2O5WA

Structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase in complex with sm+3 and pyrophosphate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
147
structure length
147
Chain Sequence
KDKVYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dATP pyrophosphohydrolase
publication title Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.67: Dihydroneopterin triphosphate diphosphatase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2o5wA00
3ZR0A 1QVJA 2QKMB 5IW5A 2KDWA 3SHDA 3EF5A 1GA7A 1MQWA 4S2WA 3O61A 1V8MA 4HVYA 4KTBA 5BS6A 2A8PA 2B2KA 1VK6A 5GHQA 1SZ3A 1VIQA 2O5WA 3CNGA 2G73A 3Q91A 3R03A 2DSDA 3GWYA 4S2VA 3WHWA 2DHOA 1VIUA 3EXQA 1HZTA 2XSQA 5LPGA 3RH7A 1IRYA 3I7UA 1Q27A 1VHGA 1JRKA 1K2EA 5DEQA 5I8UA 2DUKA 3X0RA 3X0IA 4NFXA 4C9WA 5ANVA 1NQYA 3A6TA 2VNPA 5FSMA 3KVHA 1V8IA 1V8YA 2W4EA 4JZSA 4NFWA 3AC9A 3BM4A 1V8RA 1VCDA 1V8LA 3ID9A 3N9UA 1RYAA 2DSBA 1XSBA 1HX3A 3DKUA 3Q4IA 4ICKA 5C7TA 1R67A 3FSPA 1RRSA 1I9AA 1TUMA 3X0PA 5C8LA 5DD4A 3FFUA 1X84A 1KHZA 2GT2A 3GZ5A 3P6YA 4S2YA 1MR2A 2JVBA 2YVMA 3ACAA 3GG6A 3X0MA 3FK9A 4KYXA 5FSIA 5CFIA 3FJYA 2ICKA 1MP2A 3SONA 3QSJA 2YVOA 2KDVA 1VC8A 2GT4A 5DDGA 2GB5A 3F13A 3GRNA 3Q93A 2CL3A 1OW2A 1V8NA 2FKBA 2J8QA 2YVPA 5GHNA 3L85A 3FCMA 3ZR1A 5FSKA 2A8TA 1PUNA 3A6VA 1VHZA 1V8VA 2G74A 3EESA 5ISYA 1PUSA 3BAPA 4N1UA 3MGMA 3F6AA 2R5WA 4ILQA 3HHJA 3Q1PA 1Q33A 4IJXA 5GHPA 3X0KA 3Q2SA 3X0LA 3X0OA 1MUTA 3X0NA 3EEUA 5FSOA 1NFZA 5ANUA 3COUA 3O52A 3MDGA 2PQVA 4KG3A 3G0QA 2I8UA 3U53A 5IW4A 1G0SA 1PPXA 1XSAA 1SOIA 4JZTA 1VC9A 3A6SA 5C7QA 3O8SA 3SMDA 3MDIA 3E57A 2YYHA 3I9XA 1SJYA 4DYWA 1NFSA 1NQZA 5BONA 1KT9A 3P5TA 3H95A 4K6EA 5HZXA 2B0VA 1V8UA 5CFJA 4C9XA 2DSCA 3BHOA 3I7VA 5ANWA 2Q9PA 2FMLA 3X0QA 3X0SA 5GHMA 2I6KA 1PPVA 3HYQA 4JZUA 4N1TA 1VRLA 4V14A 2YVNA 2FVVA 3DUPA 4MPOA 4S2XA 1X83A 4YPHA 1V8SA 1MQEA 4HFQA 3N77A 1U20A 3O6ZA 5GHIA 5DPKA 1PVFA 1XSCA 5ANTA 4YOQA 1RRQA 1PPWA 2RRKA 3MCFA 1KTGA 2A8RA 1MK1A 2O5FA 5GHJA 5FSLA 2I8TA 2A8SA 2B06A 2ICJA 2VNQA 3OGAA 2AZWA 4JZVA 3Q2TA 2QJTA 4YPRA 1G9QA 1Q54A 1SU2A 2A8QA 3J7Ye 2A6TA 1F3YA 1JKNA 3X0JA 3GZ6A 2QJOA 3O69A 1X51A 1K26A 4ZG0A 1V8TA 4KG4A 3GZ8A 1PUQA 5GHOA 2PNYA 5FSNA 1V8WA 5ANSA 2O1CA 3A6UA
