2O7RA

Plant carboxylesterase aecxe1 from actinidia eriantha with acyl adduct
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
311
structure length
307
Chain Sequence
LLKYLPIVLNPDRTITRPIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNSAKLPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDAMEALQWIKDSRDEWLTNFADFSNCFIMGESAGGNIAYHAGLRAAAVADELLPLKIKGLVLDEPGFGGSKRTGSELRLANDSRLPTFVLDLIWELSLPMGADRDHEYCNPTPLYSFDKIRSLGWRVMVVGCHGDPMIDRQMELAERLEKKGVDVVAQFDVGGYHAVKLEDPEKAKQFFVILKKFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CXE carboxylesterase
publication title High-Resolution Crystal Structure of Plant Carboxylesterase AeCXE1, from Actinidia eriantha, and Its Complex with a High-Affinity Inhibitor Paraoxon.
pubmed doi rcsb
source organism Actinidia eriantha
molecule tags Hydrolase
total genus 110
structure length 307
sequence length 311
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2o7rA00
2AJ8A 3W05A 2ACKA 3DLTA 2CKMA 3E0XA 3QMMA 1MO2A 3C8HA 5K3AA 3WKEA 1U8EA 1DX6A 3WWCA 4BTVA 3DKKA 5CT4A 4AQDA 2ECFA 1JMKC 3DDUA 1UK7A 1P0PA 4A16A 4Y9SA 5C8VA 2WTMA 3AINA 2PL5A 1UK6A 2R11A 3QITA 4G5XA 1EB9A 4UBIA 4YPVA 5JZ9A 5DJ5A 2XMSA 5C81A 4MQLA 2WJ6A 4S0XA 6YASA 3F67A 4LHEA 2P8SA 4ZWNA 4X93A 5AI9A 5AHXA 1EVEA 2OG1A 2PKYX 1NU6A 5IVIA 2JGLA 1THGA 3S8YA 3O4HA 2GYWA 2ZYHA 4CCWA 4X90A 2OAEA 5AKJA 4QDTA 3NOXA 3RM3A 4AO6A 2C5GA 1DU4A 4QDZA 5HFAA 5AJHA 1CUBA 5CTAA 4QWWA 4G8CA 3SX4A 1E89A 1FFAA 2BUAA 3ESAA 4F5ZA 2RIPA 4GBGA 3UUFA 5DNWA 3NUZA 4LKOA 1G42A 5BWBA 2D0DA 1J1IA 3WJ1A 1SC9A 3OM8A 3C6XA 4Y2TA 4EY8A 1GPLA 3AUKA 1ODTC 2PU7A 3HZOA 4ZV7A 1ZD3A 1OXMA 2CB9A 4EBBA 1BN7A 2Z8ZA 4JYPA 1WB6A 5BWCA 3HC7A 4E15A 3W2TA 3K2IA 4MJ3A 3V1KA 3V9AA 5AKZA 2WIDA 5AIAA 5HKAA 1T4MA 2EDAA 5AM5A 2WG1A 3DJYA 2JGMA 2Q0XA 3D5EA 4DTCA 3O4IA 1E66A 2QOEA 4X91A 4H0CA 1Y7IA 5AKGA 2PVSA 4UFOA 4C89A 1XZKA 5T4HA 2WG0A 2PSHA 2HDWA 3DKRA 2OXEA 5A71A 4QA9A 1FSSA 5HFNA 1A8QA 4FLEA 4RNCA 1XZBA 2BUCA 5SYMA 5LZ7A 4L72A 4GECA 4B82A 1QIFA 3PFCA 3D0KA 3T52A 5D3ZA 2FUKA 3G9UA 5CXXA 3C6YA 1MAAA 2OGTA 1USWA 1HBJA 4UBOA 3D2CA 4QLOA 5CMLA 4IH1A 3ZLUA 1LPMA 4KAFA 2WHPB 4KRXA 1EDBA 2BGNA 3KWFA 5K5EA 5AM3A 2PUJA 4UPDA 5K3FB 2V9ZA 4Q05A 1XZLA 2ZYRA 5AM2A 1QIEA 1EVQA 5C7YA 5AKEA 4K5QA 1AGYA 2HA3A 1F0PA 3O95A 2BAGA 3BF7A 1TK3A 3A70A 3DL7A 3EIOA 4FBLA 4E46A 2GBCA 3V48A 4IH4A 2I03A 1LPOA 2B9VA 2OCGA 1BEZA 2VJAA 2QUBA 1BU8A 5HK8A 2Y6VA 1MN6A 5AOCA 5A7FA 3WL7A 1VE6A 4J0DA 1N5RA 4B0PA 4G1FA 2YASA 1YCDA 5JAPA 5ALFA 3RKSA 1NX9A 3WKAA 5ALOA 3PFBA 2WKWA 1VXRA 5EGNA 3QM1A 4AMYA 3DYVA 4AB1A 1UK9A 4G8DA 2Z8XA 4OYLA 5BV7A 1J07A 3PUIA 4X71A 5LZ5A 3DQZA 4F60A 4ARBA 3G0GA 5CXUA 4BCDA 1GGVA 2DCMA 2WHQA 2JGJA 4FOLA 5HZGA 2BCEA 4OB6A 1CPYA 1W75A 2WHPA 3M82A 4WFJA 3YASA 3BE8A 2WUDA 4UFNA 1CUXA 3H18A 2PU5A 5AK4A 4KJXA 2ZJ7A 4H7HA 3V1LA 2UZ0A 2WFLB 1Y37A 4ZV9A 2X5XA 4ARAA 5AK5A 4LIPD 4UHCA 5D6OA 3D2BA 4H7IA 3O4GA 4LYDA 3WK9A 4TGLA 3FBWA 4N8EA 4WJLA 3PICA 4RGYA 4MWTA 4MEBA 4N5IX 5CW2A 5CRIA 3BJMA 2IITA 4XWGA 4B6GA 4W1RA 4U2BA 4P08A 3DOIA 1XRNA 1ZI9A 5FPPA 1JMYA 4BVKA 2OCLA 3AIMA 3QMVA 1YS1X 4ITVA 1ZI8A 1ACLA 2XUQA 2I3ZA 3ZLTA 5ALGA 3ED1A 2OCKA 1F6WA 3UMJA 1XZHA 3IVMA 2QVBA 3GBSA 3H2GA 4UBKA 4UHBA 5A7HA 4YK7A 5EIAA 1BE0A 1CUHA 1Q0RA 1DWOA 4DNOA 2PX6A 4CCYB 5CH5A 1THTA 2ZYIA 4HRXA 4RE6A 1HQDA 4B0OA 4DLNA 2JEYA 4EZIA 3BIXA 5HF5A 4F21A 2DHCA 3NGMA 4PSUA 5A7GA 2OPHA 1UKCA 4H7KA 2G5PA 4DGQA 3D59A 4IHAA 2JGKA 2D5LA 1BCRA 3E3AA 5DWDA 1DT5A 5FOQA 3AZQA 2QJWA 4L3WA 1JKMA 2WJ3A 2CBGA 5E4TA 1TRHA 4Q1VA 4ZRDA 4AO8A 1UOQA 1VE7A 1XKLA 1X2BA 2WFZA 3F96A 1CR6A 1A8SA 5DNUA 4KE8A 1XLWA 2R8BA 1AZWA 3WK4A 3F8SA 3B3QA 1UFOA 2VT6A 4L0CA 2WU4A 2BUBA 4C6HA 4LXGA 1CUFA 3LCRA 1XZGA 1TQHA 1ETHA 1VXOA 3FYTA 3VKFA 2XQFA 2BJHA 4TVKA 3RK4A 3C70A 3GA7A 3FCYA 4NZZA 3L1IA 4J0IA 3WL5A 3I2JA 4NMWA 1CUIA 4QDXA 2PPLA 4DMCA 3WWOA 2HA7A 5AP9A 1MX9A 3IUQA 2YYSA 4H35A 1HDEA 4DSZA 2CMFA 1CIJA 5ALKA 1LBTA 2AJLI 1QLWA 5FXMA 4J7AA 3I2FA 1W76A 1WOMA 1XRQA 2QUAA 3WA6A 1A88A 1XZCA 4F0JA 4N8SA 4OB8A 3DNMA 4PV7A 3ZV7A 2Y1KA 3L1HA 3H2HA 1VZ2A 3MVEA 4FLMA 1TCCA 3FWHA 3WWPA 5IVKA 1EX9A 4OYYA 1C7IA 5K3DA 2HA6A 2XDWA 4JUIA 4G4GA 1LPNA 1VA4A 4EUSA 3G0CA 4MYDA 2AXEA 2XUAA 4AZ0A 2ES4A 1UKBA 3C5VA 4W9RA 4AXBA 2RGUA 3ESDA 3WI7A 1QFMA 3TGLA 1ZGCA 3HEAA 4FTWA 5JZBA 5CT5A 2J3QA 2VJBA 3ANSA 3FVRA 3HRHA 4G9EA 5JYCA 4K6HA 3X3HA 2QRUA 4BP9A 4HXEB 4MXDA 4H18A 3P2MA 2WG2A 1JJFA 5AKHA 1CUWA 3FLBA 5DYWA 1EDDA 4UBLA 5DLPA 3ZWQA 1CUSA 2RONA 3EBLA 4KE9A 1W4LA 1CV2A 2WIKA 4QE3A 1QFSA 1BEEA 2C4HA 4Y2YA 1MNQA 2AJCA 3CCCA 2QKYA 3PUHA 3U0VA 3H1AA 3H2KA 3TEJA 5DYYA 5A6VA 1YB6A 3ILSA 1WPRA 2XUJA 3W04A 4ROTA 4PSDA 4FKBA 3FYUA 4OUKX 4X6YA 4PF1A 1CUCA 3O0DA 4IO0A 3V1MA 2OGSA 4U2CA 2B4KA 4BRSA 1N5MA 1YAHA 2XE4A 5EFZA 3DD5A 3HI4A 4IH9A 1LGYA 4BE4A 3S2ZA 3A2NA 2QXTA 5YASA 3I1IA 1QIDA 5CT8A 4DMKA 1D07A 4JEIA 1CFJA 4BATA 2DR0A 4Y2VA 1UZAA 2AJDA 1G5FA 4LXIA 2VEOA 5EHXA 3IUNA 4HRYA 1EB8A 5KWJA 1FFEA 1L7AA 4HVTA 4NS4A 3C5WP 3D3NA 5AK6A 4UHDA 1UT6A 1QE3A 2ROQA 1SCIA 4UUQA 2HU7A 1ODSA 5LZ9A 1M33A 2XUOA 4OD0A 4W1QA 2XLBA 4ZREA 1EH5A 5LKAA 1QZ3A 