2O89A

S. aureus thioredoxin p31t/c32s mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'AIVKVTDADFDSKVESGVQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Electron transport
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o89A00
1GSUA 5IMDA 3O76A 2HXKA 2MMAA 5IMZA 3G7JA 1BYEA 2PVQA 2M46A 5ECNB 2RUFA 1U3AA 4F82A 3LEFA 3QFBC 3DMLA 2V6KA 2A2RA 2ZNMA 3FW2A 4KDUA 5KN0A 1HQOA 5B6MA 1EOHA 1R5AA 4KGIA 4KA0A 1FVJA 2R6KA 2E2MA 2LSTA 2EIQA 4ZL9A 4G10A 1TTZA 2MMNA 1AW9A 3VWXA 3TRPA 3MNGA 1PN9A 2FY6A 2WGRA 4HOJA 4TR1A 3JCML 2L4CA 3UJ1A 3KEBA 2P31A 1HD2A 2NTOA 2YNXA 5DJLA 3LQ7A 1O81A 1ERUA 1OE7A 1E2YA 4IJ3A 4IGJA 5HR2A 3GKNA 4X1UA 1KBNA 4IBPA 2OBIA 5KN1A 3EMPA 1W89A 4IS0A 1SYRA 1XZOA 2I9HA 3VURA 2KOKA 3ISOA 2PBJA 3QD9A 2H76A 4K0NA 3DVXA 2M80A 2YANA 1T7PB 3TOTA 1NM3A 3NZNA 1Z9HA 2REMA 3WD6A 4JR6A 2LQOA 5AIVA 1PD21 2F3MA 4YQVA 4Q5QA 3HVSA 3GH6A 1IYHA 5F06A 1EGRA 4O7HA 3KH7A 1X9SB 5CAXA 2CQ9A 4OCEA 1G7OA 3TJGA 4DSSB 2GT5A 3BOAA 4HI7A 4K0GA 1V9WA 2OACA 5AGYA 5CRDA 1TK0B 3HHVA 3UAPA 1G6WA 1SKSB 3EU4A 3VI5A 4EUYA 4L0WA 3HA9A 1TK5B 1OC9A 1B4QA 4PQHA 4MZBA 3WGXA 1T4YA 4NHWA 1ON4A 1U6TA 4CDOA 4F9ZA 5LNKe 3IPZA 5CO3A 1BQ7A 3LJRA 4OFTA 2C3QA 3HVXA 4WBRD 3F6FA 3KXOA 2KHPA 4LMVA 3G7YA 2KP2A 3IHQA 4BVXA 1ACVA 1WIKA 4N11A 1CQHA 1TK8B 1KTEA 3CRTA 4IQ1A 5EPFA 4NAXA 2NPBA 1SJ6A 5ELGA 1F37A 3LORA 1FB6A 1UC7A 4HU7A 1EEMA 4O92A 5B7CA 3ME7A 1OKTA 4IELA 3KJYA 1KEBA 2XBIA 1BG5A 2YCDA 4I6XA 4IHUA 1S3DA 1PQNA 1NW2A 1NHYA 1HNCA 2YJ7A 4Q5FA 1QFNA 2WDUA 1TOFA 3VWVA 3VWUA 1QK8A 4I5QA 3FKFA 1A24A 2MMOA 2TIRA 2O85A 4J57E 4D73A 1XW9A 3UBLA 1AUCA 2CT6A 4DEJA 3EURA 3ZVJD 1TJDA 2VUPA 3ZIVA 2DJ0A 1V40A 5B8AA 6GSVA 1F6MC 3OR5A 1XPVA 3TOUA 1K3YA 5FWGA 4OWYA 2GTUA 1NHOA 2H70A 1A2MA 3APSA 4Q5RA 1T1VA 4EKZA 5FT3A 3WT1A 2ZUPA 4YQUA 3GSTA 1H75A 1PX6A 3VWWA 3D5JA 2JSYA 4F0BA 3TKSC 4GLTA 3ZZXA 3ZTLA 3IBHA 2HRNA 3CSHA 3ZITA 3WGDA 4POMA 2YOIA 2DC5A 1VF3A 1MDIA 2FWGA 4ZBBA 3A2XA 1TRVA 1M2AA 4FIWA 5D93A 2YV9A 2YP6A 3TCOA 2IMIA 2DSAA 1XBSA 2H0IA 3ED3A 1PL2A 1GL8A 2B7JA 1M2BA 4V2MA 3Q19A 2IJYA 3CSIA 4WF5A 5DQYA 2DIYA 2R3XA 4K7OA 4OCFA 1WWJA 4DVCA 4OD7A 1FHEA 2VL2A 1MDKA 4CW9A 2G2QA 2YWNA 3HJOA 3RHCA 3DIEA 2J9HA 2VCVA 2IPAA 4PGTA 4TW5A 2DJJA 1GTBA 5J9CA 2OADA 3SBCA 1PGTA 4RQXA 2LV3A 3GTUB 1SJZA 3LGCA 4KSMA 5ECHB 1A23A 2R4VA 2IIYA 1B9XC 3C71A 2WJUA 20GSA 1V2AA 3DRNA 1YEXA 4QQ7A 1U87A 3H4KA 3IR4A 2IFQA 1G0TA 4L5LA 1AC1A 1GUKA 4MPFA 2LJKA 1VF1A 2PU9C 3F6DA 2B1KA 5DAKA 3GKKA 1GNEA 4MA9A 1T4ZA 3ZFBA 4AGSA 1O73A 1B4PA 1JZOA 1R7HA 1B48A 3FR9A 16GSA 3GNJA 3DYRA 3L9VA 1T3BA 2H75A 3HZ4A 4FYUA 4IJIA 2MYGA 1QXHA 3IK9A 3O3TA 2ZCTA 1XOAA 1V98A 3S9FA 2IMFA 4HUAA 2H1AA 2GSQA 1Q4JA 4ZB8A 5EY6A 1B8XA 2WZ9A 4NV5A 1Z7PA 4RI7A 3W8JA 3TRXA 1G7EA 2YZUA 2NBSA 2GZZA 3O6TA 1TDIA 3C73A 3N9JA 2B5EA 1TRSA 1ERWA 6GSUA 1TP9A 4WF4A 4LLRA 2JZTA 2H6ZA 1R4WA 3RPNA 4MCUA 5J4UA 1A0RP 5HFIA 2LTKA 3TB2A 2JU5A 2IMEA 3IA1A 4E8HA 5A4WA 2L5OA 3EU3A 3EMXA 4AJ8A 1LBKA 2RM6A 2EIOA 3BD2A 3UOMA 1XW5A 3IAM2 3ERFA 2C0GA 2LRNA 4ECJA 1BEDA 2VO4A 2HFDA 1QGVA 1F2EA 5AN1A 3GFKA 3GV1A 2WCIA 3GX8A 1MDJA 3ERGA 4YH2A 1X5EA 4JU5A 4K8MA 4FYCA 3IV4A 4QL9A 1DUGA 1TKDB 2DJKA 2YN1A 4L5OA 3H79A 3I9V2 2TRXA 3P90A 2H72A 2C8UA 3EE2A 2CX3A 2GZYA 3F3QA 1WMJA 2PWJA 6GSSA 3G7IA 4MK3A 1SK2A 1GSYA 2HSYA 5D9WA 2P5RA 2V2GA 5LD0A 3TJKA 1Y6EA 5GAND 2FWFA 3DD3A 2C3NA 2K6VA 