chains in the Genus database with same CATH superfamily
3ZR0A 1QVJA 2QKMB 5IW5A 2KDWA 3SHDA 3EF5A 1GA7A 1MQWA 4S2WA 3O61A 1V8MA 4HVYA 4KTBA 5BS6A 2A8PA 2B2KA 1VK6A 4J7HA 1SZ3A 1VIQA 2O5WA 3CNGA 2G73A 3Q91A 3R03A 5GHQA 2DSDA 3GWYA 4S2VA 3WHWA 2DHOA 1VIUA 3EXQA 1HZTA 2XSQA 5LPGA 3RH7A 1IRYA 3I7UA 1Q27A 1VHGA 1JRKA 1K2EA 5DEQA 5I8UA 2DUKA 3X0RA 3X0IA 4NFXA 4C9WA 5ANVA 1NQYA 3A6TA 2VNPA 4J7GA 5FSMA 3KVHA 1V8IA 1V8YA 2W4EA 4JZSA 4NFWA 3AC9A 3BM4A 1V8RA 1VCDA 1V8LA 3ID9A 3N9UA 1RYAA 2DSBA 1XSBA 1HX3A 3DKUA 3Q4IA 4ICKA 5C7TA 1R67A 3FSPA 1RRSA 1I9AA 1TUMA 3X0PA 5C8LA 5DD4A 3FFUA 1X84A 1KHZA 2GT2A 3GZ5A 3P6YA 4S2YA 1MR2A 2JVBA 2YVMA 3ACAA 3GG6A 3X0MA 3FK9A 4KYXA 5FSIA 5CFIA 3FJYA 2ICKA 1MP2A 3SONA 3QSJA 2YVOA 2KDVA 1VC8A 2GT4A 5DDGA 2GB5A 3F13A 3GRNA 3Q93A 2CL3A 1OW2A 1V8NA 2FKBA 2J8QA 2YVPA 5GHNA 3L85A 3FCMA 3ZR1A 5FSKA 2A8TA 1PUNA 3A6VA 1VHZA 1V8VA 2G74A 3EESA 5ISYA 1PUSA 3BAPA 4N1UA 3MGMA 3F6AA 2R5WA 4ILQA 3HHJA 3Q1PA 1Q33A 4IJXA 5GHPA 3X0KA 3Q2SA 3X0LA 3X0OA 1MUTA 3X0NA 3EEUA 5FSOA 1NFZA 5ANUA 3COUA 3O52A 3MDGA 2PQVA 4KG3A 3G0QA 2I8UA 3U53A 5IW4A 1G0SA 1PPXA 1XSAA 1SOIA 4JZTA 1VC9A 3A6SA 5C7QA 3O8SA 3SMDA 3MDIA 3E57A 2YYHA 3I9XA 1SJYA 4DYWA 1NFSA 1NQZA 5BONA 1KT9A 3P5TA 3H95A 4K6EA 5HZXA 2B0VA 1V8UA 5CFJA 4C9XA 2DSCA 3BHOA 3I7VA 5ANWA 2Q9PA 2FMLA 3X0QA 3X0SA 5GHMA 2I6KA 1PPVA 3HYQA 4JZUA 4N1TA 1VRLA 4V14A 2YVNA 2FVVA 3DUPA 4MPOA 4S2XA 1X83A 4YPHA 1V8SA 1MQEA 4HFQA 3N77A 1U20A 3O6ZA 5GHIA 5DPKA 1PVFA 1XSCA 5ANTA 4YOQA 1RRQA 1PPWA 2RRKA 3MCFA 1KTGA 2A8RA 1MK1A 2O5FA 5GHJA 5FSLA 2I8TA 2A8SA 2B06A 2ICJA 2VNQA 3OGAA 2AZWA 4JZVA 3Q2TA 2QJTA 4YPRA 2CZRA 1G9QA 1Q54A 1SU2A 2A8QA 3J7Ye 2A6TA 1F3YA 1JKNA 3X0JA 3GZ6A 2QJOA 3O69A 1X51A 1K26A 4ZG0A 1V8TA 4KG4A 3GZ8A 1PUQA 5GHOA 2PNYA 5FSNA 1V8WA 5ANSA 2O1CA 3A6UA
