2O6QA

Structural diversity of the hagfish variable lymphocyte receptors a29
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
270
structure length
270
Chain Sequence
NEALCKKDGGVCSCNNNKNSVDCSSKKLTAIPSNIPADTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLTYLSLGYNELQSLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQLQENPWDCTCNGIIYMAKWLKKKADEGLGGVDTAGCEKGGKAVLEITEKDAASDCVSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor A
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
source organism Eptatretus burgeri
molecule tags Immune system
total genus 77
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6qA00
2UZYA 1XEUA 3REZA 3OGMB 3M19A 4BSUA 1LTXA 3C6PB 4P91A 4R6GA 3WN4A 4BSSA 1ZIWA 2RR6A 4NKHA 4LI2A 4CP6A 2O6SA 4CNCA 3ULVA 5IJDA 4UFRA 3VQ2A 3G3AA 4U7LA 3A79B 1PGVA 3E3ZA 1D0BA 4MQWX 3E4GA 1P8VA 4U06A 3WPCA 4R6JA 4LXRA 3C6NB 3WPFA 2UZXA 4PQ8A 2WQWA 3CIGA 5AWCA 1A9NA 5GMHA 2BNHA 4Z8GA 4QC0A 3RIZA 1WWLA 2BEXA 5HZLB 4L3AA 3TSRE 4V2DA 2R9UA 4CC4C 5GMGA 4KNGA 1XWDC 2P1NB 4U08A 4ARRA 4I6JB 4LSXC 4YEBB 5D3IA 2CA6A 1GWBA 4R09A 1KOOA 5FTTB 2Z7XB 2JQDA 4C2AB 4J4LA 3OJAB 4R5CA 1H6UA 4R07A 2XWTC 4RWTC 2OMXA 4FS7A 4FHOA 2P1QB 2P1MB 3E2JA 4R08A 4V2CA 5IYXC 4NKGA 3UL7A 4H09A 3OGKB 3JB9j 3WPHA 2O6QA 4OQTA 4GT6A 3W3NA 2OMYA 1OOKG 3ZYIA 4CILA 5IJCA 3GOZA 4LXSA 1M0ZA 2P1PB 4LI1A 2ID5A 3RGXA 2Z7XA 2Y5QA 2ASTB 3OJAA 4XSQA 4CC4A 2V9TB 5B0TA 4LSXA 4FCGA 1FQVA 5B4PA 4GLPA 3G3BA 3PMHG 1XCDA 1FS2A 4Q62A 5GMFA 3RW7A 1KOHA 4QXEA 4R0AA 3FXIA 4U09A 3W3MA 4TZHA 1M10B 1XECA 2WQUA 2Q4GW 4Z79A 2Z63A 4QBZA 1K5GC 5IJBA 3UL8A 3KJ4A 4AW4A 4FD0A 2Z64A 4Q3GA 4M7EC 2FT3A 4RCWA 4XOSA 1QYYA 3CVRA 5GS2B 2V70A 4R6AA 4V2EA 3RFSA 5B0NA 2Z81A 2JE0A 3RFJA 1YRGA 4J0MA 3RFEA 4WYKA 1JL5A 4ECNA 2WQVA 1M9SA 1DCEA 1P9AG 1O6VA 3RW6A 4ECOA 4R58A 2A0ZA 2Z66A 4EZGA 3P72A 4LSAA 1P8TA 3W3JA 4Z61C 4FDWA 1H6TA 4G8AA 5A5CA 3CIYA 1DS9A 2OMZA 1OGQA 3E6JA 1M9LA 4XGOA 