2O7RA

Plant carboxylesterase aecxe1 from actinidia eriantha with acyl adduct
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
311
structure length
307
Chain Sequence
b'LLKYLPIVLNPDRTITRPIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNSAKLPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDAMEALQWIKDSRDEWLTNFADFSNCFIMGESAGGNIAYHAGLRAAAVADELLPLKIKGLVLDEPGFGGSKRTGSELRLANDSRLPTFVLDLIWELSLPMGADRDHEYCNPTPLYSFDKIRSLGWRVMVVGCHGDPMIDRQMELAERLEKKGVDVVAQFDVGGYHAVKLEDPEKAKQFFVILKKFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CXE carboxylesterase
publication title High-Resolution Crystal Structure of Plant Carboxylesterase AeCXE1, from Actinidia eriantha, and Its Complex with a High-Affinity Inhibitor Paraoxon.
pubmed doi rcsb
source organism Actinidia eriantha
molecule tags Hydrolase
total genus 110
structure length 307
sequence length 311
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o7rA00
5DNVA 3G0CA 3WKAA 3M3DA 2V9ZA 4GBGA 2VQ6A 4INZA 4AMYA 5DYWA 4KRYA 2OG1A 3STUA 1PV1A 3KOOA 5I7UA 2VJDA 2OQVA 4FBLA 1LPPA 1WOMA 1N8SA 2CJPA 1Z68A 5HF6A 3IUJA 1RP1A 2OLEA 4MEAA 3F96A 3AUKA 3W05A 1CUZA 2CUTA 4UFOA 2VJAA 3E1GA 3WQHA 2PSJA 4GI1A 1MX5A 3WK7A 1Y37A 1O6FA 1LPNA 2JGIA 1YSCA 4N8EA 2QMQA 2H7YA 5AH0A 4EHBA 5EGNA 2BCEA 1IUPA 5ALUA 1TQHA 1BCSA 3W9UA 5AHXA 3I2IA 2QUBA 4C6HA 3BE8A 4Z49A 4QWWA 5AK6A 5LP1A 4OD0A 1YR2A 3FYTA 4EZIA 4H7DA 3A70A 3AFIA 5AKZA 2ECFA 2W22A 5ALSA 2XE4A 1LGYA 5AK4A 7YASA 4L3WA 3ICWA 4OU5A 3EQ9A 3MVEA 2PSHA 2OGZA 1GPKA 3BF7A 3FYUC 2VJCA 1EDDA 1ORWA 5C8XA 5AM4A 4YASA 4EY4A 1ZJ5A 4XWGA 3WL5A 1UOQA 1G66A 4CIAA 4NZZA 1XKTA 2Z3ZA 5C8ZA 1QFMA 1ZI9A 4X3CA 3GFFA 1XZKA 3H04A 3AJAA 4Q05A 3C5VA 4RGYA 2HDWA 4JYMA 2Q0XA 4Q34A 4DMFA 4YPVA 1H2YA 3PE6A 1LPAB 3CCBA 4G1FA 2V96A 5C8VA 1W1IA 1R4ZA 4OB6A 1G42A 3VVMA 3F67A 5LZ8A 5AP9A 1E89A 1EVQA 5HQ3B 4DNPA 5E2IA 2XQGA 1TIBA 3G02A 4TVKA 4KYVA 4Y2YA 3G9ZA 4G4IA 5ALHA 4AZ0A 2CMFA 5T4FA 1IZ8A 2ACKA 2EEPA 4N8DA 3H2KA 4PSDA 4B85A 1YASA 5J3JA 1XZLA 1UK7A 5JD6A 5ALRA 4X92A 1YAJA 3NUZA 2C7BA 2H7CA 1A8UA 5AO9A 1YB6A 3EBLA 3D59A 3B3QA 4F5ZA 4H7IA 2VT7A 2J4CA 2QUAA 2XMBA 4DMCA 1EXWA 1XLWA 3AIMA 5JZSA 1EVEA 1K5PA 3V1MA 4M0FA 1QIHA 1YAHA 5IKXA 3O9VA 1X2EA 4FOLA 4EUSA 1AGYA 1XZJA 4KAJA 5I8PA 4KR0A 5IVHA 2JEYA 5AM0A 1EK1A 1CUIA 1A7UA 3O0DA 3IUNA 3TRDA 5CH5A 1CUBA 2WUGA 2PU7A 2ACEA 2J3DA 1JI3A 3QYJA 2JF0A 3VISA 2H7XA 4BRZA 2PKYX 4UBMA 2HL6A 1YB7A 5JIBA 2DSNA 4J0DA 1WB4A 2I3DA 4G9EA 3S8YA 1DU4A 2PSEA 3R3ZA 4FKBA 1CFJA 4H7HA 4DYHA 1MU0A 4BB0A 4G5XA 3VJMA 3WKEA 3B5EA 1E66A 5LKRA 1QO7A 1TKRA 1K8QA 4UBJA 3C6ZA 2XUOA 5FPQA 1R1DA 4UFPA 2GYVA 5K3FA 2AJDA 4J0GA 4K6GA 4WDRA 4QLAA 3AZPA 2XMRA 4QZVA 1FFBA 3C6YA 5K3BA 3WK4A 4X6UA 3I6ZA 4PO3X 4PSUA 3H2IA 2PM8A 3VJLA 1H2ZA 1K63A 3F97A 4FFVA 2E3JA 2QJWA 1R50A 2ORYA 1DINA 2Z5GA 5A7GA 4BVLA 2WUDA 5FP0A 1FFEA 3LP5A 4UBLA 1IVYA 1J06A 4AN1A 1QTIA 4DM7A 4M0EA 4C01A 5LZ5A 3AILA 4U2EA 3GELA 4E46A 4PF1A 5CXXA 4FLEA 4IHAA 4HXEB 3WWDA 4HRYA 1BROA 1GT6A 2JGJA 3H0CA 2H1IA 4WDQA 2FUKA 5CTAA 1U4NA 1T4MA 4CI9A 1RWQA 3FAKA 5DYTA 4X91A 3DOHA 1H22A 1BN6A 3QMWA 4P93A 2ZSHA 4FTWA 3KD2A 5D7BA 1JJFA 1BCRA 5AI0A 3W06A 3O4GA 5CT8A 5ALNA 4X95A 4KACA 3OC0A 1XQWA 4HS9A 3V48A 4EA6A 1XQVA 2GBFA 5AI4A 1WPXA 4DIUA 4V2IA 2HHAA 2VT6A 1QLWA 4EY6A 3DJYA 2WUFA 3G0BA 5JAPA 4BE9A 2XQJA 1BEZA 4X6XA 4FMPA 3I2FA 2Y2UA 4QLOA 5CMLA 5ALEA 3ZV7A 3GBSA 3Q0TA 5AJHA 3IIIA 1LPMA 2HA4A 3PFBA 4XVCA 3LS2A 3HC7A 4OYLA 1OCEA 3AIOA 2HFJA 4TPKA 4ZV7A 1ZI6A 3ZLTA 3FSGA 5AKXA 4FFWA 3E4DA 1F0PA 5AK5A 3R3YA 5DNUA 3L1JA 3WL6A 3I2KA 1WHSA 5AKHA 5T4BA 2PX6A 4HAIA 2G5PA 1GZ7A 3KSRA 1LPOA 1L7AA 4ZGBA 1XRMA 2HRRA 5IH7A 4J7AA 3O95A 3HLKA 2X8BA 3X3HA 1UK8A 4B81A 5ALTA 1L7RA 1QJ4A 3N0TA 4UHDA 4IH4A 5LKAA 1CUEA 1XZAA 1ZD2P 2XT0A 1FFAA 4K6HA 4E11A 1MTZA 2YH2A 5DJ5A 5AOCA 2PSDA 1AURA 3H19A 3GZJA 4FWBA 4J0JA 5SYNA 1CUXA 4OUKX 4IQ4A 5A71A 1HLGA 3K6KA 5EI5A 1QE3A 2QXTA 5AI8A 3SK0A 3QMVA 3R3XA 4GECA 1XROA 1JFRA 3SWWA 1ZI8A 1QIDA 3Q8WA 3W2TA 4H7EA 4XJVA 4B9AA 1Y7HA 2Y1KA 3RK4A 3H1AA 5EIEA 5KBYA 3CN7A 4DMHA 1ODTC 2YYSA 4UHFA 5DWDA 2DQYA 5AM1A 2DHDA 1VE6A 1VE7A 4WY5A 1DQYA 4X93A 1SCQA 1QIEA 1J07A 2NW6A 5A2GA 3H2JA 1K4YA 2JGLA 1N1MA 4JUIA 2HU7A 4N8SA 2Z8ZA 4JNCA 4UPDA 3AZQA 5E4YA 3WYDA 4BAGA 2OXEA 2VAVA 4DNFA 1UXOA 1VKHA 4J0CA 2WHQA 4N5HX 2WU3A 1GPLA 2WM2A 2WIGA 1DT5A 4L9AA 4B9EA 5A7HA 2ZJ7A 4H0CA 5LZ4A 2OCLA 3QBJA 1A8QA 2V98A 4U2CA 2CEKA 4LYDA 1E3QA 1Q83A 3RM3A 4X00A 4J0KA 4G4GA 4AMZA 2WTMA 3IB3A 5ALPA 4PNZA 3V1NA 4LXHA 3FYUB 3WL8A 4HTAA 4N5IX 5HK8A 5CBKA 2XUAA 3R3VA 3WK5A 2BUCA 4Q1VA 1UKAA 4BZWA 1N5MA 5KWIA 3STVA 3STWA 3FLAA 4KEAA 5CH8A 3IDAA 4QE3A 4O08A 1WB5A 3C6BA 1USWA 1EDEA 3EF3A 5EHNA 2QRUA 3O4IA 1UZAA 3T4UA 5AKJA 3QH4A 5FOQA 2DHEA 2I03A 3DYIA 2XMCA 2I78A 1LBTA 3SC2A 3R41A 1CQZA 1YA4A 1YA8A 5H3HA 5FXMA 3DOIA 1CUCA 5HCUA 3BIXA 4Y2PA 3WKDA 4BE4A 3VKFA 1GKKA 2IX9A 4C87A 1LBSA 5AI6A 4CCYA 1D07A 4BC0A 5EHQA 1YS2X 3BJMA 3O4JA 3BDVA 1BS9A 4AXBA 5A7FA 4W63A 2HRQA 2XQKA 5CT9A 1H2WA 2GZRA 5CURA 2FJPA 2VEOA 1CVLA 3C6XA 3RLIA 2YXPX 4Y2XA 4P08A 5DTIA 4MYDA 4JYPA 4OCZA 1XRPA 4EY8A 4B0OA 