chains in the Genus database with same CATH topology
3ZR0A 1QVJA 2QKMB 5IW5A 2KDWA 3SHDA 3EF5A 1GA7A 1MQWA 4S2WA 3O61A 1V8MA 4HVYA 4KTBA 5BS6A 2A8PA 2B2KA 1VK6A 4J7HA 1SZ3A 1VIQA 2O5WA 3CNGA 2G73A 3Q91A 3R03A 5GHQA 2DSDA 3GWYA 4S2VA 3WHWA 2DHOA 1VIUA 3EXQA 1HZTA 2XSQA 5LPGA 3RH7A 1IRYA 3I7UA 1Q27A 1VHGA 1JRKA 1K2EA 5DEQA 5I8UA 2DUKA 3X0RA 3X0IA 4NFXA 4C9WA 5ANVA 1NQYA 3A6TA 2VNPA 4J7GA 5FSMA 3KVHA 1V8IA 1V8YA 2W4EA 4JZSA 4NFWA 3AC9A 3BM4A 1V8RA 1VCDA 1V8LA 3ID9A 3N9UA 1RYAA 2DSBA 1XSBA 1HX3A 3DKUA 3Q4IA 4ICKA 5C7TA 1R67A 3FSPA 1RRSA 1I9AA 1TUMA 3X0PA 5C8LA 5DD4A 3FFUA 1X84A 1KHZA 2GT2A 3GZ5A 3P6YA 4S2YA 1MR2A 2JVBA 2YVMA 3ACAA 3GG6A 3X0MA 3FK9A 4KYXA 5FSIA 5CFIA 3FJYA 2ICKA 1MP2A 3SONA 3QSJA 2YVOA 2KDVA 1VC8A 2GT4A 5DDGA 2GB5A 3F13A 3GRNA 3Q93A 2CL3A 1OW2A 1V8NA 2FKBA 2J8QA 2YVPA 5GHNA 3L85A 3FCMA 3ZR1A 5FSKA 2A8TA 1PUNA 3A6VA 1VHZA 1V8VA 2G74A 3EESA 5ISYA 1PUSA 3BAPA 4N1UA 3MGMA 3F6AA 2R5WA 4ILQA 3HHJA 3Q1PA 1Q33A 4IJXA 5GHPA 3X0KA 3Q2SA 3X0LA 3X0OA 1MUTA 3X0NA 3EEUA 5FSOA 1NFZA 5ANUA 3COUA 3O52A 3MDGA 2PQVA 4KG3A 3G0QA 2I8UA 3U53A 5IW4A 1G0SA 1PPXA 1XSAA 1SOIA 4JZTA 1VC9A 3A6SA 5C7QA 3O8SA 3SMDA 3MDIA 3E57A 2YYHA 3I9XA 1SJYA 4DYWA 1NFSA 1NQZA 5BONA 1KT9A 3P5TA 3H95A 4K6EA 5HZXA 2B0VA 1V8UA 5CFJA 4C9XA 2DSCA 3BHOA 3I7VA 5ANWA 2Q9PA 2FMLA 3X0QA 3X0SA 5GHMA 2I6KA 1PPVA 3HYQA 4JZUA 4N1TA 1VRLA 4V14A 2YVNA 2FVVA 3DUPA 4MPOA 4S2XA 1X83A 4YPHA 1V8SA 1MQEA 4HFQA 3N77A 1U20A 3O6ZA 5GHIA 5DPKA 1PVFA 1XSCA 5ANTA 4YOQA 1RRQA 1PPWA 2RRKA 3MCFA 1KTGA 2A8RA 1MK1A 2O5FA 5GHJA 5FSLA 2I8TA 2A8SA 2B06A 2ICJA 2VNQA 3OGAA 2AZWA 4JZVA 3Q2TA 2QJTA 4YPRA 2CZRA 1G9QA 1Q54A 1SU2A 2A8QA 3J7Ye 2A6TA 1F3YA 1JKNA 3X0JA 3GZ6A 2QJOA 3O69A 1X51A 1K26A 4ZG0A 1V8TA 4KG4A 3GZ8A 1PUQA 5GHOA 2PNYA 5FSNA 1V8WA 5ANSA 2O1CA 3A6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR0 A;  1QVJ A;  2QKM B;  5IW5 A;  2KDW A;  3SHD A;  3EF5 A;  1GA7 