4YQMA 3GURA 1TI1A 3KIJA 1FVKA 4LA1A 3L9SA 2PGTA 3UEMA 2F9SA 4JEDA 2IFQB 1SJIA 1ZL9A 5D8IA 4WETA 2GGTA 4BL7A 5DAKB 1GULA 4AJ7A 1GUHA 1MD4A 1HNAA 2B7KA 4PUAA 2KUCA 3D22A 4RI6A 2E7PA 2C0FA 1GWCA 2LUSA 3CRUA 3NIVA 1ZMAA 3RHBA 2O8VB 2LNTA 2N5FA 4Z7XA 2FGXA 4NHZA 1A0FA 2GDRA 2JSZA 2LKUA 3FY7A 4IKHA 5KN3A 4POBA 4HDEA 4K7IA 2Z9SA 3VPQA 2N5AA 5F8BA 4GRFA 5DBQA 2VL3A 1XVQA 2VD0A 4BWQA 3WGEA 4GQCA 4FYBA 3LXTA 3D4TA 4MH3A 3EYTA 4EXJA 3ZMLA 4ZBDA 1SKRB 1Y25A 2VAFA 1AXDA 1XWCA 5J9BA 4EDYA 1OYJA 3C1SA 5HR1A 4KDYA 3ERWA 3KD0A 1SK1A 3KZQA 1YKCA 2NVLA 5IMAA 4IP6A 4TOPA 3F8UA 1XCCA 2V32A 5A4VA 1EP8A 3IDVA 3QPMA 4XTSA 1PKZA 1FG4A 4PQIA 2X99A 2WB9A 4MJEA 4NMUA 1AAZA 5CREA 5GSSA 3J7Yb 4PXOA 1XWAA 4IVFA 5ID2B 2AAWA 1SYXA 4H86A 5HFKA 2XC2A 5J41A 1JLVA 4ECCA 1ZOFA 2H8LA 1OVNA 2MBTA 2K18A 13GSA 1Q98A 2VOCA 1X5DA 1I5GA 4PURA 5CRGA 4LL4B 4ZXGA 4HEA2 2F8AA 5HQPA 4JE1A 1OKDA 2K9FA 2NDOA 3P7XA 2BJXA 4HQSA 1EEJA 4QL7A 3HZ8A 5IMFA 3NOFA 2F51A 2VD1A 3DGQA 3IRAA 1TI3A 5H5SA 2HLSA 4J2FA 4BVYA 1QMVA 1DE2A 1K3LA 4K1FA 3CXGA 3ZL5A 3AY8A 2YPMA 5D96A 2XPDA 4HU9A 4WR5A 4XIHA 4HJ2A 4RUVA 2FA4A 3VPTA 1JZWA 4TN8A 2VM1A 3D21A 4KW6A 2RIIA 4E8EA 3V1WA 2GT6A 2R2JA 5J3RA 1U88A 3PINA 4G19A 5COHA 4WEYA 4NXIA 3LYKA 2B5XA 3M9KA 5G1LA 3LSZA 3W6GA 1ERVA 5IM9A 1DSBA 2N5BA 5IOXA 2DMLA 1GLPA 2C80A 5C04A 4GTUA 3F4RA 3Q6OA 3TKQA 1ML6A 2HNLA 4N0ZA 4TR1B 1K0BA 2B1LA 2JL4A 3E3EA 1YY7A 1K0NA 3DKSA 4JBBA 2AB6A 3QDNA 1AIUA 2HYXA 1K0OA 1M99A 1SK0A 4MPGA 2DMMA 2PERA 2X8HA 3CTFA 1J0FA 1MTCA 4YAVA 4BPYA 4MMMA 4PX1A 3GUSA 5IIZA 3C1RA 3M3MA 4POKA 2VM2A 2ON7A 3GHAA 2YJHA 6GSXA 1FB0A 1GUMA 4ZL8A 3L78A 2ON5A 1QQ2A 1SL1B 1O85A 2K8VA 2ES7A 5G2ZA 1C72A 1R26A 1XWGA 1ZYQB 2WFCA 2B5YA 4KNDA 1T00A 2ALBA 2KLXA 2E2GA 3LYPA 5JCUA 3I69A 2GSSA 5G5EA 1A8YA 1SD9A 4IW9A 1BAYA 5DALA 2HT9A 4KE3A 4CHSA 3H93A 1X9WB 3CTGA 5GZZB 2OKAA 5IQYA 1O7UA 1GSEA 1NSWA 1K3OA 4TKYA 3IOSA 2EIRA 2MMZA 4MJBA 3QAGA 2F8FA 4TXVA 1ABAA 3FEUA 4ZIJA 1GH2A 4TXOA 4KAEA 4MZWA 3N5OA 1SKWB 4K2DA 1OC9B 4RQRA 2OA7A 1DBYA 3HJPA 2HZEA 4X0XA 5D9XA 2FLSA 3APQA 3TJJA 3U5RE 2G0FA 4MF5A 1A8LA 3TUEA 1SL2B 2GS3A 3EWLA 4GSSA 4I2TA 4ZB6A 4V1Ag 1EV9A 4EDZA 2P5QA 4BWSA 5J5NA 1TU7A 2HRFA 3ZYWA 2JACA 4PQ1A 3GSSA 1TXXA 2IWTA 2DJ1A 2O7KA 2VLUA 3ZLPA 4TR4A 3HD5A 3TDGA 1YKAA 1O8XA 3GKMA 2AUVA 2H6YA 3ZRDA 1YJ6A 2DBCA 5DJMA 1VF2A 2X8GA 2BMXA 5D9TA 1SL0B 3HXSA 18GSA 5GSTA 2C0DA 3A2WA 3F9UA 4IN0A 2V41A 1W4VA 3A2VA 5KN2A 3VLNA 5ECQB 2IMDA 4F2IA 2GZPA 3MSZA 1GTIA 2L57A 4KH7A 3TGZA 4ISDA 1GTAA 3DXBA 3GA4A 5KEJA 4D73B 1AQXA 2O89A 2IN3A 2LJRA 1I9DA 5JWRB 2VCWA 3IE3A 1X5CA 2OE3A 3HJMA 1WOUA 3PGTA 3TJFA 3US3A 3P8WA 8GSSA 2XPEA 4OFMA 2GLRA 2FNOA 4ML1A 2FWHA 4L8EA 3LFLA 1ILOA 1KNGA 2QC7A 2AJQB 2HSHA 5EL8A 2FCHA 1VF4A 1XWBA 4DSQA 4TR0A 4HZ2A 3D0ZA 1OE8A 3EC3A 1ZZYA 2RM5A 4ZBAA 5DALB 1WJKA 2H30A 2OE0A 2HZFA 2YV7A 2RLIA 1Z6NA 1Z5YE 3HYPA 3I43A 3UL3A 1ZYEA 1PMTA 2M72A 3GN3A 4EE0A 1T8EB 3C8EA 5JWOB 3F3RA 1OAZA 1EV4A 1K0CA 2H74A 2L4QA 2PUKC 1FO5A 2PPTA 1YF1A 3RAZA 1JZRA 5EVOA 2L6DA 1N8JA 1TW9A 1G6YA 3KMOA 1RK4A 5CRHA 1FOVA 4J56E 3ZREA 2CVKA 2VL2C 4ZILA 3CYNA 2LRTA 2R5GA 1S3AA 4POLA 1O6JA 4PNGA 3UMAA 4Q5NA 4L0UA 2H73A 2LEGA 3FZ5A 3IXRA 3EINA 5DVBA 3CMIA 4V2NA 3H8QA 5D9VA 4GXZA 3FYGA 4ILFA 2H66A 3BCIA 4GSNA 3QFAC 4KCAA 2V1MA 3FRCA 2LQQA 4KUNA 4XCSA 1S3CA 1XIYA 1GTUA 4EL1A 3A3TA 3IC4A 1RQMA 1ST9A 2LJAA 