3UN9A 4IM6A 3G39A 3RJ0A 4M7EA 2IFGA 1OTNA 2WFHA 2OMUA 4Z94G 2P1OB 1O6TA 2Z65A 2OMVA 1OTMA 4ARNA 4PSJA 1U0ND 4RCAB 4WP6A 3OGLB 4FMZA 1A4YA 2ASSB 3O53A 3DZEA 3W3LA 3RGZA 3VQ1A 4BV4R 3WPBA 3WPIA 3ZYJA 1O6SA 1FT8A 4Q3IA 3G06A 5LFNA 4CNMA 4AY9X 2Z82A 1XKUA 3BZ5A 4KT1A 4PERA 4LSCA 3O6NA 1IO0A 1DFJI 5CMNA 4C2BB 4P8SA 4BSRA 3W3GA 3WPGA 1FO1A 2ELLA 4Z64C 2OMTA 4KXFB 1Z7XW 1K5DC 4R5DA 3SB4A 3G04C 4PKIG 3WPEA 2WQXA 1OZNA 4B8CD 4Y61B 3C6OB 3WPDA 1OTOA 1W8AA 5AWAA 5GQRK 4K17A 1G9UA 4R6FA 3ULUA 3ULAA 2XOTA 5AWDA 3UL9A 5GS0A 2V9SA 2OMWA 3ZYOA 2RA8A 4MN8B 4HQ1A 3ZYNA 5AWBA 1SQ0B 3M18A 3W3KA 5AZ5A 4L3FA 5HDHA 2Z62A 2JE1A 5CMPA 2O6RA 4PEQB
chains in the Genus database with same CATH superfamily
2UZYA 1XEUA 3REZA 3OGMB 3M19A 4BSUA 1LTXA 3C6PB 4P91A 4R6GA 3WN4A 4BSSA 1ZIWA 2RR6A 4NKHA 4LI2A 4CP6A 2O6SA 4CNCA 3ULVA 5IJDA 4UFRA 3VQ2A 3G3AA 4U7LA 3A79B 1PGVA 3E3ZA 1D0BA 4MQWX 3E4GA 1P8VA 4U06A 3WPCA 4R6JA 4LXRA 3C6NB 3WPFA 2UZXA 4PQ8A 2WQWA 3CIGA 5AWCA 1A9NA 5GMHA 2BNHA 4Z8GA 4QC0A 3RIZA 1WWLA 2BEXA 5HZLB 4L3AA 3TSRE 4V2DA 2R9UA 4CC4C 5GMGA 4KNGA 1XWDC 2P1NB 4U08A 4ARRA 4I6JB 4LSXC 4YEBB 5D3IA 2CA6A 1GWBA 4R09A 1KOOA 5FTTB 2Z7XB 2JQDA 4C2AB 4J4LA 3OJAB 4R5CA 1H6UA 4R07A 2XWTC 4RWTC 2OMXA 4FS7A 4FHOA 2P1QB 2P1MB 3E2JA 4R08A 4V2CA 5IYXC 4NKGA 3UL7A 4H09A 3OGKB 3JB9j 3WPHA 2O6QA 4NZRM 4OQTA 4GT6A 3W3NA 2OMYA 1OOKG 3ZYIA 4CILA 5IJCA 3GOZA 4LXSA 1M0ZA 2P1PB 4LI1A 2ID5A 3RGXA 2Z7XA 2Y5QA 2ASTB 3OJAA 4XSQA 4CC4A 2V9TB 5B0TA 4LSXA 4FCGA 1FQVA 5B4PA 4GLPA 3G3BA 3PMHG 1XCDA 1FS2A 4Q62A 5GMFA 3RW7A 1KOHA 4QXEA 4R0AA 3FXIA 4U09A 3W3MA 4TZHA 1M10B 1XECA 2WQUA 2Q4GW 4Z79A 2Z63A 4QBZA 1K5GC 5IJBA 3UL8A 3KJ4A 4AW4A 4FD0A 2Z64A 4Q3GA 4M7EC 2FT3A 4RCWA 4XOSA 1QYYA 3CVRA 5GS2B 2V70A 4R6AA 4V2EA 3RFSA 5B0NA 2Z81A 2JE0A 3RFJA 1YRGA 4J0MA 3RFEA 4WYKA 1JL5A 4ECNA 2WQVA 1M9SA 1DCEA 1P9AG 1O6VA 3RW6A 4ECOA 4R58A 2A0ZA 2Z66A 4EZGA 3P72A 4LSAA 1P8TA 3W3JA 4Z61C 4FDWA 1H6TA 