  2QKM B;  3GRN A;  5GHO A;  4C9W A;  4HVY A;  4YPH A;  2KDW A;  3O69 A;  2DUK A;  3Q91 A;  5C8L A;  3P6Y A;  1V8T A;  1PVF A;  5FSN A;  3GWY A;  3Q2S A;  3GZ8 A;  2FML A;  3HYQ A;  3RH7 A;  4KTB A;  5C7T A;  3X0K A;  5ANS A;  4NFX A;  5CFJ A;  1VHZ A;  1VIU A;  2DSD A;  2DSB A;  3ACA A;  3X0O A;  3GZ6 A;  1V8M A;  1V8W A;  2CL3 A;  1HZT A;  1V8V A;  2RRK A;  1X83 A;  3DKU A;  1K2E A;  5GHP A;  3O61 A;  1X84 A;  4JZU A;  1V8Y A;  1SU2 A;  1V8S A;  3G0Q A;  2A8T A;  4S2W A;  1QVJ A;  3MGM A;  3FK9 A;  4S2V A;  3KVH A;  1PUS A;  2GT2 A;  4KG3 A;  1Q33 A;  1K26 A;  1VRL A;  3Q2T A;  4YPR A;  3FCM A;  1PPW A;  4JZT A;  3X0J A;  1G9Q A;  2AZW A;  2JVB A;  2XSQ A;  3A6S A;  2W4E A;  2YVM A;  2R5W A;  2Q9P A;  3SON A;  3X0I A;  3Q93 A;  5ISY A;  1X51 A;  1HX3 A;  1OW2 A;  1PUQ A;  2QJT A;  3EF5 A;  3X0L A;  5IW5 A;  1VC9 A;  2B06 A;  2A8S A;  1MK1 A;  4ICK A;  5FSI A;  1RRS A;  3A6T A;  3F13 A;  4YOQ A;  4NFW A;  5GHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...