4GWRA 3FZAA 1THXA 4XS4A 3K8NA 1LU4A 2VLVA 5HR0A 3SWLA 2V6OA 2J23A 5JCGA 4MDCA 5CRWA 3TKRA 2A4VA 3E9JB 2CX4A 4XRDA 4ID0A 4TR3A 3M1GA 3IAS2 5GAPD 3KH9A 3LWAA 4ULXA 5H5RA 3RBTA 3R2QA 5IO0A 3GH9A 2H71A 2JZRA 3QAWA 2H0HA 1UVZA 5G1KA 4GQFA 2YWOA 3TKPA 1A2LA 1K0AA 2YWMA 3VI7A 4FO5A 4LL1B 1IYIA 2HI7A 3RPPA 1Z3EA 3KM6A 5E59A 5DCHA 4MJCA 3TRQA 3VFIA 10GSA 1EWXA 4ECIA 1THOA 1PL1A 4IP1A 4JR4A 1EZKA 1UN2A 3GYKA 1JHBA 2E0QA 3F63A 11GSA 1GP1A 4KSOA 4LMWA 1X9MB 4KB3A 1ZCPA 3F0IA 1F3BA 2PMTA 2AV4A 4KX4A 1R5PA 2GQKA 2X64A 2OBKA 3BCKA 4HQZA 1GNWA 5IMVA 2TRCP 5G30A 2CAQA 1USBA 1PSQA 2PN8A 5DQSA 4V2LA 1TRWA 5DDLA 2I1UA 3GKXA 4MABA 1OC8A 2GQLA 1O8WA 9GSSA 3TKSA 2K8SA 1M9BA 5B6NA 5IPGA 4MZCA 2HE3A 4KCEA 4HZ4A 5A5KA 4AF2A 2OJLA 3HY2A 5ECPB 4GSTA 5IOWA 3UARA 5HR3A 2VCXA 1K0MA 1Z6MA 3FHKA 3BJ5A 2I81A 3F4TA 1N2AA 2CVBA 5D73A 1PKWA 3J7Yk 4AJ6A 2X8CA 4MH2A 2IMKA 5F0GA 1GLQA 4ECBA 3FK8A 1JFUA 1TRUA 3FZ9A 17GSA 4XS4B 3HDCA 3WYWA 2C0EA 4EO3A 22GSA 2QGVA 1U3IA 2QSIA 2GSRA 5FHIA 5G31A 1DE1A 1XWKA 3UVTA 5ELAA 2VIMA 2AHEA 1ZGNA 2LRCA 3FR6A 3I6AA 14GSA 4EC0A 2JADA 4MF7A 4KDXA 4HJMA 1M2DA 4ACSA 2A2SA 3GTUA 2R37A 5G5FA 4K7NA 2QKEA 5CYYA 4O5RA 2L59A 2B3SA 1EP7A 3UIWA 1M7TA 3D4MA 3KTBA 2DIZA 4P3YB 3U6VA 3KGKA 4OO4A 4BA7A 3KP9A 4ML6A 3G9BA 2H0GA 1UA5A 2FD3A 5JCWA 2EC4A 1CQGA 3M9JA 1XVWA 2WULA 3GX0A 1PRXA 4N30A 3CBUA 6GSWA 1M9AA 1EOGA 3KMNA 5ECOB 2LNSA 2B6MA 5E4WA 5A4UA 2GSTA 2MBSA 7GSSA 3MAKA 1OC3A 2VLTA 1WP0A 1XW6A 3P2AA 1PA3A 5F05A 5IMCA 4FH8A 1X0RA 3LXZA 4WR4A 5LCZA 2C3TA 2O87A 3L4NA 2I4AA 4TRXA 3UBKA 5ECLB 1BJXA 6GSTA 2DJ2A 5AISA 1B9YC 2CZ2A 1V58A 5ECSA 5IPHA 2XHFA 3TKSE 1WE0A 3HCZA 4NPBA 3C7MA 4MLYA 6GSYA 4K6XA 4V1Ap 3KP8A 4X43A 3ZMKA 2PVOC 1FW1A 3FR3A 2FWEA 5H5QA 2CVDA 4WBJA 3RDWA 3E0UA 5B8BA 5ECRB 3DEXA 3HVVA 1WRYA 1RW1A 2GVPA 2KP1A 2CAIA 3F4SA 1YEPA 3L0HA 4I2UA 4N0VA 1QUWA 1BX9A 2OE1A 2WRTA 3PR8A 1Z7RA 1YF0A 3Q18A 1J08A 1M0UA 2AYTA 3M8NA 1GSSA 4F03A 5C00A 3APOA 3QMXA 3DVWA 3ZVJA 4OMVA 3LG6A 5ECMB 3W8SA 4XRAA 1VGLA 3L9UA 1XXUA 4OO5A 1GRXA 3QAVA 3A5WA 1HYUA 2C4JA 2CA8A 4PNFA 3GL5A 2VCTA 1ERTA 5DCGA 2YZHA 4ZL7A 3GRXA 1MD3A 1SENA 3MWHA 4MJAA 2H1DA 2MZCA 1SU9A 4DSRA 4XS6A 2L5LA 2L6CA 3KCMA 4GCIA 4NWYA 2DLXA 5F07A 5HFGA 3M0FA 2VL9A 1GSDA 2XBQA 2H6XA 4EVMA 3ME8A 3HKRA 5CNWA 4EF0A 4I8BA 4G9HA 5ECIB 3BBYA 3GL3A 1V57A 1JZDA 4XS1A 1PX7A 1TU8A 3MDKA 3QCPA 1YZXA 2WS2A 1SD8A 3CSJA 4G2EA 3ZFLA 2FA8A 2H1BA 2YWIA 1YQ1A 3DWVA 4PUFC 2H19A 4JRRA 3FZ4A 2P0GA 1AQVA 5AIXA 1GSQA 2I3YA 1F9MA 2CV4A 1XFLA 2BTOT 4N10A 5CP1A 4TVEA 1LJRA 5ABRA 4OFNA 1JLWA 1EGOA 1A2JA 1VRSD 4WKWA 3KTLA 4WXTA 3ZIJA 4F0CA 2RUEA 5ENUA 5L71A 1MEKA 1HNBA 5IO2A 5ECKB 2D2ZA 3QR6A 4MP4A 4MF6A 2FHEA 3TJBA 4JZQA 3D6IA 1YDKA 2DJ3A 1K0DA 2VCZA 3GMFA 12GSA 5JWQB 2LS5A 4XHMA 2VCQA 3IK7A 1E6BA 3EVIA 4TXOB 2C1YA 4IQAA 2H01A 2HZEB 1URMA 4NV2A 1H4OA 1J9BA 2JZSA 3Q74A 19GSA 5INYA 4ZB9A 4GF0A 1XOBA 3QOUA 3GIXA 2H1GA 2CZ3A 4YAPA 5ID2A 4DSSA 2GQMA 4K9ZA 1F3AA 2FUG2 1GSFA 1WPIA 3PH9A 4O32A 3VK9A 1AQWA 3WT2A 4I97A 1FAAA 3H1NA 2IL3A 4HS1A 3UVHA
chains in the Genus database with same CATH superfamily