3QMMA 2VA9A 4P9NA 5K3DA 2VF2A 3G0IA 5FKJA 2YASA 4MYSA 4WCVA 3IUQA 1THTA 4A16A 2PUHA 3H2HA 4Y2JA 6YASA 1W76A 4WFIA 1XFDA 1AX9A 4UUQA 4W1QA 1LLFA 1A8SA 2ZVDA 1C7JA 3I28A 1ODSA 1SCIA 3VJKA 2ZYHA 4FHZA 4JH0A 2BUAA 2G4LA 3YASA 1EH5A 5SYMA 1UKBA 3I6MA 1LNSA 4BP8A 1Y7IA 4E15A 3FLEA 3P2MA 4Q82A 3TGLA 2AJ8A 4EBBA 1CPYA 5CT5A 1W6RA 4BAUA 3IUMA 3PUHA 2OCIA 4AO7A 3BF8A 2C5GA 5FLKA 5KWJA 1GXSA 1QIGA 4XX1A 4PSCA 3G7NA 2XMDA 5LYYA 5ALZA 4F21A 2WIJA 3UUEA 3H18A 4FDMA 3IVMA 2WIFA 2XUFA 3IA2A 4X90A 2BGRA 4DSAA 5ALFA 4AN0A 3WK6A 1RYYA 3LCRA 3HI4A 1YCDA 1FJ2A 2XMQA 1JKMA 2G5TA 3LIPA 4QDXA 1UWCA 2PVSA 1CUDA 1ZIXA 3WWCA 4U2FA 2CKMA 3WIOA 5E4JA 1EK2A 1R3DA 4LXIA 1XRLA 3IULA 1EB9A 3C8HA 5FDFA 2OAGA 4UBIA 1AKNA 4B80A 1MAHA 4U2DA 3EQ8A 3NOXA 1VZ3A 3HXKA 3A6ZA 3I1YA 3ZPXA 3R0VA 1GPNA 3FVRA 3ILSA 2WHRA 5AM3A 4JEIA 1E8DA 1CUWA 3MUNA 1ETHA 1X2BA 1J1IA 3STTA 3ZI7A 2RI6A 4UHCA 5D6OA 5HK9A 2Z3WA 5DTJA 2JEZA 2JIDA 3BDIA 3R3WA 4Y2SA 1AUOA 3PFCA 4X85A 4A5SA 1QIIA 5FPPA 1XZGA 5AI5A 2HFKA 2K2QB 4Y2RA 3W9BA 3WWOA 5AICA 4EY7A 2WQZA 1HQDA 4C4ZA 3WK9A 2D5LA 4MEBA 2C4HA 2JGEA 3C5WP 5K3FB 2BGNA 2X5XA 4MQLA 4H77A 2WFZA 1JJBA 1IMJA 5JAHA 2ZYRA 1FFDA 2XLBA 3I2JA 3SX4A 3FOBA 4GW3A 1U8EA 2JGMA 4TGLA 2RAUA 3WKBA 2OCKA 4QWMA 5JAUA 2XUIA 1BRTA 1XRRA 3QPAA 1R9NA 4KE8A 5JD5A 4Y7DA 4B82A 1B6GA 3C8DA 1GGVA 3ESBA 1ZICA 2EDCA 2VSQA 4I4CA 2WHPA 1VOTA 3K9BA 5AKLA 4QNNA 5JAOA 2QXUA 4C89A 1XZHA 2WILA 4QEKA 2VTVA 5K3CA 3KDAA 2BAGA 1C4XA 2UZ0A 4HRXA 1XZCA 1R88A 1XLVA 4G8BA 1TRHA 4Y2VA 1VA5A 1LZLA 1WPRA 2XMZA 5AIBA 3I2GA 5BWBA 2OAEA 2XUPA 4YX9A 3A2NA 3G9XA 1VXRA 3PUIA 3BJRA 4J3JA 3GUUA 2QS9A 3AIKA 2LIPA 5BOVA 3ED1A 2RIPA 3U1TA 1PFQA 2RHTA 2ZYSA 3ESAA 2XDWA 1XRQA 2XQFA 5IVIA 5ALKA 3DKKA 2PSFA 2C5FA 4BCBA 1TCBA 4ZV9A 1AC5A 1CR6A 1DX4A 2GBIA 1R9MA 1MO2A 3MGAA 4LHEA 5ALYA 2WIDA 1CUFA 1JJIA 1DTEA 3WZLA 2QKYA 4ARAA 3WL7A 4CG2A 5BWCA 1EB8A 4J0HA 4IH1A 4AO6A 4B7ZA 4K5QA 1HBJA 4LKOA 4FNMA 4KE7A 1ISPA 5AKEA 4GWLA 1MX1A 2WG2A 4KE9A 3PI6A 5KREA 3WI7A 1UK6A 3CCCA 2O7VA 4FLFA 2IIVA 3QPCA 2ZSIA 4BC1A 4UBNA 1EA5A 3DS8A 4Y2QA 4H7KA 4BRSA 1X70A 2AJLI 3ESCA 4DTCA 1OILA 4BZZA 2C58A 4Y2UA 1ZGBA 1E8MA 4NVRA 5DYYA 4QDOA 4BTLA 1O6GA 2XUHA 1MNAA 2C0PA 4BDSA 1Q0ZA 1SFRA 2Z8XA 1XZFA 2Y6VA 4UBKA 5AM5A 2AXEA 4CFSA 3WMRA 2FJ0A 3W04A 4H7JA 4J0IA 3G0GA 3DD5A 5JARA 2BJHA 1QOZA 3NWOA 5JATA 5LZ9A 2QOEA 3HRHA 3VVLA 4DLNA 5JADA 3JYHA 2BUBA 1VJ5A 4U2BA 4DGQA 4AZ3A 2CB9A 3WJ2A 3VXKA 1P0MA 3OTQA 2GBCA 5I9IA 1IUNA 1NX9A 2C0QA 1VLQA 3DQZA 2VAXA 5D3KA 4Q3LA 3AINA 3QZUA 4PQEA 1DT3A 3OURA 1ORVA 4GLBA 5HFNA 2PU5A 2B4KA 1KU6A 1CRLA 1XQYA 4BCDA 4ZREA 5YASA 3O9MA 5HF5A 2OGTA 3ZLVA 1DWOA 4MWTA 3DLTA 4BAZA 3OOSA 3STXA 1W4LA 4AO8A 2OQIA 1E8NA 5JANA 2PBLA 3K2IA 2QR5A 1SCKA 3H2GA 5AK3A 3WA7A 1ZOIA 4UHEA 4BBZA 2J3QA 4W1SA 1CUUA 3PF8A 3PICA 4WJLA 4M0MA 3FNBA 2XLCA 3VDXA 5D3ZA 3FWHA 1HL7A 3F9CA 4CCWA 2O7RA 1BN7A 3V1KA 3EIOA 5T4HA 2CZQA 1G4HA 3BXPA 1WM1A 3B12A 4D9JA 5AI9A 3OG9A 1T2NA 1QGED 5ALXA 4I3FA 4BDTA 4FLMA 3L1IA 2RONA 1NU6A 4G8CA 5AOAA 1AZWA 5DNWA 3RKSA 2XB6A 3E3AA 3I2HA 3WJ1A 4B84A 1MN6A 2O2IA 4C4XA 4W1RA 1ZD5A 4CG3A 2WLSA 1XZIA 5EIHA 1M33A 5EHZA 1CUAA 2FX5A 1VA4A 1ZJ4A 3BWXA 3TEJA 4HVTA 2WG1A 3WK8A 2HA7A 5AKGA 3D2CA 2V97A 2XMSA 4F0JA 1XRNA 4K6KA 1WCYA 2WTNA 4KAAA 4AQDA 4BTVA 5BV7A 4OB7A 3D2AA 3A2LA 2ES4A 1FFCA 3R40A 3F98A 1VZ2A 5LIPA 5CRIA 5FUMA 1JMYA 4GEGA 4QDUA 3HACA 2B20A 5CT6A 4X6YA 3QPDA 3STYA 5JALA 1MX9A 2RGUA 2AJBA 1GQRA 5K3EA 2AJCA 4QDZA 4CCYB 1C7IA 1G5FA 2QT9A 1Q84A 3FSGD 1ZD3A 4HXFB 5IVDA 1N5RA 3D3NA 5JD4A 2DQZA 2ROQA 2Y2VA 1JT2A 2XQIA 5AOBA 5ALMA 2XMGA 3FCYA 5HQ3A 1P0QA 3IBTA 1KEZA 5HFAA 2ONCA 1EDBA 4Q3KA 3OM8A 1XZDA 1XKLA 1F8UA 1CLEA 2WG0A 1CUVA 4RE6A 4F60A 4LXGA 1DX6A 2DFPA 2DR0A 2BFNA 3ANSA 4XIIA 4CG1A 3C87A 5ALDA 3HJUA 1QTRA 3JW8A 4ZRDA 1W52X 4X97A 2WU4A 5CW2A 2QVBA 4DNOA 3LLCA 5ALQA 4AX4A 1MNQA 1OXMA 2WJ6A 2G63A 5JYCA 3ICVA 2XUKA 4HXGA 4K2AA 2ZJ6A 5AKYA 1VXOA 5AM2A 5FV4A 2HA3A 1MT3A 2WUEA 3H1BA 3DEAA 3FVTA 4OB8A 1QZ3A 3BIWA 1UFOA 2B9VA 1ZIYA 4UFNA 5FRDA 3WZMA 5C81A 2R8BA 3DDUA 5HF8A 4A23A 2B61A 3HEAA 2JGKA 1W75A 4UBOA 4OSEA 3T52A 2QJRA 5JASA 1MPXA 1U2EA 2VJBA 3RARA 3V9AA 3C70A 3UUFA 4J03A 2IITA 2WFLA 2ZJFA 3I1IA 2DCMA 4MWSA 1EINA 1CUSA 3FBWA 1JMKC 2R11A 4LIPD 3U0VA 2HA2A 3HYSA 1L7QA 2JGFA 2Y6UA 4BP9A 4B0PA 3WLAA 3WYNA 4FNGA 1MJ5A 3V1LA 2J4FA 1DWPA 3QITA 2WFLB 2HA6A 3C45A 3DL7A 4WFJA 3HZOA 1Q0RA 2XUDA 3H17A 4KE6A 5E4TA 5K3AA 1ZD4A 2WSLA 2BKLA 1XZBA 2GYWA 1DQZA 1I6WA 1WHTA 1QIJA 3F8SA 3FLBA 1UKCA 1UOOA 5LZ2A 1GKLA 3WKCA 1QIKA 5LLSA 4U2GA 4RE5A 1CUYA 1TAHA 1BEEA 5LZ7A 4MJ3A 2I3ZA 5DLPA 4Y2TA 2HA0A 3EQ7A 4BATA 1H2XA 2PPLA 1LZKA 4DNQA 4OPMA 5CH3A 1HPLA 4Y9SA 2OCGA 5AKKA 2XUQA 2RHWA 1CUGA 1THGA 3E0XA 3QM1A 5ALIA 4UHBA 4C4YA 3M81A 1XZEA 3HSSA 3WWEA 3DKRA 4OYYA 3M82A 1ZGCA 3CN9A 4FBMA 5ALVA 4GHWA 3LIIA 4B83A 4G9GA 2HADA 2GBGA 2P8SA 1FSSA 1BU8A 3I6YA 3N2ZB 4H7FA 2OPHA 3IURA 2QZPA 3G9UA 1UT6A 4QA9A 4KJXA 1E5TA 4QDTA 4I19A 1HKHA 1DWQA 1CIJA 2WHPB 1EX9A 3WWPA 1TCAA 4NS4A 5A6VA 1GQSA 1PJAA 3D2BA 3KWJA 2OGSA 1KU0A 3OPMA 4P92A 5HF9A 1NU8A 3KWFA 4X71A 3AZOA 4WFKA 3ZWQA 5ALWA 3WA6A 4DMKA 