2O71A

Crystal structure of raidd dd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
HILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of RAIDD Death Domain Implicates Potential Mechanism of PIDDosome Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Death domain-containing protein CRADD
total genus 35
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2o71A00
2DBHA 2DBGA 1CY5A 1A1WA 4IZ5E 4IZAB 4JQWA 3LQQA 2MB9A 1UCPA 2G7RA 2GF5A 4I16A 4O7QA 1DGNA 3J63A 2BBRA 2HM2Q 4O6XA 2YGSA 4FH0A 4RHWA 4D8OA 3MOPA 4NQKA 4N1JA 2MS7A 4M9ZA 1D2ZA 4A2QA 4P4HI 1FADA 2LWDA 4P4HA 1YGOA 2N97A 2M5VA 3MOPK 3CL3A 3QF2A 1N3KA 2OF5H 2N83A 1E3YA 2B1WA 2DBDA 4M9SA 4F44A 1WH4A 3MOPG 3KATA 2LWEA 4IZ7B 2N80A 4N1LA 3EZQA 4E9MA 2A5YB 2LS7A 2MN4A 3J6JA 4JUPA 2DO9A 4A2WA 3YGSP 4O9LA 2MPCA 2D96A 2L6AA 1ICHA 2KN6A 1D2ZB 1C15A 4F42A 1E41A 1NGRA 2N7ZA 3LQRA 3YGSC 1WMGA 4QOBA 1DDFA 2OF5A 2YVIA 2N1FA 4O9FA 2KM6A 3CRDA 2O71A 1Z6TA 2BBZA 3EZQB 4N1KA 4UZ0A 2MS8A 4M9XA 2VGQA 2IB1A 2A9IA 2NSNA 4DWNA 4ZBWA 1CWWA 2L9MA 1WXPA 4LWDA 2P1HA 4EWIA 3T6PA 2DBFA 2N00A 2YU0A 2NAQA 2YQFA 4RHWE 1PN5A 2NZ7A 1A1ZA 2F1SA
chains in the Genus database with same CATH superfamily
2DBHA 2DBGA 1CY5A 1A1WA 4IZ5E 4IZAB 4JQWA 3LQQA 2MB9A 2XV9A 1UCPA 2G7RA 2GF5A 4I16A 4O7QA 1DGNA 3J63A 2BBRA 2HM2Q 4O6XA 2YGSA 4FH0A 2MJMA 4RHWA 4D8OA 3MOPA 4NQKA 4N1JA 2MS7A 4M9ZA 1D2ZA 4A2QA 4P4HI 1FADA 2LWDA 4P4HA 1YGOA 2N97A 2M5VA 3MOPK 3CL3A 3QF2A 1N3KA 2OF5H 2N83A 1E3YA 2B1WA 2DBDA 4M9SA 4F44A 1WH4A 3MOPG 3KATA 2LWEA 4IZ7B 2N80A 4N1LA 3EZQA 4E9MA 2A5YB 2LS7A 2MN4A 3J6JA 4JUPA 2DO9A 4A2WA 3YGSP 4O9LA 2MPCA 2D96A 2L6AA 1ICHA 2KN6A 1D2ZB 1C15A 4F42A 1E41A 1NGRA 2N7ZA 3LQRA 3YGSC 1WMGA 4QOBA 1DDFA 2OF5A 2YVIA 2N1FA 4O9FA 2KM6A 3CRDA 2O71A 1Z6TA 2BBZA 3EZQB 4N1KA 4UZ0A 2MS8A 4M9XA 2VGQA 2IB1A 2A9IA 2NSNA 4DWNA 4ZBWA 1CWWA 2L9MA 1WXPA 4LWDA 2P1HA 4EWIA 3T6PA 2DBFA 2N00A 2YU0A 2NAQA 2YQFA 4RHWE 1PN5A 2NZ7A 1A1ZA 2F1SA
chains in the Genus database with same CATH topology