4EY7A 2XUGA 2XLCA 3STTA 4DIUA 3IBTA 5ISMA 2C0QA 1AX9A 2H1IA 3M81A 2PBLA 4M0EA 1EK2A 1QTRA 1N1MA 1XZDA 5AH0A 4C87A 3H2IA 1CUUA 3G8YA 4JNCA 3I6YA 2JBWA 1PV1A 3PF9A 2VA9A 3AIOA 4LYEA 2PSDA 2OGZA 3WQHA 4FWBA 3KWJA 3G02A 2XQGA 5HF8A 1AUOA 3R40A 4WCVA 3B5EA 2HU8A 4UBNA 4TPKA 4QWMA 2QTBA 1QGED 2QR5A 3C45A 5E2IA 5HK9A 1YSCA 3WKBA 1DWPA 2CUTA 2VTVA 2W6CX 3BL8A 2HA2A 4E14A 4O08A 1XZJA 1MX1A 4PNZA 1KU6A 4INZA 5ALNA 4X6UA 2WUEA 5AICA 3OTQA 4J0GA 3LP5A 5E4JA 2IIVA 2XUHA 1UKAA 5JZSA 4Y7DA 1MAHA 2ZVDA 4CIAA 4XVCA 1ZOIA 5FRDA 1MNAA 4QLAA 3JWEA 3KSRA 3R3XA 4GEGA 3R3UA 3U1TA 3HXKA 5FPQA 1QIJA 1XROA 4H7FA 4BBZA 1EA5A 1DINA 3L1JA 1XQVA 3ICWA 5AIBA 1W6RA 1SCQA 3VISA 5CH8A 1R50A 2XMDA 3G0BA 3CCBA 4W63A 5ALJA 3SWWA 4X92A 2VJCA 4G4IA 1H23A 2GZSA 3FSGA 2HU5A 3WYDA 5I9IA 2ORYA 3WL8A 1IUPA 3T4UA 3NWOA 2H7CA 2OQIA 1MTZA 4KAJA 2XI4A 5LLSA 4YX9A 4W1SA 4BC1A 1XRMA 3E1GA 1PFQA 1SCKA 3HSSA 2HFJA 3DYIA 1SOMA 2ZJ6A 1ISPA 1TIBA 5BOVA 1R4ZA 1LBSA 1VJ5A 4DM7A 5IVHA 1YAJA 3STVA 4DNPA 4Y2JA 1WB5A 2HADA 1YA8A 5T4BA 4H7JA 3VDXA 2RHTA 4Q3LA 4PW0A 1P0QA 3WKCA 4Y2RA 2GYVA 4P93A 3QMWA 4Z49A 2H7YA 3C8DA 5JD4A 1XZAA 4XJVA 1R1DA 5FLKA 1MPXA 3OG9A 4CG3A 3Q8WA 3R3YA 2H7XA 1LLFA 2K2QB 1P0IA 4DNFA 1BRTA 1VOTA 2QS9A 1CLEA 1PJAA 3UUEA 2VAVA 3WK6A 3A2MA 4WDRA 4J0JA 4BAGA 2XQIA 4B83A 4JH0A 3PI6A 5ALRA 1U65A 4EHBA 4PSCA 3C43A 3H17A 3MUNA 3I1YA 4UHEA 3AJAA 3ZPXA 2GYUA 4QZVA 1L7QA 2XB6A 4DYHA 2HIHA 3RARA 1KEZA 4BVLA 1G66A 2HL6A 1E8DA 1CQZA 4DNQA 3I6MA 4GW3A 2GZRA 3DOHA 1EI9A 2OAGA 2XT0A 2OLEA 1TCAA 4CI9A 3RLIA 3C6ZA 5AI4A 3WWDA 4DSAA 2WUFA 3BWXA 5T4FA 4FBMA 2FJPA 4MYSA 4OCZA 3HACA 2QJRA 5JD5A 3I2IA 1K5PA 1J2EA 1QIMA 4KRYA 4UFPA 2V98A 1OILA 2V97A 4Y2PA 3QVMA 3BDVA 3E4DA 2OCIA 4KR0A 3QH4A 4BC0A 5CT6A 1FFDA 1A8UA 3KXPA 3O4JA 4C4ZA 3LS2A 1XZEA 4D9JA 1R9NA 4HZGA 1XKTA 5ALTA 5JAUA 1IUNA 1LPBB 5AI0A 4EY6A 5FUMA 3CXUA 5C8XA 1P0MA 1HLGA 2XUKA 3FCXA 2PM8A 4QEKA 4X85A 2Y2UA 4EY5A 3IB3A 4Q3OA 1NU8A 2EEPA 4U2DA 1GQRA 3WWEA 1EXWA 4BRZA 1XRRA 4U2GA 4P92A 5AI5A 1XZMA 2DSNA 3PDCA 1X2EA 5IVDA 3ESCA 3N2ZB 3GELA 2PSEA 4HXGA 3N0TA 4NVRA 4V2IA 5ALHA 2JIDA 2JEZA 1XLUA 4ZXFA 4BTLA 4BB0A 1Q0ZA 5DNVA 5HCUA 4CIBA 3HYSA 1WM1A 2WUGA 1CUYA 2I3DA 4FFVA 3DCNA 3VJMA 1ORWA 3GROA 3Q0TA 5ALQA 1XQXA 4MWSA 5JATA 4HS9A 1E5TA 4WFIA 2IX9A 2XUPA 1CUEA 1YASA 3FYUB 2WHRA 1VZ3A 5ALPA 3SK0A 3C87A 4BYMA 5AOBA 2JF0A 5KREA 4HXFB 2GBGA 3TJMA 1BROA 1JT2A 4BAZA 5AM1A 5CT9A 1DWQA 3F98A 1A7UA 3FVTA 2J3DA 2AJBA 1BCSA 3G0IA 1CQWA 2C5FA 4BAUA 5EHZA 3ANTA 1BS9A 1DTEA 1CUVA 1QOZA 2V96A 3LLCA 3R0VA 4BCCA 1OCEA 1CUGA 3BJRA 3QPDA 1H2WA 1YR2A 5AKXA 4WY8A 5AKIA 5LP1A 4X7BA 3OC0A 2C7BA 1EDEA 1QONA 2Z3ZA 3V1NA 3IUMA 2HHAA 1IMJA 2C58A 3W06A 3H2JA 4K6KA 3BXPA 2GBFA 3R3WA 2XQJA 3WIBA 5JALA 1Q83A 4X97A 5ALSA 5EIHA 1GKLA 3TRDA 3F9CA 4OU4A 3D2AA 3A6ZA 1IZ7A 1YB7A 3WK8A 3ICVA 4MQMA 5AM4A 2VF2A 3I2GA 1ZICA 2ONCA 4K6GA 4B84A 5I8PA 1W1IA 3SC2A 3K9BA 2VQ6A 3EF3A 1DX4A 4FLFA 2VATA 5ALIA 2H9YA 3R3VA 4B9EA 2WLSA 2B20A 1EK1A 3OPMA 3CN9A 1U4NA 3D4LA 5FKJA 1GT6A 5LIPA 1O6GA 2WTNA 4X3CA 5AI6A 2VAXA 1UOPA 4GI1A 5IKXA 2I78A 4FMPA 3AZOA 5HQ3A 1QIKA 1H2ZA 2X76A 1AURA 5ALZA 3LIPA 1S8OA 3PF8A 3GZJA 5EI5A 1XZFA 1MU0A 4OSEA 4Y2QA 3IIIA 1AQLA 4B7ZA 3VXKA 4Y2UA 3M3DA 2XMRA 1CUDA 2O2GA 3H19A 3QPCA 1TKRA 1JU4A 1QIGA 5FDFA 4JYMA 3KD2A 2WFMA 5AKKA 1RP1A 4GDMA 4AZ3A 2X8BA 3IDAA 5DTJA 2XUDA 4BZZA 5AOAA 3MUOA 1ZD4A 4GHWA 1QO7A 4Q3KA 4QDOA 5AKYA 4UHHA 3BDIA 2HRQA 4BP8A 3R3ZA 3VJLA 2DQZA 1K6EA 1Y7HA 1ZIYA 4H7DA 3EQ8A 5I7UA 5AI8A 3WZMA 1ORVA 1XRPA 1YS2X 4J0KA 1ODCA 2NW6A 3WZLA 3STXA 3FAKA 1VLQA 2OQVA 2WIJA 2WQZA 2RI6A 2WIFA 4G4JA 2WU3A 5J3JA 1XQYA 4U2FA 4WFKA 2O2HA 1ACJA 1IZ8A 3BIWA 5CBKA 5A62A 4LXHA 1R88A 1UWCA 1UOOA 2CZQA 1LPSA 5T4EA 2VJDA 5ALLA 3W9BA 1GXSA 4I4CA 5AKLA 1I6WA 1GPKA 3LIIA 4I19A 4RPCA 4Q82A 3VJKA 5EIEA 2CJPA 4EB0A 5ALMA 3QPAA 2CEKA 3IA2A 4H77A 3HABA 4OPMA 1O6FA 5HF6A 2EDCA 2G5TA 1JI3A 1LPPA 3R41A 4GLBA 3O9MA 3H04A 3QZUA 3FOBA 2BFNA 2WJ4A 5JASA 2Z5GA 5ALEA 1BN6A 2W22A 1VKHA 3HLKA 5K3EA 1WPXA 1MX5A 5FV4A 4G8BA 2XMQA 3VVLA 2PSJA 1CUAA 3B12A 1E3QA 2WIGA 3WA7A 5D7BA 3IUJA 1DQZA 5ALWA 1FFCA 1F8UA 1H22A 5KBYA 5D3KA 5JADA 3EQ7A 1ZD5A 2Y6UA 2XUFA 1AC5A 2WM2A 2XMCA 4HAIA 2HA4A 5SYNA 3G9XA 1JJBA 1JJIA 4KE6A 5JD6A 4DMFA 4FNMA 4OB7A 3I2KA 3I6ZA 5HKBA 3FLEA 2XUIA 5ALDA 4B9AA 1CEXA 2GBIA 5AO9A 4CFSA 2XMGA 2JGIA 4Y2XA 4YASA 4C01A 1RYYA 5AK3A 5LZ8A 4N5HX 3WMRA 2FX5A 1GZ7A 3AFIA 4N8DA 1J06A 4GXNA 3H0CA 1EINA 4CG2A 1U2EA 5EHQA 1FFBA 2XMZA 3JYHA 4AO7A 3OOSA 4ETWA 3AILA 4DMHA 4A23A 5E4YA 4AMZA 5LZ2A 4G9GA 4ZI5A 4BDSA 2HA0A 4BZWA 3PE6A 4P9NA 5K3FA 1WHTA 4MEAA 4L9AA 5IH7A 4E11A 2E3JA 1UK8A 4KEAA 1B41A 3G9TA 3QBJA 3G9ZA 1EHYA 2JGEA 2HA5A 4Q34A 4KE7A 4KYVA 4AN0A 5ALVA 1H2XA 2FJ0A 4UBMA 4U2EA 4EY4A 4H7EA 1LNSA 5K3CA 2QT9A 4UHFA 4HTAA 1DQYA 5DYTA 2DHDA 2G63A 3A2LA 4WDQA 1GKKA 3AZPA 2DQYA 4J0CA 5LZ4A 1K4YA 1IUOA 1LZKA 1JU3A 4M0MA 3EQ9A 1WCYA 4A5SA 4OU5A 3STWA 2PUHA 1UXOA 2Y2VA 4QNNA 1CUJA 4W1PA 1E8MA 4FFWA 5DTIA 7YASA 5CURA 1WB4A 3FLAA 4B80A 1Q84A 3IULA 2ZSHA 4C4XA 1QIHA 3DS8A 4X00A 2RAUA 2DFPA 1CUZA 4FNGA 3FYUC 3F97A 1H2YA 4UBJA 5JIBA 1W52X 1KU0A 