2WKWA 1EI9A 2WJ3A 5EHXA 3HABA 4KRXA 2ZYIA 2HU8A 2GZSA 2HA5A 4G4JA 5EIAA 5F4ZA 1CUJA 4G8DA 1QFSA 1CUHA 1LPSA 4HZGA 2QTBA 3O4HA 1H23A 1QIFA 1P0IA 3PF9A 5AIAA 4PW0A 4H18A 1F6WA 4BVJA 5ALJA 1A88A 4X7BA 4MQMA 5K5EA 2WIKA 2H9YA 4W1PA 2D0DA 3D4LA 3UMJA 4EY5A 2PL5A 1ODCA 3G9TA 3D7RA 5HKAA 4BYMA 5IVKA 3CXUA 1B41A 3GROA 3DNMA 3PDCA 4B6GA 3BL8A 3C43A 1F0NA 3A2MA 4IO0A 2GYUA 1TCCA 5ALLA 4X94A 4W9RA 4E14A 3G8YA 4L0CA 2DHCA 2QM0A 5CT4A 3WIBA 2XUJA 1EHYA 4ZI5A 5A62A 4ZWNA 1HDEA 3G0DA 1QONA 1QO9A 4S0XA 5ISMA 2X76A 1IZ7A 3FCXA 4WY8A 1IUOA 5HKBA 2EDAA 2XI4A 4KAFA 5ESRA 1TK3A 3GA7A 5ALOA 1CV2A 2PUJA 3M83A 4ROTA 4BVKA 4BCCA 4IH9A 1UOPA 2JBWA 1SC9A 5T4EA 4RPCA 1AMNA 2O2HA 4ETWA 2HM7A 4RNCA 3DYVA 5HZGA 2HU5A 5C7YA 3S2ZA 1P0PA 4ZXFA 5ALGA 1CEXA 1XQXA 4ARBA 1BE0A 1JU3A 3KXPA 1ACLA 4GXNA 1AQLA 1UK9A 3R3UA 1YS1X 4C88A 4NMWA 3DCNA 4Q3OA 4CIBA 1K6EA 1LPBB 3JWEA 2WJ4A 1MAAA 1S8OA 3NGMA 4H35A 3ZLUA 3D0KA 3TJMA 4UHHA 4AB1A 1U65A 4DSZA 2HIHA 3MUOA 4OU4A 5AKIA 1CQWA 1JU4A 2WFMA 1SOMA 4ITVA 2O2GA 1XZMA 5JZ9A 5CXUA 2XUGA 4MXDA 1ACJA 2CBGA 3ANTA 3QVMA 4PV7A 4EB0A 3L1HA 4LYEA 2VATA 4YK7A 1XLUA 5JZBA 4L72A 4GDMA 1J2EA 3DL4A 3ESDA 5EFZA 3D5EA 1QIMA 2W6CX 3FYUA 1WB6A
chains in the Genus database with same CATH superfamily
1EU1A 4P84A 2QN6A 4FE7A 2HSDA 2QE7D 5DNVA 3T1VA 3WBBA 1G4AE 4RORA 4WBNF 3ROXA 3MGCA 1ONNA 2DF8A 5GM1A 4AJ1A 2CXNA 3SF0A 3MRTA 4L27A 1X92A 5A05A 3ETNA 1IVSA 3OIVA 5DYWA 3V4VB 3QU5A 5B4TA 3UCXA 4J43A 4KRYA 4U7FA 3RAJA 2R97A 3STUA 4ZGWA 1Z6QA 5AW0A 2W6PA 1ZISA 1UBNA 2VHUA 5ENDA 3DTNA 1XK6A 2JLRA 3OP1A 4XDGA 1U8AA 4UVEA 3A4YA 2V3WA 2VJDA 3S2SA 3EXHA 1UM9B 5DB4A 5BN1A 2X9GA 1C4KA 3AY7A 2P9BA 4QPJC 4DLWA 2FUNB 2AIRA 4ZICA 3RSSA 2OM2A 1BO6A 2AOUA 2ATVA 3CVVA 4YP0A 3ZY3A 1LBEA 4IOKA 1PQWA 4AI6A 3NM4A 4IGEA 3ZKWA 1TUBA 1DDGA 3BYZA 5HF6A 4EP1A 2JIZD 2P62A 2ZJ0A 1ZMRA 3AC0A 4O4LA 5PNTA 2C98A 4BMPB 2XRYA 1KJJA 3FKSD 3RYCA 3ANYB 4NL4H 4EPYA 1GTVA 1IN4A 1U0RA 3SJUA 1KMCA 1UMBB 1X9HA 2AN5A 3AUKA 1YS4A 3F96A 5CVJA 4JQZA 5H16A 2F2TA 3W05A 5K7SA 3MPOA 3PXUA 1OFIA 4LI3X 1G3UA 3OOJA 2LRHA 1Z3CA 4FX5A 4UFOA 1PL7A 2QU8A 4HAVA 2FQXA 4U1RA 1NVEA 2H4JA 3C1TA 3QFSA 3P2EA 3P5SA 2P3OA 2VJAA 3KQLA 3E1GA 1NN3A 3L6EA 1U0JA 4LN1A 3OZGA 4UATA 3TLEA 1JHPA 4TKZA 4D45A 2VR1A 4GL2A 4S1OA 1UPCA 2LXNA 2O3UA 4K9NA 2ARKA 1FYXA 2IDZA 2PKQO 3IIJA 4N82A 1O6FA 2GK4A 5DT9A 4CMKA 2FEAA 3CPJB 5K8JB 1SGWA 4CTMA 2P30A 2PAFA 3BORA 4N03A 4D9KA 1UIMA 2DT8A 3FX2A 2A1IA 4NU5A 4ZYXA 2PAAA 3BRCA 3EEIA 1YIAA 3GFBA 3HNRA 4TT3D 1E9SA 4XM1A 4O4JB 5AH0A 5JPCA 1CHDA 1RPJA 1DNPA 3GLGA 5EGNA 3E2IA 3K4PA 3KT8A 4CT5A 3A4NA 1PYDA 3CKKA 3LL7A 3ZS8A 3TPZA 3WIUA 1J5XA 4JL5A 2EGUA 2GESA 4RJ2A 5IZCA 3T0GA 3DKPA 3A1NA 4TLLB 1S3FA 1MO3A 4HVLA 1FFXA 3VU9B 2Q5LA 1NP3A 2G4CA 5ALUA 4BKMA 2ZDQA 3OAAD 3UV3A 3W7BA 3OPYA 3WV4A 4IDPA 3JYPA 1PE0A 1IB6A 5KCMA 3T3GA 5DP2A 1FK8A 4N0MA 1N57A 3G7SA 3OCVA 1NMQA 4HH0A 3LTNC 4C6HA 2ZTHA 5E9AA 5EE9A 1BHQ1 3AXSA 2AXPA 3GLTA 1K75A 1HY3A 1X1QA 3VYWA 1H5UA 1M1XB 1YRQA 3LVFO 5AK6A 4A2QA 2OCAA 4I1YA 1X42A 2HLPA 4OD0A 4JYZA 3GFGA 2FG7C 1RLMA 2FSSA 1PFWA 1VDZA 3VTZA 1WU7A 1B8PA 1SO8A 1WZEA 2ZRBA 3AVPA 2QR3A 3EBPA 4NBLA 1N7HA 4ND8A 3SC6A 4RSMA 3R7DA 3VC1A 5LBIA 3N2EA 5JJBA 1F8FA 3ENNA 1TM5E 2J0VA 4WN3A 5ALSA 3CR8A 5AK4A 4RK7A 1DPFA 2R4TA 3RS4A 1BGXT 1NV9A 1VI6A 2R2GA 1IFXA 3KPUA 1JUDA 2XCSB 1G64A 3ESYA 3OZAA 4PS0A 2XOKA 3GEBA 3HPQA 3FYUC 3KJIA 3MJSA 3AYZB 3LT0A 3OLXA 1EDDA 4BFVA 1KAHA 1B4DA 3RH0A 4HGRA 4CQMA 2P9ZA 4DL9A 2YN0A 2GM4A 4YASA 4BX3A 3IAUA 2V7EA 4ZJPA 5EJ9A 4C0XA 3PGJA 3LPCA 4BP3A 4D9FA 3DE6X 5AW7A 2C9MA 1YCHA 2G28A 4O4IA 4XWGA 1J33A 5JD3A 2BDEA 2BV3A 4LJAA 5CVCA 3N0XA 1IQUA 1IBRA 4WK2B 5K8LA 2R6HA 1GTJ1 3ABRB 1CFZA 5K6AC 4IQ0A 3ZW7A 4AECA 2QM3A 2ON6A 3M6UA 3DTVD 4Y1GA 5C8ZA 2Z09A 1Z63A 13PKA 1QFMA 1ZI9A 3C3KA 3FRIA 5F5XA 1QGUB 3GOHA 4B5LA 4BWGA 3K1YA 4TTJA 1MO4A 2EX0A 4I9FA 3TIIA 1B6SA 5IHPA 4CM8A 3PHJA 2F8LA 4CUZA 3C5VA 2IV2X 4RTMA 4RA6A 4LHSA 4R41A 2KX7A 3RIXA 2Z9CA 1TQDA 2JCBA 2VP2A 3B70A 2GXQA 2O3TA 1ZH4A 3RK1A 4DMFA 3PFIA 4OHRA 1H2YA 3O8CA 5EY5B 1HDOA 1JDBB 2V96A 4MPJA 4XQEA 5FNVB 3JQPA 1Z0FA 1P18A 3LVBA 4F11A 2NV2B 3OZVA 1V47A 4WNCA 1N3LA 3FLMA 4PQYA 4EL5A 1YQGA 2D0PB 2R4UA 1DIAA 1E89A 1T1EA 1VMAA 3NYRA 1GVNB 3SF8A 3ZXUB 5HQ3B 2V6GA 4GU5A 4FKZA 4UU8A 1SKYE 1NSFA 2RKWA 3GC6A 3B52X 2XXAB 4TVKA 4O25A 4KYVA 3NT5A 4EYQA 3RVKA 3BB3A 1XN4A 2DPGA 1GUBA 5KJEA 2XT9A 5BSVA 2R62A 3OJFA 3ZYCA 1E1DA 3PC7A 1UINA 1Z0ZA 2VDWA 3AVTA 3KQUA 3U40A 5IDVA 4BLOA 4RX1A 1IZ8A 1LLUA 3IMFA 3KYDB 3P2YA 3JWHA 4N0QA 3AH8A 4B85A 5L53A 3T3OA 2M6RA 3W78A 1YASA 1MB3A 1QS0B 1M7BA 3JQBC 3KT0A 2QY9A 1JTFA 3WXBA 1HRKA 4ALIA 4ZYWA 3INGA 3PLNA 4MLZA 2IPOA 1RNLA 2P5TB 2Z6VA 2ZIGA 3ZGZA 5B1EA 1C2YA 3EFOB 1C7RA 1NYTA 3FTQA 4NG5A 4U5XA 1N1DA 2ZYDA 4X92A 4P0PB 1KYVA 3SQNA 4RZQA 3NUZA 2QBYB 1JVNA 4DIFA 4ESOA 3UKJA 4FINA 1D2RA 5KYGA 1EFCA 4RTOA 4LJYA 1JHQA 3H86A 4GGOA 3EBLA 3D59A 4TXJA 4IDHA 2YJ4A 1L7BA 4EW1A 1GCAA 2D8AA 1NF8A 2PCJA 3FNRA 3KYBA 4AZ0B 2VT7A 2A59A 3QF4B 1UAGA 2XMBA 1Y6ZA 4FONA 1TEZA 1G6OA 1ZK0A 3Q7SA 2XZOA 4AWXA 3AIMA 2N1MA 1IVNA 3WMFA 4XPIA 1EVEA 3HNOA 4GNRA 