2O71A

Crystal structure of raidd dd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
HILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of RAIDD Death Domain Implicates Potential Mechanism of PIDDosome Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Death domain-containing protein CRADD
total genus 35
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2o71A00
2OF5H 1WMGA 4F44A 4LWDA 2A9IA 2L9MA 2LWEA 3T6PA 1FADA 2OF5A 4M9SA 2HM2Q 4A2QA 3YGSP 4IZ7B 4IZ5E 2KN6A 4NQKA 1YGOA 1Z6TA 1ICHA 2DO9A 1D2ZA 4EWIA 4DWNA 2DBGA 4N1JA 2MS7A 4RHWE 2NSNA 3CRDA 1CY5A 2M5VA 2DBHA 4E9MA 2MB9A 2BBRA 4FH0A 2N1FA 1DGNA 3KATA 2DBDA 3QF2A 2NZ7A 2YGSA 3J6JA 3LQRA 2YVIA 4IZAB 4O9FA 2MN4A 3MOPA 4F42A 2N00A 1A1WA 4ZBWA 4D8OA 2VGQA 4QOBA 1WXPA 4A2WA 1E3YA 2G7RA 3CL3A 1WH4A 1D2ZB 4O7QA 1E41A 2IB1A 4I16A 2LWDA 2YU0A 2KM6A 2N80A 2N97A 2MPCA 3MOPG 1NGRA 4RHWA 3EZQB 4M9XA 4N1LA 4P4HA 2F1SA 2LS7A 2O71A 2NAQA 4O9LA 4UZ0A 2DBFA 2D96A 2P1HA 4N1KA 2B1WA 2GF5A 1DDFA 2A5YB 1PN5A 2L6AA 1CWWA 2YQFA 2N7ZA 2N83A 4JUPA 1UCPA 4O6XA 3YGSC 2BBZA 3EZQA 4M9ZA 4P4HI 3J63A 3LQQA 1A1ZA 2MS8A 3MOPK 1C15A 1N3KA 4JQWA
chains in the Genus database with same CATH superfamily
2OF5H 1WMGA 4F44A 4LWDA 2A9IA 2L9MA 2LWEA 3T6PA 1FADA 2OF5A 4M9SA 2HM2Q 4A2QA 3YGSP 4IZ7B 4IZ5E 2KN6A 4NQKA 1YGOA 1Z6TA 1ICHA 2DO9A 1D2ZA 4EWIA 4DWNA 2DBGA 4N1JA 2MS7A 4RHWE 2NSNA 3CRDA 1CY5A 2M5VA 2DBHA 4E9MA 2MB9A 2BBRA 4FH0A 2N1FA 1DGNA 3KATA 2DBDA 3QF2A 2NZ7A 2YGSA 3J6JA 3LQRA 2YVIA 4IZAB 4O9FA 2MN4A 3MOPA 4F42A 2N00A 1A1WA 4ZBWA 4D8OA 2VGQA 4QOBA 1WXPA 4A2WA 1E3YA 2G7RA 3CL3A 1WH4A 1D2ZB 4O7QA 1E41A 2IB1A 4I16A 2LWDA 2YU0A 2KM6A 2N80A 2N97A 2MJMA 2MPCA 3MOPG 1NGRA 4RHWA 3EZQB 4M9XA 4N1LA 4P4HA 2F1SA 2LS7A 2O71A 2NAQA 4O9LA 4UZ0A 2DBFA 2D96A 2P1HA 4N1KA 2B1WA 2GF5A 1DDFA 2A5YB 1PN5A 2L6AA 1CWWA 2YQFA 2N7ZA 2N83A 4JUPA 1UCPA 4O6XA 3YGSC 2XV9A 2BBZA 3EZQA 4M9ZA 4P4HI 3J63A 3LQQA 1A1ZA 2MS8A 3MOPK 1C15A 1N3KA 4JQWA
chains in the Genus database with same CATH topology