1GSUA 5IMDA 3O76A 2HXKA 2MMAA 5IMZA 3G7JA 1BYEA 2PVQA 2M46A 5ECNB 2RUFA 1U3AA 4F82A 3LEFA 3QFBC 3DMLA 2V6KA 2A2RA 2ZNMA 3FW2A 4KDUA 5KN0A 1HQOA 5B6MA 1EOHA 1R5AA 4KGIA 4EIQA 4KA0A 1FVJA 2R6KA 2E2MA 2LSTA 3EPTA 2EIQA 4ZL9A 4G10A 1TTZA 2MMNA 1AW9A 3VWXA 3TRPA 3MNGA 4CY6A 1PN9A 2FY6A 2WGRA 4HOJA 4TR1A 3R3EA 3JCML 2L4CA 3UJ1A 3KEBA 2P31A 1HD2A 2NTOA 2YNXA 5DJLA 3LQ7A 1O81A 1ERUA 2QA1A 1OE7A 1E2YA 4IJ3A 4IGJA 5HR2A 3GKNA 3HVNA 4X1UA 1KBNA 4IBPA 2OBIA 5KN1A 3EMPA 1W89A 4IS0A 1SYRA 1XZOA 2I9HA 3VURA 2KOKA 3ISOA 2PBJA 3QD9A 2H76A 4K0NA 3DVXA 2M80A 2YANA 1T7PB 3TOTA 1NM3A 3NZNA 1Z9HA 2REMA 3WD6A 4JR6A 2LQOA 5AIVA 3MIXA 1PD21 2F3MA 4YQVA 4Q5QA 3HVSA 3GH6A 1IYHA 5F06A 1EGRA 4O7HA 3KH7A 1X9SB 5CAXA 2CQ9A 4OCEA 1G7OA 3TJGA 2R0CA 4DSSB 2GT5A 3BOAA 4HI7A 4K0GA 1V9WA 2OACA 5AGYA 4CY8A 5CRDA 1TK0B 3HHVA 3UAPA 1G6WA 1SKSB 3EU4A 3VI5A 4EUYA 4L0WA 3HA9A 1TK5B 1OC9A 1B4QA 4PQHA 4MZBA 3WGXA 1T4YA 4NHWA 1ON4A 1U6TA 4CDOA 4F9ZA 5LNKe 3IPZA 5CO3A 1BQ7A 3LJRA 4OFTA 2C3QA 3HVXA 4WBRD 3F6FA 3KXOA 2KHPA 4LMVA 3G7YA 2KP2A 3IHQA 4BVXA 1ACVA 1WIKA 2A2PA 4N11A 1CQHA 1TK8B 1KTEA 3CRTA 4IQ1A 5EPFA 4NAXA 2NPBA 1SJ6A 5ELGA 1F37A 3LORA 1FB6A 1UC7A 4HU7A 1EEMA 4O92A 5B7CA 3ME7A 1OKTA 4IELA 3KJYA 1KEBA 2XBIA 1BG5A 2YCDA 4I6XA 4IHUA 1S3DA 1PQNA 1NW2A 1NHYA 1ZYNA 1HNCA 2YJ7A 4Q5FA 1QFNA 2WDUA 1TOFA 3VWVA 4EIPA 5BMUA 3VWUA 1QK8A 2HRAA 4I5QA 3FKFA 1A24A 2MMOA 2TIRA 2O85A 4J57E 4D73A 1XW9A 3UBLA 1AUCA 2CT6A 4DEJA 3EURA 4X4JA 3ZVJD 1TJDA 2VUPA 3ZIVA 2DJ0A 1V40A 5B8AA 6GSVA 1F6MC 3OR5A 4ICYA 1XPVA 3TOUA 1K3YA 4O5UA 5FWGA 4OWYA 2GTUA 1NHOA 5KOWA 2H70A 1A2MA 3APSA 4Q5RA 1T1VA 4EKZA 5FT3A 3WT1A 2ZUPA 4YQUA 3GSTA 1H75A 1PX6A 3VWWA 3D5JA 2JSYA 4F0BA 3TKSC 4GLTA 3ZZXA 3ZTLA 3IBHA 2HRNA 3CSHA 3ZITA 3WGDA 4POMA 2YOIA 1PN0A 2DC5A 1VF3A 1MDIA 2FWGA 4ZBBA 3A2XA 1TRVA 1M2AA 4FIWA 5D93A 4G0IA 2YV9A 2YP6A 3TCOA 2IMIA 2DSAA 1XBSA 2H0IA 3ED3A 1PL2A 1GL8A 2B7JA 1M2BA 4V2MA 3Q19A 2IJYA 3CSIA 4WF5A 5DQYA 2DIYA 2R3XA 4K7OA 4OCFA 1WWJA 4DVCA 4OD7A 1FHEA 2VL2A 1MDKA 4CW9A 2G2QA 2YWNA 3HJOA 3RHCA 3DIEA 2J9HA 2VCVA 2IPAA 4PGTA 4TW5A 2DJJA 1GTBA 5J9CA 2OADA 3SBCA 1PGTA 4RQXA 2LV3A 3GTUB 1M3JA 1SJZA 3LGCA 4KSMA 5ECHB 1A23A 2R4VA 2IIYA 1B9XC 3C71A 4G0KA 2WJUA 20GSA 1V2AA 3DRNA 1YEXA 4QQ7A 1U87A 3H4KA 3IR4A 2IFQA 1G0TA 4L5LA 1AC1A 1GUKA 4MPFA 2LJKA 1VF1A 2PU9C 3F6DA 2B1KA 5DAKA 3GKKA 1GNEA 4MA9A 4K5SA 1T4ZA 3ZFBA 4AGSA 4Z2TA 1O73A 1B4PA 1JZOA 1R7HA 1B48A 3FR9A 16GSA 3GNJA 3DYRA 3L9VA 1T3BA 2H75A 3HZ4A 4FYUA 4IJIA 2MYGA 1QXHA 3IK9A 3O3TA 2ZCTA 1XOAA 1V98A 3S9FA 2IMFA 4HUAA 2H1AA 2GSQA 1Q4JA 4ZB8A 5EY6A 1B8XA 2WZ9A 4NV5A 1Z7PA 4RI7A 3W8JA 3TRXA 1G7EA 2YZUA 2NBSA 2GZZA 3O6TA 1TDIA 3C73A 3N9JA 2B5EA 1TRSA 1ERWA 6GSUA 4HSCX 1TP9A 4WF4A 4LLRA 2JZTA 2H6ZA 1R4WA 3RPNA 4MCUA 5J4UA 1A0RP 2HSMA 5HFIA 2LTKA 3TB2A 2JU5A 2IMEA 3IA1A 4E8HA 5A4WA 2L5OA 3EU3A 3EMXA 4AJ8A 1LBKA 2RM6A 2EIOA 3BD2A 3UOMA 1XW5A 3IAM2 3ERFA 2C0GA 2LRNA 2HRKA 4ECJA 1BEDA 2VO4A 2HFDA 2DKHA 1QGVA 1F2EA 5AN1A 4PTSA 3GFKA 3GV1A 2WCIA 3GX8A 1MDJA 3ERGA 4YH2A 1X5EA 4JU5A 4K8MA 4FYCA 3IV4A 4QL9A 1DUGA 1TKDB 2DJKA 2YN1A 4L5OA 3H79A 3I9V2 2TRXA 3P90A 4K2XA 2H72A 2C8UA 3EE2A 2CX3A 2GZYA 3F3QA 3IHGA 1WMJA 4Z2RA 2PWJA 6GSSA 3G7IA 4MK3A 1SK2A 1GSYA 2HSYA 5D9WA 2P5RA 2V2GA 5LD0A 3TJKA 1Y6EA 5GAND 2FWFA 1S3RA 3DD3A 2C3NA 2K6VA 4YQMA 3GURA 2DKIA 1TI1A 3CQFA 3KIJA 1FVKA 4LA1A 3L9SA 4A5PA 2PGTA 3UEMA 2F9SA 4JEDA 2IFQB 1SJIA 1ZL9A 5D8IA 4WETA 2GGTA 4BL7A 5DAKB 1GULA 4AJ7A 1GUHA 1MD4A 1HNAA 2B7KA 4PUAA 2KUCA 3D22A 4RI6A 2E7PA 2C0FA 1GWCA 2LUSA 3CRUA 3NIVA 1ZMAA 3RHBA 2O8VB 2LNTA 2N5FA 4Z7XA 2FGXA 4NHZA 1A0FA 2GDRA 2JSZA 2LKUA 