4G8AA 5A5CA 3CIYA 1DS9A 2OMZA 1OGQA 3E6JA 1M9LA 4XGOA 3UN9A 4IM6A 3G39A 3RJ0A 4M7EA 2IFGA 1OTNA 2WFHA 2OMUA 4Z94G 2P1OB 1O6TA 2Z65A 2OMVA 1OTMA 4ARNA 4PSJA 1U0ND 4RCAB 4WP6A 3OGLB 4FMZA 1A4YA 2ASSB 3O53A 3DZEA 3W3LA 3RGZA 3VQ1A 4BV4R 3WPBA 3WPIA 3ZYJA 1O6SA 1FT8A 4Q3IA 3G06A 5LFNA 4CNMA 4AY9X 2Z82A 1XKUA 3BZ5A 4KT1A 4PERA 4LSCA 3O6NA 1IO0A 1DFJI 5CMNA 4C2BB 4P8SA 4BSRA 3W3GA 3WPGA 1FO1A 2ELLA 4Z64C 2OMTA 4KXFB 1Z7XW 1K5DC 4R5DA 3SB4A 3G04C 4PKIG 3WPEA 2WQXA 1OZNA 4B8CD 4Y61B 3C6OB 3WPDA 1OTOA 1W8AA 5AWAA 5GQRK 4K17A 1G9UA 4R6FA 3ULUA 3ULAA 2XOTA 5AWDA 3UL9A 5GS0A 2V9SA 2OMWA 3ZYOA 4NZTM 2RA8A 4MN8B 4HQ1A 3ZYNA 5AWBA 1SQ0B 3M18A 3W3KA 5AZ5A 4L3FA 5HDHA 2Z62A 2JE1A 5CMPA 2O6RA 4PEQB
chains in the Genus database with same CATH topology
2UZYA 1XEUA 3REZA 3OGMB 3M19A 4BSUA 1LTXA 3C6PB 4P91A 4R6GA 3WN4A 4BSSA 1ZIWA 2RR6A 4NKHA 4LI2A 4CP6A 2O6SA 4CNCA 3ULVA 5IJDA 4UFRA 3VQ2A 3G3AA 4U7LA 3A79B 1PGVA 3E3ZA 1D0BA 4MQWX 3E4GA 1P8VA 4U06A 3WPCA 4R6JA 4LXRA 3C6NB 3WPFA 2UZXA 4PQ8A 2WQWA 3CIGA 5AWCA 1A9NA 5GMHA 2BNHA 4Z8GA 4QC0A 3RIZA 1WWLA 2BEXA 5HZLB 4L3AA 3TSRE 4V2DA 2R9UA 4CC4C 5GMGA 4KNGA 1XWDC 2P1NB 4U08A 4ARRA 4I6JB 4LSXC 4YEBB 5D3IA 2CA6A 1GWBA 4R09A 1KOOA 5FTTB 2Z7XB 2JQDA 4C2AB 4J4LA 3OJAB 4R5CA 1H6UA 4R07A 2XWTC 4RWTC 2OMXA 4FS7A 4FHOA 2P1QB 2P1MB 3E2JA 4R08A 4V2CA 5IYXC 4NKGA 3UL7A 4H09A 3OGKB 3JB9j 3WPHA 2O6QA 4OQTA 4GT6A 3W3NA 2OMYA 1OOKG 3ZYIA 4CILA 5IJCA 3GOZA 4LXSA 1M0ZA 2P1PB 4LI1A 2ID5A 3RGXA 2Z7XA 2Y5QA 2ASTB 3OJAA 4XSQA 4CC4A 2V9TB 5B0TA 4LSXA 4FCGA 1FQVA 5B4PA 4GLPA 3G3BA 3PMHG 1XCDA 1FS2A 4Q62A 5GMFA 3RW7A 1KOHA 4QXEA 4R0AA 3FXIA 4U09A 3W3MA 4TZHA 1M10B 1XECA 2WQUA 2Q4GW 4Z79A 2Z63A 4QBZA 1K5GC 5IJBA 3UL8A 3KJ4A 4AW4A 4FD0A 2Z64A 4Q3GA 4M7EC 2FT3A 4RCWA 4XOSA 1QYYA 3CVRA 5GS2B 2V70A 4R6AA 4V2EA 3RFSA 5B0NA 2Z81A 2JE0A 3RFJA 1YRGA 4J0MA 3RFEA 4WYKA 1JL5A 4ECNA 2WQVA 1M9SA 1DCEA 1P9AG 1O6VA 3RW6A 4ECOA 4R58A 2A0ZA 2Z66A 