2O8BB 3T9EA 4B6OA 3T5PA 1C41A 2QSZA 1GTMA 3ET5A 4L7VA 3K0CC 4FOLA 4HFJA 3PHGA 2BEWB 3Q3GE 2AQKA 1NZFA 4WPGA 1TW2A 3B2EA 4B6SA 3IQZA 4ZJUA 2FPRA 2YXLA 1QVRA 2XWJI 3KUDA 3CSSA 4X3OA 5BSWA 2KLBA 4WLNA 4B76A 3N1UA 3PHCA 2WJVA 3QVLA 5BN4A 1XTUA 1VKJA 1SB9A 5FPTA 1EFHA 3L7NA 1IXKA 1SUAA 1JKIA 2JEYA 4EG0A 2QTAA 1T1IA 4DXHA 5KJ1A 1Z33A 2EWVA 3O0DA 1A0OA 3N75A 2JJ2D 3N3AC 3HXLA 5CH5A 3NEYA 2G1UA 2D13A 1IQ0A 2H1LA 3CLSD 4Q18A 1H0HA 2NXJA 1J0CA 3ZZNA 4D81A 5BV2P 2JLWA 1G8KA 4CU2A 1JDJA 1A9XB 3CH7A 3H1GA 3PYLA 1FUUA 4JZKA 3QYJA 1YDEA 1Q7TA 1V39A 2HEGA 3CCFA 4B2LA 4CMAA 3LGSA 5ICGA 2C1XA 2FH5B 5U9CA 1SG0A 3VISA 4JU9A 4MS3A 1IHUA 1CQXA 4M46A 2EJBA 3IDQA 5CDFA 2ZUWA 1E2BA 1E2GA 3AHDA 3ZGXA 4YQEA 3AGPA 2CZGA 3PRJA 2PUAA 4HPJB 4CQLB 2OO5C 2A67A 1GDDA 3WMEA 3MCVA 3VKUA 1ULHA 3QJYA 4XSHA 2A0WA 2MINB 2XVAA 3D02A 4FKBA 1HC7A 3PUXA 3ZCTA 1TECE 2KJQA 1U2TA 2I54A 2Z9DA 4H7HA 1MU0A 5I9TA 2UZIR 5EXEA 1CRPA 3B48A 3VJMA 5LKRA 3GA5A 3LO5A 1PUIA 3OY2A 4U7PB 4W7SA 4E4TA 3CKLA 5FTJA 3NX4A 1RHRA 5BURA 3TO5A 5IRCD 4FOSA 1XTVA 2O3QA 4LWZA 4JS0A 2I2CA 5CNJA 3L7IA 2YVQA 2P75A 3CR3C 3AOEA 3VYSB 1U7TA 3NBMA 3N6XA 2VJOA 3BSFA 4MW1A 3KDSE 4MKZA 4ND3A 1DAOA 4ZEMA 1FBTA 1WCXA 2J7KA 3GL9A 5FWXA 3PUZA 3ZEAA 2F3TA 4RK1A 2V54A 5D3MA 3GVPA 5F73A 5KOJB 5KU1A 5SZIA 2FVXA 4QLAA 5CVDA 4DIBA 3MA0A 4P4UA 3UHFA 4JC5A 2F9LA 3QVGB 4L75A 2ILTA 1O97C 3A6DA 3OQNA 2Q50A 3B1KA 3BZBA 4TKMA 5TMEA 1LK7A 1NJFA 1K8YB 3I6ZA 3R3JA 4L78A 1MJHA 2XQVA 4K7JA 2FRDC 2R84A 3CT6A 2R1VA 4M88A 4LVUA 4RJIA 3VU1A 2CJFA 1P9LA 1TCVA 4ZC8A 4G5QA 2XZTA 3KKNA 3N7AA 4UHJA 1BOFA 1KFEB 3NAGA 3RUDA 3X1JA 1P4GA 1C3LA 2QNBA 1H6CA 3KX2A 3W1WA 4DQDA 2VTBA 1X3SA 3IP7A 4K87A 3SYNA 1IU9A 1H2ZA 1HDIA 3P0JA 4EELA 1RRPA 2FFQA 2ZVJA 1UJMA 3GZTB 2M9MA 1YRWA 4WOPA 2Z5GA 4QU8A 3KALA 3PPYA 3DLBA 1F0YA 2WUDA 3OO1A 4RKRA 3ZJ4A 4A73A 5A0VA 1FFEA 3LP5A 2DRIA 1E3DA 3F2IA 4E5SA 3W8NA 4JLWA 2AEJA 1ZUNA 4YYZA 1C7QA 1KORA 2GK3A 3IHKA 5JEEA 3AKYA 3PXBA 1BXZA 4C6TA 1DMSA 3ZE2B 1OI4A 4EHFA 1DC8A 4RPLA 1A82A 4IUCS 3W5SA 4JYCA 3FTEA 1FJGB 1NOJA 2ZBFA 4IS3A 5GPBA 1KDTA 3ELUA 4K9LA 4FFNA 1QZUA 5E0OA 4E46A 4R71A 4A15A 3OCXA 5K3SA 5CA1B 1V5WA 2GCGA 3CUUA 3HVKA 4IHAA 4HXEB 5CGZA 1XE3A 2GRJA 3ROZA 3VH3A 1M6HA 2OB2A 4KV7A 4XVRA 4DWWA 2G1PA 2LDBA 5FUWA 3R2JA 3EK2A 3G85A 2ATCA 3U4GA 3BKWA 3KLOA 3VAZA 5LNK1 1ZD9A 5MGNA 1GT6A 4ZDWA 3WVNA 5JJLA 1DHTA 1PJ4A 1ZCBA 2XF8A 4Q66C 1QG4A 2IDMA 4WDQA 5FBHA 4ROSA 4OQ4A 5BP7A 2Z5LA 3ZDAA 4FB4A 5CTAA 4BWFB 1Y5MA 3X43A 3MBOA 1DJOA 2WB4A 4E5MA 1JHXA 1Y6GA 4CI9A 3G5MA 3TJZA 1RWQA 3KFVA 4JBGA 4BE7B 3F1LA 4U7WA 3NHSA 2QP4A 5KOHB 4ARSA 1QTNA 3W3AA 3IPYA 5DYTA 1V5GA 1B42A 5I6DA 1G20E 1I94B 3E7WA 5FPYA 5DI3B 4B73A 3QMWA 3PC8A 4P93A 4PC3A 4A92A 1NM5A 3DDWA 3SYTA 5BW8A 4ESVA 2G1AA 4YJ2F 1CSEE 1Z4QA 5HTOA 2HWXA 2XZDA 3W06A 3HYTA 2X4GA 3MRSA 3IPCA 1G55A 1XHEA 2VXOA 5HJ5A 4KACA 3U60B 2EWWA 1HOTA 1ZDMA 3ENKA 3GEGA 4QECA 4U0JA 3V48A 4DIEA 3UJ3X 3VSDA 2GBFA 1XTRA 2R6FA 4GICA 4HUJA 2P69A 4NK5A 5E9QA 3ZNNA 3UB4A 1XLTC 4XD2A 2KPOA 1UT8A 4HL6A 1B43A 4JLSA 4HADA 5JSFA 5JY1A 1JZQA 2VT6A 4WAUA 3PQ2A 5KWVA 4EI8A 1D2MA 1QLWA 3S4YA 5TSDA 1UBGA 5GONA 4BNLA 2QN3A 5JAPA 3I9NA 3V34A 4BE9A 2VZ8A 2XQJA 4JLAA 3MC1A 4BMDA 1Y8ZA 4RF4A 3TXAA 1P1IA 1GLGA 4E6PA 2JLUA 1UP4A 1RWKA 1FDTA 1DXHA 2MT9A 3PEWA 4OHKA 1JE0A 3LBAA 4ND6A 1JLKA 3QI2A 4Q48A 2YIVX 4QLOA 1T43A 1TVKB 4BJ3A 1HEIA 4Q24A 1BW9A 1UDWA 1P1CA 3WHPA 3GBSA 3SJAA 5JFTA 4PC7A 5AJHA 2Q41A 1TZJA 3H1EA 1N32B 4EUFA 5MGBA 1NY5A 4D97A 1H3EA 4KIGA 5J4VA 2IYRA 2Y0EA 1VQ1A 2YHSA 4MW2A 1EDOA 1HA3A 3Q5GA 1NVFA 1HTWA 1R0SA 1MFPA 1RPAA 1O6BA 1ZSVA 2ZJAA 4M7WA 4B45A 2GJ9A 3AIOA 2QXYA 4UDNA 4RLFA 4A3SA 1YRAA 3CA8A 4DRXB 4II3A 3AXTA 1FYEA 2HUNA 1AS0A 4MHTA 3LQFA 4KBFA 4ZV7A 3PPIA 5DDIP 3T1OA 5DGDA 3KEMA 3S5UA 5CM8B 3OMXA 7AT1A 1Z39A 1NF2A 3KXDA 2JGDB 4RPGA 3R23A 2H1HA 2HIMA 2EYQA 2AD5A 2EZ8A 1G21A 2VQ3A 2Z5FA 3KQSA 2YOGA 3Q2OA 4YFVA 1UP7A 5SY6A 1K89A 2P67A 2VDLB 2MSKA 5ETJA 4YHHB 2O23A 1Y6FA 2LW7A 2PCLA 4BWVA 5DNUA 3I2KA 3L8GA 4B43A 3GJ5A 3KCNA 1OX4A 1WUIS 1CJUC 2FFJA 4YYEA 2JIRA 4HAIA 4QAQA 3BK7A 3RIHA 2QVLA 4DLTA 1RM5A 1N2EA 1MXFA 3KSRA 3OZXA 4DCJA 1L7AA 3N5KA 4XIYA 5J5CA 1R6AA 3GA0A 4ZGBA 4TYNA 3VTFA 4R2WA 4KFUA 1IXSB 2FPOA 4EHNA 5IH7A 4O2AB 4AJ9A 1GG8A 4NBKA 4MUEA 4ZP1A 4IMJB 2C84A 3AF2A 3BTUA 2GH1A 1Z17A 3HLKA 3RQSA 1PLKA 5AVSA 1AK2A 3X3HA 4ENVA 1XP8A 4R1LA 5KTPA 5JMWA 4N7RA 4JJAA 1L7RA 1QJ4A 2Q28A 1B0UA 2AMFA 4XI9A 3EA5A 4IH4A 3U4QA 2GZ1A 2OHHA 4PPGA 1D7AA 3W6ZA 1YL6A 1DG9A 2EERA 1JX6A 3BBLA 3ND7A 2XT0A 4NEQA 2ZS7A 4QXMA 3CX8A 3SI7A 2HUPA 5H3LA 5AOCA 3WFZA 1T2CA 5DU2A 4KL8S 1V8PA 3GZJA 2IBTA 5FIUA 2Q5JA 3DAPA 1KMIY 4J0JA 1Q1GA 2FHPA 4I5GA 5SYNA 5ED4A 4A82A 2JZCA 2LPMA 1U31A 3ONVA 2E85A 4PGMA 2ZRHA 4U3JB 4MB6A 2VF7A 1M6NA 3SSAA 1JXMA 4IQ4A 5IN4A 4D0RA 3BD6A 2R4QA 4AMUA 3GAAA 3LT4A 4KFTA 1KZ6A 3SEZA 5IT5A 2A35A 4G1VA 4YJ3A 3JVVA 1MEJA 3JY6A 1J97A 4ZEVA 4A0SA 4Q12A 2CKDA 1GFWA 4QLBA 3NDIA 2D6FA 3QMVA 4H16A 4O4HA 3M6XA 4R7ZA 2CHEA 1B8VA 1KNQA 1ZI8A 4ZVVA 2WQ7A 3Q8WA 3EXEB 3GARA 3CTMA 4I1SA 4L74A 5DM2A 4C08A 5F1OA 1SELA 3ILVA 4HLUA 3F1KA 4RF3A 1MR3F 4YAEA 2GWRA 