3FY7A 4IKHA 5KN3A 4POBA 4HDEA 4K7IA 2Z9SA 3VPQA 2N5AA 5F8BA 4GRFA 5DBQA 2VL3A 4MNNA 1XVQA 2VD0A 4BWQA 3WGEA 4GQCA 4FYBA 3LXTA 3D4TA 4MH3A 3EYTA 4EXJA 3ZMLA 4ZBDA 1SKRB 1Y25A 2VAFA 1AXDA 1XWCA 5J9BA 4EDYA 1OYJA 3C1SA 5HR1A 4KDYA 3ERWA 3KD0A 1SK1A 3KZQA 1YKCA 2NVLA 5IMAA 4IP6A 4TOPA 3F8UA 1XCCA 2V32A 5A4VA 1EP8A 3IDVA 3QPMA 4XTSA 1PKZA 1FG4A 4PQIA 2X99A 2WB9A 4MJEA 4NMUA 1AAZA 5CREA 5GSSA 3J7Yb 4PXOA 1XWAA 4IVFA 5ID2B 2AAWA 1SYXA 4H86A 5HFKA 2XC2A 5J41A 1JLVA 4ECCA 1ZOFA 2H8LA 1OVNA 2MBTA 2K18A 13GSA 1Q98A 2VOCA 1X5DA 1I5GA 4PURA 5CRGA 4LL4B 4ZXGA 4HEA2 2F8AA 5HQPA 4JE1A 1OKDA 2K9FA 2NDOA 3P7XA 2BJXA 4HQSA 1EEJA 4QL7A 3HZ8A 5IMFA 3NOFA 2F51A 2VD1A 3DGQA 3IRAA 1TI3A 5H5SA 2HLSA 4J2FA 4BVYA 2X4AA 1QMVA 1DE2A 1K3LA 4K1FA 3CXGA 3ZL5A 3AY8A 2YPMA 5D96A 2XPDA 4HU9A 4WR5A 4XIHA 4KF9A 4HJ2A 4RUVA 2FA4A 3VPTA 1JZWA 4TN8A 2VM1A 3D21A 4KW6A 2RIIA 4E8EA 3V1WA 2GT6A 2R2JA 5J3RA 1U88A 3PINA 4G19A 5COHA 4WEYA 4NXIA 3LYKA 2B5XA 3M9KA 5G1LA 4BL7B 3LSZA 3W6GA 1ERVA 5IM9A 1DSBA 2N5BA 5IOXA 2DMLA 1GLPA 4O5QA 2C80A 5C04A 4GTUA 3F4RA 3Q6OA 3TKQA 1ML6A 2HNLA 4N0ZA 4TR1B 1K0BA 2B1LA 2JL4A 3E3EA 1YY7A 1K0NA 3DKSA 4JBBA 2AB6A 3QDNA 1AIUA 2HYXA 1K0OA 5KOXA 1M99A 1SK0A 4MPGA 2DMMA 2PERA 2X8HA 3CTFA 1J0FA 1MTCA 4YAVA 4BPYA 4MMMA 4PX1A 3GUSA 5IIZA 3C1RA 3M3MA 4POKA 2VM2A 2ON7A 3GHAA 2YJHA 6GSXA 1FB0A 1GUMA 4ZL8A 3L78A 2ON5A 1QQ2A 1SL1B 1O85A 2K8VA 2ES7A 5G2ZA 1C72A 1R26A 1XWGA 1ZYQB 5BRTA 2WFCA 2B5YA 4KNDA 1T00A 2ALBA 2KLXA 2E2GA 3LYPA 5JCUA 3I69A 2GSSA 5G5EA 1A8YA 1SD9A 4IW9A 1BAYA 5DALA 2HT9A 4KE3A 4CHSA 3H93A 1X9WB 3CTGA 5GZZB 2OKAA 5IQYA 1O7UA 1GSEA 1NSWA 1K3OA 4TKYA 3IOSA 2EIRA 2MMZA 4MJBA 3QAGA 2F8FA 4TXVA 1ABAA 3FEUA 4ZIJA 1GH2A 4TXOA 4KAEA 4MZWA 3N5OA 1SKWB 4K2DA 1OC9B 4RQRA 2OA7A 1DBYA 4BVYB 3HJPA 2HZEA 4X0XA 5D9XA 2FLSA 3APQA 3TJJA 3U5RE 2G0FA 3IC8A 4MF5A 1A8LA 3TUEA 1SL2B 2GS3A 3EWLA 4GSSA 4I2TA 4ZB6A 4V1Ag 4BVXB 1EV9A 4EDZA 2P5QA 4BWSA 5J5NA 1TU7A 2HRFA 3ZYWA 2JACA 4PQ1A 3GSSA 1TXXA 2IWTA 2DJ1A 2O7KA 2VLUA 3ZLPA 4TR4A 3HD5A 3TDGA 1YKAA 1O8XA 3GKMA 2AUVA 2H6YA 3ZRDA 4K5RA 1YJ6A 2DBCA 5DJMA 1VF2A 2X8GA 2BMXA 5D9TA 1SL0B 3HXSA 18GSA 5GSTA 2C0DA 3A2WA 3F9UA 4IN0A 2V41A 1W4VA 3A2VA 5KN2A 3VLNA 5ECQB 2IMDA 4F2IA 2GZPA 3MSZA 1GTIA 2L57A 4KH7A 3TGZA 4ISDA 1GTAA 3DXBA 3GA4A 5KEJA 4D73B 1AQXA 2O89A 2IN3A 2LJRA 1I9DA 5JWRB 2VCWA 3IE3A 1X5CA 2OE3A 3HJMA 1WOUA 3PGTA 3TJFA 3US3A 3P8WA 8GSSA 2XPEA 4OFMA 2GLRA 2FNOA 4ML1A 2FWHA 4L8EA 3LFLA 1ILOA 1KNGA 2QC7A 2AJQB 2HSHA 5EL8A 1ZYPA 2FCHA 1VF4A 1XWBA 4DSQA 4TR0A 4HZ2A 3D0ZA 1OE8A 3EC3A 1ZZYA 2RM5A 4ZBAA 5DALB 1WJKA 2H30A 2OE0A 2HZFA 2YV7A 2RLIA 1Z6NA 1Z5YE 3HYPA 3I43A 3UL3A 1ZYEA 1PMTA 4YKFA 2M72A 3GN3A 4EE0A 1T8EB 3C8EA 5JWOB 3F3RA 1OAZA 1EV4A 1K0CA 2H74A 2L4QA 2PUKC 1FO5A 2PPTA 1YF1A 3RAZA 1JZRA 5EVOA 2L6DA 1N8JA 1TW9A 1G6YA 3KMOA 1RK4A 5CRHA 1FOVA 4J56E 3ZREA 2CVKA 2VL2C 4ZILA 3CYNA 2LRTA 2R5GA 1S3AA 4POLA 1O6JA 4PNGA 3UMAA 4Q5NA 4L0UA 2H73A 2LEGA 3FZ5A 2R0PA 3IXRA 3EINA 5DVBA 3CMIA 4V2NA 3H8QA 4BIKA 5D9VA 4GXZA 3FYGA 4ILFA 2H66A 3BCIA 4GSNA 3QFAC 4KCAA 2V1MA 3FRCA 2LQQA 4KUNA 4XCSA 1S3CA 3PPUA 1XIYA 2X49A 1GTUA 4EL1A 3A3TA 3IC4A 1RQMA 1ST9A 2LJAA 4GWRA 3FZAA 1THXA 4XS4A 3K8NA 1LU4A 2VLVA 2UZ8A 5HR0A 3SWLA 2V6OA 2J23A 5JCGA 4MDCA 5CRWA 3TKRA 2A4VA 3E9JB 2CX4A 4XRDA 4ID0A 4TR3A 3M1GA 2R0GA 3IAS2 5GAPD 3KH9A 3LWAA 4ULXA 5H5RA 3RBTA 