A;  1MQW A;  4S2W A;  3O61 A;  1V8M A;  4HVY A;  4KTB A;  5BS6 A;  2A8P A;  2B2K A;  1VK6 A;  5GHQ A;  1SZ3 A;  1VIQ A;  2O5W A;  3CNG A;  2G73 A;  3Q91 A;  3R03 A;  2DSD A;  3GWY A;  4S2V A;  3WHW A;  2DHO A;  1VIU A;  3EXQ A;  1HZT A;  2XSQ A;  5LPG A;  3RH7 A;  1IRY A;  3I7U A;  1Q27 A;  1VHG A;  1JRK A;  1K2E A;  5DEQ A;  5I8U A;  2DUK A;  3X0R A;  3X0I A;  4NFX A;  4C9W A;  5ANV A;  1NQY A;  3A6T A;  2VNP A;  5FSM A;  3KVH A;  1V8I A;  1V8Y A;  2W4E A;  4JZS A;  4NFW A;  3AC9 A;  3BM4 A;  1V8R A;  1VCD A;  1V8L A;  3ID9 A;  3N9U A;  1RYA A;  2DSB A;  1XSB A;  1HX3 A;  3DKU A;  3Q4I A;  4ICK A;  5C7T A;  1R67 A;  3FSP A;  1RRS A;  1I9A A;  1TUM A;  3X0P A;  5C8L A;  5DD4 A;  3FFU A;  1X84 A;  1KHZ A;  2GT2 A;  3GZ5 A;  3P6Y A;  4S2Y A;  1MR2 A;  2JVB A;  2YVM A;  3ACA A;  3GG6 A;  3X0M A;  3FK9 A;  4KYX A;  5FSI A;  5CFI A;  3FJY A;  2ICK A;  1MP2 A;  3SON A;  3QSJ A;  2YVO A;  2KDV A;  1VC8 A;  2GT4 A;  5DDG A;  2GB5 A;  3F13 A;  3GRN A;  3Q93 A;  2CL3 A;  1OW2 A;  1V8N A;  2FKB A;  2J8Q A;  2YVP A;  5GHN A;  3L85 A;  3FCM A;  3ZR1 A;  5FSK A;  2A8T A;  1PUN A;  3A6V A;  1VHZ A;  1V8V A;  2G74 A;  3EES A;  5ISY A;  1PUS A;  3BAP A;  4N1U A;  3MGM A;  3F6A A;  2R5W A;  4ILQ A;  3HHJ A;  3Q1P A;  1Q33 A;  4IJX A;  5GHP A;  3X0K A;  3Q2S A;  3X0L A;  3X0O A;  1MUT A;  3X0N A;  3EEU A;  5FSO A;  1NFZ A;  5ANU A;  3COU A;  3O52 A;  3MDG A;  2PQV A;  4KG3 A;  3G0Q A;  2I8U A;  3U53 A;  5IW4 A;  1G0S A;  1PPX A;  1XSA A;  1SOI A;  4JZT A;  1VC9 A;  3A6S A;  5C7Q A;  3O8S A;  3SMD A;  3MDI A;  3E57 A;  2YYH A;  3I9X A;  1SJY A;  4DYW A;  1NFS A;  1NQZ A;  5BON A;  1KT9 A;  3P5T A;  3H95 A;  4K6E A;  5HZX A;  2B0V A;  1V8U A;  5CFJ A;  4C9X A;  2DSC A;  3BHO A;  3I7V A;  5ANW A;  2Q9P A;  2FML A;  3X0Q A;  3X0S A;  5GHM A;  2I6K A;  1PPV A;  3HYQ A;  4JZU A;  4N1T A;  1VRL A;  4V14 A;  2YVN A;  2FVV A;  3DUP A;  4MPO A;  4S2X A;  1X83 A;  4YPH A;  1V8S A;  1MQE A;  