2O6QA

Structural diversity of the hagfish variable lymphocyte receptors a29
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
270
structure length
270
Chain Sequence
NEALCKKDGGVCSCNNNKNSVDCSSKKLTAIPSNIPADTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLTYLSLGYNELQSLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQLQENPWDCTCNGIIYMAKWLKKKADEGLGGVDTAGCEKGGKAVLEITEKDAASDCVSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
molecule keywords Variable lymphocyte receptor A
source organism Eptatretus burgeri
molecule tags Immune system
total genus 77
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6qA00
2OMXA 2R9UA 2BNHA 5AZ5A 3RIZA 4R5CA 1DS9A 4R08A 4BSSA 3W3JA 2XWTC 3UN9A 4BSUA 4TZHA 5GMHA 1H6UA 5GS0A 3O53A 1KOHA 2P1MB 1FQVA 3RJ0A 1W8AA 2Z7XA 4KXFB 4FCGA 1P9AG 4U08A 3KJ4A 2P1QB 4H09A 2Z64A 3WPDA 3WN4A 1K5GC 2WQVA 2Z81A 2V9SA 4R09A 4CNCA 2P1PB 4R07A 4Q3GA 3BZ5A 3CIGA 2UZXA 2UZYA 4IM6A 3OJAA 4R6AA 4HQ1A 5GS2B 2Z62A 1OTNA 4PERA 1LTXA 3ULUA 1P8TA 4R0AA 1OZNA 4P91A 2Z7XB 5AWAA 1GWBA 3VQ2A 4CP6A 4M7EA 4XOSA 4ARNA 3PMHG 4LSCA 4LXRA 3WPEA 3A79B 2WQWA 4Z94G 2BEXA 1FO1A 3M19A 2Y5QA 4AW4A 3G3BA 2XOTA 4PSJA 2Z82A 4QXEA 3OJAB 4EZGA 3RW6A 1XKUA 4J0MA 5AWBA 2WFHA 1XCDA 3M18A 3RW7A 4G8AA 5A5CA 3ZYOA 2OMVA 4LSAA 4M7EC 4GT6A 4FD0A 1XEUA 1O6TA 3C6OB 2V9TB 4V2CA 4L3AA 3ZYIA 1JL5A 3C6NB 4U7LA 5CMNA 3RFEA 1WWLA 5AWDA 4PKIG 1IO0A 4U06A 1OTOA 3E6JA 1SQ0B 3G39A 4Z8GA 4L3FA 4R6FA 5HZLB 1P8VA 4KNGA 4B8CD 1M0ZA 4K17A 4LI1A 3G3AA 1A9NA 4R6JA 3ULVA 4Q3IA 4Q62A 4RWTC 2JQDA 3G06A 2WQXA 4U09A 2JE1A 4UFRA 1D0BA 5IYXC 1K5DC 3W3KA 3RFSA 3WPFA 1M10B 4CC4A 1G9UA 3W3LA 2RR6A 2O6RA 5D3IA 5IJBA 3OGLB 3G04C 5GMGA 2OMWA 4C2BB 1H6TA 1U0ND 4FHOA 4MN8B 3REZA 4QBZA 4RCAB 1M9SA 3P72A 3TSRE 1YRGA 2Z63A 3O6NA 1M9LA 4ARRA 3WPIA 4C2AB 4RCWA 4PEQB 5FTTB 4I6JB 2ID5A 3UL9A 3E4GA 1KOOA 1OGQA 5B4PA 1A4YA 3WPHA 2WQUA 4FDWA 4KT1A 3JB9j 2RA8A 4CC4C 5B0TA 3SB4A 