3R2QA 5IO0A 3GH9A 2H71A 2JZRA 3QAWA 2H0HA 1UVZA 5G1KA 4GQFA 2YWOA 3TKPA 1A2LA 1K0AA 2YWMA 3VI7A 4FO5A 4LL1B 1IYIA 2HI7A 3RPPA 1Z3EA 4FQUA 3KM6A 5E59A 1M3IA 5DCHA 4MJCA 3TRQA 3VFIA 10GSA 1EWXA 4ECIA 1THOA 1PL1A 4IP1A 4JR4A 1EZKA 1UN2A 3GYKA 1JHBA 2E0QA 3F63A 11GSA 1GP1A 4KSOA 4LMWA 1X9MB 4KB3A 1ZCPA 3F0IA 1F3BA 2PMTA 2AV4A 4KX4A 1R5PA 2GQKA 2X64A 2OBKA 3BCKA 4HQZA 1GNWA 5IMVA 2TRCP 5G30A 2CAQA 1USBA 1PSQA 2PN8A 5DQSA 4V2LA 1TRWA 5DDLA 2I1UA 3GKXA 4MABA 1OC8A 2GQLA 3MYDA 1O8WA 9GSSA 3TKSA 2K8SA 1M9BA 5B6NA 5IPGA 4MZCA 2HE3A 4KCEA 4HZ4A 5A5KA 4AF2A 2OJLA 3HY2A 4Z2UA 5ECPB 4GSTA 5IOWA 3UARA 5HR3A 2VCXA 1K0MA 1Z6MA 3FHKA 3BJ5A 2I81A 3F4TA 1N2AA 2CVBA 5D73A 1PKWA 3J7Yk 4AJ6A 2X8CA 4MH2A 2IMKA 5F0GA 1GLQA 4ECBA 3FK8A 1JFUA 1TRUA 3FZ9A 17GSA 4XS4B 3HDCA 3WYWA 2C0EA 4EO3A 22GSA 2QGVA 1U3IA 2QSIA 2GSRA 5FHIA 5G31A 1DE1A 1XWKA 3UVTA 5ELAA 2VIMA 2AHEA 1ZGNA 2LRCA 3FR6A 3I6AA 14GSA 4EC0A 2JADA 4MF7A 4KDXA 4HJMA 1M2DA 4ACSA 2A2SA 3GTUA 2R37A 5G5FA 4K7NA 2QKEA 5CYYA 4O5RA 2L59A 2B3SA 1EP7A 3UIWA 1M7TA 3D4MA 3KTBA 2DIZA 4P3YB 3U6VA 3KGKA 4OO4A 4BA7A 3KP9A 4ML6A 3G9BA 2H0GA 1UA5A 2FD3A 5JCWA 2EC4A 1CQGA 3M9JA 1XVWA 2WULA 3GX0A 1PRXA 4N30A 3CBUA 6GSWA 1M9AA 1EOGA 3KMNA 5ECOB 2LNSA 2B6MA 5E4WA 5A4UA 2GSTA 2MBSA 7GSSA 3MAKA 1OC3A 2VLTA 1WP0A 1XW6A 3P2AA 1PA3A 5F05A 5IMCA 4FH8A 1X0RA 3LXZA 4WR4A 5LCZA 2C3TA 2O87A 3L4NA 1FOHA 2I4AA 4TRXA 3UBKA 5ECLB 1BJXA 4G0LA 6GSTA 2DJ2A 5AISA 1B9YC 2CZ2A 1V58A 5ECSA 5IPHA 2XHFA 3TKSE 1WE0A 3HCZA 4NPBA 3C7MA 4MLYA 6GSYA 4K6XA 4V1Ap 3KP8A 4X43A 3ZMKA 2PVOC 3A5IA 1FW1A 3FR3A 2FWEA 5H5QA 2CVDA 4WBJA 3RDWA 3E0UA 5B8BA 5ECRB 3DEXA 3HVVA 1WRYA 1RW1A 4YKGA 2GVPA 2KP1A 2CAIA 3F4SA 1YEPA 3L0HA 4I2UA 4N0VA 1QUWA 2A4HA 1BX9A 2OE1A 2WRTA 3PR8A 1Z7RA 1YF0A 3Q18A 1J08A 1M0UA 2AYTA 3M8NA 1GSSA 4F03A 5C00A 3APOA 3QMXA 3DVWA 3ZVJA 4OMVA 3LG6A 1XG8A 5ECMB 3W8SA 4XRAA 1VGLA 3L9UA 1XXUA 4OO5A 1GRXA 3QAVA 3A5WA 1HYUA 2C4JA 2CA8A 4PNFA 3GL5A 2VCTA 4USSA 3LW9A 1ERTA 5DCGA 2YZHA 4ZL7A 3GRXA 1MD3A 1SENA 3MWHA 4MJAA 2QA2A 2H1DA 2MZCA 1SU9A 4DSRA 4XS6A 2L5LA 2L6CA 3KCMA 4GCIA 4NWYA 2DLXA 5F07A 5HFGA 3M0FA 2VL9A 1GSDA 2XBQA 2H6XA 4EVMA 3ME8A 3HKRA 5CNWA 4EF0A 4I8BA 4G9HA 5ECIB 3BBYA 3GL3A 1V57A 1JZDA 4XS1A 1PX7A 1TU8A 3MDKA 3QCPA 1YZXA 2WS2A 1SD8A 3CSJA 4G2EA 3ZFLA 2FA8A 2H1BA 2YWIA 1YQ1A 3DWVA 4PUFC 2H19A 4JRRA 3FZ4A 2P0GA 1AQVA 5AIXA 1GSQA 2I3YA 1F9MA 2CV4A 1XFLA 2BTOT 4N10A 5CP1A 4TVEA 1LJRA 5ABRA 4OFNA 1JLWA 1EGOA 1A2JA 1VRSD 4WKWA 3KTLA 4WXTA 3ZIJA 4F0CA 2RUEA 5ENUA 5L71A 1MEKA 1HNBA 5IO2A 5ECKB 2D2ZA 3QR6A 4MP4A 4MF6A 2FHEA 3TJBA 4JZQA 3D6IA 1YDKA 2DJ3A 1K0DA 2VCZA 3GMFA 12GSA 5JWQB 2LS5A 4XHMA 2VCQA 3IK7A 1E6BA 1PFOA 3EVIA 4TXOB 2C1YA 4IQAA 2H01A 2HZEB 1URMA 4NV2A 1H4OA 1J9BA 2JZSA 3Q74A 19GSA 5INYA 4ZB9A 4GF0A 1XOBA 3QOUA 3GIXA 2H1GA 2CZ3A 4YAPA 5ID2A 4DSSA 2GQMA 4K9ZA 1F3AA 2FUG2 1GSFA 1WPIA 3PH9A 4O32A 3VK9A 1AQWA 3FMWA 3WT2A 4I97A 1FAAA 3H1NA 2IL3A 4HS1A 3UVHA
chains in the Genus database with same CATH topology