5IC6A 2Y1KA 1KDZA 4ZYUA 4HDQB 3RK4A 2RGAA 1J5PA 1BJRE 1RI1A 2UZ3A 4MUYA 4QG7A 5GZ6A 2IKQA 4GKVA 2DECA 5EIEA 2PV0A 5L45A 5KBYA 3CN7A 1JTVA 5G3ZA 2H48A 1ODTC 4FS8A 1KNXA 2YW2A 3KL4A 4UHFA 1SXJC 1RI3A 3BSYA 3UICA 1KJZA 1UFQA 2DQYA 3QW4B 4BTEA 2I8AA 4ZEXA 3V4LA 3BH7A 2CHUA 3BMCB 2OD2A 5CA0F 3G2QA 1VE7A 3BE4A 1SCQA 2QX8A 1LSJA 2W37A 1WBDA 5IAJA 4BZQA 3QFFA 3LOPA 3AUSA 1RXSA 1N1MA 3E15A 3ZIUA 4L95C 4ENUA 1ZOOA 1UWLA 1HDYA 2Z8ZA 2IYWA 3BXXA 4JNCA 2JRLA 3CPHA 4EFNA 4UPDA 4EUKA 5FAKA 1ESDA 2GZHA 4DNFA 3TTYA 1N2HA 3RWBA 1CC1S 1CHNA 1GOTA 1GRCA 4H4CA 4Q37A 4RTRA 5EWMB 3V6MA 2B2XA 4YUVA 1DRUA 2HHJA 1Y7LA 2PEYA 1OU4A 1PIWA 1QLHA 3H75A 1GRVA 1DT5A 1R4MA 2BMWA 2VYQA 2WIGA 3KCQA 5L3QA 4B9EA 1E60A 3OLQA 4GNKA 4HCJA 2VPZA 4DA6A 1OH5A 2AZDA 3BH6A 2QSJA 1JE1A 2WJYA 3I0ZA 4IIUA 1PDOA 3G59A 7ADHA 1HTTA 3EZGA 1O94C 1S7GA 2DFTA 3Q8LA 4AF6A 2RJNA 1PJ2A 3M6FA 4IJUA 3QFRA 4BQNA 3GPIA 5CEEA 1N9ZA 2MSDB 4AG6A 4U2CA 4N5MA 1GGFA 4BNWA 4Y0AA 4LYDA 4FYJA 1X1AA 4B48A 4M98A 4QUBA 3T4PA 4PZEA 2A9RA 4X00A 3K0EA 5F1KA 1QV7A 3D7NA 3PQ6A 4KQEA 4C4SA 2JHGA 4LF8B 1CQIB 2VYNA 1EG2A 1K97A 1JSXA 3N2LA 3IJPA 4B40A 2NZYA 4LHXA 4XGIA 1OH6A 5LQMA 9ATCA 3DPSA 5EJGA 1R5NA 3TXXA 5BNFA 3IV6A 4HWSA 2INGX 5ALPA 4O2LA 1ZCAA 3AKZA 3PJRA 1I7NA 1UBMS 4U6QA 1KSFX 2JDIA 3DCJA 4KX5A 1PR2A 2EOAA 1HH4A 3LY5A 3WL8A 1GG5A 4C03A 4N5IX 3HDTA 2ZUSA 3LBFA 5CBKA 4YCDA 3SBDA 1E3TA 1OWPA 3FB1A 4HGNA 4R84A 3C1UA 2EP8A 2YIJA 1JWBB 3N9IA 4R8RA 2CDBA 1MLDA 3RNLA 3ZQ4A 4BMXA 1ST2A 1T1JA 1MD9A 2AXQA 2ZBRA 1UKAA 3F3YA 4KKXB 3RJ9A 5B36A 4BKUA 1TK2A 3H9UA 1UBFA 3STWA 1DADA 3U5ZB 2FMXA 2ZWAA 4O02B 1UJCA 4X24A 4MIYA 4MWCA 5CH8A 3L4BA 1XPOA 1XZ8A 3L8YA 4D4JA 1GSOA 1V26A 1Y3BE 3ORQA 3QX8A 3WSTA 3R3HA 3RUFA 3BZUA 3GGPA 1V3QE 3ETCA 3EF3A 4LZLA 1UJ4A 4RA9B 2FQQA 4RQAA 1K5DA 3MGGA 1UZAA 3T4UA 1FTSA 3LDHA 1Q21A 3IAS6 4UCQA 4Y8VA 2V8BA 4CM4A 3SQXA 5FOQA 1KGDA 2VSFA 1W0CA 5EN4A 3PXEA 4RQUA 2G08A 1S2MA 2I66A 3ZIDA 1NWHA 1K2WA 3TKLA 6PFKA 2YJ5A 3C24A 2BFDB 4X5OA 5LJLA 1KQ3A 1ZIPA 1WW8A 3QOYA 3MFQA 5CYPA 3EPRA 3M6IA 3RVRA 1BA2A 3PHIA 3NC4A 3PQ5A 4KWTA 3A9TA 4YAUA 1QX4A 3PGA1 4QSMA 4X9XA 2FP4A 2FW6A 2JIMA 2QRKA 3ZD7A 1TMYA 1WP9A 4DE5A 2AFRA 3DKIA 4HAXA 5J2UA 3H3FA 4IIFA 4GP9A 1L5GB 2VC2B 2VBCA 3GO4A 4IHKA 1J00A 2OV8A 4RVDA 3DE0X 5FXMA 3A04A 4DG8A 4XGNA 2I87A 4ZEOA 4TZTA 5IX8A 1JFFA 2RHCA 1UPFA 2X4LA 2QRJA 4KGZA 1D2NA 1VSBA 2H1SA 3IX7A 2H9AA 3K2EA 4UU7A 3O7MA 1AQUA 4PHGA 3TXYA 1OAKA 3USZA 4PX3A 5JNWA 1LB1B 4FMBB 3BIXA 3L1VA 4ASUD 1ANKA 4P1ZA 3W5HA 1ONSA 2WM9B 4GR5A 5EKUA 4BE4A 3SXPA 2NVOA 3DO6A 5JDIC 5JNUA 1TAQA 4A1OA 3ZIAD 2GPWA 5AI6A 4D1YA 4CCYA 2F7SA 3OJWA 3WRXC 1YS2X 3BJMA 3KV1A 3MWDA 4GMGA 4CJXA 2GBLA 3FHJA 5KYXA 2J9GA 1NUPA 1P62B 4CT0A 4A26A 1Q22A 5HEKA 2HJHA 3GEEA 3RIYA 4HH4A 2ACWA 5G1NA 1GQOA 2AZ4A 4XX0A 3K0CA 3TSAA 4Z6KA 2HRQA 3QEBZ 2IZ0A 1NPTO 2NQ2C 5G0VA 3TCKA 3VR3D 1H2WA 2QPOA 2VCYA 3DDNA 4YRKA 1GU7A 2A4KA 1L5QA 2UYOA 2ZUUA 5LQAA 2VEOA 4KXNA 4QOFA 2ZWMA 4XGRA 2E49A 1PR4A 4QDJA 2PUGA 1BD3A 3GUVA 1QH8B 3AX6A 3FZNA 2Q4DA 3MAGA 4G2TA 1JHOA 2RB4A 4QPNA 1RFLA 4R8VA 2J9XB 1RIIA 2Y05A 4JKOA 4TLCA 4M53A 1VLJA 4KPGA 1EWYA 3L0ZA 3I32A 2V65A 4MYDA 4RTQA 5EJ6A 2GFHA 3UJ7A 2F62A 4YJFA 3T34A 2A86A 5BO5A 1IXRC 2H2WA 3S99A 1MV5A 3ZGOA 2XF2A 3NHYA 2VA9A 4LEIA 4EA8A 5KTYA 3AETA 5MDHA 1C1YA 4UUPA 4XH9B 5SYAA 3RUIA 1OFUX 2WSBA 2W6MA 3U3JA 3LTEA 3MYYA 4WIAA 4XFDA 5A4DA 4JB3A 3RBVA 3QKUA 1FS4A 2FQWA 4UM5A 2VF2A 4R9SA 2A3RA 1RXUA 1CETA 2XDYA 2ZFUA 5AHKA 4UVDA 1V4VA 3JTEA 2Y76A 1LI5A 2IUFA 3FMOB 4DQXA 1QYXA 2A9FA 2E4AA 3LUBA 4WCVA 3IUQA 4KW7A 4FN4A 4BKOA 1WR8A 4A16A 4O3MA 1SMKA 1ECLA 3CLUC 4B3FX 1XZQA 4Y2JA 1GAXA 1ZD1A 2FTKE 2ZXFA 3VV3A 5AVOA 1P4JA 1Z83A 1DI0A 3B3GA 1I3LA 3IBYA 4RM3A 2PKRA 5I9NA 3DOFA 2X0IA 1IEVA 2YRXA 3H8JA 1HG0A 4J1NA 2QD5A 1QQTA 3CIOA 1G2IA 3EVTA 4WZBE 5B3JC 1HNNA 3NTQA 1ZK2A 2ZB3A 5D1HA 5FX2A 2ZIVB 3VPAA 1U0SY 4CGZA 3WRYA 3IAM6 2F1RA 5F4BA 4TM7A 2V0GA 2WTXA 4DQKA 2YN4A 3JASB 3UT6A 3ZX4A 5KHOC 2G07A 5F7XA 1Y63A 4KQFA 2IK8A 3A3KA 4QGGA 3E9RA 4JH0A 1NIJA 4MUMA 2HU2A 4MR8A 5K4GA 4UCWA 3I6MA 1LNSA 2GGSA 3V5NA 1LBQA 3IRVA 1JQ5A 2MSWA 4E15A 3FLEA 1CTQA 5E8RA 4BFWA 5TRTA 5C52B 2J6BA 4N47A 5CT5A 2R9VA 3K1TA 4DZRA 1D03A 3B38A 4NZNA 2ZJ1A 1D2EA 3ILHA 3WYBA 3TJRA 4QUIA 2EIHA 3UV6A 4KIUA 2VK1A 2ZQ5A 3AOGA 3EG9B 4H0NA 2H3EA 4J29A 1JG3A 3SNHA 3A1WA 2J0QA 1E0SA 3FPSA 3IMCA 1M2GA 1OWOA 1JEOA 1GXSA 4NNJA 4LDRA 3A14A 4MDEA 1DOAA 2VDPB 4O4LF 5CHYA 3JD1A 4V3CA 4BRUA 1HFJA 2C42A 4S1TA 1N3BA 4PSCA 2E4UA 1KMHA 2X5OA 2B37A 2ZU6A 5CJ2A 5ADVA 2Y77A 1OOEA 2UYQA 5KOIA 4XLTA 2A1UA 1YDHA 1KFBB 1EBBA 2A0FA 3LX8A 3OFKA 1MJFA 1Q0TA 4I55B 5J23A 1DB3A 1RQ7A 2Y99A 3QUBA 1L8OA 2XUFA 2NUAA 2XUZA 5K05A 2P79A 2P78A 1W36B 5JJIA 2UVPB 4P7BA 3BHJA 4XDHA 2OCXA 4AP5A 4DYDA 2ECPA 3U4IA 5IBCA 2EJVA 5EAIA 3OKFA 2DR2A 1F38A 3WK6A 4D3DA 2XMQA 3ZNPA 4L9SA 4EITA 2FEPA 4QDXA 1UWCA 1D1QA 5DLYA 1CNFA 3RFXA 2WPDD 4AF7A 2CKMA 2GLXA 2YHAA 1RXIA 4QELA 2KW5A 1QQ5A 4L4YA 4DS3A 1L1RA 3RC8A 4MGIR 3TZKA 1G21E 1ZVQA 4LXIA 3RODA 2XA9A 2J5QA 5DE3A 2BP7A 3QK7A 3RR2A 1EB9A 1O4WA 1P60A 2K5UA 3G82C 4PZDA 4I4NA 4MPPA 4LOIA 4UBIA 2B4TO 