5HDHA 1Z7XW 4J4LA 3FXIA 5AWCA 4WP6A 4LXSA 3CIYA 1XWDC 2ELLA 4PQ8A 3W3GA 1OOKG 3C6PB 4LSXA 3ULAA 2OMZA 2ASTB 4NKHA 3WPCA 1O6VA 2O6SA 4R5DA 2CA6A 4P8SA 5GMFA 4V2DA 4V2EA 4R6GA 2OMYA 1XECA 2OMUA 1FS2A 4Z79A 4Z64C 4QC0A 2OMTA 4LI2A 3E3ZA 4MQWX 4YEBB 4GLPA 4XSQA 3ZYNA 4BSRA 4XGOA 5IJDA 4R58A 3ZYJA 4WYKA 4FS7A 2IFGA 4Y61B 2P1NB 4BV4R 1FT8A 3W3NA 1DCEA 4OQTA 4Z61C 4LSXC 3VQ1A 4CNMA 1ZIWA 4ECOA 4ECNA 2ASSB 3RFJA 3CVRA 2Z65A 4AY9X 5B0NA 3OGMB 1QYYA 2P1OB 5CMPA 3W3MA 3RGZA 4CILA 2V70A 5LFNA 3DZEA 2O6QA 3UL7A 3WPBA 5IJCA 2JE0A 2A0ZA 2Q4GW 4NKGA 1PGVA 3RGXA 1DFJI 5GQRK 2Z66A 2FT3A 3GOZA 1O6SA 3OGKB 1OTMA 3WPGA 3E2JA 4FMZA 3UL8A
chains in the Genus database with same CATH superfamily
2OMXA 2R9UA 2BNHA 5AZ5A 3RIZA 4R5CA 1DS9A 4R08A 4BSSA 3W3JA 2XWTC 3UN9A 4BSUA 4TZHA 5GMHA 1H6UA 5GS0A 3O53A 1KOHA 2P1MB 1FQVA 3RJ0A 1W8AA 2Z7XA 4KXFB 4FCGA 1P9AG 4U08A 3KJ4A 2P1QB 4H09A 2Z64A 3WPDA 3WN4A 1K5GC 2WQVA 2Z81A 2V9SA 4R09A 4CNCA 2P1PB 4R07A 4Q3GA 3BZ5A 3CIGA 2UZXA 2UZYA 4NZTM 4IM6A 3OJAA 4R6AA 4HQ1A 5GS2B 2Z62A 1OTNA 4PERA 1LTXA 3ULUA 1P8TA 4R0AA 1OZNA 4P91A 2Z7XB 5AWAA 1GWBA 3VQ2A 4CP6A 4M7EA 4XOSA 4ARNA 3PMHG 4LSCA 4LXRA 3WPEA 3A79B 2WQWA 4Z94G 2BEXA 1FO1A 3M19A 2Y5QA 4AW4A 3G3BA 2XOTA 4PSJA 2Z82A 4QXEA 3OJAB 4EZGA 3RW6A 1XKUA 4J0MA 5AWBA 2WFHA 1XCDA 3M18A 3RW7A 4G8AA 5A5CA 3ZYOA 2OMVA 4LSAA 4M7EC 4GT6A 4FD0A 1XEUA 1O6TA 3C6OB 2V9TB 4V2CA 4L3AA 3ZYIA 1JL5A 3C6NB 4U7LA 5CMNA 3RFEA 1WWLA 5AWDA 4PKIG 1IO0A 4U06A 1OTOA 3E6JA 1SQ0B 3G39A 4Z8GA 4L3FA 4R6FA 5HZLB 1P8VA 4KNGA 4B8CD 1M0ZA 4K17A 4LI1A 3G3AA 1A9NA 4R6JA 3ULVA 4Q3IA 4Q62A 4RWTC 2JQDA 3G06A 2WQXA 4U09A 2JE1A 4UFRA 1D0BA 5IYXC 1K5DC 3W3KA 3RFSA 3WPFA 1M10B 4CC4A 1G9UA 3W3LA 2RR6A 2O6RA 5D3IA 5IJBA 3OGLB 3G04C 5GMGA 2OMWA 4C2BB 1H6TA 1U0ND 4FHOA 4MN8B 3REZA 4QBZA 4RCAB 1M9SA 3P72A 3TSRE 1YRGA 2Z63A 3O6NA 1M9LA 4ARRA 3WPIA 4C2AB 4RCWA 4PEQB 5FTTB 4I6JB 2ID5A 3UL9A 3E4GA 1KOOA 1OGQA 5B4PA 1A4YA 