1GSUA 5IMDA 3O76A 2HXKA 2MMAA 5IMZA 3G7JA 1BYEA 2PVQA 2M46A 5ECNB 2RUFA 1U3AA 4F82A 3LEFA 3QFBC 3DMLA 2V6KA 2A2RA 2ZNMA 3FW2A 4KDUA 5KN0A 1HQOA 5B6MA 1EOHA 1R5AA 4KGIA 4EIQA 4KA0A 1FVJA 2R6KA 2E2MA 2LSTA 3EPTA 2EIQA 4ZL9A 4G10A 1TTZA 2MMNA 1AW9A 3VWXA 3TRPA 3MNGA 4CY6A 1PN9A 2FY6A 2WGRA 4HOJA 4TR1A 3R3EA 3JCML 2L4CA 3UJ1A 3KEBA 2P31A 1HD2A 2NTOA 2YNXA 5DJLA 3LQ7A 1O81A 1ERUA 2QA1A 1OE7A 1E2YA 4IJ3A 4IGJA 5HR2A 3GKNA 4X1UA 1KBNA 4IBPA 2OBIA 5KN1A 3EMPA 1W89A 4IS0A 1SYRA 1XZOA 2I9HA 3VURA 2KOKA 3ISOA 2PBJA 3QD9A 2H76A 4K0NA 3DVXA 2M80A 2YANA 1T7PB 3TOTA 1NM3A 3NZNA 1Z9HA 2REMA 3WD6A 4JR6A 2LQOA 5AIVA 3MIXA 1PD21 2F3MA 4YQVA 4Q5QA 3HVSA 3GH6A 1IYHA 5F06A 1EGRA 4O7HA 3KH7A 1X9SB 5CAXA 2CQ9A 4OCEA 1G7OA 3TJGA 2R0CA 4DSSB 2GT5A 3BOAA 4HI7A 4K0GA 1V9WA 2OACA 5AGYA 4CY8A 5CRDA 1TK0B 3HHVA 3UAPA 1G6WA 1SKSB 3EU4A 3VI5A 4EUYA 4L0WA 3HA9A 1TK5B 1OC9A 1B4QA 4PQHA 4MZBA 3WGXA 1T4YA 4NHWA 1ON4A 1U6TA 4CDOA 4F9ZA 5LNKe 3IPZA 5CO3A 1BQ7A 3LJRA 4OFTA 2C3QA 3HVXA 4WBRD 3F6FA 3KXOA 2KHPA 4LMVA 3G7YA 2KP2A 3IHQA 4BVXA 1ACVA 1WIKA 2A2PA 4N11A 1CQHA 1TK8B 1KTEA 3CRTA 4IQ1A 5EPFA 4NAXA 2NPBA 1SJ6A 5ELGA 1F37A 3LORA 1FB6A 1UC7A 4HU7A 1EEMA 4O92A 5B7CA 3ME7A 1OKTA 4IELA 3KJYA 1KEBA 2XBIA 1BG5A 2YCDA 4I6XA 4IHUA 1S3DA 1PQNA 1NW2A 1NHYA 1ZYNA 1HNCA 2YJ7A 4Q5FA 1QFNA 2WDUA 1TOFA 3VWVA 4EIPA 5BMUA 3VWUA 1QK8A 2HRAA 4I5QA 3FKFA 1A24A 2MMOA 2TIRA 2O85A 4J57E 4D73A 1XW9A 3UBLA 1AUCA 2CT6A 4DEJA 3EURA 4X4JA 3ZVJD 1TJDA 2VUPA 3ZIVA 2DJ0A 1V40A 5B8AA 6GSVA 1F6MC 3OR5A 4ICYA 1XPVA 3TOUA 1K3YA 4O5UA 5FWGA 4OWYA 2GTUA 1NHOA 5KOWA 2H70A 1A2MA 3APSA 4Q5RA 1T1VA 4EKZA 5FT3A 3WT1A 2ZUPA 4YQUA 3GSTA 1H75A 1PX6A 3VWWA 3D5JA 2JSYA 4F0BA 3TKSC 4GLTA 3ZZXA 3ZTLA 3IBHA 2HRNA 3CSHA 3ZITA 3WGDA 4POMA 2YOIA 1PN0A 2DC5A 1VF3A 1MDIA 2FWGA 4ZBBA 3A2XA 1TRVA 1M2AA 4FIWA 5D93A 4G0IA 2YV9A 2YP6A 3TCOA 2IMIA 2DSAA 1XBSA 2H0IA 3ED3A 1PL2A 1GL8A 2B7JA 1M2BA 4V2MA 3Q19A 2IJYA 3CSIA 4WF5A 5DQYA 2DIYA 2R3XA 4K7OA 4OCFA 1WWJA 4DVCA 4OD7A 1FHEA 2VL2A 1MDKA 4CW9A 2G2QA 2YWNA 3HJOA 3RHCA 3DIEA 2J9HA 2VCVA 2IPAA 4PGTA 4TW5A 2DJJA 1GTBA 5J9CA 2OADA 3SBCA 1PGTA 4RQXA 2LV3A 3GTUB 1SJZA 3LGCA 4KSMA 5ECHB 1A23A 2R4VA 2IIYA 1B9XC 3C71A 4G0KA 2WJUA 20GSA 1V2AA 3DRNA 1YEXA 4QQ7A 1U87A 3H4KA 3IR4A 2IFQA 1G0TA 4L5LA 1AC1A 1GUKA 4MPFA 2LJKA 1VF1A 2PU9C 3F6DA 2B1KA 5DAKA 3GKKA 1GNEA 4MA9A 4K5SA 1T4ZA 3ZFBA 4AGSA 4Z2TA 1O73A 1B4PA 1JZOA 1R7HA 1B48A 3FR9A 16GSA 3GNJA 3DYRA 3L9VA 1T3BA 2H75A 3HZ4A 4FYUA 4IJIA 2MYGA 1QXHA 3IK9A 3O3TA 2ZCTA 1XOAA 1V98A 3S9FA 2IMFA 4HUAA 2H1AA 2GSQA 1Q4JA 4ZB8A 5EY6A 1B8XA 2WZ9A 4NV5A 1Z7PA 4RI7A 3W8JA 3TRXA 1G7EA 2YZUA 2NBSA 2GZZA 3O6TA 1TDIA 3C73A 3N9JA 2B5EA 1TRSA 1ERWA 6GSUA 1TP9A 4WF4A 4LLRA 2JZTA 2H6ZA 1R4WA 3RPNA 4MCUA 5J4UA 1A0RP 2HSMA 5HFIA 2LTKA 3TB2A 2JU5A 2IMEA 3IA1A 4E8HA 5A4WA 2L5OA 3EU3A 3EMXA 4AJ8A 1LBKA 2RM6A 2EIOA 3BD2A 3UOMA 1XW5A 3IAM2 3ERFA 2C0GA 2LRNA 2HRKA 4ECJA 1BEDA 2VO4A 2HFDA 2DKHA 1QGVA 1F2EA 5AN1A 4PTSA 3GFKA 3GV1A 2WCIA 3GX8A 1MDJA 3ERGA 4YH2A 1X5EA 4JU5A 4K8MA 4FYCA 3IV4A 4QL9A 1DUGA 1TKDB 2DJKA 2YN1A 4L5OA 3H79A 3I9V2 2TRXA 3P90A 4K2XA 2H72A 2C8UA 3EE2A 2CX3A 2GZYA 3F3QA 3IHGA 1WMJA 4Z2RA 2PWJA 6GSSA 3G7IA 4MK3A 1SK2A 1GSYA 2HSYA 5D9WA 2P5RA 2V2GA 5LD0A 3TJKA 1Y6EA 5GAND 2FWFA 3DD3A 2C3NA 2K6VA 4YQMA 3GURA 2DKIA 1TI1A 3KIJA 1FVKA 4LA1A 3L9SA 4A5PA 2PGTA 3UEMA 2F9SA 4JEDA 2IFQB 1SJIA 1ZL9A 5D8IA 4WETA 2GGTA 4BL7A 5DAKB 1GULA 4AJ7A 1GUHA 1MD4A 1HNAA 2B7KA 4PUAA 2KUCA 3D22A 4RI6A 2E7PA 2C0FA 1GWCA 2LUSA 3CRUA 3NIVA 1ZMAA 3RHBA 2O8VB 2LNTA 2N5FA 4Z7XA 2FGXA 4NHZA 1A0FA 2GDRA 2JSZA 2LKUA 3FY7A 4IKHA 5KN3A 4POBA 4HDEA 4K7IA 2Z9SA 3VPQA 2N5AA 5F8BA 4GRFA 5DBQA 2VL3A 4MNNA 1XVQA 2VD0A 4BWQA 3WGEA 4GQCA 