4EZGA 3P72A 4LSAA 1P8TA 3W3JA 4Z61C 4FDWA 1H6TA 4G8AA 5A5CA 3CIYA 1DS9A 2OMZA 1OGQA 3E6JA 1M9LA 4XGOA 3UN9A 4IM6A 3G39A 3RJ0A 4M7EA 2IFGA 1OTNA 2WFHA 2OMUA 4Z94G 2P1OB 1O6TA 2Z65A 2OMVA 1OTMA 4ARNA 4PSJA 1U0ND 4RCAB 4WP6A 3OGLB 4FMZA 1A4YA 2ASSB 3O53A 3DZEA 3W3LA 3RGZA 3VQ1A 4BV4R 3WPBA 3WPIA 3ZYJA 1O6SA 1FT8A 4Q3IA 3G06A 5LFNA 4CNMA 4AY9X 2Z82A 1XKUA 3BZ5A 4KT1A 4PERA 4LSCA 3O6NA 1IO0A 1DFJI 5CMNA 4C2BB 4P8SA 4BSRA 3W3GA 3WPGA 1FO1A 2ELLA 4Z64C 2OMTA 4KXFB 1Z7XW 1K5DC 4R5DA 3SB4A 3G04C 4PKIG 3WPEA 2WQXA 1OZNA 4B8CD 4Y61B 3C6OB 3WPDA 1OTOA 1W8AA 5AWAA 5GQRK 4K17A 1G9UA 4R6FA 3ULUA 3ULAA 2XOTA 5AWDA 3UL9A 5GS0A 2V9SA 2OMWA 3ZYOA 2RA8A 4MN8B 4HQ1A 3ZYNA 5AWBA 1SQ0B 3M18A 3W3KA 5AZ5A 4L3FA 5HDHA 2Z62A 2JE1A 5CMPA 2O6RA 4PEQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZY A;  1XEU A;  3REZ A;  3OGM B;  3M19 A;  4BSU A;  1LTX A;  3C6P B;  4P91 A;  4R6G A;  3WN4 A;  4BSS A;  1ZIW A;  2RR6 A;  4NKH A;  4LI2 A;  4CP6 A;  2O6S A;  4CNC A;  3ULV A;  5IJD A;  4UFR A;  3VQ2 A;  3G3A A;  4U7L A;  3A79 B;  1PGV A;  3E3Z A;  1D0B A;  4MQW X;  3E4G A;  1P8V A;  4U06 A;  3WPC A;  4R6J A;  4LXR A;  3C6N B;  3WPF A;  2UZX A;  4PQ8 A;  2WQW A;  3CIG A;  5AWC A;  1A9N A;  5GMH A;  2BNH A;  4Z8G A;  4QC0 A;  3RIZ A;  1WWL A;  2BEX A;  5HZL B;  4L3A A;  3TSR E;  4V2D A;  2R9U A;  4CC4 C;  5GMG A;  4KNG A;  1XWD C;  2P1N B;  4U08 A;  4ARR A;  4I6J B;  4LSX C;  4YEB B;  5D3I A;  2CA6 A;  1GWB A;  4R09 A;  1KOO A;  5FTT B;  2Z7X B;  2JQD A;  4C2A B;  4J4L A;  3OJA B;  4R5C A;  1H6U A;  4R07 A;  2XWT C;  4RWT C;  2OMX A;  4FS7 A;  4FHO A;  2P1Q B;  2P1M B;  3E2J A;  4R08 A;  4V2C A;  5IYX C;  4NKG A;  3UL7 A;  4H09 A;  3OGK B;  3JB9 j;  3WPH A;  2O6Q A;  4OQT A;  4GT6 A;  3W3N A;  2OMY A;  1OOK G;  3ZYI A;  4CIL A;  5IJC A;  3GOZ A;  4LXS A;  1M0Z A;  2P1P B;  4LI1 A;  2ID5 A;  3RGX A;  2Z7X A;  2Y5Q A;  2AST B;  3OJA A;  4XSQ A;  4CC4 A;  