3WPHA 2WQUA 4FDWA 4KT1A 3JB9j 2RA8A 4CC4C 5B0TA 3SB4A 5HDHA 1Z7XW 4J4LA 3FXIA 5AWCA 4WP6A 4LXSA 3CIYA 1XWDC 2ELLA 4PQ8A 3W3GA 1OOKG 3C6PB 4LSXA 3ULAA 2OMZA 2ASTB 4NKHA 3WPCA 1O6VA 2O6SA 4R5DA 2CA6A 4P8SA 5GMFA 4V2DA 4V2EA 4R6GA 2OMYA 1XECA 2OMUA 1FS2A 4Z79A 4Z64C 4QC0A 2OMTA 4LI2A 3E3ZA 4MQWX 4YEBB 4GLPA 4XSQA 3ZYNA 4BSRA 4XGOA 5IJDA 4R58A 3ZYJA 4WYKA 4FS7A 2IFGA 4Y61B 2P1NB 4BV4R 1FT8A 3W3NA 1DCEA 4OQTA 4Z61C 4LSXC 3VQ1A 4CNMA 1ZIWA 4ECOA 4ECNA 2ASSB 3RFJA 3CVRA 2Z65A 4AY9X 5B0NA 4NZRM 3OGMB 1QYYA 2P1OB 5CMPA 3W3MA 3RGZA 4CILA 2V70A 5LFNA 3DZEA 2O6QA 3UL7A 3WPBA 5IJCA 2JE0A 2A0ZA 2Q4GW 4NKGA 1PGVA 3RGXA 1DFJI 5GQRK 2Z66A 2FT3A 3GOZA 1O6SA 3OGKB 1OTMA 3WPGA 3E2JA 4FMZA 3UL8A
chains in the Genus database with same CATH topology
2OMXA 2R9UA 2BNHA 5AZ5A 3RIZA 4R5CA 1DS9A 4R08A 4BSSA 3W3JA 2XWTC 3UN9A 4BSUA 4TZHA 5GMHA 1H6UA 5GS0A 3O53A 1KOHA 2P1MB 1FQVA 3RJ0A 1W8AA 2Z7XA 4KXFB 4FCGA 1P9AG 4U08A 3KJ4A 2P1QB 4H09A 2Z64A 3WPDA 3WN4A 1K5GC 2WQVA 2Z81A 2V9SA 4R09A 4CNCA 2P1PB 4R07A 4Q3GA 3BZ5A 3CIGA 2UZXA 2UZYA 4IM6A 3OJAA 4R6AA 4HQ1A 5GS2B 2Z62A 1OTNA 4PERA 1LTXA 3ULUA 1P8TA 4R0AA 1OZNA 4P91A 2Z7XB 5AWAA 1GWBA 3VQ2A 4CP6A 4M7EA 4XOSA 4ARNA 3PMHG 4LSCA 4LXRA 3WPEA 3A79B 2WQWA 4Z94G 2BEXA 1FO1A 3M19A 2Y5QA 4AW4A 3G3BA 2XOTA 4PSJA 2Z82A 4QXEA 3OJAB 4EZGA 3RW6A 1XKUA 4J0MA 5AWBA 2WFHA 1XCDA 3M18A 3RW7A 4G8AA 5A5CA 3ZYOA 2OMVA 4LSAA 4M7EC 4GT6A 4FD0A 1XEUA 1O6TA 3C6OB 2V9TB 4V2CA 4L3AA 3ZYIA 1JL5A 3C6NB 4U7LA 5CMNA 3RFEA 1WWLA 5AWDA 4PKIG 1IO0A 4U06A 1OTOA 3E6JA 1SQ0B 3G39A 4Z8GA 4L3FA 4R6FA 5HZLB 1P8VA 4KNGA 4B8CD 1M0ZA 4K17A 4LI1A 3G3AA 1A9NA 4R6JA 3ULVA 4Q3IA 4Q62A 4RWTC 2JQDA 3G06A 2WQXA 4U09A 2JE1A 4UFRA 1D0BA 5IYXC 1K5DC 3W3KA 3RFSA 3WPFA 1M10B 4CC4A 1G9UA 3W3LA 2RR6A 2O6RA 5D3IA 5IJBA 3OGLB 3G04C 5GMGA 2OMWA 4C2BB 1H6TA 1U0ND 4FHOA 4MN8B 3REZA 4QBZA 4RCAB 1M9SA 3P72A 3TSRE 1YRGA 2Z63A 3O6NA 1M9LA 4ARRA 3WPIA 4C2AB 4RCWA 4PEQB 