4HFQ A;  3N77 A;  1U20 A;  3O6Z A;  5GHI A;  5DPK A;  1PVF A;  1XSC A;  5ANT A;  4YOQ A;  1RRQ A;  1PPW A;  2RRK A;  3MCF A;  1KTG A;  2A8R A;  1MK1 A;  2O5F A;  5GHJ A;  5FSL A;  2I8T A;  2A8S A;  2B06 A;  2ICJ A;  2VNQ A;  3OGA A;  2AZW A;  4JZV A;  3Q2T A;  2QJT A;  4YPR A;  1G9Q A;  1Q54 A;  1SU2 A;  2A8Q A;  3J7Y e;  2A6T A;  1F3Y A;  1JKN A;  3X0J A;  3GZ6 A;  2QJO A;  3O69 A;  1X51 A;  1K26 A;  4ZG0 A;  1V8T A;  4KG4 A;  3GZ8 A;  1PUQ A;  5GHO A;  2PNY A;  5FSN A;  1V8W A;  5ANS A;  2O1C A;  3A6U A; 
#chains in the Genus database with same CATH topology
 3ZR0 A;  1QVJ A;  2QKM B;  5IW5 A;  2KDW A;  3SHD A;  3EF5 A;  1GA7 A;  1MQW A;  4S2W A;  3O61 A;  1V8M A;  4HVY A;  4KTB A;  5BS6 A;  2A8P A;  2B2K A;  1VK6 A;  4J7H A;  1SZ3 A;  1VIQ A;  2O5W A;  3CNG A;  2G73 A;  3Q91 A;  3R03 A;  5GHQ A;  2DSD A;  3GWY A;  4S2V A;  3WHW A;  2DHO A;  1VIU A;  3EXQ A;  1HZT A;  2XSQ A;  5LPG A;  3RH7 A;  1IRY A;  3I7U A;  1Q27 A;  1VHG A;  1JRK A;  1K2E A;  5DEQ A;  5I8U A;  2DUK A;  3X0R A;  3X0I A;  4NFX A;  4C9W A;  5ANV A;  1NQY A;  3A6T A;  2VNP A;  4J7G A;  5FSM A;  3KVH A;  1V8I A;  1V8Y A;  2W4E A;  4JZS A;  4NFW A;  3AC9 A;  3BM4 A;  1V8R A;  1VCD A;  1V8L A;  3ID9 A;  3N9U A;  1RYA A;  2DSB A;  1XSB A;  1HX3 A;  3DKU A;  3Q4I A;  4ICK A;  5C7T A;  1R67 A;  3FSP A;  1RRS A;  1I9A A;  1TUM A;  3X0P A;  5C8L A;  5DD4 A;  3FFU A;  1X84 A;  1KHZ A;  2GT2 A;  3GZ5 A;  3P6Y A;  4S2Y A;  1MR2 A;  2JVB A;  2YVM A;  3ACA A;  3GG6 A;  3X0M A;  3FK9 A;  4KYX A;  5FSI A;  5CFI A;  3FJY A;  2ICK A;  1MP2 A;  3SON A;  3QSJ A;  2YVO A;  2KDV A;  1VC8 A;  2GT4 A;  5DDG A;  2GB5 A;  3F13 A;  3GRN A;  3Q93 A;  2CL3 A;  1OW2 A;  1V8N A;  2FKB A;  2J8Q A;  2YVP A;  5GHN A;  3L85 A;  3FCM A;  3ZR1 A;  5FSK A;  2A8T A;  1PUN A;  3A6V A;  1VHZ A;  1V8V A;  2G74 A;  3EES A;  5ISY A;  1PUS A;  3BAP A;  4N1U A;  3MGM A;  3F6A A;  2R5W A;  4ILQ A;  3HHJ A;  3Q1P A;  1Q33 A;  4IJX A;  