2V9T B;  5B0T A;  4LSX A;  4FCG A;  1FQV A;  5B4P A;  4GLP A;  3G3B A;  3PMH G;  1XCD A;  1FS2 A;  4Q62 A;  5GMF A;  3RW7 A;  1KOH A;  4QXE A;  4R0A A;  3FXI A;  4U09 A;  3W3M A;  4TZH A;  1M10 B;  1XEC A;  2WQU A;  2Q4G W;  4Z79 A;  2Z63 A;  4QBZ A;  1K5G C;  5IJB A;  3UL8 A;  3KJ4 A;  4AW4 A;  4FD0 A;  2Z64 A;  4Q3G A;  4M7E C;  2FT3 A;  4RCW A;  4XOS A;  1QYY A;  3CVR A;  5GS2 B;  2V70 A;  4R6A A;  4V2E A;  3RFS A;  5B0N A;  2Z81 A;  2JE0 A;  3RFJ A;  1YRG A;  4J0M A;  3RFE A;  4WYK A;  1JL5 A;  4ECN A;  2WQV A;  1M9S A;  1DCE A;  1P9A G;  1O6V A;  3RW6 A;  4ECO A;  4R58 A;  2A0Z A;  2Z66 A;  4EZG A;  3P72 A;  4LSA A;  1P8T A;  3W3J A;  4Z61 C;  4FDW A;  1H6T A;  4G8A A;  5A5C A;  3CIY A;  1DS9 A;  2OMZ A;  1OGQ A;  3E6J A;  1M9L A;  4XGO A;  3UN9 A;  4IM6 A;  3G39 A;  3RJ0 A;  4M7E A;  2IFG A;  1OTN A;  2WFH A;  2OMU A;  4Z94 G;  2P1O B;  1O6T A;  2Z65 A;  2OMV A;  1OTM A;  4ARN A;  4PSJ A;  1U0N D;  4RCA B;  4WP6 A;  3OGL B;  4FMZ A;  1A4Y A;  2ASS B;  3O53 A;  3DZE A;  3W3L A;  3RGZ A;  3VQ1 A;  4BV4 R;  3WPB A;  3WPI A;  3ZYJ A;  1O6S A;  1FT8 A;  4Q3I A;  3G06 A;  5LFN A;  4CNM A;  4AY9 X;  2Z82 A;  1XKU A;  3BZ5 A;  4KT1 A;  4PER A;  4LSC A;  3O6N A;  1IO0 A;  1DFJ I;  5CMN A;  4C2B B;  4P8S A;  4BSR A;  3W3G A;  3WPG A;  1FO1 A;  2ELL A;  4Z64 C;  2OMT A;  4KXF B;  1Z7X W;  1K5D C;  4R5D A;  3SB4 A;  3G04 C;  4PKI G;  3WPE A;  2WQX A;  1OZN A;  4B8C D;  4Y61 B;  3C6O B;  3WPD A;  1OTO A;  1W8A A;  5AWA A;  5GQR K;  4K17 A;  1G9U A;  4R6F A;  3ULU A;  3ULA A;  2XOT A;  5AWD A;  3UL9 A;  5GS0 A;  2V9S A;  2OMW A;  3ZYO A;  2RA8 A;  4MN8 B;  4HQ1 A;  3ZYN A;  5AWB A;  1SQ0 B;  3M18 A;  3W3K A;  5AZ5 A;  4L3F A;  5HDH A;  2Z62 A;  2JE1 A;  5CMP A;  2O6R A;  4PEQ B; 
#chains in the Genus database with same CATH topology