2JGFA 3WKDA 1MT3A 2J4FA 4FDMA 2QXUA 2XMBA 3WK7A 3IURA 5JAOA 2O7VA 5A2GA 5C8ZA 4K2AA 3CN7A 2ZSIA 5JAHA 4PQEA 4J3JA 2BKLA 1ZIXA 1TAHA 2WFLA 2ZJFA 4GWLA 4IQ4A 4PO3X 1Z68A 4BDTA 2QMQA 5ALYA 2VT7A 3K6KA 3C6BA 1FJ2A 3W9UA 1AKNA 1ZD2P 2PSFA 1K8QA 3HJUA 3GFFA 1SFRA 2Z3WA 1ZJ4A 2O7RA 3WJ2A 4FHZA 5AM0A 2DHEA 4AX4A 5K3BA 1R3DA 2B61A 4CG1A 2WILA 1R9MA 4C4YA 4B81A 1DT3A 1QO9A 4M0FA 5H3HA 3WL6A 1B6GA 2LIPA 1QTIA 3ESBA 5CH3A 1TCBA 4BE9A 1AMNA 1XLVA 4WY5A 3ZLVA 5FP0A 1GQSA 3KDAA 1ZI6A 1L7RA 2HRRA 2J4CA 5EHNA 4QDUA 4BVJA 1WHSA 3STUA 4X95A 1HKHA 3I2HA 3M83A 4BCBA 5KWIA 3WYNA 4KAAA 1IVYA 4CCYA 1GPNA 1VA5A 3VVMA 1C7JA 3STYA 1E8NA 3QYJA 3JW8A 4J0HA 2ACEA 1N8SA 2HFKA 3FNBA 5ALUA 4Y2SA 5JANA 3WLAA 2YXPX 2RHWA 2ZYSA 1HL7A 1C4XA 5LYYA 1XZIA 3BF8A 1XRLA 2YH2A 1XFDA 2BGRA 1QIIA 4ZGBA 4X94A 3AIKA 5ESRA 1LPAB 4AN1A 3DEAA 4X6XA 4RE5A 1ZGBA 1LZLA 3FSGD 1ZJ5A 2WSLA 4B85A 5ALXA 1HPLA 1T2NA 4XX1A 2O2IA 2QM0A 2QZPA 4I3FA 1XQWA 1F0NA 4EA6A 1RWQA 3G0DA 1JFRA 3DL4A 2C0PA 1MJ5A 1G4HA 5HQ3B 4J03A 5LKRA 1X70A 2G4LA 3KOOA 3WIOA 1CVLA 2VSQA 5HF9A 3GUUA 3D7RA 3OURA 4KACA 4C88A 2HM7A 5F4ZA 3I28A 1CRLA 2XQKA 1YA4A 3O9VA 4XIIA 1QJ4A 3H1BA 5JARA 3ZI7A 3MGAA 1K63A 3WK5A 3G7NA
chains in the Genus database with same CATH superfamily
4WBNB 821PA 2PUWA 2VHTA 2AJ8A 3EWNA 2COEA 3MBIA 2J3KA 3HFJA 1KGSA 2ACKA 1KMCA 2X5KO 3NUQA 4LYGA 2XBLA 3DVLA 1MAUA 1NE2A 4QPPA 4TTPA 2IU0A 3IAAA 3QMMA 3TRKA 1MO2A 3F6RA 5KTNA 4OJYA 1IZ9A 4LXYA 1N5OX 3THYA 1IWBB 3RRNA 5LR6A 1XNJA 4B3DA 1BHQ1 1XDWA 4RLSA 5M34A 3RC9A 3C4VA 1JKXA 4P4SA 1YQXA 2GF2A 3JYLA 1NC1A 3MLAA 1VYVA 1Y3HA 2P9CA 3L05A 3PXXA 1KIAA 2GX6A 5DHPA 4K46A 4D9CA 5KO2A 2YFQA 4G6ZA 4O4IA 1KETA 2V1XA 4C4OA 1P0PA 4A16A 1W36B 2NOAA 5I5GA 2WTMA 3QVSA 3HBNA 4Y1GA 1O08A 2OXTA 4W82A 5ENZA 3QFCA 3HWSA 1MB2A 1PJSA 4ZVUA 521PA 1YS6A 3GAMA 3UY4A 2OL4A 3NMUF 4Q7MB 4IEEA 2QTVA 4UBIA 5IM4A 1CW2B 4YPVA 5JZ9A 4JGGA 1P9NA 2GHIA 3EZYA 4LDPA 4BQFA 1QRTA 2WQ6A 3P45A 1MV8A 3RBAA 3HTXA 1HDZA 2XHEA 1R4NA 2I99A 3BA1A 4X63A 1GR1A 3GZTB 3WLOA 5E8JA 1NWCA 3ZQ6A 2YVLA 1KY4A 3KKPA 1S3SA 4URUR 4Y18A 4ND4A 4IW3B 3BWVA 3CM0A 3A6EA 3TRHA 1RLUA 3BGOS 3CNOA 3HLTA 1M2OA 4F4UA 1SCDA 4WHMA 5AHKA 1GTL1 2GVDC 2VPTA 4X93A 4OKNA 4ZWNA 1KQNA 5JPDA 2MHCA 5BYBA 1SBIA 5C53B 2NZ2A 3NYIA 3CISA 1XZNA 2X41A 3NAGA 2GAFA 3FHCB 3MTAA 4JSRA 4YJGB 3VNRA 3WB1A 1AKYA 5L4NA 3GPIA 5LIRA 1Q74A 4UVDA 4FYXA 4DQLA 1GXSB 1QHYA 3TLBA 4DR5B 4WZBA 4QD3A 4P3KA 1U31A 1QZUA 5F2KA 3NS7A 1OFGA 1P7YA 3ADPA 1DEHA 3L6EA 4ZI2A 5KQRA 5KYGA 2OO7A 1KVSA 1RRKA 4E4TA 2E6UX 5T5QA 3B1KA 4X90A 2HQRA 1JKJA 3GN2A 1GPWB 3NOXA 5L3SB 4YMHA 2HV9A 3P9YA 4RXUA 1V1MA 1FB5A 1VIAA 4O02B 1V47A 2CK3A 4A0QA 5J9FA 4BVEA 3NP7A 3C41J 3F9RA 4QWWA 3KKEA 3WQRA 2D1SA 2BUAA 1AMUA 2D62A 3FDIA 3IQDB 5TF0A 2FKNA 4E7OA 3H2YA 3P2KA 1UFQA 1RLJA 2ZQYA 4AWAA 2J0SA 4GBGA 4B40A 1GKUB 4QPDA 1Z33A 5DNWA 3BH7A 3NUZA 1NYQA 1TZJA 3P9PA 4LKOA 2GKGA 4AKHA 4QXAA 2OP1A 3EN0A 5KYUA 1C9JA 1SC9A 3AF4A 3ZTTA 1RCFA 3BSYA 4R71A 2D1YA 4PYMA 4DA6A 1ODTC 3OFND 1RBMA 5A9TA 2PU7A 1OI2A 3IR5A 3Q72A 2MIIA 1ZJJA 7ABPA 2I29A 2ZUCA 5K0BA 3B53X 1SOAA 4OJTA 2Y1LA 1ZD3A 2BY4A 3OIYA 4YR7A 1FDOA 2UZ4A 1X1RA 2D1QA 1JKFA 2O52A 4EBBA 2Z8ZA 1FW6A 1ZN2A 1UBFA 4NSNA 1MAVA 3QUBA 4DCOA 4DBLC 4EMSA 1Y6GA 3BICA 3KR0A 2AOTB 5FJJA 4NABA 3TZQA 3P26A 1PDVA 1WMEA 4C0QC 2WIDA 1V4BA 3IBYA 2WRZA 1D04A 2XDQA 1KOLA 1A8IA 2Q1YA 2YR0A 3H5TA 4WN3A 2EDAA 4J4BA 4HX9A 2KMLA 2NPOA 4A91A 4Z4CA 3S99A 4AJOA 2LP4Y 3ROEA 3KAQA 2F6RA 2Q0XA 5D86A 4K9QA 3U9TA 4CQLA 2RARA 4HWPA 3DV2A 4MQFB 1VL1A 1WW3A 5EP1A 4DTCA 4C7OA 3V7YA 1SXJD 1ULTA 4CEHB 1MVOA 2R48A 5DNEA 1ISMA 4XTCS 3W4KA 2QOEA 1JIJA 3IKLA 4L75A 2WWIA 1W4BA 4E03A 2J8ZA 5AJUA 5DOZA 1U5CA 2QLJA 1FMTA 3ZHCA 2EGUA 5CNJA 1DL5A 1U3CA 1YJ5A 2E87A 4Q4AA 2PR7A 4C89A 1QS0B 1Z0AA 2BGKA 2N1MA 2LKCA 5D5PA 3JD1A 4NF2A 2P4QA 4LRWA 5T4HA 2WG0A 3KCNA 4KMOA 3U7GA 2HDWA 3MN1A 2OXEA 3HJBA 5J2UB 5A71A 3T9CA 4QA9A 2QVXX 5HFNA 4Y6GB 8GPBA 4JVNA 2V7PA 5B4VA 4FLEA 5M7EA 3AVPA 4RNCA 4GBJA 3JU3A 1Z2CA 1ZC4A 2BUCA 3CNNA 4H6XA 5SYMA 5BN3B 4KR3A 1S3GA 2HT1A 4UAGA 1I5EA 1WB9A 1PR3A 3I5MA 3TZHA 1WVGA 1U0TA 1E9CA 1F48A 2Z2IA 1U5AA 4ARZB 4B82A 4EVRA 3D0RA 5HCNA 4REQB 3T52A 1P19A 2P1RA 2C1ZA 4IZHA 2A7QA 5TC4A 1MLDA 2FUKA 3GRVA 3GXBA 1JA9A 3O5AA 3ZU6A 2HSGA 1V8DA 5CXXA 3C6YA 1MAAA 4NR0A 1N6KA 4BLVA 3GV0A 2L18A 3AHGA 1HBJA 1PJCA 2P3SA 5E1OA 3PT5A 4GI5A 1E1CB 1V8PA 1YZUA 3D2CA 2PEZA 3HP7A 3NHUA 4QLOA 4X20B 1DJOA 1ZYUA 3LF2A 1LPMA 2FG5A 2Z0MA 3OU6A 2CNNA 4MB0A 5E95A 3VZQA 4DPMA 1OVMA 2FFHA 1T9KA 3DLAA 2QLTA 5THQA 1P29A 2BGNA 2ZBFA 3LWDA 4FBGA 4G24A 4HSGA 4L5AA 5F2EA 3N8KA 3A0UA 3SM3A 3SEAA 1FMFA 2ARKA 2C83A 4M7OA 3LPDA 3RBVA 2RDMA 5K05A 4O4JF 3TPCA 5JSHA 3ZWAA 1XZLA 1BS2A 4RH0A 3IP8A 5IUNC 5AM2A 4MUGA 2W2QA 5AVOA 4B3CA 3A3OA 4LGYA 3I6QA 1P8JA 3EIXA 3GHHA 2BKAA 3JQ7A 1QX4A 4MWDA 3RO7A 4O63O 4EK9A 1QHIA 3ILXA 4HN4B 3JWHA 2CFRA 3MM4A 3SJAA 3GIWA 3TFOA 3D31A 4OOEA 3BF7A 3V4LA 2OBFA 2IY9A 1NW3A 4IIJA 2GVZC 3EIOA 2WWXA 5EZ6B 2CF5A 2CXNA 4ZU6X 4ZZIA 3HBAA 4E46A 3V48A 4PLPA 1MB9A 2Z5VA 3SEQA 2J85A 3E5HA 4GKKB 1B2LA 2Q2WA 4UEOA 1E5DA 3RRZA 1P0CA 1KDTA 3CKLA 