2DBHA 2DBGA 1CY5A 1A1WA 4IZ5E 4IZAB 4JQWA 3LQQA 2MB9A 2XV9A 1UCPA 2G7RA 2GF5A 4I16A 4O7QA 1DGNA 3J63A 2BBRA 2HM2Q 4O6XA 2YGSA 4FH0A 2MJMA 4RHWA 4D8OA 3MOPA 4NQKA 4N1JA 2MS7A 4M9ZA 1D2ZA 4A2QA 4P4HI 1FADA 2LWDA 4P4HA 1YGOA 2N97A 2M5VA 3MOPK 3CL3A 3QF2A 1N3KA 2OF5H 2N83A 1E3YA 2B1WA 2DBDA 4M9SA 4F44A 1WH4A 3MOPG 3KATA 2LWEA 4IZ7B 2N80A 4N1LA 3EZQA 4E9MA 2A5YB 2LS7A 2MN4A 3J6JA 4JUPA 2DO9A 4A2WA 3YGSP 4O9LA 2MPCA 2D96A 2L6AA 1ICHA 2KN6A 1D2ZB 1C15A 4F42A 1E41A 1NGRA 2N7ZA 3LQRA 3YGSC 1WMGA 4QOBA 1DDFA 2OF5A 2YVIA 2N1FA 4O9FA 2KM6A 3CRDA 2O71A 1Z6TA 2BBZA 3EZQB 4N1KA 4UZ0A 2MS8A 4M9XA 2VGQA 2IB1A 2A9IA 2NSNA 4DWNA 4ZBWA 1CWWA 2L9MA 1WXPA 4LWDA 2P1HA 4EWIA 3T6PA 2DBFA 2N00A 2YU0A 2NAQA 2YQFA 4RHWE 1PN5A 2NZ7A 1A1ZA 2F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBH A;  2DBG A;  1CY5 A;  1A1W A;  4IZ5 E;  4IZA B;  4JQW A;  3LQQ A;  2MB9 A;  1UCP A;  2G7R A;  2GF5 A;  4I16 A;  4O7Q A;  1DGN A;  3J63 A;  2BBR A;  2HM2 Q;  4O6X A;  2YGS A;  4FH0 A;  4RHW A;  4D8O A;  3MOP A;  4NQK A;  4N1J A;  2MS7 A;  4M9Z A;  1D2Z A;  4A2Q A;  4P4H I;  1FAD A;  2LWD A;  4P4H A;  1YGO A;  2N97 A;  2M5V A;  3MOP K;  3CL3 A;  3QF2 A;  1N3K A;  2OF5 H;  2N83 A;  1E3Y A;  2B1W A;  2DBD A;  4M9S A;  4F44 A;  1WH4 A;  3MOP G;  3KAT A;  2LWE A;  4IZ7 B;  2N80 A;  4N1L A;  3EZQ A;  4E9M A;  2A5Y B;  2LS7 A;  2MN4 A;  3J6J A;  4JUP A;  2DO9 A;  4A2W A;  3YGS P;  4O9L A;  2MPC A;  2D96 A;  2L6A A;  1ICH A;  2KN6 A;  1D2Z B;  1C15 A;  4F42 A;  1E41 A;  1NGR A;  2N7Z A;  3LQR A;  3YGS C;  1WMG A;  4QOB A;  1DDF A;  2OF5 A;  2YVI A;  2N1F A;  4O9F A;  2KM6 A;  3CRD A;  2O71 A;  1Z6T A;  2BBZ A;  3EZQ B;  4N1K A;  4UZ0 A;  2MS8 A;  4M9X A;  2VGQ A;  2IB1 A;  2A9I A;  2NSN A;  4DWN A;  4ZBW A;  1CWW A;  2L9M A;  1WXP A;  4LWD A;  2P1H A;  4EWI A;  3T6P A;  2DBF A;  2N00 A;  2YU0 A;  2NAQ A;  2YQF A;  4RHW E;  1PN5 A;  2NZ7 A;  1A1Z A;  2F1S A; 
#chains in the Genus database with same CATH topology