 2UZY A;  1XEU A;  3REZ A;  3OGM B;  3M19 A;  4BSU A;  1LTX A;  3C6P B;  4P91 A;  4R6G A;  3WN4 A;  4BSS A;  1ZIW A;  2RR6 A;  4NKH A;  4LI2 A;  4CP6 A;  2O6S A;  4CNC A;  3ULV A;  5IJD A;  4UFR A;  3VQ2 A;  3G3A A;  4U7L A;  3A79 B;  1PGV A;  3E3Z A;  1D0B A;  4MQW X;  3E4G A;  1P8V A;  4U06 A;  3WPC A;  4R6J A;  4LXR A;  3C6N B;  3WPF A;  2UZX A;  4PQ8 A;  2WQW A;  3CIG A;  5AWC A;  1A9N A;  5GMH A;  2BNH A;  4Z8G A;  4QC0 A;  3RIZ A;  1WWL A;  2BEX A;  5HZL B;  4L3A A;  3TSR E;  4V2D A;  2R9U A;  4CC4 C;  5GMG A;  4KNG A;  1XWD C;  2P1N B;  4U08 A;  4ARR A;  4I6J B;  4LSX C;  4YEB B;  5D3I A;  2CA6 A;  1GWB A;  4R09 A;  1KOO A;  5FTT B;  2Z7X B;  2JQD A;  4C2A B;  4J4L A;  3OJA B;  4R5C A;  1H6U A;  4R07 A;  2XWT C;  4RWT C;  2OMX A;  4FS7 A;  4FHO A;  2P1Q B;  2P1M B;  3E2J A;  4R08 A;  4V2C A;  5IYX C;  4NKG A;  3UL7 A;  4H09 A;  3OGK B;  3JB9 j;  3WPH A;  2O6Q A;  4NZR M;  4OQT A;  4GT6 A;  3W3N A;  2OMY A;  1OOK G;  3ZYI A;  4CIL A;  5IJC A;  3GOZ A;  4LXS A;  1M0Z A;  2P1P B;  4LI1 A;  2ID5 A;  3RGX A;  2Z7X A;  2Y5Q A;  2AST B;  3OJA A;  4XSQ A;  4CC4 A;  2V9T B;  5B0T A;  4LSX A;  4FCG A;  1FQV A;  5B4P A;  4GLP A;  3G3B A;  3PMH G;  1XCD A;  1FS2 A;  4Q62 A;  5GMF A;  3RW7 A;  1KOH A;  4QXE A;  4R0A A;  3FXI A;  4U09 A;  3W3M A;  4TZH A;  1M10 B;  1XEC A;  2WQU A;  2Q4G W;  4Z79 A;  2Z63 A;  4QBZ A;  1K5G C;  5IJB A;  3UL8 A;  3KJ4 A;  4AW4 A;  4FD0 A;  2Z64 A;  4Q3G A;  4M7E C;  2FT3 A;  4RCW A;  4XOS A;  1QYY A;  3CVR A;  5GS2 B;  2V70 A;  4R6A A;  4V2E A;  3RFS A;  5B0N A;  2Z81 A;  2JE0 A;  3RFJ A;  1YRG A;  4J0M A;  3RFE A;  4WYK A;  1JL5 A;  4ECN A;  2WQV A;  1M9S A;  1DCE A;  1P9A G;  1O6V A;  3RW6 A;  4ECO A;  4R58 A;  2A0Z A;  2Z66 A;  4EZG A;  3P72 A;  4LSA A;  1P8T A;  3W3J A;  4Z61 C;  4FDW A;  1H6T A;  4G8A A;  5A5C A;  3CIY A;  1DS9 A;  2OMZ A;  1OGQ A;  3E6J A;  1M9L A;  4XGO A;  3UN9 A;  4IM6 A;  3G39 A;  3RJ0 A;  4M7E A;  2IFG A;  1OTN A;  2WFH A;  2OMU A;  4Z94 G;  2P1O B;  1O6T A;  2Z65 A;  2OMV