3JYQA 1IB0A 2ZOSA 2OCGA 2QLMA 2GZ2A 4I14A 1SBHA 1GA6A 1AK9A 4U7TB 2ZYAA 3ZHTA 2W4IA 4OJKA 5AVRA 2Y6VA 1E4YA 1MN6A 3LUKA 4ZVSA 1A9SA 5F73A 5A7FA 4MVWA 3O8QB 1Q1NA 1E9EA 1TEHA 4BN0A 3UAZA 2C31A 1PJZA 4TS9A 1T2CA 2B78A 3E8SA 4ZOAA 3N53A 2F8MA 4X64B 3DGEC 1QYCA 2ZSBA 4HN9A 1G55A 3LI2A 2D5BA 1FDRA 3RKSA 5DM2A 5IAGA 3SBXA 3B6EA 2FCAA 2V7XA 3HNOA 4OI0A 5IANA 4CEIA 2VTEA 2GA9A 3HMQA 2BBWA 1ECLA 3ROXA 2E4VA 4BBJA 4ZVPA 4RTMA 2EP7A 4RVSA 1G3MA 1SY7A 4I6EA 3MQ2A 3QOXA 2G83A 1ZN8A 2XQVA 2Q5EA 3WYBA 5KTSA 3R7WA 2D1FA 4CLRA 3VM6A 1GLGA 4PU0A 3TM4A 4JASB 4RYLA 5GZ1A 1RI5A 4FYPA 1A2OA 3V34A 3CLUD 4TWRA 1UK9A 2C54A 2HOQA 5BW8A 1KVTA 3MWDA 5K6TA 4D6YA 4AS1A 3E9ZA 1I5OA 4YPOA 3TUJC 1CEQA 4DDMA 1YDWA 2BTOA 1P80A 1E32A 2HU2A 2IU3A 3DLIA 1GPDG 1P4HA 1Q7BA 4JBLA 3ET5A 3RS5A 2EL7A 1Z4KA 2H2WA 2I5PO 1GGVA 1HT3A 4KREA 3ZOKA 2OK8A 2WHQA 4TXJA 1QPBA 1LLQA 5B1DA 4FB5A 5BQ3A 5CFLA 3FRIA 2JGJA 5IN5A 2OMKA 5BV2P 5HZGA 2IYPA 2MYNA 1W75A 1IMOA 2W6OA 4ZDIA 1P4JA 5SY6A 3QKTA 2WHPA 3RC2A 4KXWA 2JBAA 1MC1A 3B6JA 5TQ2A 4DJAA 1AKUA 2PANA 2QP4A 2GJ4A 2VNSA 5G3ZA 2IZ6A 4ZGWA 2QE7A 3JR3A 2C4TA 5KJ6A 1PR4A 3EG9A 4LF8B 2ZJAA 2IZ0A 1CUXA 4ZCLA 5ED4A 4GYKA 4QRDA 5M3BA 1L4HA 4I55A 5EJMA 5E8RA 2Y05A 4ZIRB 2JIMA 4PWZA 2WEKA 4G07A 5KCZA 4OQMA 1YGYA 4L0DA 3HKBA 3K5HA 5IDYA 1N6HA 3H11A 1PZHA 2FU5C 2IV3A 1DDOA 1M83A 1VCIA 4FEGA 1D6MA 2WFLB 4TVBA 3P27A 4Y1EA 3MWYW 3WLRA 4OH7A 1YE5A 1ID8A 2AFIE 3KALA 1RKXA 3A9SA 3A25A 2WJAA 5B3KA 4QASA 1I36A 3H0KA 5G1OA 1DAEA 1EXNA 2P77A 3TW4A 3EZGA 4QGSA 1Z5WA 3ND8A 1PGPA 2CHVA 2J3MA 2PKQP 3Q1LA 5G2OA 3SKYA 3V6LA 4DOMA 3RRBA 3LF1A 3KBOA 5D6OA 2WMYA 2XODA 2I9KA 2C4VA 4W9NA 3GRZA 5C32A 1JAHA 3UAYA 1LBQA 4UUBA 2QBYA 5T64A 2QRZA 4EHNA 5I4KA 5IEJA 1S7GA 3W8RA 2CZCA 4N5IX 3TIFA 4OGFA 1HZJA 1RWXA 2JJYA 5CRIA 2O19A 5HVNA 1PTKA 3P9XA 2CVQA 3H3FA 4GI3A 3PUKA 5K4HA 4X8LA 2YQZA 4UD6A 1W2WB 4TTIA 1NJ1A 4B6GA 1GIAA 4EQ6A 2Y1CA 2BT4A 3RAEC 2XNKA 3NATA 3S28A 1GRVA 4RA6B 1WULS 3DOIA 3OSUA 3AG5A 3TLGA 2V55B 4OLAA 1L5VA 1ZI9A 3FUWA 5CDFE 1ZHFA 5FPPA 1K2WA 2IOHA 2OZKA 2OCLA 2NP7A 3AIMA 1QFYA 4ZAWA 3AY3A 4HQNA 3B6IA 4ITVA 3LA8A 3KL4A 4TLAA 4YV0A 2IOYA 1ISHA 1MHPA 4C0WA 4FSHA 3V80A 4NAVA 1AV6A 3JZAA 3AESA 4XQCA 3L4EA 4MTCA 3GFPA 2VXYA 4F8YA 3QEOA 4ND6A 3WICA 1Q0HA 1CQIB 2ZUWA 1BS1A 1SHLA 1WNTA 1XXHA 2NUTB 5CA0F 1ISGA 3IUSA 2NT4A 2DBRA 4RA9B 1GARA 1KZYC 1ZD9A 4Q7EA 1ZHHA 1ZXXA 2NG1A 4N3GA 4EI8A 1XZHA 2FV8A 3GJ0A 1P9LA 1KMHA 1N9KA 3H2GA 3IVMA 3QEJA 3VR0A 2YOFA 5BXQC 3KTAB 4MV8A 1UJNA 2JPDA 5CB4A 1Q3HA 1BE0A 1XDUA 2QN9A 1M66A 2RC5A 2UYQA 1DWOA 4D1YA 3FZNA 4AIIA 1Y0BA 2Q3HA 4N4AA 2N42A 4YCJA 5ERYA 2H1VA 2GEJA 4HPJB 4UVEA 3DFFA 4QOEA 5LQNA 3UUWA 1WZ2A 5HBGA 4U3JA 2ZYIA 1JFTA 1JDZA 3JTMA 4JOBA 3I39X 1OBOA 3MWJA 3BB4A 4QAJA 2FG7C 5EKTA 4D25A 4A1FA 4FOOA 1VCNA 4U00A 1IN1A 1B2RA 1U8AA 4O6VA 2OO5A 1UKEA 5FO1A 2B21A 2GHTA 1EX1A 2VJOA 3LX8A 4IKEA 3L6OO 1J56A 5CFNA 4O4HA 3B2NA 4N3AA 3F3SA 2YV4A 1OHHD 2YHIA 3BIXA 3L6RA 1T1IA 3QVJA 5FOSA 5BT9A 1Y89A 1Z36A 2X40A 3LDUA 4D3ZA 4EI7A 4PSUA 3T7KA 4QXQA 4HZUB 4UZSA 3T7RA 1UKCA 1F2VA 3NVMB 4MB2A 1YZHA 4PG4A 2QQ0A 1KQOA 1NASA 4IJ5A 1Z7YA 3BWEA 5I9LA 3DOUA 3JD3A 4M21A 1E96A 1GFSA 1T8TA 1GSOA 3AEUA 3CINA 2FDCA 3N9IA 4FGSA 4J1SA 5AHWA 3R9KA 5BMVA 1V3UA 4PYKA 1YQDA 3DT6A 2X4LA 1DT5A 3H1EA 3HN7A 2JFQA 2ZDGA 1ZCFA 2CV0A 2Q7DA 1YIDA 2R6GA 4B32A 2QAGB 2XEXA 4BJ1A 4RKFA 1TF5A 1OTHA 4PXSA 4JU8A 5G0SA 4PCUA 3GCZA 2I8AA 3LUPA 3GJTA 5E4TA 1IHDA 1W36D 1TMKA 4AO8A 1VE7A 4NBKA 3OLCX 4NY1A 3I0ZA 1XKLA 1CEEA 4KIFA 1Q1ZA 1DFIA 1MOSA 3WZ2A 3S2UA 1KJNA 1X2BA 2ODQA 2BFAA 1QH8B 4DABA 3ZS8A 5JRJA 1W5TA 1ECBA 3GEEA 5F9FA 1FC0A 3IQZA 1ZOSA 5EKUA 3BC1A 2QZSA 1RJEA 4FDVA 1OH5A 3CZPA 3AUUA 3I3SR 4JI7B 1GRCA 5HTKA 5KHLB 1II8B 2DZDA 2C9DA 3B1VA 1A97A 4G86A 4P80A 1Z37A 2R8BA 1OAOC 4MSUA 1NZDA 1OLOA 4R9SA 4B6QA 5BQXA 4V0SA 2ZRQA 4Y9RA 5JISA 4L0CA 4F7DA 4KHPB 1M8PA 3QNUA 4C6HA 1Z0JA 2VR1A 1LJ8A 1MGOA 1PEKE 4A82A 1NQVA 1J99A 2XNSA 3LV8A 1BOOA 1T24A 3C1UA 4Q93A 1TQHA 1VPVA 1ZR2A 1ZSNA 2BM8A 4L6IA 5DRTA 3R5KA 1TPZA 4L74A 3I9KA 3N70A 1SZJG 1KAOA 2PGJA 4L0QA 3GMIA 2XNDD 2R6HA 6REQB 1PSWA 1QU3A 4HOYA 3N05A 5AJXA 2QUIA 3G13A 3RSGA 2WA2A 3SDZA 3RK4A 1ZH4A 3CKMA 1O57A 2F43A 1C30B 3GA7A 3OAAA 4ITUA 4Z9FA 3JR7A 2O20A 3WL5A 4EG1A 4X6LA 4C76A 1ZONA 4NMWA 2HNAA 4EEKA 3TL6A 3UFXA 4JLJA 4B6PA 3SIWA 1F14A 2F1RA 2OBXA 2Q9BA 3HCOA 2PMCA 3FDZB 3RJMA 3NGLA 3KDPA 4BJ5A 1M0EA 1NJFA 3F7NA 2PPLA 3P5SA 4MNTA 1KVUA 2F3PA 5SV2A 5TE9A 4GLJA 5E1DA 2VYVA 3WWOA 3CPJB 4F4FA 2JA2A 3PTLA 3PWSA 4DLUA 3TTUA 2QTRA 5JXHA 3PD0A 5KAMA 5IKEA 1UBEA 5G40A 3T9BA 1ZZGA 5AP9A 4DA9A 1XK6A 3I8XA 2XNHA 3ZGXA 2LW7A 3HWRA 4ID3A 1YIOA 2O3UA 3JATB 2HMUA 4Q24A 3S0JA 1U6IA 4Y9DA 4R2LA 3QFRA 5KQPA 1ZEMA 3UHPA 3O2QB 8LDHA 3U7IA 4DSZA 4KWCA 2XKJE 2CJFA 2O5RA 4RADA 4TLEA 1E69A 3RC1A 4BO1A 1GCAA 2CMFA 2FVXA 3GUZA 3PLNA 1LBTA 1WMSA 4LV8B 5ALKA 4NH0A 5DV9A 4BASA 1NJ8A 2AJLI 3WIUA 1K7EB 4ROSA 1MOZA 2CVHA 3UZUA 4AMVA 3EASA 2RGNC 4UREA 4UNPA 2OV1A 3F7TA 3IIEA 1W76A 2MMCA 2HRZA 1THMA 4YJKA 1UWLA 1XRQA 4G1EB 5REQA 3TKYA 3V4PB 1DELA 1KJZA 2QUAA 3AKDA 1JVNA 3SD7A 3WA6A 2PL3A 2X2PA 3PCTA 3KBBA 