 2DBH A;  2DBG A;  1CY5 A;  1A1W A;  4IZ5 E;  4IZA B;  4JQW A;  3LQQ A;  2MB9 A;  2XV9 A;  1UCP A;  2G7R A;  2GF5 A;  4I16 A;  4O7Q A;  1DGN A;  3J63 A;  2BBR A;  2HM2 Q;  4O6X A;  2YGS A;  4FH0 A;  2MJM A;  4RHW A;  4D8O A;  3MOP A;  4NQK A;  4N1J A;  2MS7 A;  4M9Z A;  1D2Z A;  4A2Q A;  4P4H I;  1FAD A;  2LWD A;  4P4H A;  1YGO A;  2N97 A;  2M5V A;  3MOP K;  3CL3 A;  3QF2 A;  1N3K A;  2OF5 H;  2N83 A;  1E3Y A;  2B1W A;  2DBD A;  4M9S A;  4F44 A;  1WH4 A;  3MOP G;  3KAT A;  2LWE A;  4IZ7 B;  2N80 A;  4N1L A;  3EZQ A;  4E9M A;  2A5Y B;  2LS7 A;  2MN4 A;  3J6J A;  4JUP A;  2DO9 A;  4A2W A;  3YGS P;  4O9L A;  2MPC A;  2D96 A;  2L6A A;  1ICH A;  2KN6 A;  1D2Z B;  1C15 A;  4F42 A;  1E41 A;  1NGR A;  2N7Z A;  3LQR A;  3YGS C;  1WMG A;  4QOB A;  1DDF A;  2OF5 A;  2YVI A;  2N1F A;  4O9F A;  2KM6 A;  3CRD A;  2O71 A;  1Z6T A;  2BBZ A;  3EZQ B;  4N1K A;  4UZ0 A;  2MS8 A;  4M9X A;  2VGQ A;  2IB1 A;  2A9I A;  2NSN A;  4DWN A;  4ZBW A;  1CWW A;  2L9M A;  1WXP A;  4LWD A;  2P1H A;  4EWI A;  3T6P A;  2DBF A;  2N00 A;  2YU0 A;  2NAQ A;  2YQF A;  4RHW E;  1PN5 A;  2NZ7 A;  1A1Z A;  2F1S A; 
#chains in the Genus database with same CATH homology
 2DBH A;  2DBG A;  1CY5 A;  1A1W A;  4IZ5 E;  4IZA B;  4JQW A;  3LQQ A;  2MB9 A;  2XV9 A;  1UCP A;  2G7R A;  2GF5 A;  4I16 A;  4O7Q A;  1DGN A;  3J63 A;  2BBR A;  2HM2 Q;  4O6X A;  2YGS A;  4FH0 A;  2MJM A;  4RHW A;  4D8O A;  3MOP A;  4NQK A;  4N1J A;  2MS7 A;  4M9Z A;  1D2Z A;  4A2Q A;  4P4H I;  1FAD A;  2LWD A;  4P4H A;  1YGO A;  2N97 A;  2M5V A;  3MOP K;  3CL3 A;  3QF2 A;  1N3K A;  2OF5 H;  2N83 A;  1E3Y A;  2B1W A;  2DBD A;  4M9S A;  4F44 A;  1WH4 A;  3MOP G;  3KAT A;  2LWE A;  4IZ7 B;  2N80 A;  4N1L A;  3EZQ A;  4E9M A;  2A5Y B;  2LS7 A;  2MN4 A;  3J6J A;  4JUP A;  2DO9 A;  4A2W A;  3YGS P;  4O9L A;  2MPC A;  2D96 A;  2L6A A;  1ICH A;  2KN6 A;  1D2Z B;  1C15 A;  4F42 A;  1E41 A;  1NGR A;  2N7Z A;  3LQR A;  3YGS C;  1WMG A;  4QOB A;  1DDF A;  2OF5 A;  2YVI A;  2N1F A;  4O9F A;  2KM6 A;  3CRD A;  2O71 A;  1Z6T A;  2BBZ A;  3EZQ B;  4N1K A;  4UZ0 A;  2MS8 A;  4M9X A;  2VGQ A;  2IB1 A;  2A9I A;  2NSN A;  4DWN A;  4ZBW A;  1CWW A;  2L9M A;  1WXP A;  4LWD A;  2P1H A;  4EWI A;  3T6P A;  2DBF A;  2N00 A;  2YU0 A;  2NAQ A;  2YQF A;  4RHW E;  1PN5 A;  2NZ7 A;  1A1Z A;  2F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...