5GHP A;  3X0K A;  3Q2S A;  3X0L A;  3X0O A;  1MUT A;  3X0N A;  3EEU A;  5FSO A;  1NFZ A;  5ANU A;  3COU A;  3O52 A;  3MDG A;  2PQV A;  4KG3 A;  3G0Q A;  2I8U A;  3U53 A;  5IW4 A;  1G0S A;  1PPX A;  1XSA A;  1SOI A;  4JZT A;  1VC9 A;  3A6S A;  5C7Q A;  3O8S A;  3SMD A;  3MDI A;  3E57 A;  2YYH A;  3I9X A;  1SJY A;  4DYW A;  1NFS A;  1NQZ A;  5BON A;  1KT9 A;  3P5T A;  3H95 A;  4K6E A;  5HZX A;  2B0V A;  1V8U A;  5CFJ A;  4C9X A;  2DSC A;  3BHO A;  3I7V A;  5ANW A;  2Q9P A;  2FML A;  3X0Q A;  3X0S A;  5GHM A;  2I6K A;  1PPV A;  3HYQ A;  4JZU A;  4N1T A;  1VRL A;  4V14 A;  2YVN A;  2FVV A;  3DUP A;  4MPO A;  4S2X A;  1X83 A;  4YPH A;  1V8S A;  1MQE A;  4HFQ A;  3N77 A;  1U20 A;  3O6Z A;  5GHI A;  5DPK A;  1PVF A;  1XSC A;  5ANT A;  4YOQ A;  1RRQ A;  1PPW A;  2RRK A;  3MCF A;  1KTG A;  2A8R A;  1MK1 A;  2O5F A;  5GHJ A;  5FSL A;  2I8T A;  2A8S A;  2B06 A;  2ICJ A;  2VNQ A;  3OGA A;  2AZW A;  4JZV A;  3Q2T A;  2QJT A;  4YPR A;  2CZR A;  1G9Q A;  1Q54 A;  1SU2 A;  2A8Q A;  3J7Y e;  2A6T A;  1F3Y A;  1JKN A;  3X0J A;  3GZ6 A;  2QJO A;  3O69 A;  1X51 A;  1K26 A;  4ZG0 A;  1V8T A;  4KG4 A;  3GZ8 A;  1PUQ A;  5GHO A;  2PNY A;  5FSN A;  1V8W A;  5ANS A;  2O1C A;  3A6U A; 
#chains in the Genus database with same CATH homology
 3ZR0 A;  1QVJ A;  2QKM B;  5IW5 A;  2KDW A;  3SHD A;  3EF5 A;  1GA7 A;  1MQW A;  4S2W A;  3O61 A;  1V8M A;  4HVY A;  4KTB A;  5BS6 A;  2A8P A;  2B2K A;  1VK6 A;  4J7H A;  1SZ3 A;  1VIQ A;  2O5W A;  3CNG A;  2G73 A;  3Q91 A;  3R03 A;  5GHQ A;  2DSD A;  3GWY A;  4S2V A;  3WHW A;  2DHO A;  1VIU A;  3EXQ A;  1HZT A;  2XSQ A;  5LPG A;  3RH7 A;  1IRY A;  3I7U A;  1Q27 A;  1VHG A;  1JRK A;  1K2E A;  5DEQ A;  5I8U A;  2DUK A;  3X0R A;  3X0I A;  4NFX A;  4C9W A;  5ANV A;  1NQY A;  3A6T A;  2VNP A;  4J7G A;  5FSM A;  3KVH A;  1V8I A;  1V8Y A;  2W4E A;  4JZS A;  4NFW A;  3AC9 A;  3BM4 A;  1V8R A;  1VCD A;  1V8L A;  3ID9 A;  3N9U A;  1RYA A;  2DSB A;  1XSB A;  1HX3 