4L9RA 4RF2A 3F90A 2AKYA 2BBTA 2AN5A 1Y1SA 2GRAA 2XJ4A 3JVUA 4FONA 2AEJA 1UT5A 4HDNB 4PV7A 4U7JA 4BKOA 2R8XA 5KI6A 2GAIA 4B5KA 2W90A 3Q8LA 1F5SA 1DLIA 2V7QA 3GLFE 1JIIA 1T9ZA 4H15A 2ECOA 3OU7A 5E6UA 3QWBA 1M1YE 3DOEA 1TCCA 4JU9A 2QQEA 3DL0A 5JO9A 2ZJ2A 4EO7A 3FWHA 3AVWA 1U11A 2JGRA 4R1UA 1EX9A 4ES6A 3ZUGA 5AW6A 3NWEA 2CMKA 1AU9A 1DP4A 2RAPA 2QL7A 3W3ZB 4KNWA 4LXXA 3U7QB 4ZCRA 1KZ4A 2G9RA 3KSBC 3KJFA 2ZSJA 1XAIA 1CS0A 2F17A 1S1CA 3BXFA 3PUYA 4I1UA 5I9MA 3OQOA 1N1EA 2CNWD 3OKPA 1P75A 1H2EA 2EW2A 2ZJ5A 4KLZA 1NFFA 1LQTA 1H85A 4XD2A 4V0QA 1KYIA 2B0CA 2CW5A 3U4IA 4P7JA 3NEJA 4MGKR 2IPXA 4NU6A 2G82A 3UT6A 3GOHA 4KVGA 4DV1B 4PFSA 3TGWA 1PU2A 3TQSA 1NKVA 4D99A 1YS4A 5IZCC 1UKBA 2VJPA 3C5VA 4L22A 1KFCB 2RGUA 2BHTA 2AZDA 4MW6A 4UUMA 2BLNA 4W9RA 5K20A 3FHJA 3NTQA 3TGLA 1XCBA 1SG0A 1Z2DA 2IYOA 2AA3A 2QTAA 3DC2A 1ESZA 1A9QA 2J3QA 2LRHA 3ANSA 3LT1A 1E5VA 4AD8A 3X3HA 5DCYA 4L2IA 2BSAA 3IMGA 2WMNB 3KLBA 2C5BA 2ATVA 2FWIA 3C4JA 3Q5GA 4HXEB 5DBGA 1T5BA 1XNGA 1YQGA 2O2SA 1OI4A 1SOWA 3D81A 5T3YA 4KOEC 2WB2A 5AR1A 2GTPA 2WG2A 3B38A 2GPJA 5CCEA 1KXJA 1T2VA 4C2TA 1RQLA 1A72A 2Y1OA 5AKHA 2J6IA 1OT3A 1QYVA 3OY7A 4IUYA 5DLPA 3ZWQA 2GN9A 4P53A 1CV2A 3ODGA 2WIKA 3PHIA 3RC8A 3QUQA 4QEDA 2QRMA 3G2NA 3HDHA 4GZ5A 4P4LA 1RQPA 5SZIA 4OSOA 4GMFA 3U19A 3QX7A 1MNQA 2AJCA 3CCCA 2QKYA 4RFLA 2ZJYA 1YF3A 2I67A 5L3QA 5A3VA 3ZDCA 1E60A 1WMDA 2G08A 5CLFA 3TEJA 2X8WA 1BXGB 1DAFA 3Q0EA 2C96A 1QVVA 4UQOA 4YAOA 5ARBA 4UQLA 4IV0A 1N1GA 3DBHA 4RPHA 5MN6A 1WPRA 3OWOA 3E84A 5JI3E 2GCIA 2QZ4A 4UTRA 1X77A 3L41A 1RADA 4D2IA 5IDVA 3BORA 3CVXA 1KPHA 4IRUB 1FZQA 3GLHA 1HYBA 2JIQA 4PVDA 1S3FA 4PF1A 5J40A 4CF6A 3IESA 3W78A 1TM5E 4H4DA 1QF9A 1G7TA 2XAUA 3D8BA 5GV8A 4U2CA 3U7JA 2B94A 1EIWA 4IDQA 2COKA 1N6IA 3JTEA 1MD9A 2C61A 3O8OB 1Q6YA 4MMZB 2XE4A 1QQTA 1EDOA 2WWFA 1ST3A 3K9NA 4ZVQA 4B4OA 3CPHA 4IH9A 1EG2A 2FMFA 2ZI4A 3HRIA 3DTNA 4KVFA 3IKMB 4G5OA 4TUYB 5AJYA 4YP9A 3VFDA 5KQGA 1R0KA 3JPYA 4AF6A 1E2JA 5ER9A 2Q5JA 1IULA 5EWMA 1NT4A 4JGBA 4LN1A 2PZJA 3KZ1E 1S2MA 3EZLA 3I23A 5BYJA 1RZUA 1QIDA 3QBDA 2HK6A 2ZJ8A 5HIJA 5ES4B 1EPUA 4PZYA 2JGDB 1SC1A 4JEIA 1CFJA 1W9HA 1Q11A 1XJQA 3UQYS 4BATA 4TV9B 4A8JC 4DDKA 4DVGA 4PZCA 2A5JA 1ZNYA 2G25A 2QLLA 1ZK0A 4HHEA 4XB1A 3ULKA 3GEHA 3WV4A 5EHXA 2O2DA 4L7VA 4ZOBA 5DW3A 2GCOA 5CVJA 4HRYA 2DYKA 5KWJA 5J58A 1YKSA 2HWKA 5EIOA 2JI6A 4NS4A 5IEBA 3U3JA 5B1YA 1C0PA 3D3NA 3EQ2A 3M4YA 4IKOA 4RHXA 5AK6A 2VQEB 4RKWA 1SURA 5D6NA 4ARCA 4I4TA 1Y9ZA 3DFMA 1K8RA 4L3OA 1Z5GA 1KI3A 2AOXA 2PAFA 4QPCA 4W1QA 4OD0A 2QZZA 4GYWA 2IIBA 3SHQA 4PZLA 3CLTC 2WWTA 4RESA 1L1EA 1FRNA 1OLUB 5LKAA 1IEWA 3RNOA 2YWCA 4ERXA 3FWYA 2F1KA 2WVJA 1WKCA 4Q9JA 4UU7A 3NHYA 4CQMB 3DD1A 2H1HA 3DBVO 2BGTA 2FW8A 4EPRA 3KQUA 1KI7A 2Z83A 3STTA 3ZK7A 4OM7A 3TK1A 4B71A 1ZXBA 5JV5A 4DARA 5F3RA 5PGMA 4PC3A 1GPBA 3AI2A 4NENB 2H0AA 4HNAA 5CK4A 4ZC8A 4ZO6A 4XD7A 3CXRA 1VE3A 3OE4A 2F1IA 1TYBE 4YJHB 4XRGA 4PZ9A 1ST2A 3OM1A 2PVCA 3TDKA 3USZA 5KOIA 2F1HA 3CVWA 4TV8F 5JC8A 3AY6A 3LW7A 4AKGA 3ST7A 5FQOA 1RNLA 2ALJA 4AM8A 3RODA 4XCXA 4OOFA 4H1UA 2NU6A 3RJ9A 3ETNA 3BXOA 3DP9A 3FWPA 3PBKA 1GP2A 1G5IA 2GM9A 2UAGA 1PT8A 2NU8B 5K0ZA 3LCCA 4F45A 3H5OA 1CUUA 4ZHQA 1GADO 3I6YA 1PV1A 3H6HA 2JVKA 2ZSDA 4ZJYA 3QPUA 1W0KD 1NRIA 1Y3AA 3ET4A 2QTCA 1P1CA 1NAHA 1T1JA 3RABA 1AGNA 3PUXA 4P5DA 5KKAA 4K9PA 4YUXA 3K9QO 1G6KA 2EKQA 2H18A 1UMKA 4FWBA 2JFZA 4OX9Y 1XA4A 1KFJB 1PGQA 4CM1A 5KSPA 2XQGA 2HJVA 1EBUA 3EBOA 5JWOA 5BSWA 3GVCA 5I8ZA 2CLKB 5ESXA 3BS4A 3ZKAA 4KDCA 3OF3A 4WCVA 1WMBA 3LPNA 3GT0A 3ZZ0A 2A0UA 2IHUA 1T1GA 2HU8A 1Z3IX 3OCWA 1E77A 3F3MA 4MPRA 5HIMA 2NLOA 1I2AA 4C3OB 5IYZA 5ILOA 4JVSB 2HC9A 4FMDF 4QWMA 1NXWA 4NNJA 5E9AA 4K05A 4B3JA 3K9WA 1DQSA 3MWGA 3JQGA 5J43A 2QR5A 2PUEA 3OLZA 1SBZA 1U81A 5F21A 5E2IA 1SH7A 2G09A 5I48A 3BQMB 1UPBA 4IOJA 1L5WA 2J4DA 4WCFC 1NPYA 3GNTA 1EEHA 1AKEA 2PIDA 4JP1A 1WP4A 3R6GA 3LPMA 3ABIA 2REQA 1VKNA 4RTRA 5AW5A 1MX1A 2NSJA 3LX5A 1PKXA 3Q87B 1FY2A 2ODEA 4ND1A 3KKLA 5ALNA 3KQNA 1TZMA 4A0SA 2MJLA 5AICA 2W2PA 1GNTA 2H7VA 3LQFA 4D57A 5A5DA 3CPEA 4NLLA 1KH3A 2ZBDA 1MAHA 1TUBA 4RF4A 3VO8A 1IBKB 1UBNA 2QVYX 3QVXA 2ZYVX 1KEEB 3LFUA 4DN6A 3I53A 3CB4A 3UMRA 3DXXA 2OVBA 3TIVA 3ZCTA 4DRYA 3UPUA 1EM6A 3P5BA 1T8UA 3TFWA 4PIPA 4EG5A 5HOQA 4Y6RA 3PHGA 4BN5A 2ZS7A 3I4FA 2HCRA 2V7BA 3TQOA 3B2QA 5F2OA 4ZVVA 2ZSAA 3DPIA 2AMYA 1NF9A 3LDFA 2QPAA 1WUJS 3E8MA 2DUWA 3C15C 1HRKA 3PQEA 3QWIA 3UHOA 5JZMA 5HJ2A 3FFXA 1RJWA 5IULC 1LDNA 5DK6A 1CDEA 1H9BA 4TKLA 2P0YA 1NI4B 1RBQA 3DBOB 1ITZA 4M76B 1G21B 2YWEA 3ADOA 4QLBA 1XROA 1L7DA 4BBZA 8OHMA 3MHPA 4YACA 1X7DA 1XALA 2NM0A 4OI2A 4UARA 1RHJA 2FLVA 2AGVA 4GT1A 4Z5XA 2QTFA 4LJSA 4ATNA 2Z43A 3DE3X 5AIBA 4DC1A 1SCQA 3VISA 4PIVA 1R50A 2YHBA 3T5BA 2QSUA 2R9VA 1KJWA 1PS0A 2QXYA 5ADUS 1GGJA 5JO0A 5DMXA 1XEFA 3TCKA 1ENOA 1K88A 2DGDA 2R00A 2WV9A 3CSDA 1DOAA 4RK1A 4RVUA 1HOTA 4YIKA 3IEKA 3SWWA 4PGAA 3ZH9B 1H4SA 2PNFA 3IPAA 3GBVA 3N8NA 4G4IA 8ABPA 1XPJA 1Q7EA 3ZIDA 3T0IA 3UC9A 4RULA 3TB4A 1WX1A 2GZSA 3FSGA 5EYPB 1SVNA 4R8RA 3HKEB 2BRUA 5I8WA 3NXSA 1FYEA 4PYNA 3NWOA 2P75A 4RW0A 1TIPA 1NHWA 1SNYA 2YXBA 5MN5A 1S1MA 2FEXA 3HLYA 2XI4A 1KSHA 5BUCA 3IE0A 