5FTTB 4I6JB 2ID5A 3UL9A 3E4GA 1KOOA 1OGQA 5B4PA 1A4YA 3WPHA 2WQUA 4FDWA 4KT1A 3JB9j 2RA8A 4CC4C 5B0TA 3SB4A 5HDHA 1Z7XW 4J4LA 3FXIA 5AWCA 4WP6A 4LXSA 3CIYA 1XWDC 2ELLA 4PQ8A 3W3GA 1OOKG 3C6PB 4LSXA 3ULAA 2OMZA 2ASTB 4NKHA 3WPCA 1O6VA 2O6SA 4R5DA 2CA6A 4P8SA 5GMFA 4V2DA 4V2EA 4R6GA 2OMYA 1XECA 2OMUA 1FS2A 4Z79A 4Z64C 4QC0A 2OMTA 4LI2A 3E3ZA 4MQWX 4YEBB 4GLPA 4XSQA 3ZYNA 4BSRA 4XGOA 5IJDA 4R58A 3ZYJA 4WYKA 4FS7A 2IFGA 4Y61B 2P1NB 4BV4R 1FT8A 3W3NA 1DCEA 4OQTA 4Z61C 4LSXC 3VQ1A 4CNMA 1ZIWA 4ECOA 4ECNA 2ASSB 3RFJA 3CVRA 2Z65A 4AY9X 5B0NA 3OGMB 1QYYA 2P1OB 5CMPA 3W3MA 3RGZA 4CILA 2V70A 5LFNA 3DZEA 2O6QA 3UL7A 3WPBA 5IJCA 2JE0A 2A0ZA 2Q4GW 4NKGA 1PGVA 3RGXA 1DFJI 5GQRK 2Z66A 2FT3A 3GOZA 1O6SA 3OGKB 1OTMA 3WPGA 3E2JA 4FMZA 3UL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMX A;  2R9U A;  2BNH A;  5AZ5 A;  3RIZ A;  4R5C A;  1DS9 A;  4R08 A;  4BSS A;  3W3J A;  2XWT C;  3UN9 A;  4BSU A;  4TZH A;  5GMH A;  1H6U A;  5GS0 A;  3O53 A;  1KOH A;  2P1M B;  1FQV A;  3RJ0 A;  1W8A A;  2Z7X A;  4KXF B;  4FCG A;  1P9A G;  4U08 A;  3KJ4 A;  2P1Q B;  4H09 A;  2Z64 A;  3WPD A;  3WN4 A;  1K5G C;  2WQV A;  2Z81 A;  2V9S A;  4R09 A;  4CNC A;  2P1P B;  4R07 A;  4Q3G A;  3BZ5 A;  3CIG A;  2UZX A;  2UZY A;  4IM6 A;  3OJA A;  4R6A A;  4HQ1 A;  5GS2 B;  2Z62 A;  1OTN A;  4PER A;  1LTX A;  3ULU A;  1P8T A;  4R0A A;  1OZN A;  4P91 A;  2Z7X B;  5AWA A;  1GWB A;  3VQ2 A;  4CP6 A;  4M7E A;  4XOS A;  4ARN A;  3PMH G;  4LSC A;  4LXR A;  3WPE A;  3A79 B;  2WQW A;  4Z94 G;  2BEX A;  1FO1 A;  3M19 A;  2Y5Q A;  4AW4 A;  3G3B A;  2XOT A;  4PSJ A;  2Z82 A;  4QXE A;  3OJA B;  4EZG A;  3RW6 A;  1XKU A;  4J0M A;  5AWB A;  2WFH A;  1XCD A;  3M18 A;  3RW7 A;  4G8A A;  5A5C A;  3ZYO A;  2OMV A;  4LSA A;  4M7E C;  4GT6 A;  4FD0 A;  1XEU A;  1O6T A;  3C6O B;  2V9T B;  4V2C A;  4L3A A;  3ZYI A;  1JL5 A;  3C6N B;  4U7L A;  5CMN A;  3RFE A;  1WWL A;  5AWD A;  4PKI G;  1IO0 