1D8AA 3FCOA 1AKNA 2XR1A 1F8YA 4B80A 1W4ZA 2BE7A 3OJXA 4RJLA 1Y9DA 2I80A 2IEDA 2RMKA 4F3CA 2ISCA 3GFSA 2CXXA 4IRUB 5JAQA 5C4GB 3BUSA 3QF7A 5CLJA 1ADGA 3HXKA 1GZVA 4AQYB 2CL0X 3A6ZA 2BONA 3V3KA 3I1YA 5C8DA 2GF9A 4IS2A 3Q2IA 4D42A 3KPWA 5CM2Z 4HZUA 2P1DA 1O9HA 2TSYB 3CONA 4OHOA 4AJJA 3WDKA 2BKXA 4MK4A 3VTKA 1RLOA 2PVCA 1KVQA 1NUUA 1SN7A 3AW8A 1YQDA 3GLHB 2I0FA 2ZIZA 4OQNA 3BGWA 5AVYA 1M34B 3DXXA 3MUNA 1ETHA 3TNJA 2HYIC 1J1IA 3TL6A 3HU1A 3M9XA 4L73A 4RXUA 3IBGA 4CXMA 1BVUA 3QELB 4KK4A 1N2OA 1P6QA 2WDZA 4Q9DA 1H69A 4P6VF 5TS3A 1FZQA 3LFHA 4LQDA 4S1VA 4XB1A 1R0XA 1XCOA 4D4HA 4B44A 2GPTA 4JP1A 2P9TA 4Q1BA 1FYVA 3Q1LA 4ER0A 4V0SA 5TGDA 3AEQA 3ADBA 3R3WA 4MTCA 3W6PA 1SIWA 2JI7A 4BN0A 3EVFA 3FM9A 3IHWA 1KETA 5KSWB 2O48X 3RGWS 5A3SA 2V4ZA 1IRIA 4O4IF 4IX1A 4ZU1X 4ARZB 3FOFC 1OD6A 3BSSA 1RSZA 1RQNA 4H2DA 3G68A 1WABA 1L5ZA 5FPPA 2QENA 5AI5A 2J9RA 2QN2A 4CG0A 1I4TD 1RJGA 3T7TA 1QSGA 4H6XA 4V1CB 2K2QB 3CJRA 4Y2RA 4KPUB 4F9GA 4IV8A 3W9BA 4HYYA 3COJA 3A36A 5AICA 1UWVA 3ETLA 1P2VA 1CF9A 3B20A 3FZYA 1Z25A 3CZ4A 3HADA 1UBRS 1JTEA 3PGXA 3V8BA 4Z1MD 4LBYA 1OB2A 2IY8A 2JC3A 4C4ZA 4L5CA 1U9IA 2CNDA 5CNKA 3FOZA 3WY9A 2REQA 4MR7A 2HQRA 4FIZA 4EDFA 1IPHA 2E4WA 3C5WP 2J32A 2ZB7A 2OHJA 4IXDA 1MG5A 5T64A 1WXGA 5GGXA 5JNTA 2UZ1B 4H77A 3RC9A 4BMZA 3WISA 5EIBC 1KARA 1NFFA 4K8OA 1I32A 4LMPA 1LTKA 2Q2WA 4E33A 2D7CA 5KTNA 1U28A 4DXDA 3ZY6A 5JAHA 3QPWA 3PD1A 4RDXA 1PL8A 3REGA 4FI3C 3LK7A 5KWEA 3VNVA 1TZMA 2IXGA 2ZYRA 3UHPA 1QQBA 2XLBA 3SX4A 4L0QA 3OEED 2VP0A 1U8EA 5DCWA 4A8JA 2FOLA 2J3KA 3KZVA 4TGLA 5I8ZA 3RVBA 2RAUA 2Q29A 3WGHA 2V7VA 3L7BA 4IG4A 1SOUA 3K4QA 3PQDA 3TNLA 3K6RA 3QP9A 4YI3A 4B33A 1D5WA 4JP2A 3TLGA 5JAUA 1U7WA 1GEGA 1FYFA 1J0XO 3DBVO 1W85B 5DGHA 4MVJP 5I7RA 1IG3A 3GAFA 3SR3A 2EJWA 3IQHX 3RVLA 2J9FA 5FA8A 4REMA 3G3EA 1WF6A 4B82A 4YUZA 1IK4A 4KGVA 5H68A 3B3JA 1QF7A 4NBVA 3P94A 5EKXA 5EMJA 4DPLA 3WNQA 2JZOA 3HJAA 3HBLA 3KVVA 1VOTA 2BEVB 2AV6A 3ZTWA 5C53B 4EI9A 3X2SA 2QAGC 4IZ6A 2QXUA 4C89A 1XZHA 3Q40A 1HYQA 3LVRE 3MTJA 3UWSA 2QDKA 1IPFA 3CX6A 1M75A 3N39C 1GSHA 4UAGA 3K73O 4B4KA 1KAGA 2H54A 1C4XA 1YS6A 1NUTA 2FPIA 3TSCA 1MOPA 3X44A 5DBEX 4GX1A 4KXVA 4M9CA 5B7GA 5INTA 1BMQA 3PNKA 4ZPXA 1HT0A 1XD2B 4JL8A 4W5RA 2OO3A 1XLVA 4TXNA 2IXEA 5JVDB 3BQ9A 3RS9A 6GPBA 1I5RA 2W70A 3DQPA 4Y2VA 3H0EA 3U4CA 1SWVA 1Y9JA 2F1JA 3DL0A 2GF2A 1AT1A 4JEHA 4M0DA 4PU0A 4KWCA 5LJIA 3I09A 3FMIA 2DKNA 2HLDD 3I2GA 4KIWA 1LH0A 5HX7A 2XUPA 5SY9A 1OWNA 2QTVA 2Z2JA 1VXRA 1ICEA 4D3YA 1HR0B 4WN9B 1HV8A 4PAQA 1KH1A 1M1YB 1LSUA 3BJRA 3LBHA 3PUIA 4K28A 3VR6D 4J3JA 3K0KA 4R81A 4XE5A 1H9CA 4D43A 2CMDA 1Z4PX 1M7GA 2QS9A 3AWDA 1SUBA 3ENWA 1RE1A 3SSMA 3ZI4A 3VNBA 4CLDA 1PFQA 1I7PA 4KJZA 5CDHA 4PYJA 3IR7A 2D1YA 4AN4A 2VLBA 8LDHA 5HXAA 4EDHA 4YMIA 4EKEA 2C03A 4OHZA 4RMJA 3QUCA 4UAVA 3RRZA 3ZTTA 2YBEA 3MTGA 1PJ8A 5EXXA 4U7TB 1E1NA 3JVDA 4MYCA 4BNDB 1ZXBA 3O3CA 3T7RA 3A3NA 4CMEA 3N6RA 4JJ6A 5KSPA 2GZAA 1T4BA 2VDVE 1SBHA 3EIFA 4BLUA 1DAGA 1B76A 2XSZA 3I92A 2Z95A 2C5FA 3QVXA 3TSOA 3F4LA 4ZV9A 1AC5A 1L3IA 1XA3A 2HRBA 5BN5B 3OUZA 1KOLA 4IDDA 1MO2A 3RWOA 5A4JA 3TMAA 3MGAA 3EMVA 2P5YA 5FOUA 5JSZA 2OSBA 2WIDA 3NGLA 3RS5A 1CUFA 2B69A 3ECSA 2GYYA 3SBEA 4LDQA 2X7XA 4DMRA 2F8MA 4G1UC 4DDHA 4NQZA 2V7PA 1G8JA 2PKQP 5BWCA 1EB8A 3TQCA 2GRUA 3SBOA 1U99A 2FEOA 4RIIA 1CJMA 1PGJA 3H1FA 4MI9A 2WR8A 1NBHA 2VF4X 3A1CA 4WEQA 2XCTB 3HXMA 1NI3A 3GLIE 2NXEA 3RCBA 2R6ZA 4LC9A 4LXTA 3U44B 1Q1AA 1O97D 2GFIA 4QFDA 3WYGA 3ZGYA 5ARBA 2ZB2A 5A0FA 4L0DA 3LC7O 3I9LA 3KOMA 3WI7A 721PA 3J7AC 3ETJA 5E2AA 4F3TA 1N6KA 1UEJA 5EUQB 1E18A 2ZSIA 4MR9B 4DUYB 1SD1A 2AFHA 3O0TA 4BC1A 1VPLA 4UBNA 5EP4A 3ZQJA 2IU6A 1V9CA 2O6HA 3UWPA 1M0SA 5B12A 4I08A 2AFVA 4EFLA 2EL9A 3FROA 4IG9A 4WERA 4QT4A 1GITA 1DQNA 1PV2A 2PUVA 2IPLA 2PV7A 4I9NA 3ESCA 1E1LA 4BGDA 1E79A 5L3SA 4MW0A 2NU7A 4NYIQ 2Q2OA 4PAGA 4FGWA 1PR9A 5IULC 4ZOBA 1HI9A 3K1AB 3AI7A 1E8MA 1GTZA 4X8HA 4XM2A 3OESA 3WHIA 1NVBA 1B0ZA 5JV5A 2E5WA 1XDGA 3M2TA 5HKKA 1O6GA 3LPNA 1OASA 1V71A 3E22B 4W5WA 3S27A 1K08A 3WLTA 1VJGA 1NE2A 4TSFA 1MRZA 1K8XB 1Y1SA 5DK6A 4CV2A 3OTWA 4ZCIA 4YCLA 5KNCD 4RGVA 1FNSA 2Z1DA 2Z8XA 3I5YA 1KOGA 2OZEA 2Z08A 1Y48E 1IZ9A 4XYBA 4CN9A 4LGCA 1E9EA 2AXEA 2BZ1A 2CNLA 4M22A 4Q4HA 4UBKA 3TQIA 4CFSA 3K6SB 4QATA 1MOSA 3MWJA 4H7JA 4LNUB 2CYCA 1DJNA 3DBLA 3RQIA 4F12A 3ZN2A 5IU6A 3DD5A 3G13A 4KVGA 2AFIB 2R68A 3VVCA 4CF3A 3VHLB 4DCCA 1YMUA 4XIFA 5E1OA 2CD7A 5AW9A 5HDQA 2PZJA 3C98A 5JATA 5LZ9A 3CRRA 4LJ4A 2XITA 4QHTA 3BWVA 2X0NA 3TZCA 2QLMA 3WAKA 4CCAA 1ADCA 1UZMA 2GX6A 2PMBA 2QOEA 2FYTA 1H4TA 2XCOA 3VVLA 4AMBA 3WNVA 4ZTZB 4D3ZA 3FPJA 3ZZ1A 1TC2A 2W6JA 1JKJA 4Z4GA 1R3UA 1ZEJA 3OOWA 4PIMA 1H6DA 3MFYA 4ZO9A 2PXCA 3GUCA 1SIBE 1LLDA 2CWDA 2E0IA 2IYVA 3SSNA 5BQ3A 4GKAA 1G0NA 1NQUA 4A03A 4LW8A 2VCHA 3P9NA 3ZXYA 4YT8A 5FI5A 4MYRA 4KR7A 3OIUA 4JN6B 3OTQA 1Q95A 3EGXB 4Q7EA 4DG9A 4QYTA 1TOAA 4DCPA 1H3FA 3FWPA 4Q01A 1OKKD 3U4AA 3VPBA 3A4TA 1UR5A 3NTLA 4BO8A 4IQGA 2H1VA 4JI3B 2H92A 2OFWA 4QGBA 2YHIA 1SK8A 4HDMA 2HRDA 2P2YA 3AINA 2QB5A 2H5LA 4PQEA 1OIVA 5JAMA 5KHLB 4AG3A 3L93A 1A04A 5EQDA 2RG1A 4K9QA 1DT3A 2P4SA 1UBLS 2A1TR 5TQ0A 1ZNWA 2X23A 1JIKA 1V1JA 