4W1SA 4C3ZA 2PUCA 5B1IA 3AF3A 3A4LA 3KPYA 5LWHA 4E08A 2ZJZA 5DSZA 1PFQA 3AHFA 1PK9A 1SCKA 4JT8A 4LGVA 2HFJA 4YO7A 2BISA 3KHSA 4GX2A 3SX0A 5AUPB 3WNCA 5C18A 3M9XA 2PWPA 4G3XA 4HGRA 1D2GA 1D1PA 3ND7A 4KO2S 3KHKA 1F0YA 1OYVA 4TXMA 2QX4A 2ZR7A 3WR5A 3U4HA 3ZN2A 4BU0A 2EKPA 2PIAA 5IVHA 3AETA 1G5HA 1R8QA 2HREA 1IJBA 1NSFA 2ONKA 4ZO7A 1AS3A 3C24A 2XF8A 1QCYA 5HMMA 1WDTA 4P7FA 4H7JA 2VWQA 5AVSA 2EP8A 1D9ZA 4OHRA 5SZKB 3VDXA 3ZGYA 1K5GA 4A9AA 3T5AA 2VPIA 1YWGO 5KNDD 2GRJA 3IAXA 2OK7A 4E07A 1WQ1R 3V8QA 1TPYA 3LBNA 1I4LD 1ZA1A 2CFCA 3L3BA 3QG5A 2V8OA 3WKCA 4EW1A 2VT2A 3KEGA 3LKZA 2GYVA 5KC8A 2J0QA 3WMFA 4GIBA 3EARA 3OE7A 2FFQA 3QMWA 4Z49A 4KK3A 4MS1B 3NWPA 5AW0A 2C8KA 3A1UA 3M2TA 3RRJA 4QGBA 4PFQA 1VG8A 4RIIA 1WUHS 3GGGA 1R1DA 4WVFA 3WXBA 4C0SA 5EJFA 4GZ6A 1QWSA 5CEJA 3CFYA 2VHJA 4J9VA 5D3MA 3FIUA 1G1MA 3G5MA 3T7IA 1SIBE 1SOVA 5KOHB 3GLGB 4FGZA 1I94B 1OXUA 4GWKA 4E5NA 3I0MA 2XIQA 4HAVA 1Q0UA 3UPTA 4JGIA 3BK7A 5D5QA 3EXHB 1BVRA 3R4CA 1G3RA 1NV9A 3Q7PA 5DSXA 4RF5A 3R3YA 4QC2A 3LVRE 4XVQA 1EUDB 1VJ0A 2PD3A 3EZ9A 2JG3A 2DBZA 1CFZA 5J4KA 3AHHA 1U7DA 3HN6A 5C5EA 5KNCH 4MZDA 3DE6X 3HGQA 3ZWKA 1T4GA 1G6HA 1JNXX 4DB4A 4C4AA 4IOLA 3C3WA 4MS3A 2Q1WA 1JDPA 3MT7A 4QBFA 2VAVA 1KSFX 2Q99A 1HT2E 3KJIA 4M22A 4R1QA 2FOLA 2G40A 1TRKA 5IJWA 2YZKA 3DM5A 4IIEA 4V0NA 2WWRA 2ODPA 1RI4A 2OP0A 4BAGA 2A1TS 4MV6A 4CT5A 3G1WA 2WJGA 1EWRA 3NIGB 5CVEA 2A5LA 4H60A 4TRNA 3TCNA 1DXHA 2JW5A 2FZCA 2VYNA 4IV5A 4JH0A 1BCRB 1U65A 5DM4A 2JAQA 4EVIA 4JHXA 3PKIA 1LF5A 2Q9UA 3A05A 4ZALA 3KKMA 1GFIA 4PCAA 4WZAE 4WNYA 2FLKA 3H1PA 3MUNA 3NVAA 5FNVA 4BLSA 3ICCA 4OHBA 3IJ5A 1WL8A 2LD4A 3MS2A 4UHEA 5IW8A 3TLAA 5M5BA 1FS6A 3KYJB 4QGHA 3ITKA 2VUTA 3OX3A 1OA1A 4KYTA 6ADHA 1IY0A 2C9OA 2FEKA 3I01A 3UN1A 4ALJA 4B7XA 3L8DA 5B6JA 1U7TA 2ZJ1A 4JYZA 4KFRA 1UODA 2K7ZA 1WABA 2PGIA 4PYQA 5KYYB 2FRXA 3H9UA 1C9KA 1OASA 1Z16A 4ZAVA 3EXIB 1CHDA 3MWLA 4GKAA 3ZY2A 4LF4B 2C7GA 1ND6A 3MXOA 4YP7A 1CY8A 2HCBA 3G89A 3L8YA 1CQZA 3B1JA 4LUCA 4Y6OA 3WG9A 3KAJA 3I6MA 4N12A 4JLSA 4KLAA 2O5VA 4RIHA 3TL3A 4EFKA 3FKQA 4YJ2A 4D8VA 1J5EB 1LUAA 2FQQA 1Q0LA 1G8PA 1U0RA 2B82A 2OAGA 2OCDA 2XT0A 3IAEA 2OLEA 4FC6A 4OJMX 4ZAZA 4XLZA 2JFWA 2NO7A 3AK4A 1FVOA 1ZM2A 3M4JA 4Q16A 5TSDA 3WRYA 4MKRA 3LSYA 3ZNQA 4EGAA 3RLIA 1RAGA 3VR5H 4MLCA 3IHLA 4XX0A 2RH8A 3DDOA 4JJZA 3ZJYA 4BX2A 4D43A 4AG5A 2I2CA 1X1BA 2GEFA 1H94A 4LPKA 4Y6SA 3RF7A 3SXUA 3GVIA 4PC7A 3WWDA 4DSAA 1R27A 1B74A 1C29B 2A9JA 3MJFA 2BFCA 5T4FA 4BFXA 4B3TB 1TO2E 1D6JA 3T7AA 4DCUA 2QRKA 2VDOB 2J5BA 2ZIWB 4F4DA 2QRLA 3HACA 3BN3A 2UUAB 1TADA 2QJRA 1F12A 1JQAA 1G4UR 1RAIA 3OI7A 4URXR 3G8DA 4QYIA 4EF4A 4RJ2A 1EMDA 1X7WB 1ZXLA 3BJEA 2XCLA 1GTG1 3JQFC 3SYKA 4WE3A 3ADDA 2ZXEA 3V3KA 3N0VA 3AEKA 4NG5A 2B5WA 1GFZA 5E6RB 5EZYB 2V98A 3UH0A 3N6VA 3TUZC 1A7AA 1NUQA 1R0XA 3OFNA 2WY2D 1GL6A 1O6BA 3T0GA 4DXHA 4DLBA 2QORA 3QH4A 1IL0A 1GG2A 3ZG6A 1I0IA 2VOJA 4AQ7A 4UVIA 1JT9A 2P9QA 3AYZB 4FYIA 4M83A 1TEVA 2G8NA 3BEOA 4BLTA 5DCUA 3EG5A 2GJKA 2X9NA 1A8UA 1O94C 4Q9NA 3SDBA 1JE0A 5JNWA 3CRW1 3BCSA 5BQPA 4C4ZA 1QYWA 4C5AA 4GKJB 3LS2A 1XZEA 3WKDA 1YZVA 2ZIAA 1TM1E 3N2YA 3S2EA 4X66B 4CIVA 4XQ9A 1O96A 1UXKA 4YUAA 4YT8A 1GL3A 2HX1A 1J21A 1WU8A 4P4GA 4S24A 1V41E 4RJTA 2ZBEA 1G3IA 1KZ7B 1XMIA 1XX6A 3Q0IA 1OLSB 1R6XA 5AJVB 4GOND 1ZWKA 5F7XA 4S04A 4M1QA 4R98A 4J91A 1KMQA 2IODA 3PHLA 3EGCA 2YOHA 3F6YA 4FFNA 2YY6A 3BQNB 2BEUA 4YT2A 1SXJA 3AQIA 3LBAA 5GONF 4OHMA 2GDZA 2IYTA 2MT9A 3LXMA 4E31A 3UT5A 2I7TA 5FUMA 1OF1A 4RS3A 2EHJA 1C7ZA 2AF3C 2CWWA 1P0MA 1RXSA 2SKCA 4N6GA 3RUDA 2PM8A 3WC4A 4G97A 5BN5A 4X85A 1GT91 3PS9A 1NF3A 5EIBD 3MB8A 4IDFA 1GUFA 5TGDA 2EEPA 1SKYB 1GQRA 1KYQA 2E0IA 3WWEA 4Z4EA 4XQGA 3W77A 1NIJA 2A9RA 5BUZA 1SHJA 1L7OA 2ZB4A 1HEUA 5FH9A 1EKXA 1NMQA 3MLBA 2OBMA 4F4CA 1RYMA 3A7DA 3GJYA 3B70A 3UPDA 1Z4OA 10MHA 2P2DA 3LBIA 3V9PA 3WLHA 4AZ0B 1XZMA 2XECA 2X8JB 3A14A 1FVXA 2PFSA 3G8CA 3PDCA 4JDUA 1WCIA 1PBTA 4P3YA 5IX8A 1X13A 2WC1A 3N2ZB 4FEYA 3JQ8B 1SCUA 2PSEA 4DLVA 5K45A 1NE7A 3G0HA 2XH8A 1R18A 2XGOA 1NXOA 2BZSA 2VC2B 3N0TA 2BHSA 4NVRA 5JBNA 1YB4A 2JIDA 3IBCA 4P3NA 1HDRA 5I6DA 3LK7A 5DBIA 3CZAA 3R2JA 3RAPR 3OCXA 3QXSA 2HR1A 1CVIA 4KI7A 4UMDA 3T94A 3D64A 5ARDA 5DX8A 4IIXA 4E30A 2VFAA 4ZXFA 2X9GA 1ULHA 1VG1A 4NS1A 4XGIA 4PE5B 5DNVA 1MCZA 3AI1A 2B7CA 3E5RA 3HYSA 4LNHA 4O5OA 5J63A 4EPWA 3AVXA 2ACWA 2UUCB 2WUGA 1YKGA 1U4OA 5J5AA 4FFVA 2DR2A 3DCNA 2GFIA 3UGJA 2NSYA 2IIPA 1UIRA 3VJMA 1DBQA 3Q15C 2O4UX 3D7NA 4ZHSA 3WLTA 1OPRA 3DCJA 3MBKA 1ORWA 3GROA 4LZWA 4Q9HA 3QVGA 5F1PA 5JS7A 5KKCA 1DUVG 1SCJA 4NDZA 1F7VA 1Y1LA 2DH6A 2JFYA 3L8ZA 1ZUNB 3EVEA 4TL8A 3T5GA 4OXYA 1QHSA 4YRSA 3EC7A 1AQIA 3FPBA 3PJEA 3VV2A 1PI3A 4FT4A 1VGQA 2MYPA 3DDZX 2EJBA 1YASA 421PA 1FFXA 1NQ5A 3FYUB 4ASUA 4UOZA 1DG3A 4WPGA 2MSCB 1ELOA 5FYQA 5FI1B 1SHKA 1X80A 4EOGA 2HHLA 3M6XA 1CY1A 4M9SA 1JHXA 2TMDA 1VL8A 1M2FA 4EZEA 3SK0A 4IM7A 3KLPX 2JCGA 3D6TB 3HKDB 3A4VA 4IF4A 5BSMA 4PO1A 3T8YA 5AXDA 1AKVA 3AC0A 1TOAA 3WO1A 5CIYA 4NCIA 2BHRA 4J2OA 4JOCA 3AOEA 3ZVLA 4HXFB 1QGUA 1H2FA 4B3MB 3V2UA 3UW3A 2HK9A 4G81A 4YRBA 1BROA 3OJLA 5H0IA 4O2LA 1JQDA 2JFOA 2XVMA 1T6BY 3Q3CA 3JWPA 3L7CA 2GPNA 4JR0A 4H31A 