A;  4U06 A;  1OTO A;  3E6J A;  1SQ0 B;  3G39 A;  4Z8G A;  4L3F A;  4R6F A;  5HZL B;  1P8V A;  4KNG A;  4B8C D;  1M0Z A;  4K17 A;  4LI1 A;  3G3A A;  1A9N A;  4R6J A;  3ULV A;  4Q3I A;  4Q62 A;  4RWT C;  2JQD A;  3G06 A;  2WQX A;  4U09 A;  2JE1 A;  4UFR A;  1D0B A;  5IYX C;  1K5D C;  3W3K A;  3RFS A;  3WPF A;  1M10 B;  4CC4 A;  1G9U A;  3W3L A;  2RR6 A;  2O6R A;  5D3I A;  5IJB A;  3OGL B;  3G04 C;  5GMG A;  2OMW A;  4C2B B;  1H6T A;  1U0N D;  4FHO A;  4MN8 B;  3REZ A;  4QBZ A;  4RCA B;  1M9S A;  3P72 A;  3TSR E;  1YRG A;  2Z63 A;  3O6N A;  1M9L A;  4ARR A;  3WPI A;  4C2A B;  4RCW A;  4PEQ B;  5FTT B;  4I6J B;  2ID5 A;  3UL9 A;  3E4G A;  1KOO A;  1OGQ A;  5B4P A;  1A4Y A;  3WPH A;  2WQU A;  4FDW A;  4KT1 A;  3JB9 j;  2RA8 A;  4CC4 C;  5B0T A;  3SB4 A;  5HDH A;  1Z7X W;  4J4L A;  3FXI A;  5AWC A;  4WP6 A;  4LXS A;  3CIY A;  1XWD C;  2ELL A;  4PQ8 A;  3W3G A;  1OOK G;  3C6P B;  4LSX A;  3ULA A;  2OMZ A;  2AST B;  4NKH A;  3WPC A;  1O6V A;  2O6S A;  4R5D A;  2CA6 A;  4P8S A;  5GMF A;  4V2D A;  4V2E A;  4R6G A;  2OMY A;  1XEC A;  2OMU A;  1FS2 A;  4Z79 A;  4Z64 C;  4QC0 A;  2OMT A;  4LI2 A;  3E3Z A;  4MQW X;  4YEB B;  4GLP A;  4XSQ A;  3ZYN A;  4BSR A;  4XGO A;  5IJD A;  4R58 A;  3ZYJ A;  4WYK A;  4FS7 A;  2IFG A;  4Y61 B;  2P1N B;  4BV4 R;  1FT8 A;  3W3N A;  1DCE A;  4OQT A;  4Z61 C;  4LSX C;  3VQ1 A;  4CNM A;  1ZIW A;  4ECO A;  4ECN A;  2ASS B;  3RFJ A;  3CVR A;  2Z65 A;  4AY9 X;  5B0N A;  3OGM B;  1QYY A;  2P1O B;  5CMP A;  3W3M A;  3RGZ A;  4CIL A;  2V70 A;  5LFN A;  3DZE A;  2O6Q A;  3UL7 A;  3WPB A;  5IJC A;  2JE0 A;  2A0Z A;  2Q4G W;  4NKG A;  1PGV A;  3RGX A;  1DFJ I;  5GQR K;  2Z66 A;  2FT3 A;  3GOZ A;  1O6S A;  3OGK B;  1OTM A;  3WPG A;  3E2J A;  4FMZ A;  3UL8 A; 
#chains in the Genus database with same CATH topology