A;  1OTM A;  4ARN A;  4PSJ A;  1U0N D;  4RCA B;  4WP6 A;  3OGL B;  4FMZ A;  1A4Y A;  2ASS B;  3O53 A;  3DZE A;  3W3L A;  3RGZ A;  3VQ1 A;  4BV4 R;  3WPB A;  3WPI A;  3ZYJ A;  1O6S A;  1FT8 A;  4Q3I A;  3G06 A;  5LFN A;  4CNM A;  4AY9 X;  2Z82 A;  1XKU A;  3BZ5 A;  4KT1 A;  4PER A;  4LSC A;  3O6N A;  1IO0 A;  1DFJ I;  5CMN A;  4C2B B;  4P8S A;  4BSR A;  3W3G A;  3WPG A;  1FO1 A;  2ELL A;  4Z64 C;  2OMT A;  4KXF B;  1Z7X W;  1K5D C;  4R5D A;  3SB4 A;  3G04 C;  4PKI G;  3WPE A;  2WQX A;  1OZN A;  4B8C D;  4Y61 B;  3C6O B;  3WPD A;  1OTO A;  1W8A A;  5AWA A;  5GQR K;  4K17 A;  1G9U A;  4R6F A;  3ULU A;  3ULA A;  2XOT A;  5AWD A;  3UL9 A;  5GS0 A;  2V9S A;  2OMW A;  3ZYO A;  4NZT M;  2RA8 A;  4MN8 B;  4HQ1 A;  3ZYN A;  5AWB A;  1SQ0 B;  3M18 A;  3W3K A;  5AZ5 A;  4L3F A;  5HDH A;  2Z62 A;  2JE1 A;  5CMP A;  2O6R A;  4PEQ B; 
#chains in the Genus database with same CATH homology
 2UZY A;  1XEU A;  3REZ A;  3OGM B;  3M19 A;  4BSU A;  1LTX A;  3C6P B;  4P91 A;  4R6G A;  3WN4 A;  4BSS A;  1ZIW A;  2RR6 A;  4NKH A;  4LI2 A;  4CP6 A;  2O6S A;  4CNC A;  3ULV A;  5IJD A;  4UFR A;  3VQ2 A;  3G3A A;  4U7L A;  3A79 B;  1PGV A;  3E3Z A;  1D0B A;  4MQW X;  3E4G A;  1P8V A;  4U06 A;  3WPC A;  4R6J A;  4LXR A;  3C6N B;  3WPF A;  2UZX A;  4PQ8 A;  2WQW A;  3CIG A;  5AWC A;  1A9N A;  5GMH A;  2BNH A;  4Z8G A;  4QC0 A;  3RIZ A;  1WWL A;  2BEX A;  5HZL B;  4L3A A;  3TSR E;  4V2D A;  2R9U A;  4CC4 C;  5GMG A;  4KNG A;  1XWD C;  2P1N B;  4U08 A;  4ARR A;  4I6J B;  4LSX C;  4YEB B;  5D3I A;  2CA6 A;  1GWB A;  4R09 A;  1KOO A;  5FTT B;  2Z7X B;  2JQD A;  4C2A B;  4J4L A;  3OJA B;  4R5C A;  1H6U A;  4R07 A;  2XWT C;  4RWT C;  2OMX A;  4FS7 A;  4FHO A;  2P1Q B;  2P1M B;  3E2J A;  4R08 A;  4V2C A;  5IYX C;  4NKG A;  3UL7 A;  4H09 A;  3OGK B;  3JB9 j;  3WPH A;  2O6Q A;  4OQT A;  4GT6 A;  3W3N A;  2OMY A;  1OOK G;  3ZYI A;  4CIL A;  5IJC A;  3GOZ A;  4LXS