2AWOA 4BEJA 5KU1A 5AJTA 1KNQA 1M6WA 1ULAA 2X8LA 2J3DA 5TS3A 2AJBA 1BCSA 2EEZA 3G0IA 1E2BA 1TO6A 1Q7RA 5CM2Z 3DHVA 1EM8B 2L2QA 2VZEA 4NXNB 4BNHA 1VGRA 3KG2A 4NYIR 4QTUB 3CEPB 1E79A 1LRLA 3VI4B 5JMPA 3WY9A 1K97A 1RXWA 3KLOA 3R0VA 4BGVA 5KJCA 1ADCA 3ESZA 5JW6A 2QQGA 1C4WA 4HXYA 4IWNA 3PXEA 4O4LA 3ZX5A 1QYIA 2GN2A 1FA9A 3BJRA 4CU5A 2I3AA 4NMHA 1M6HA 3D3WB 5K3SA 3AR2A 3HY6A 4D98A 2QR2A 3PHBE 4N9WA 5AKXA 4EM6A 2FDXA 3WLKX 5K8VA 2Y8EA 1B93A 1L9XA 3RS2A 1Y3FE 2Z3ZA 1QONA 3RRXA 3V1NA 4ZDJA 5HZKA 1RM4A 3DTVB 3BDAA 4LE2A 4Z4FA 5B6IA 4DWVA 5KYTA 1E2NA 1Y9AA 4FMCB 4UUAA 4EJFA 3NDIA 2C58A 4OAPA 5K01A 3AFMA 1TXGA 5LA6F 4K6KA 1RRGA 4X65B 2QMYA 1JDVA 4JUCA 3X1KA 1IHXA 3AXSA 4B17A 1FNNA 3K4QA 3ELUA 5I7VA 2NZWA 5SY9A 3B8HA 1JHYA 2XQJA 3GUHA 4PANA 4BKPA 1F60A 5CW1A 1RPNA 4LHZA 2BI7A 1ADJA 2FWNA 3BMOA 1OIXA 2P9TA 3NHFA 4JUBA 5EWJA 3ASUA 3TQCA 2ZG6A 1Q83A 3F5SA 2HJWA 3VNVA 1NPTO 4GR5A 1IAQA 2A3RA 2FTKE 4MPDA 4CNQA 1ZM9A 1JBEA 3MINB 4OU4A 2NZ8A 3D2AA 2JBHA 4KPUA 2O0HA 4ZT3A 3LBFA 5B55A 1J9GA 2JZCA 1X1DA 3F3KA 1PZXA 1VE5A 1U9YA 1DWUA 2RK6A 1YB7A 4U5QA 4CDMA 2R7LA 3GPBA 1TZBA 1YI0A 2R8EA 1XDDA 5K8LA 2OYRA 3VPGA 2VF2A 3JRXA 5D5HA 3M4NA 4AJ2A 1YULA 1WUYA 3L0IB 1SR8A 4R41A 4D4MA 1E2IA 2PYIA 4DM3A 3A6GA 3OIGA 4EFDA 4YCDA 3EUFA 1EGQA 4KWIA 4YFYA 4A2PA 3JCZA 2UUOA 2V9CA 2ZPUA 3T15A 4NNPA 2J9XB 1CZNA 2VAWA 2EFYA 2VQ6A 4DV5B 2C88A 4CG0A 4UVHA 4XGKA 2I62A 3EF3A 1GNRA 2DPHA 3LL7A 3LQ2A 2FPIA 4JITA 4IOKA 4Q9IA 3SVZA 2QV0A 4FLFA 1M2NA 4BFWA 4H1HA 2VPYA 2KWIA 3GFRA 2OTCA 3B6ZA 3K0AB 3LUAA 1ESEA 1E9DA 1TUGA 4CBVA 1ZL2A 1RZVA 1M0SA 1AIPA 3EQZA 2WLSA 3WBKA 1T4CB 1W30A 3SLKA 2OPBA 4AWXA 4H17A 4OL9A 3BG5A 5JUWA 4J0FA 2YIMA 5A9SA 3KB6A 4ABTA 1E63A 3M33A 5LIPA 4FFBA 1HTWA 4OHWA 4X3CA 4V0LA 1PJLA 5MF6A 2C3YA 3FFBA 4S1WA 4XYMA 1M0TA 3DVAB 3M6IA 4K88A 5TEVA 4GI1A 3R5SA 2QDXA 1QBKC 2MSNA 4K9SA 3GUVA 2C3MA 1PJRA 4KMSA 4OQEA 4NJMB 3TZBA 1Q0PA 1V8FA 3AZOA 3KUDA 4QVKA 3VAZA 5IJ0A 2ZVPX 4IXWA 4O4IF 5FPKA 5LMUB 4AY2A 2GN0A 1PS9A 1MG5A 4PSKA 1E0AA 1BFDA 1PR1A 2AX3A 2X76A 5B2ZA 1XD2A 5GVRA 1C9YA 1BSVA 2RB5A 2FPXA 1XEWY 1TQDA 4TS3A 2FN7A 4AY3A 2R79A 1BYIA 1HSZA 3P2JA 1S8OA 5DSTA 1GDDA 2XWBF 4Y2QA 4NEGA 1TGYA 5BPHA 3VXKA 1KAHA 3ZDEA 3SDSA 3FNEA 2PWYA 4LYJA 1CUDA 4G89A 3TMKA 5IM4F 2OZVA 3H19A 3G85A 4ZXPA 3QPCA 4G5FA 3KYCA 2O0MA 4QOIA 4D9IA 1JU4A 3DZGA 3NX4A 3BIOA 4ENVA 3C3JA 2C20A 4XR9A 4ZARA 5LQSA 4F11A 4FYYA 4QUHA 5ERGB 1JHDA 1W94A 4WN9B 3CQ9A 2ZRAA 1XQ9A 4GDMA 4KG7A 5AKKA 4BIIA 3QUTA 1QB8A 2P2ZA 1NLMA 1JG1A 2XUDA 3DT9A 3D4OA 4LDJA 2PEYA 5FBHA 1II0A 1U3GA 3GCGA 4KV9A 1L8AA 1WU7A 1KQGA 2X0FA 2RCNA 3PNBA 1VSQA 2Z4SA 4HDRB 1D5CA 2A5YB 3HH8A 3GLRA 4OK5A 4X84A 3U62A 4EG3A 4EKEA 3QELB 4OXQA 3TX2A 4UHHA 3RYIB 4POOA 1MQ8B 3UWKA 1ZBQA 5IXSA 2I6XA 1AB5A 3N87A 4LJYA 3UK1A 4AJJA 3PHJA 3VZDA 3QEAZ 4UZFA 1Y7HA 1I9CA 4G5SA 3L04A 3R3JA 3AUTA 1ZIYA 2PZMA 4JYBA 5JDCA 1XWFA 4H7DA 2BF7A 3EQ8A 5I7UA 2XYQA 1G19A 1H66A 1F8FA 4NEQA 1U2QA 1U3FA 1U0GA 3QLUA 2BFWA 2GLTA 3ZD7A 2NPIA 1A50B 3RFUA 3ZWYA 4MVJG 1D0IA 1XRPA 1JR6A 3ED5A 3L1VA 4G01B 3H4IA 5D84A 4EGSA 2OKGA 3OT1A 4ENPA 2IX3A 2H31A 2FZVA 4KPGA 2R4TA 2VZ0A 1PKEA 2NW6A 4IL5A 3SE0A 2GM5A 4EJ6A 3FAKA 1E9FA 1KR5A 3FN4A 2QRNA 1XDBA 4Y6PA 5K1ZA 5IU6A 1THZA 2WIJA 2VHEA 1T5DX 4INPA 3T35A 4ETNA 1V37A 1IK4A 1HE1C 3VHLB 1M1UA 1HMPA 4IVRA 3M7IA 2P9JA 1S7CA 1IOZA 5EINA 2WU3A 3EZ7A 1Z4JA 3MJCA 3FFTA 4ZQGA 5J3JA 4TMKA 4Y8VA 2FUG1 1DKRA 2G7MC 4ZEOA 3ZDDA 2NTNA 1U9JA 9ATCA 1MRNA 4PCLA 2GEVA 2JJ2D 3FWZA 2HY7A 3BBPA 1NXSA 1FQOA 1VSUA 1IZ8A 3BIWA 4OUDB 2E85A 5HKOA 1VKRA 2XNDA 1UPCA 1L4EA 3IP5A 1CB0A 2DQSA 1TX4B 1R8XA 8ATCA 4AJ9A 4Z4QA 3FPKA 1UFKA 4PEVA 2CZQA 3OHSX 5C7LO 4DCVA 1VHQA 5FA5A 2X7XA 2R7NA 1GXSA 5AKLA 1HYHA 1I6WA 3N3AC 4E2YA 4XRRA 1R00A 4COOA 4G41A 2GJ9A 3ZE0B 4BXOA 4Q82A 4AWBA 5L3RA 1NXQA 3C3KA 4RHFA 3P9QA 2VRBA 1D2MA 2J3IA 4MX8A 5FA8A 2CJPA 4QG7A 1YRAA 4IUBS 1HG0A 3AOGA 3QPAA 3L7MA 3QJYA 2O23A 3CCFA 3IA2A 1FSZA 1NONA 3OMLA 4H77A 3THSA 1WDKA 3CU5A 4DXAA 3IP7A 2AG1A 3RC3A 5L3SA 1ES9A 3ANMA 3G2LA 2EDCA 3VNAA 3RHFA 5JEDA 1XELA 5JJIA 2HMTA 1WCV1 3OSZA 1NY6A 4NAUA 1S2NA 4YWJA 1ANKA 1GZSA 3M6AA 4KDFA 1LPPA 1NT2A 5HWSA 3CB2A 3HA5A 4P5EA 3R41A 3KTFA 1K6JA 2JVJA 3PENA 5ECDA 3OJEA 5ERXA 4A8JB 4ZDKA 3H04A 4JBNA 3QZUA 4R68A 3IQWA 4YQEA 1AKWA 2ZZKA 4JLUA 4B4UA 3KE8A 4ER3A 5D1HA 1PSDA 1E1RD 2ZWMA 2HN9A 4WXMA 3EC1A 1QV9A 1LBEA 3RPEA 4BVHA 4BNIA 4JJ7A 1PG0A 4V0MA 3GP3A 5IXJA 1JYEA 2I4RA 3UK2A 4IBOA 3VU0A 1MX5A 3WGTA 4LW8A 3I9V1 5EE3A 1XMVA 1OGYA 4OLJA 5K4AA 5IJZA 4G8BA 3DTYA 1FTGA 3HA7A 1YJXA 3PGA1 1BHJA 4AYWA 5EESA 2ZYDA 1Z4LA 5FHQA 2XB4A 3N6XA 2ZATA 3W90A 2G9ZA 4CF5A 5HRUA 4R1NA 3TECE 1MH9A 3BA6A 2HXSA 1PJTA 3RTDA 3JY6A 3SXPA 3NW9A 3QJGA 1U9CA 2GPSA 5CLGA 3ND6A 3RIHA 3CR7A 3UMGA 5JADA 1GTJ1 1RQ7A 3QW4B 5K6RA 4OYHA 1QLJA 4HGOA 2IKSA 2AOTA 1ZD5A 2AN4A 3BMCB 1RYHA 2A9VA 3LT0A 4JC0A 3ZXXA 5I3CA 1KQPA 2GTIA 5IKMA 2Z9CA 2LTAA 2XUFA 2OC4A 3O3MB 3A4TA 1US8B 2RH5A 2ZUFA 3VHXB 1Y3BE 1KF0A 1X1TA 2YOGA 3N7TA 3HFRA 5FT9A 5HMLA 1TI7A 2ZT8A 1E3MA 1NQTA 3MUEA 3EXFB 1XAGA 1GA1A 4E5UA 3BHIA 3CSUA 3CMCO 5A1TA 1JXOA 2D8AA 4MQFA 3I58A 4X41A 4HEHA 