 2OMX A;  2R9U A;  2BNH A;  5AZ5 A;  3RIZ A;  4R5C A;  1DS9 A;  4R08 A;  4BSS A;  3W3J A;  2XWT C;  3UN9 A;  4BSU A;  4TZH A;  5GMH A;  1H6U A;  5GS0 A;  3O53 A;  1KOH A;  2P1M B;  1FQV A;  3RJ0 A;  1W8A A;  2Z7X A;  4KXF B;  4FCG A;  1P9A G;  4U08 A;  3KJ4 A;  2P1Q B;  4H09 A;  2Z64 A;  3WPD A;  3WN4 A;  1K5G C;  2WQV A;  2Z81 A;  2V9S A;  4R09 A;  4CNC A;  2P1P B;  4R07 A;  4Q3G A;  3BZ5 A;  3CIG A;  2UZX A;  2UZY A;  4NZT M;  4IM6 A;  3OJA A;  4R6A A;  4HQ1 A;  5GS2 B;  2Z62 A;  1OTN A;  4PER A;  1LTX A;  3ULU A;  1P8T A;  4R0A A;  1OZN A;  4P91 A;  2Z7X B;  5AWA A;  1GWB A;  3VQ2 A;  4CP6 A;  4M7E A;  4XOS A;  4ARN A;  3PMH G;  4LSC A;  4LXR A;  3WPE A;  3A79 B;  2WQW A;  4Z94 G;  2BEX A;  1FO1 A;  3M19 A;  2Y5Q A;  4AW4 A;  3G3B A;  2XOT A;  4PSJ A;  2Z82 A;  4QXE A;  3OJA B;  4EZG A;  3RW6 A;  1XKU A;  4J0M A;  5AWB A;  2WFH A;  1XCD A;  3M18 A;  3RW7 A;  4G8A A;  5A5C A;  3ZYO A;  2OMV A;  4LSA A;  4M7E C;  4GT6 A;  4FD0 A;  1XEU A;  1O6T A;  3C6O B;  2V9T B;  4V2C A;  4L3A A;  3ZYI A;  1JL5 A;  3C6N B;  4U7L A;  5CMN A;  3RFE A;  1WWL A;  5AWD A;  4PKI G;  1IO0 A;  4U06 A;  1OTO A;  3E6J A;  1SQ0 B;  3G39 A;  4Z8G A;  4L3F A;  4R6F A;  5HZL B;  1P8V A;  4KNG A;  4B8C D;  1M0Z A;  4K17 A;  4LI1 A;  3G3A A;  1A9N A;  4R6J A;  3ULV A;  4Q3I A;  4Q62 A;  4RWT C;  2JQD A;  3G06 A;  2WQX A;  4U09 A;  2JE1 A;  4UFR A;  1D0B A;  5IYX C;  1K5D C;  3W3K A;  3RFS A;  3WPF A;  1M10 B;  4CC4 A;  1G9U A;  3W3L A;  2RR6 A;  2O6R A;  5D3I A;  5IJB A;  3OGL B;  3G04 C;  5GMG A;  2OMW A;  4C2B B;  1H6T A;  1U0N D;  4FHO A;  4MN8 B;  3REZ A;  4QBZ A;  4RCA B;  1M9S A;  3P72 A;  3TSR E;  1YRG A;  2Z63 A;  3O6N A;  1M9L A;  4ARR A;  3WPI A;  4C2A B;  4RCW A;  4PEQ B;  5FTT B;  4I6J B;  2ID5 A;  3UL9 A;  3E4G A;  1KOO A;  1OGQ A;  5B4P A;  1A4Y A;  3WPH A;  2WQU A;  4FDW A;  4KT1 A;  3JB9 j;  2RA8 A;  4CC4 C;  5B0T A;  3SB4 A;  5HDH A;  1Z7X W;  4J4L A;  3FXI A;  5AWC A;  4WP6 A;  4LXS A;  3CIY A;  1XWD C;  2ELL A;  4PQ8 A;  3W3G A;  1OOK