A;  3DKU A;  3Q4I A;  4ICK A;  5C7T A;  1R67 A;  3FSP A;  1RRS A;  1I9A A;  1TUM A;  3X0P A;  5C8L A;  5DD4 A;  3FFU A;  1X84 A;  1KHZ A;  2GT2 A;  3GZ5 A;  3P6Y A;  4S2Y A;  1MR2 A;  2JVB A;  2YVM A;  3ACA A;  3GG6 A;  3X0M A;  3FK9 A;  4KYX A;  5FSI A;  5CFI A;  3FJY A;  2ICK A;  1MP2 A;  3SON A;  3QSJ A;  2YVO A;  2KDV A;  1VC8 A;  2GT4 A;  5DDG A;  2GB5 A;  3F13 A;  3GRN A;  3Q93 A;  2CL3 A;  1OW2 A;  1V8N A;  2FKB A;  2J8Q A;  2YVP A;  5GHN A;  3L85 A;  3FCM A;  3ZR1 A;  5FSK A;  2A8T A;  1PUN A;  3A6V A;  1VHZ A;  1V8V A;  2G74 A;  3EES A;  5ISY A;  1PUS A;  3BAP A;  4N1U A;  3MGM A;  3F6A A;  2R5W A;  4ILQ A;  3HHJ A;  3Q1P A;  1Q33 A;  4IJX A;  5GHP A;  3X0K A;  3Q2S A;  3X0L A;  3X0O A;  1MUT A;  3X0N A;  3EEU A;  5FSO A;  1NFZ A;  5ANU A;  3COU A;  3O52 A;  3MDG A;  2PQV A;  4KG3 A;  3G0Q A;  2I8U A;  3U53 A;  5IW4 A;  1G0S A;  1PPX A;  1XSA A;  1SOI A;  4JZT A;  1VC9 A;  3A6S A;  5C7Q A;  3O8S A;  3SMD A;  3MDI A;  3E57 A;  2YYH A;  3I9X A;  1SJY A;  4DYW A;  1NFS A;  1NQZ A;  5BON A;  1KT9 A;  3P5T A;  3H95 A;  4K6E A;  5HZX A;  2B0V A;  1V8U A;  5CFJ A;  4C9X A;  2DSC A;  3BHO A;  3I7V A;  5ANW A;  2Q9P A;  2FML A;  3X0Q A;  3X0S A;  5GHM A;  2I6K A;  1PPV A;  3HYQ A;  4JZU A;  4N1T A;  1VRL A;  4V14 A;  2YVN A;  2FVV A;  3DUP A;  4MPO A;  4S2X A;  1X83 A;  4YPH A;  1V8S A;  1MQE A;  4HFQ A;  3N77 A;  1U20 A;  3O6Z A;  5GHI A;  5DPK A;  1PVF A;  1XSC A;  5ANT A;  4YOQ A;  1RRQ A;  1PPW A;  2RRK A;  3MCF A;  1KTG A;  2A8R A;  1MK1 A;  2O5F A;  5GHJ A;  5FSL A;  2I8T A;  2A8S A;  2B06 A;  2ICJ A;  2VNQ A;  3OGA A;  2AZW A;  4JZV A;  3Q2T A;  2QJT A;  4YPR A;  2CZR A;  1G9Q A;  1Q54 A;  1SU2 A;  2A8Q A;  3J7Y e;  2A6T A;  1F3Y A;  1JKN A;  3X0J A;  3GZ6 A;  2QJO A;  3O69 A;  1X51 A;  1K26 A;  4ZG0 A;  1V8T A;  4KG4 A;  3GZ8 A;  1PUQ A;  5GHO A;  2PNY A;  5FSN A;  1V8W A;  5ANS A;  2O1C A;  3A6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...