2B7BA 2Y0BA 4OB7A 4CEHA 3DVRX 3I6ZA 5LB2A 3WLSA 3C0KA 3FLEA 3PX3A 4A6PA 5KYKA 3KOZA 4B9AA 5ETJA 2GBIA 4UCXA 4K9NA 4BWVA 1RYNA 2Q45A 4CFSA 2XMGA 2E9SA 1UZLA 3AUYA 4BNNA 2AEEA 4Y2XA 2DPMA 1QS0A 3IOCA 4CIYA 4CKWB 2I4LA 5K8JB 1MHTA 2G5CA 2J87A 3T4XA 2E4AA 1W47A 2VHWA 1KFBB 3H9CA 4C01A 1BX1A 3CNLA 3OLVA 3LLVA 4NBWA 4N5HX 2CXXA 3PC8A 4ODIA 4NYIQ 4IIJF 4MR9B 5B2EA 5TRTA 3DMRA 3AFIA 4FC7A 5C4GB 4N8DA 3FHTA 2BFPA 3TXXA 3WHIA 1SK9A 1OPXA 3TOSA 4CV2A 3ERCA 1JVSA 3TOVA 3GCDA 1C5KA 1G6OA 4KQMA 3OZUA 4RH1A 3OKFA 4X8HA 5DP2A 2XMZA 1KDVA 3RV4A 4REQA 4ARZA 4QDKA 4ZVLA 1T25A 3WNQA 4IEIA 4PLYA 2PO5A 1N8NA 4FE3A 5LJLA 4C07A 4DV2B 2JIOA 3OT4A 1JDBC 1Y1RA 4I5FA 2AFHB 4DMHA 1HGXA 4A23A 4AMZA 1ML4A 1E1CA 2A9OA 2BZGA 3EIWA 4X20A 2A59A 2GD1O 2R4UA 3F8TA 3MJEA 3TNJA 5BUSA 3A37A 3MJTA 3T7SA 2HYDA 4G0YA 1FS4A 3ROTA 1AB6A 3WDLA 3OIFA 5GONB 1WVIA 2B8EA 1J2RA 2HA0A 3RVDA 1YBMA 4H08A 1HM5A 1F06A 3EB9A 3VSBA 3FPCA 3UXYA 1H8HA 2HRCA 4L9AA 5CDYA 3W5JA 5IH7A 4B6OA 2I91A 2AN3A 3I92A 2E3JA 3F2IA 1XPRA 2DWPA 4MI9A 1NDHA 5EERA 1AJEA 2XDYA 3CLRC 3IIMA 4X8OA 1HXHA 3G9ZA 4YRKA 4Z0NA 2G0TA 4GU5A 1C8LA 4UTZA 4TTVA 4MRRA 3VR6H 2GK4A 5L6MB 3W2FA 3ENVA 1T9BA 4JY7A 2V58A 2H2DA 1J2UA 1H2XA 4UBMA 4ALLA 5JS1A 3MD9A 2A9QA 1H8EA 1WG8A 4U2EA 4EY4A 4H7EA 1ODFA 1CY0A 3L7IA 3L7NA 4D4KA 2QT9A 4ISCA 2DB3A 3OCJA 1WSBA 5LBTA 1NKSA 2QNBA 3CZMA 3GD5A 3G2KA 2GQ0A 4HTAA 4LSMA 4RGBA 4QTXA 4DCTA 1NUAA 4JQYA 5C2JB 3PQ6A 2LCQA 2DHDA 2KJQA 3IV7A 3CSSA 4ZTUB 3A2LA 3GPDG 2ILVA 5G02A 1JIXA 3DHYA 3TI7A 3VDMA 1EJBA 1HDGO 3O8QA 5E2BA 3G2MA 2C4KA 4HQOA 5LZ4A 2EF0A 4HAYA 4I55F 1LZKA 4OEHA 5KEIA 1G1AA 1JU3A 3E7XA 5JZOA 1GAEO 5LD2C 4M0MA 3EQ9A 4MQ6A 2H2AA 4OIMA 4RIFA 3IO5A 4F3NA 4A5SA 4Q9DA 2C7VA 2IYQA 1JLLB 1UDAA 2ZBPA 4F4IA 1ZR4A 4ZOEA 1N7IA 1TU3A 2R1TB 2JLUA 2RG1A 1V16A 4JMPA 2RH4A 4QNNA 2F3QA 3NT4A 1CUJA 4DA4A 1A76A 3NHLA 5ITVA 1YACA 1RABA 2QUKA 1Z29A 3ZW8A 3VAYA 4WEOA 3AM1A 4JL8A 5A0FA 3ZDFA 4DRXB 1WB4A 1UDWA 2N9UA 3FYSA 4EIWA 4MRPA 1JHMA 2QMUA 4ZK6A 2EFJA 5T67A 1QIHA 3H9QA 3B13B 2JFXA 3GFVA 2RBGA 3CF6R 3D6HA 3H4VA 1R16A 2AF4C 1OW3B 2BYTA 3EYWA 5JR3A 4B7UA 1H2YA 2PLNA 5JIBA 5EJEA 2P6OA 1UM8A 1P5ZB 3R23A 2O14A 4JOSA 1FU4A 4N3NA 3R75A 3ZU5A 4Z1MD 2J33A 1DQPA 2B9EA 2JGFA 2ZAYA 3HHPA 3NEPX 2ZAOA 2W83A 4I9UA 4FDMA 3PXGA 3WK7A 3M6MD 1S6YA 2MSWA 1T2FA 2YV1A 3GRCA 1Z4IA 1U3VA 1Z15A 3IOBA 1Z28A 4V1CA 2R6JA 3IEVA 3EGVA 4MMYB 5C8ZA 2X0NA 1UOEA 2I6SA 5FOTA 5JY6A 2Q41A 3CN7A 3ETEA 1O95C 3DAPA 4KQ2A 3UGQA 1YB5A 4ZCSA 4MINA 3FSRA 1R10A 2IZOA 1M74A 3AUAA 3BCHA 3IHKA 3PK0A 4J3JA 4AL4A 5AW1A 4ZJUA 1IVSA 3F5DA 4ZIRA 3DNFA 4RQTA 2FPSA 1INLA 2VAPA 3HVKA 4S05A 1J8DA 1OU4A 2WFLA 4OXIA 5ARCA 3W8DA 1I7DA 1W0KA 3GNSA 4GWLA 4HKTA 1PRYA 1A2BA 1CJVC 1ISRA 2A33A 4IQ4A 2OENG 2Y66A 3Q12A 3QLJA 4PO3X 4R1TA 5EJ9A 4NC9A 4TYYA 1CF4A 3NM5A 4OBWA 1JMVA 1Q2UA 4BDTA 1I4EB 1JEEA 4E2WA 2Z2ZA 1PWYE 2NV0A 4A4DA 1FJ2A 2AUNA 1NMYA 3BIJA 3E4CA 3R8XA 1AKNA 1TTPB 3L4BA 3JASB 3N0RA 5F7JA 1KBZA 1R6UA 4LDRA 5CB4F 4AK9A 4YB8A 3I3OA 1YVDA 3IEUA 3BZUA 4Q9AA 3WSVA 1Y6ZA 2N1BA 5JVDB 1SFRA 2G1UA 4RY9A 1QZXA 2O06A 4FFDA 2Q1TA 1PZFA 3VSAA 4MV4A 3W2GA 1B0UA 4HLUC 5EIWA 3T5MA 1TJNA 2NXWA 1C3JA 3ZV4A 5CFZA 5LA6B 2PGAA 1PFGA 1EJ6A 1EX7A 3GWZA 3CF4G 5AM0A 5A4IS 1F1BA 4OHCA 1VCOA 1QV6A 1JAYA 4DCJA 2I4NA 3IR7A 3HXMA 2B1GA 1R3DA 3I9JA 2HMYB 3KU4A 1KDRA 4RA6A 4CG1A 4O4HF 2WILA 4ZAGA 2BTEA 3PJFA 4WSOA 2FI1A 3CUKA 5C7OO 1VJTA 2PYZA 3Q88A 1ZP6A 5H3HA 5C5DA 4AKIA 4EO9A 3O74A 1D6NA 5DN6D 1W5BA 2LIPA 4Q4CA 3ESBA 1B23P 2ZRHA 3HNRA 4IDCA 3QU9A 5TDHA 3R5HA 4ZMRA 4DIKA 1CZLA 5BMVF 1MPTA 4M36A 1DKQA 1CQIA 3Q6NA 2PZFA 1IE3A 2PV0A 3R9XB 3KDAA 4EPTA 4IHJB 4PPYA 2HRRA 2J4CA 3A0RB 3Q9LA 4RA9A 1B3RA 3A27A 2QL5A 3PCXA 3I6IA 1NVVR 3WRXA 2V7WA 1I7LA 3TAXA 1GGKA 4A3SA 2HZ7A 4ZT4A 1PNVA 4BVJA 1ZU4A 2IOFA 4IWYA 4DV7B 4N0PA 4EG0A 2C2XA 3STUA 3RHZA 4X95A 3KTAA 3F74A 5DBOA 2DMRA 4WECA 3RU7A 1WQ4A 1DAGA 2UV8A 4I08A 1WXFA 3LKDA 4JLVA 5FR1A 5J2TB 5KWIA 2RD2A 1IN8A 3EA0A 2YQ5A 1PEAA 4FGUA 2F90A 3QXHA 1DIAA 1XMSA 3H2SA 3I83A 1DCTA 1NYLA 1E3DA 2C5LA 3SU8A 2VTBB 2IRWA 1G2QA 2FFAA 2B4AA 3QYJA 1ZMTA 1Y5RA 3HJHA 3V2IA 3AEQB 3PIIA 3UF0A 3DHNA 5IF9A 3E53A 5DTRA 2ZBGA 3TJRA 1ZCJA 5DYGA 1U5BB 3N2GB 1N8SA 2I2DA 2BC9A 2Q3EA 3CH5A 1EIZA 3Q10A 1H9CA 2K87A 1FLVA 4Y2SA 1L2TA 3MUFA 5JANA 2RHOA 3PQ2A 3W5HA 4PRLA 4QM7A 2XWPA 3TMAA 5C5CA 5FQNA 5AW9A 1PQPA 4MKGA 3AR3A 5EIXA 3KYDB 4IJKA 4I50B 1Z39A 4D81A 1Z8NA 1D5WA 1PQYA 1T5SA 3K30A 5LYYA 5F7ZA 4FYJA 2X9LA 4H6PA 4YN3A 5BRNA 4KYUA 2A58A 1OV6A 1RLTA 1XRLA 1XFDA 2BGRA 4K6MA 1DIHA 1QIIA 1WXDA 4S1OA 2V6GA 1KTIA 1BDJA 4R9NA 4KFCA 1E7RA 1JEJA 1N0IA 5JNUA 5TQ0B 4X94A 2YVKA 3CRMA 1QWOA 5EJIA 4GMGA 3HNPA 4U0KA 4YXWA 5JWHA 3AP3A 2GS9A 1IM2A 3QOFA 1G21E 4QSHA 2QAGA 4YCSA 1W88A 3DEAA 1O0BA 4X6XA 1F8YA 2IOFK 4RE5A 3G2HA 3EHEA 4B7AA 1FXSA 4D6PA 5CB8A 1H69A 3NTXA 5BNTA 4MVJP 5DIFA 1P7WA 4B85A 2PX3A 3IELA 4MR7A 5ALXA 1QH8A 4E3WA 4Q21A 3HYCA 1T2NA 2VP6A 1LWNA 4U8GA 3W5IA 1ISFA 5E9WA 3ZZUA 3MCZA 2I8CA 3Q3JB 3TZKA 4PAOA 4Q3DA 5C1DA 1R0YA 2G0NA 3HXPA 3ZJVA 5C1OA 5ADHA 5KSZA 4Z8XA 3RFTA 3TAUA 1RWQA 3EAFA 4K0RA 1II8A 3PC6A 3ZTYA 2NVOA 4I6JA