A;  1M0Z A;  2P1P B;  4LI1 A;  2ID5 A;  3RGX A;  2Z7X A;  2Y5Q A;  2AST B;  3OJA A;  4XSQ A;  4CC4 A;  2V9T B;  5B0T A;  4LSX A;  4FCG A;  1FQV A;  5B4P A;  4GLP A;  3G3B A;  3PMH G;  1XCD A;  1FS2 A;  4Q62 A;  5GMF A;  3RW7 A;  1KOH A;  4QXE A;  4R0A A;  3FXI A;  4U09 A;  3W3M A;  4TZH A;  1M10 B;  1XEC A;  2WQU A;  2Q4G W;  4Z79 A;  2Z63 A;  4QBZ A;  1K5G C;  5IJB A;  3UL8 A;  3KJ4 A;  4AW4 A;  4FD0 A;  2Z64 A;  4Q3G A;  4M7E C;  2FT3 A;  4RCW A;  4XOS A;  1QYY A;  3CVR A;  5GS2 B;  2V70 A;  4R6A A;  4V2E A;  3RFS A;  5B0N A;  2Z81 A;  2JE0 A;  3RFJ A;  1YRG A;  4J0M A;  3RFE A;  4WYK A;  1JL5 A;  4ECN A;  2WQV A;  1M9S A;  1DCE A;  1P9A G;  1O6V A;  3RW6 A;  4ECO A;  4R58 A;  2A0Z A;  2Z66 A;  4EZG A;  3P72 A;  4LSA A;  1P8T A;  3W3J A;  4Z61 C;  4FDW A;  1H6T A;  4G8A A;  5A5C A;  3CIY A;  1DS9 A;  2OMZ A;  1OGQ A;  3E6J A;  1M9L A;  4XGO A;  3UN9 A;  4IM6 A;  3G39 A;  3RJ0 A;  4M7E A;  2IFG A;  1OTN A;  2WFH A;  2OMU A;  4Z94 G;  2P1O B;  1O6T A;  2Z65 A;  2OMV A;  1OTM A;  4ARN A;  4PSJ A;  1U0N D;  4RCA B;  4WP6 A;  3OGL B;  4FMZ A;  1A4Y A;  2ASS B;  3O53 A;  3DZE A;  3W3L A;  3RGZ A;  3VQ1 A;  4BV4 R;  3WPB A;  3WPI A;  3ZYJ A;  1O6S A;  1FT8 A;  4Q3I A;  3G06 A;  5LFN A;  4CNM A;  4AY9 X;  2Z82 A;  1XKU A;  3BZ5 A;  4KT1 A;  4PER A;  4LSC A;  3O6N A;  1IO0 A;  1DFJ I;  5CMN A;  4C2B B;  4P8S A;  4BSR A;  3W3G A;  3WPG A;  1FO1 A;  2ELL A;  4Z64 C;  2OMT A;  4KXF B;  1Z7X W;  1K5D C;  4R5D A;  3SB4 A;  3G04 C;  4PKI G;  3WPE A;  2WQX A;  1OZN A;  4B8C D;  4Y61 B;  3C6O B;  3WPD A;  1OTO A;  1W8A A;  5AWA A;  5GQR K;  4K17 A;  1G9U A;  4R6F A;  3ULU A;  3ULA A;  2XOT A;  5AWD A;  3UL9 A;  5GS0 A;  2V9S A;  2OMW A;  3ZYO A;  2RA8 A;  4MN8 B;  4HQ1 A;  3ZYN A;  5AWB A;  1SQ0 B;  3M18 A;  3W3K A;  5AZ5 A;  4L3F A;  5HDH A;  2Z62 A;  2JE1 A;  5CMP A;  2O6R A;  4PEQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...