G;  3C6P B;  4LSX A;  3ULA A;  2OMZ A;  2AST B;  4NKH A;  3WPC A;  1O6V A;  2O6S A;  4R5D A;  2CA6 A;  4P8S A;  5GMF A;  4V2D A;  4V2E A;  4R6G A;  2OMY A;  1XEC A;  2OMU A;  1FS2 A;  4Z79 A;  4Z64 C;  4QC0 A;  2OMT A;  4LI2 A;  3E3Z A;  4MQW X;  4YEB B;  4GLP A;  4XSQ A;  3ZYN A;  4BSR A;  4XGO A;  5IJD A;  4R58 A;  3ZYJ A;  4WYK A;  4FS7 A;  2IFG A;  4Y61 B;  2P1N B;  4BV4 R;  1FT8 A;  3W3N A;  1DCE A;  4OQT A;  4Z61 C;  4LSX C;  3VQ1 A;  4CNM A;  1ZIW A;  4ECO A;  4ECN A;  2ASS B;  3RFJ A;  3CVR A;  2Z65 A;  4AY9 X;  5B0N A;  4NZR M;  3OGM B;  1QYY A;  2P1O B;  5CMP A;  3W3M A;  3RGZ A;  4CIL A;  2V70 A;  5LFN A;  3DZE A;  2O6Q A;  3UL7 A;  3WPB A;  5IJC A;  2JE0 A;  2A0Z A;  2Q4G W;  4NKG A;  1PGV A;  3RGX A;  1DFJ I;  5GQR K;  2Z66 A;  2FT3 A;  3GOZ A;  1O6S A;  3OGK B;  1OTM A;  3WPG A;  3E2J A;  4FMZ A;  3UL8 A; 
#chains in the Genus database with same CATH homology
 2OMX A;  2R9U A;  2BNH A;  5AZ5 A;  3RIZ A;  4R5C A;  1DS9 A;  4R08 A;  4BSS A;  3W3J A;  2XWT C;  3UN9 A;  4BSU A;  4TZH A;  5GMH A;  1H6U A;  5GS0 A;  3O53 A;  1KOH A;  2P1M B;  1FQV A;  3RJ0 A;  1W8A A;  2Z7X A;  4KXF B;  4FCG A;  1P9A G;  4U08 A;  3KJ4 A;  2P1Q B;  4H09 A;  2Z64 A;  3WPD A;  3WN4 A;  1K5G C;  2WQV A;  2Z81 A;  2V9S A;  4R09 A;  4CNC A;  2P1P B;  4R07 A;  4Q3G A;  3BZ5 A;  3CIG A;  2UZX A;  2UZY A;  4IM6 A;  3OJA A;  4R6A A;  4HQ1 A;  5GS2 B;  2Z62 A;  1OTN A;  4PER A;  1LTX A;  3ULU A;  1P8T A;  4R0A A;  1OZN A;  4P91 A;  2Z7X B;  5AWA A;  1GWB A;  3VQ2 A;  4CP6 A;  4M7E A;  4XOS A;  4ARN A;  3PMH G;  4LSC A;  4LXR A;  3WPE A;  3A79 B;  2WQW A;  4Z94 G;  2BEX A;  1FO1 A;  3M19 A;  2Y5Q A;  4AW4 A;  3G3B A;  2XOT A;  4PSJ A;  2Z82 A;  4QXE A;  3OJA B;  4EZG A;  3RW6 A;  1XKU A;  4J0M A;  5AWB A;  2WFH A;  1XCD A;  3M18 A;  3RW7 A;  4G8A A;  5A5C A;  3ZYO A;  2OMV A;  4LSA A;  4M7E C;  4GT6 A;  4FD0 A;  1XEU A;  1O6T A;  3C6O B;  2V9T