1MBZA 2H4XA 2H08A 3ZWNA 4OKSA 2NWQA 1QDEA 3JQAA 3SZLA 3FI9A 3HP1A 1KU6A 4IVRA 1RYZA 3PC3A 3TZEA 1AMUA 1JKXA 1L4MA 5EE1A 1G2OA 4RDHA 3A0UA 4C76A 4E31A 1Z6TA 1Q92A 3JATA 1W19A 2C8JA 4ZREA 5GWXA 3WYAA 3VKGA 5YASA 2RDMA 3O9MA 4MW4A 1KEEB 1XMXA 1L4KA 4TSRA 4UXJA 5KI6A 5GONF 3RVOA 1B0PA 2R8EA 1TL7C 2ZITA 3DB1A 3CZRA 3NRBA 3G2JA 2WTEA 3DLTA 3K9CA 1WUKS 4I8IA 1SBTA 1E7RA 4Q39A 2DWCA 1N78A 3OOSA 2P27A 2EKDA 1Z4MA 3BD7A 4K26A 3T0IA 3WX0A 4M1YA 1HSZA 4I5IA 2OQIA 2RARA 3PYXA 2WD8A 1P29A 4X45A 1YGPA 3E9EA 3IEIA 1E9CA 1LVGA 4INAA 1SBYA 1T2EA 1IDOA 2IPNA 3KZCA 3PWTA 4JDPA 2JCYA 3SVTA 3A28A 4ZARA 3K8ZA 1BWSA 2F8TA 1UM9A 4QGAA 3GWZA 3OUUA 1VMKA 4L4UA 1V48A 3I6QA 1SVOA 2X3UA 3O92A 1D9XA 1Z2AA 2BMFA 2YICA 1WUYA 2VP3A 3BCSA 1T2DA 4A6DA 2DC1A 3RVQA 3AP3A 1E0AA 2VP4A 3J81A 2ZIXB 4KSCA 5DBOA 1YUBA 4MRAA 1OYVA 3KUKA 4OGKA 3HA5A 4M7RA 4DPKA 1DCTA 1N6IA 2XLCA 1ZZEA 3SP1A 3H99A 2SNIE 4OM8A 1Z75A 3VDXA 2PQ0A 1V3VA 2BW0A 1JSCA 1UMBA 6CHYA 1OE0A 1LF0A 2WU8A 2OYCA 3UAYA 1RYEA 2E1RA 4OGWA 3UWMA 3NWBA 3VX4A 4JBHA 1HNWB 2ZJ4A 4P4NA 3HB4X 4JT2A 1BNCA 4URHA 4DZZA 3QKSB 2I8CA 5MFZA 1K7CA 2R00C 4G81A 1QAMA 1BN7A 1YCFA 3BWEA 4LMAA 3CS3A 3EIOA 3O38A 4S2EA 1ZJJA 5JO9A 1P5HA 3R5SA 4JP3A 4PLTA 3ZWPA 1TGVA 2E2WA 3DONA 1GUDA 3T06B 1WM1A 1JA9A 5K9ZA 3Q87B 3U09A 2DG2A 3G79A 3BL5A 2V7WA 2HNAA 3SSOA 5DIZA 5AI9A 3N05A 4YCCA 2XWBF 1RFGE 3EA0A 1MB4A 3ZWKA 3SFVA 1PJTA 1QGED 3LQ1A 5BYAA 4QIHA 1E2UA 2NAPA 1P9RA 1UC8A 3KTFA 1HM5A 4C05A 4IMIB 1NHWA 1T9DA 2GHIA 4WZ6A 4EJMA 3GP5A 2RONA 2H1OA 4G8CA 3DC2A 4EENA 2JNWA 2XB6A 5DTRA 4F84A 4FW8A 1JHUA 1LA2A 3AGQA 2RI1A 3R24A 3A9WA 3VU9A 4EB8A 1LWOA 3EOAI 5IDQA 1X8LA 1F2VA 1WBJB 2HSJA 2A3NA 3TGPA 1P3DA 3OKCA 5IAKA 2GXUA 2N75A 4YP7A 4EKNB 2XW6A 4YRFA 2Q2VA 2IHNA 2FSVC 2QV7A 5C80A 1QGDA 2WLSA 4C1BA 1NAIA 1XZIA 1ZHFA 3BBPA 1LD3A 5FT9A 2C7OA 5EIHA 5JY6A 3QRWA 3EY9A 2I29A 3EZXA 1F2UB 1ZJ4A 5CR9A 2OVBA 4FR0A 4RFSB 3VU0A 3IIKA 1U3GA 3ZZUA 1IHPA 1GNSA 1YA6A 3SOZA 2J3LA 4NJEB 4A8TA 1MENA 3IYLW 2O2YA 3WK8A 3PQCA 3JWPA 1NVVQ 3PT9A 2V97A 3DLCA 2RHBA 3V4OA 1S9DA 3ZGNA 1CY4A 1X94A 3S70A 1KXZA 3OD1A 1NPDA 2QG6A 1BX3A 1X9GA 3A26A 2QD4A 3BQMB 4WEOA 3SC2B 5BN3B 4RULA 2GD1O 4R0NA 4OHMA 1VSTA 2ZRCA 1K5GA 1JLLA 3N53A 5KYKA 1N8KA 5BRNA 1G8PA 3KJZA 2YV4A 4IRXA 4O4HF 3DE4X 2Y1WA 4M8IA 2I2FA 5EE0A 5A3QA 1EKXA 2FEWB 3TFQA 4XVQA 3D2AA 3IB6A 1X7YB 2C2HA 2ES4A 1FFCA 3K1JA 1NVKA 1EIZA 2LKDA 3GJXC 1ADBA 2CE7A 4DIMA 4BO1A 2XB2A 4LRYA 4FGUA 5DSXA 4JENA 4EJFA 2VRCD 4Q15A 2ZM5A 2NGRA 1QPGA 3RB8A 3EZ6A 1HRDA 1NR7A 3UANA 3TGWA 4EIWA 5JALA 3QPDA 2IS2A 4OXRA 1Q2UA 1KZGB 1GQRA 1YBHA 3CX7A 1M6VB 3DEKA 5CHEA 2PGOA 5K0EA 2AJCA 1WZIA 4PIPA 4Z4CA 1C7IA 2PRIA 1KVTA 1QGUA 2JAWA 1IN8A 1RWOA 2O2XA 4M21A 3M0EA 3NGXA 3FSGD 4G0OA 3AI3A 4RJTA 3IDZA 2M32A 5JI3E 2YHBA 1DKMA 2DP4E 2QTMA 4QARA 1TM3E 3LDGA 4CNQA 4K05A 5EMKA 3LQQA 2WUVA 5DM1A 3KZNA 4JVOA 3JYLA 1Y42X 4BLTA 1INLA 2C20A 3GAZA 3HJGA 5E6SA 3ZDQA 5JD4A 3BREA 1V9SA 1R6TA 2XQIA 3VRHA 3I4FA 5FNVA 2OMEA 4BMYA 1NW5A 3NHKA 3EISA 4YV0A 3LP8A 2OLJA 4LJSA 2GB4A 4P3YA 5ALMA 4H3SA 2ZBGA 1O94D 4UU1A 1PYGA 5FHQA 3FCYA 5HQ3A 4XASA 1KEZA 5HFAA 3ONEA 3VZQA 3FR7A 3LFTA 5KCZA 1H2HA 5HIAA 2HDNB 2QF7A 4I6GA 1RACA 2W6OA 1XT6A 3BOSA 1DBSA 4K6OA 3WBKA 3PQFA 4E4YA 4M2LA 3PX3A 3WRWA 5KPDA 1BKDR 1YRBA 2QT1A 1E9RA 3AFGA 3CT4A 3LVQE 1KF0A 3PIIA 4F60A 1K5HA 3T1TA 4XWOA 1CERA 2GZ2A 2P9CA 3BXZA 4CLHA 4V0OA 3MTIA 1FL9A 1ZRNA 1OXTA 2HXSA 3KYDA 5A4FS 2BFNA 1U0HC 1YT5A 2FFBA 3QLEA 1VGVA 2PUBA 3HR7A 3M8KA 2HCBA 2XIQA 3CNOA 3NHPA 3EC7A 4JMLA 3LQKA 4O63O 4X0EA 4P7KA 2WSSD 3LY8A 5TMBA 2QW8A 1KDVA 4ECEA 2WBLC 4ZYYA 3HCEA 5F3WB 4JFRA 1CY7A 4ZXPA 1FXWA 1PWZA 1X1EA 3JW8A 4P5EA 3D8UA 1RYBA 2ICAA 2ZP1A 4U7DA 3DF7A 3EFOA 5B1DA 5KTTA 4LY0A 1Z3IX 2C82A 2WU4A 5CW2A 1DC3A 4CMCA 2F3SA 2QBYA 3DDOA 1W5FA 1PT8A 1EAMA 5ALQA 2UXBB 1VIMA 3M4JA 3Q7QA 1SCAA 4W8OA 3REOA 6ABPA 2DXIA 2XA1A 3O1IC 4FFSA 4AUMA 3HDYA 2WJ6A 5TPZD 2VP5A 2G63A 1IZ0A 3ANMA 5JYCA 2CK3A 2VYVD 2ZJ2A 4HB2A 3WDSA 4J0FA 1CIVA 5DPMA 4I46A 4Y9DA 1ZOSA 3ICVA 2BHSA 3QF4A 4ZYZA 3C3MA 4HXGA 1X7WB 4QNRA 5A6SB 3JQRA 1YB5A 1VLHA 3F6SA 2Y3IA 4EOGA 4S1NA 2ZJ6A 2EP7A 3EZNA 1L8QA 4KQ9A 2O8BA 1NUSA 1VC2A 4WXRA 1L5SA 2XDQB 1J0AA 4LWOA 1MT3A 2WUEA 5JYEA 3H1BA 1TJ3A 2IS1A 2DTXA 2BEWA 3DEAA 2JI9A 4OB8A 3G6KA 1XQ1A 1QZ3A 4GDFA 2ZR7A 3AVYA 3IDSA 3IAEA 3KXLA 3K8OE 5HYVA 3SQLA 1ZIYA 5FRDA 4FCVA 1ND6A 1SUSA 2EFJA 3TLCA 4RZXA 1YZGA 5C81A 3R6GA 4BJ1A 3INNA 3DDUA 2DBQA 3FPFA 3IAAA 5KTRA 2PXXA 4CDNA 1G5IA 1F4VA 3MT9A 4KG7A 1ZU5A 2OD9A 4LJ6A 5LDGA 3L7LA 2ZR9A 3L7DA 4WKBA 4BU1A 4GP6A 3NDJA 4U6SA 3C85A 4MW7A 3WYCA 3IAHA 4NFYA 1U2EA 2VJBA 1JLSA 1JNXX 3NTVA 5FA5A 1A9XA 3VOTA 3C70A 2X8AA 1P2SA 4FXPA 4Z4FA 2ORVA 2YINC 3KKOA 2IY7A 2WFLA 4LBZA 1K3FA 2PKXA 2CVOA 2HIAA 3ZWOA 2D1FA 3DP9A 2SCUA 3KSMA 4M0CA 5IT9A 1KY4A 2ZJFA 3QUSA 3OLVA 2WQ6A 3I1IA 4CQLA 1F8XA 2PQ2A 4H3KB 2ECQA 1EINA 3RJ5A 1B15A 3USCS 1JMKC 1OZHA 2AE2A 1JJ7A 2JFUA 1K7YA 2R11A 4JXZA 1XOIA 1Z6ZA 1PDVA 1LTHR 3RSOA 2MINA 4OHUA 5EG5A 2AFHE 4HD8A 4QTZA 2EHJA 5DWVA 4IQ8A 4B87A 4YJ2B 4YUYA 1KIAA 1ULAA 1ZYUA 2QG4A 4DDVA 1TKBA 3UCEA 4EF6A 2A0KA 3DO5A 3UWOA 1BQ4A 