2OF5H 1WMGA 4F44A 4LWDA 2A9IA 2L9MA 2LWEA 3T6PA 1FADA 2OF5A 4M9SA 2HM2Q 4A2QA 3YGSP 4IZ7B 4IZ5E 2KN6A 4NQKA 1YGOA 1Z6TA 1ICHA 2DO9A 1D2ZA 4EWIA 4DWNA 2DBGA 4N1JA 2MS7A 4RHWE 2NSNA 3CRDA 1CY5A 2M5VA 2DBHA 4E9MA 2MB9A 2BBRA 4FH0A 2N1FA 1DGNA 3KATA 2DBDA 3QF2A 2NZ7A 2YGSA 3J6JA 3LQRA 2YVIA 4IZAB 4O9FA 2MN4A 3MOPA 4F42A 2N00A 1A1WA 4ZBWA 4D8OA 2VGQA 4QOBA 1WXPA 4A2WA 1E3YA 2G7RA 3CL3A 1WH4A 1D2ZB 4O7QA 1E41A 2IB1A 4I16A 2LWDA 2YU0A 2KM6A 2N80A 2N97A 2MJMA 2MPCA 3MOPG 1NGRA 4RHWA 3EZQB 4M9XA 4N1LA 4P4HA 2F1SA 2LS7A 2O71A 2NAQA 4O9LA 4UZ0A 2DBFA 2D96A 2P1HA 4N1KA 2B1WA 2GF5A 1DDFA 2A5YB 1PN5A 2L6AA 1CWWA 2YQFA 2N7ZA 2N83A 4JUPA 1UCPA 4O6XA 3YGSC 2XV9A 2BBZA 3EZQA 4M9ZA 4P4HI 3J63A 3LQQA 1A1ZA 2MS8A 3MOPK 1C15A 1N3KA 4JQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF5 H;  1WMG A;  4F44 A;  4LWD A;  2A9I A;  2L9M A;  2LWE A;  3T6P A;  1FAD A;  2OF5 A;  4M9S A;  2HM2 Q;  4A2Q A;  3YGS P;  4IZ7 B;  4IZ5 E;  2KN6 A;  4NQK A;  1YGO A;  1Z6T A;  1ICH A;  2DO9 A;  1D2Z A;  4EWI A;  4DWN A;  2DBG A;  4N1J A;  2MS7 A;  4RHW E;  2NSN A;  3CRD A;  1CY5 A;  2M5V A;  2DBH A;  4E9M A;  2MB9 A;  2BBR A;  4FH0 A;  2N1F A;  1DGN A;  3KAT A;  2DBD A;  3QF2 A;  2NZ7 A;  2YGS A;  3J6J A;  3LQR A;  2YVI A;  4IZA B;  4O9F A;  2MN4 A;  3MOP A;  4F42 A;  2N00 A;  1A1W A;  4ZBW A;  4D8O A;  2VGQ A;  4QOB A;  1WXP A;  4A2W A;  1E3Y A;  2G7R A;  3CL3 A;  1WH4 A;  1D2Z B;  4O7Q A;  1E41 A;  2IB1 A;  4I16 A;  2LWD A;  2YU0 A;  2KM6 A;  2N80 A;  2N97 A;  2MPC A;  3MOP G;  1NGR A;  4RHW A;  3EZQ B;  4M9X A;  4N1L A;  4P4H A;  2F1S A;  2LS7 A;  2O71 A;  2NAQ A;  4O9L A;  4UZ0 A;  2DBF A;  2D96 A;  2P1H A;  4N1K A;  2B1W A;  2GF5 A;  1DDF A;  2A5Y B;  1PN5 A;  2L6A A;  1CWW A;  2YQF A;  2N7Z A;  2N83 A;  4JUP A;  1UCP A;  4O6X A;  3YGS C;  2BBZ A;  3EZQ A;  4M9Z A;  4P4H I;  3J63 A;  3LQQ A;  1A1Z A;  2MS8 A;  3MOP K;  1C15 A;  1N3K A;  4JQW A; 
#chains in the Genus database with same CATH topology