B;  4V2C A;  4L3A A;  3ZYI A;  1JL5 A;  3C6N B;  4U7L A;  5CMN A;  3RFE A;  1WWL A;  5AWD A;  4PKI G;  1IO0 A;  4U06 A;  1OTO A;  3E6J A;  1SQ0 B;  3G39 A;  4Z8G A;  4L3F A;  4R6F A;  5HZL B;  1P8V A;  4KNG A;  4B8C D;  1M0Z A;  4K17 A;  4LI1 A;  3G3A A;  1A9N A;  4R6J A;  3ULV A;  4Q3I A;  4Q62 A;  4RWT C;  2JQD A;  3G06 A;  2WQX A;  4U09 A;  2JE1 A;  4UFR A;  1D0B A;  5IYX C;  1K5D C;  3W3K A;  3RFS A;  3WPF A;  1M10 B;  4CC4 A;  1G9U A;  3W3L A;  2RR6 A;  2O6R A;  5D3I A;  5IJB A;  3OGL B;  3G04 C;  5GMG A;  2OMW A;  4C2B B;  1H6T A;  1U0N D;  4FHO A;  4MN8 B;  3REZ A;  4QBZ A;  4RCA B;  1M9S A;  3P72 A;  3TSR E;  1YRG A;  2Z63 A;  3O6N A;  1M9L A;  4ARR A;  3WPI A;  4C2A B;  4RCW A;  4PEQ B;  5FTT B;  4I6J B;  2ID5 A;  3UL9 A;  3E4G A;  1KOO A;  1OGQ A;  5B4P A;  1A4Y A;  3WPH A;  2WQU A;  4FDW A;  4KT1 A;  3JB9 j;  2RA8 A;  4CC4 C;  5B0T A;  3SB4 A;  5HDH A;  1Z7X W;  4J4L A;  3FXI A;  5AWC A;  4WP6 A;  4LXS A;  3CIY A;  1XWD C;  2ELL A;  4PQ8 A;  3W3G A;  1OOK G;  3C6P B;  4LSX A;  3ULA A;  2OMZ A;  2AST B;  4NKH A;  3WPC A;  1O6V A;  2O6S A;  4R5D A;  2CA6 A;  4P8S A;  5GMF A;  4V2D A;  4V2E A;  4R6G A;  2OMY A;  1XEC A;  2OMU A;  1FS2 A;  4Z79 A;  4Z64 C;  4QC0 A;  2OMT A;  4LI2 A;  3E3Z A;  4MQW X;  4YEB B;  4GLP A;  4XSQ A;  3ZYN A;  4BSR A;  4XGO A;  5IJD A;  4R58 A;  3ZYJ A;  4WYK A;  4FS7 A;  2IFG A;  4Y61 B;  2P1N B;  4BV4 R;  1FT8 A;  3W3N A;  1DCE A;  4OQT A;  4Z61 C;  4LSX C;  3VQ1 A;  4CNM A;  1ZIW A;  4ECO A;  4ECN A;  2ASS B;  3RFJ A;  3CVR A;  2Z65 A;  4AY9 X;  5B0N A;  3OGM B;  1QYY A;  2P1O B;  5CMP A;  3W3M A;  3RGZ A;  4CIL A;  2V70 A;  5LFN A;  3DZE A;  2O6Q A;  3UL7 A;  3WPB A;  5IJC A;  2JE0 A;  2A0Z A;  2Q4G W;  4NKG A;  1PGV A;  3RGX A;  1DFJ I;  5GQR K;  2Z66 A;  2FT3 A;  3GOZ A;  1O6S A;  3OGK B;  1OTM A;  3WPG A;  3E2J A;  4FMZ A;  3UL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...