2XNHA 4RIFA 1GHTA 4HLNA 3B2NA 3V1LA 4EHHA 1E69A 4HH3C 1VL1A 3GJQA 4BNUA 3L07A 2D00A 3RUHA 4DUGD 5LLTA 3M7IA 3QITA 4P0QB 4MUGA 3O1HB 4Q4CA 1LBIA 3LBYA 2X1VA 3A3PA 1N92A 2HF7A 2FR8A 3JALB 4JVLA 1HE1C 4DIOA 3IKVA 4YLGA 2O20A 5LU8A 1DOHA 3RS7A 1RC1A 1BH2A 1CIPA 3DL7A 1EXVA 5HS6A 4F6LA 4M99A 3SJZA 4EVQA 1Z7WA 3DOJA 4PCAA 3LCJA 3DDCA 3S81A 3O4VA 4KE6A 4LWQA 2V4UA 3DFUA 2CXPA 2CVPA 2G17A 4ZANA 3ZG6A 3GLSA 4BFTA 5DULA 1ZH0A 5JSUA 1R5BA 1Y1PA 2W48A 4H59A 1RDFA 3MJ4A 1J7JA 4CTNA 1AHPA 2X9NA 1C0LA 2C5LA 2V7GA 4N3CA 2BKLA 1X86B 1XZBA 2GYWA 4GPIB 4TMTA 5JR3A 5JXGA 3AU9A 1UT5A 2TMDA 5FEMA 4R2XA 2FMKA 5H81A 4ZOEA 3UO8B 1YQQA 2PO5A 4RAOA 4IV5A 5AXDA 3CLUD 1F3LA 4LZAA 3DMTC 3P32A 1SH7A 3KLBA 4D26A 4F45A 2VUSA 3PFNA 3WKCA 5LLSA 2QLBA 1VMEA 1JRLA 2HPZA 1R27A 2HSWA 2IA5A 4QREA 4WGFA 2W2VA 1NTOA 3RADC 3OMLA 5BMVB 4WNAB 3ZBUA 5LZ7A 1LS6A 1H66A 2RGXA 4WNIA 1SC1A 5CLFA 4QEDA 1FLAA 3MTBA 1Q7EA 1SR8A 1QYWA 3EQ7A 1H5NA 1SRRA 1WW2A 4JAVC 5CA1A 1UKZA 2PPLA 2ZRIA 3P0IA 4G6ZA 4XWWA 4OPMA 4KXQA 1EWQA 3NP7A 4PGHA 4NFSA 4V24A 2XUQA 2BGWA 1J8DA 2RHWA 3ZHZA 3D1JA 1THGA 4RMHA 5ABPA 3A6PC 3QBVA 2OCBA 2C9YA 4UARA 3A9SA 1IWPB 2IXDA 3BQNB 4R1NA 3TAUA 3BEOA 5HMLA 3TD6A 1UADA 4KLZA 3WWEA 5BV8A 3DKRA 1WTCA 1GG9A 2LIVA 4I6JA 3FPEA 2P7IA 3D81A 1YRYE 1KKLA 2AT1A 2HMTA 3CN9A 3O8NA 4JELA 5KNBD 2I4TA 4ERNA 3BWBA 3DH0A 4M0KA 4QOIA 2FX3A 4L76A 4BIMA 4E5PA 2A9PA 4OK5A 4AS2A 4B83A 4QRHA 5JCZA 2JEOA 4EMSA 3O26A 3F3KA 5KYYA 3SHWA 2HADA 1ZN8A 4M54A 2A92A 1PJ3A 1GFIA 3RT9A 1DSSG 3JSXA 3GUHA 3M9WA 3QKWA 3IMKA 5DI3A 5BW6B 3X1XA 2P8SA 1IUKA 1CLUA 3EG5A 1FSSA 4G09A 1RXCA 4KOAA 4AY5A 2BT4A 2OHIA 3FBTA 2X1HA 3I45A 4QAJA 3I6YA 5JEDA 1N2IA 1PVDA 2OPHA 4KIJA 2P2DA 4IW3B 1TADA 1ESMA 2B8NA 4JLUA 4MTLA 5CK5A 4QA9A 4OSPA 1LDBA 1M2EA 2H2FA 3H9GA 4RENA 1FSPA 1W4AA 4LAFA 3L8EA 3QEJA 4QDTA 4BS9A 1KR2A 1CVIA 4I19A 3VPDA 5LIRA 5ILOA 2P7HA 1H5QA 3CG4A 1Z0DA 4O5OA 5JRDS 2WKSA 3A37A 1ES9A 1HKHA 2ZAMA 4Q93A 1DWQA 3BB1A 2WHPB 2P9FA 3PG5A 5HIJA 3T35A 3VMMA 1TJYA 4UULA 2DPXA 2I5PO 3WWPA 1DC6A 4OF4A 3TRHA 3D2BA 3ZD6A 2R751 1DQPA 2NQ8A 1NMSA 4P92A 4ODIA 3V8MA 2IUEA 1GNVA 1L7DA 5CM9C 4Z9FA 1NOIA 1TVKA 3U39A 2AZXA 2G9RA 3AZOA 4WFKA 4ZT3A 3E0QA 1M2FA 1P80A 2OXTA 2B34A 1KQOA 1I1HA 4PAMA 2WKWA 3SC3A 2WV9A 4JGIA 3URKA 3W2HA 1JFLA 5AFSA 3RVSA 1SQ5A 1E1RD 2QPTA 2TYSB 3SD7A 3DB2A 2RHRA 3JD3A 1V8DA 2HJVA 3MS7A 2A9VA 3RU7A 1JSLA 1WDKA 2BHTA 3NB0A 2PGIA 3UK6A 3UB3A 5EIAA 3E4CA 4Q03A 1BSVA 3ETHA 3FRHA 5CA0B 1QFSA 3JQCA 3H7AA 4IPTA 3V8PA 4JJZA 4DRXA 3HY4A 1C4WA 1QFYA 1QRDA 2QI9C 4EO9A 3A3OA 4ENWA 1AOXA 1H23A 1P0IA 1XEAA 3P2IA 2Y0CA 4G0QA 1DS6A 3I30X 2R7NA 5BY2A 2JGDA 2Q49A 4DVGA 2I65A 1YOVA 2W6NA 1KO8A 1VBNA 3KD3A 4UEQA 5LUAA 3AVUA 2C4NA 4DLZA 4JXXA 5CX1B 1A88A 3O1JC 4CL3A 4B34A 3AP1A 4GOMD 1ZQ1A 4MQMA 3DAFA 2QTZA 4Y9TA 4C0WA 2YOFA 5K5EA 1J25A 2BFAA 4L07A 4DQLA 3FPBA 3IH5A 2H9YA 4IOJA 1UDXA 4ZJYA 4WFQA 1P72A 3H84A 4IMPA 4CPDA 3RAPR 1NURA 4E94A 3IE1A 3U7GA 3SHOA 1ZRSA 4E7OA 2RGCA 4EPTA 1H8ED 1SU6A 3G9TA 1FXUA 1F9EA 2MR5A 5F12A 1GPBA 3I61A 1ZBQA 3INYA 3KOWA 2W2KB 1BXRB 4YGXB 2X86A 5JUWA 2EW2A 3TTSA 5KMGB 3N70A 3GROA 1RC0A 3UBTA 1XNQB 5JE8A 4Q9NA 5LXTA 1XU9A 1PEAA 2HXYA 2XBUA 2HMWA 3GV0A 4JDUA 1M2JA 5H7XA 3PITA 2OBLA 1AH2A 1WXEA 2V5VA 5F77A 4WXYB 1XCGB 5CVUA 5F9FA 2JK0A 3ZCVA 2LZ0A 1P9OA 3TPFA 5CD1A 1L5RA 3PZRA 4HDCA 4Z9AA 1N6LA 3ASZA 3VYTB 1E5VA 2ATEA 4L0CA 3V46A 2DHCA 4E1VA 2QM0A 2V1XA 5CT4A 1JI0A 2RHLA 3TK1A 3WIBA 1LKZA 1EHYA 4FVTA 3WGYA 1KEWA 3G1WA 5EIBD 5LMCA 1WPGA 1Q57A 3G49A 4NOMA 3G0DA 1Y5NA 4HPWA 1FUIA 4BV9A 3QKTA 2ZIUB 1EJ2A 4IDBA 1B74A 2JS7A 2FPPB 3Q85A 1IZ7A 2VUTA 4U3JA 1RLTA 3CMMA 4WV3A 2OE2A 1TF2A 3JSAA 1WG8A 3K30A 5HKBA 1RTKA 1CY8A 2WT9A 2PD6A 2C9OA 1I3NA 3LUAA 3O4RA 5ALOA 2JH3A 3DTVB 3V1YA 1T0JB 2B30A 3AL3A 3M83A 4BVKA 4IH9A 3JQQA 2EP5A 1RZVA 2R00A 1HDCA 1VG0B 1PFUA 3E2PA 2UUPA 3C3EA 3ER6A 3I3SR 3OEHD 4LZWA 4RPCA 1FMLA 2HNBA 4DVJA 1AMNA 3TFWA 5CFOA 1D7OA 3EXEA 2HM7A 1RJ9B 3Q10A 3CXRA 3ENQA 3OQVA 1YI1A 4CRWB 5E7MA 3TL2A 5JFGA 2Q46A 5A1JA 1NONA 2QSYA 1QKJA 3KR1A 2ZYAA 1QAQA 3OQJA 4UMVA 2BF7A 2HO5A 2X2FA 2A0YA 3JV7A 4FYKA 1VM6A 1P9WA 2CXRA 1DJQA 2C61A 3LSYA 4G5SA 3N2GB 3UN1A 4AJIA 5JBNA 3FIUA 1SVUA 1JIXA 2WZQA 2ZCVA 1BTOA 1UKEA 4LJ7A 1AB6A 3WGLA 1BE0A 1HDZA 3DV0B 5TT0A 1R37A 4B3RB 3SR0A 5LU9A 1RZ3A 3HJTA 3BMCA 3HVIA 1JILA 1YRHA 1BMTA 3WZ2A 1ZGJA 3HB7A 4ZI3A 4QUJA 2F4VB 3N2NA 2XNDA 3DCNA 4PZYA 4L4RA 2VDJA 5H1YA 3W2IA 4ADSG 2N3ZA 1K6EA 1KO5A 2GM5A 2Q3HA 2IL1A 3OLCX 4JROA 4RVGA 1Q50A 5A5VA 2FSVA 3JWEA 2WJ4A 1IOWA 1U7UA 4H35A 4C4OA 1CY0A 3D0KA 3TJMA 1VKZA 3Q12A 4UHHA 5KAMA 1AHHA 4RUKA 3V8RA 5DN6D 1QZZA 4PVDA 4UREA 5TARA 3OM9A 3HL0A 4HN9A 1P4RA 2NVUB 5FL7A 1J8MF 1UJ2A 1U65A 3P9SA 4MICA 2BKUA 3FVVA 4R40A 5IP5A 4DWOA 4P3PA 4X1IB 4HSGA 5EWMA 4AZ3B 1ICIA 2LWIA 1XMIA 4MQFB 3DOUA 1JU4A 2RH5A 2ZVPX 3IP3A 4Z86A 1D4AA 1W5BA 3TG8A 4V2UA 3IAFA 3OC6A 2X41A 3PNMA 1QBKC 4N48A 1L6IA 2F1OA 3MXTA 4OBWA 5G41A 3ECCA 3EGVA 1GCOA 4ILEA 4R3NA 3BFXA 3S1AB 3T7SA 2JANA 4DILA 4LDZA 2H11A 1A9PA 3TD2A 2XUGA 1TMKA 4BVBA 2P9EA 2AYYA 2R86A 1QNFA 3V4ZA 1OAOC 4HWKA 1KP2A 3ANTA 4FCWA 1U02A 4D98A 3JQ9C