 2OF5 H;  1WMG A;  4F44 A;  4LWD A;  2A9I A;  2L9M A;  2LWE A;  3T6P A;  1FAD A;  2OF5 A;  4M9S A;  2HM2 Q;  4A2Q A;  3YGS P;  4IZ7 B;  4IZ5 E;  2KN6 A;  4NQK A;  1YGO A;  1Z6T A;  1ICH A;  2DO9 A;  1D2Z A;  4EWI A;  4DWN A;  2DBG A;  4N1J A;  2MS7 A;  4RHW E;  2NSN A;  3CRD A;  1CY5 A;  2M5V A;  2DBH A;  4E9M A;  2MB9 A;  2BBR A;  4FH0 A;  2N1F A;  1DGN A;  3KAT A;  2DBD A;  3QF2 A;  2NZ7 A;  2YGS A;  3J6J A;  3LQR A;  2YVI A;  4IZA B;  4O9F A;  2MN4 A;  3MOP A;  4F42 A;  2N00 A;  1A1W A;  4ZBW A;  4D8O A;  2VGQ A;  4QOB A;  1WXP A;  4A2W A;  1E3Y A;  2G7R A;  3CL3 A;  1WH4 A;  1D2Z B;  4O7Q A;  1E41 A;  2IB1 A;  4I16 A;  2LWD A;  2YU0 A;  2KM6 A;  2N80 A;  2N97 A;  2MJM A;  2MPC A;  3MOP G;  1NGR A;  4RHW A;  3EZQ B;  4M9X A;  4N1L A;  4P4H A;  2F1S A;  2LS7 A;  2O71 A;  2NAQ A;  4O9L A;  4UZ0 A;  2DBF A;  2D96 A;  2P1H A;  4N1K A;  2B1W A;  2GF5 A;  1DDF A;  2A5Y B;  1PN5 A;  2L6A A;  1CWW A;  2YQF A;  2N7Z A;  2N83 A;  4JUP A;  1UCP A;  4O6X A;  3YGS C;  2XV9 A;  2BBZ A;  3EZQ A;  4M9Z A;  4P4H I;  3J63 A;  3LQQ A;  1A1Z A;  2MS8 A;  3MOP K;  1C15 A;  1N3K A;  4JQW A; 
#chains in the Genus database with same CATH homology
 2OF5 H;  1WMG A;  4F44 A;  4LWD A;  2A9I A;  2L9M A;  2LWE A;  3T6P A;  1FAD A;  2OF5 A;  4M9S A;  2HM2 Q;  4A2Q A;  3YGS P;  4IZ7 B;  4IZ5 E;  2KN6 A;  4NQK A;  1YGO A;  1Z6T A;  1ICH A;  2DO9 A;  1D2Z A;  4EWI A;  4DWN A;  2DBG A;  4N1J A;  2MS7 A;  4RHW E;  2NSN A;  3CRD A;  1CY5 A;  2M5V A;  2DBH A;  4E9M A;  2MB9 A;  2BBR A;  4FH0 A;  2N1F A;  1DGN A;  3KAT A;  2DBD A;  3QF2 A;  2NZ7 A;  2YGS A;  3J6J A;  3LQR A;  2YVI A;  4IZA B;  4O9F A;  2MN4 A;  3MOP A;  4F42 A;  2N00 A;  1A1W A;  4ZBW A;  4D8O A;  2VGQ A;  4QOB A;  1WXP A;  4A2W A;  1E3Y A;  2G7R A;  3CL3 A;  1WH4 A;  1D2Z B;  4O7Q A;  1E41 A;  2IB1 A;  4I16 A;  2LWD A;  2YU0 A;  2KM6 A;  2N80 A;  2N97 A;  2MJM A;  2MPC A;  3MOP G;  1NGR A;  4RHW A;  3EZQ B;  4M9X A;  4N1L A;  4P4H A;  2F1S A;  2LS7 A;  2O71 A;  2NAQ A;  4O9L A;  4UZ0 A;  2DBF A;  2D96 A;  2P1H A;  4N1K A;  2B1W A;  2GF5 A;  1DDF A;  2A5Y B;  1PN5 A;  2L6A A;  1CWW A;  2YQF A;  2N7Z A;  2N83 A;  4JUP A;  1UCP A;  4O6X A;  3YGS C;  2XV9 A;  2BBZ A;  3EZQ A;  4M9Z A;  4P4H I;  3J63 A;  3LQQ A;  1A1Z A;  2MS8 A;  3MOP K;  1C15 A;  1N3K A;  4JQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...