4FYBA 3LXTA 3D4TA 4MH3A 3EYTA 4EXJA 3ZMLA 4ZBDA 1SKRB 1Y25A 2VAFA 1AXDA 1XWCA 5J9BA 4EDYA 1OYJA 3C1SA 5HR1A 4KDYA 3ERWA 3KD0A 1SK1A 3KZQA 1YKCA 2NVLA 5IMAA 4IP6A 4TOPA 3F8UA 1XCCA 2V32A 5A4VA 1EP8A 3IDVA 3QPMA 4XTSA 1PKZA 1FG4A 4PQIA 2X99A 2WB9A 4MJEA 4NMUA 1AAZA 5CREA 5GSSA 3J7Yb 4PXOA 1XWAA 4IVFA 5ID2B 2AAWA 1SYXA 4H86A 5HFKA 2XC2A 5J41A 1JLVA 4ECCA 1ZOFA 2H8LA 1OVNA 2MBTA 2K18A 13GSA 1Q98A 2VOCA 1X5DA 1I5GA 4PURA 5CRGA 4LL4B 4ZXGA 4HEA2 2F8AA 5HQPA 4JE1A 1OKDA 2K9FA 2NDOA 3P7XA 2BJXA 4HQSA 1EEJA 4QL7A 3HZ8A 5IMFA 3NOFA 2F51A 2VD1A 3DGQA 3IRAA 1TI3A 5H5SA 2HLSA 4J2FA 4BVYA 2X4AA 1QMVA 1DE2A 1K3LA 4K1FA 3CXGA 3ZL5A 3AY8A 2YPMA 5D96A 2XPDA 4HU9A 4WR5A 4XIHA 4KF9A 4HJ2A 4RUVA 2FA4A 3VPTA 1JZWA 4TN8A 2VM1A 3D21A 4KW6A 2RIIA 4E8EA 3V1WA 2GT6A 2R2JA 5J3RA 1U88A 3PINA 4G19A 5COHA 4WEYA 4NXIA 3LYKA 2B5XA 3M9KA 5G1LA 4BL7B 3LSZA 3W6GA 1ERVA 5IM9A 1DSBA 2N5BA 5IOXA 2DMLA 1GLPA 4O5QA 2C80A 5C04A 4GTUA 3F4RA 3Q6OA 3TKQA 1ML6A 2HNLA 4N0ZA 4TR1B 1K0BA 2B1LA 2JL4A 3E3EA 1YY7A 1K0NA 3DKSA 4JBBA 2AB6A 3QDNA 1AIUA 2HYXA 1K0OA 5KOXA 1M99A 1SK0A 4MPGA 2DMMA 2PERA 2X8HA 3CTFA 1J0FA 1MTCA 4YAVA 4BPYA 4MMMA 4PX1A 3GUSA 5IIZA 3C1RA 3M3MA 4POKA 2VM2A 2ON7A 3GHAA 2YJHA 6GSXA 1FB0A 1GUMA 4ZL8A 3L78A 2ON5A 1QQ2A 1SL1B 1O85A 2K8VA 2ES7A 5G2ZA 1C72A 1R26A 1XWGA 1ZYQB 5BRTA 2WFCA 2B5YA 4KNDA 1T00A 2ALBA 2KLXA 2E2GA 3LYPA 5JCUA 3I69A 2GSSA 5G5EA 1A8YA 1SD9A 4IW9A 1BAYA 5DALA 2HT9A 4KE3A 4CHSA 3H93A 1X9WB 3CTGA 5GZZB 2OKAA 5IQYA 1O7UA 1GSEA 1NSWA 1K3OA 4TKYA 3IOSA 2EIRA 2MMZA 4MJBA 3QAGA 2F8FA 4TXVA 1ABAA 3FEUA 4ZIJA 1GH2A 4TXOA 4KAEA 4MZWA 3N5OA 1SKWB 4K2DA 1OC9B 4RQRA 2OA7A 1DBYA 4BVYB 3HJPA 2HZEA 4X0XA 5D9XA 2FLSA 3APQA 3TJJA 3U5RE 2G0FA 3IC8A 4MF5A 1A8LA 3TUEA 1SL2B 2GS3A 3EWLA 4GSSA 4I2TA 4ZB6A 4V1Ag 4BVXB 1EV9A 4EDZA 2P5QA 4BWSA 5J5NA 1TU7A 2HRFA 3ZYWA 2JACA 4PQ1A 3GSSA 1TXXA 2IWTA 2DJ1A 2O7KA 2VLUA 3ZLPA 4TR4A 3HD5A 3TDGA 1YKAA 1O8XA 3GKMA 2AUVA 2H6YA 3ZRDA 4K5RA 1YJ6A 2DBCA 5DJMA 1VF2A 2X8GA 2BMXA 5D9TA 1SL0B 3HXSA 18GSA 5GSTA 2C0DA 3A2WA 3F9UA 4IN0A 2V41A 1W4VA 3A2VA 5KN2A 3VLNA 5ECQB 2IMDA 4F2IA 2GZPA 3MSZA 1GTIA 2L57A 4KH7A 3TGZA 4ISDA 1GTAA 3DXBA 3GA4A 5KEJA 4D73B 1AQXA 2O89A 2IN3A 2LJRA 1I9DA 5JWRB 2VCWA 3IE3A 1X5CA 2OE3A 3HJMA 1WOUA 3PGTA 3TJFA 3US3A 3P8WA 8GSSA 2XPEA 4OFMA 2GLRA 2FNOA 4ML1A 2FWHA 4L8EA 3LFLA 1ILOA 1KNGA 2QC7A 2AJQB 2HSHA 5EL8A 1ZYPA 2FCHA 1VF4A 1XWBA 4DSQA 4TR0A 4HZ2A 3D0ZA 1OE8A 3EC3A 1ZZYA 2RM5A 4ZBAA 5DALB 1WJKA 2H30A 2OE0A 2HZFA 2YV7A 2RLIA 1Z6NA 1Z5YE 3HYPA 3I43A 3UL3A 1ZYEA 1PMTA 4YKFA 2M72A 3GN3A 4EE0A 1T8EB 3C8EA 5JWOB 3F3RA 1OAZA 1EV4A 1K0CA 2H74A 2L4QA 2PUKC 1FO5A 2PPTA 1YF1A 3RAZA 1JZRA 5EVOA 2L6DA 1N8JA 1TW9A 1G6YA 3KMOA 1RK4A 5CRHA 1FOVA 4J56E 3ZREA 2CVKA 2VL2C 4ZILA 3CYNA 2LRTA 2R5GA 1S3AA 4POLA 1O6JA 4PNGA 3UMAA 4Q5NA 4L0UA 2H73A 2LEGA 3FZ5A 2R0PA 3IXRA 3EINA 5DVBA 3CMIA 4V2NA 3H8QA 5D9VA 4GXZA 3FYGA 4ILFA 2H66A 3BCIA 4GSNA 3QFAC 4KCAA 2V1MA 3FRCA 2LQQA 4KUNA 4XCSA 1S3CA 3PPUA 1XIYA 2X49A 1GTUA 4EL1A 3A3TA 3IC4A 1RQMA 1ST9A 2LJAA 4GWRA 3FZAA 1THXA 4XS4A 3K8NA 1LU4A 2VLVA 2UZ8A 5HR0A 3SWLA 2V6OA 2J23A 5JCGA 4MDCA 5CRWA 3TKRA 2A4VA 3E9JB 2CX4A 4XRDA 4ID0A 4TR3A 3M1GA 2R0GA 3IAS2 5GAPD 3KH9A 3LWAA 4ULXA 5H5RA 3RBTA 3R2QA 5IO0A 3GH9A 2H71A 2JZRA 3QAWA 2H0HA 1UVZA 5G1KA 4GQFA 2YWOA 3TKPA 1A2LA 1K0AA 2YWMA 3VI7A 4FO5A 4LL1B 1IYIA 2HI7A 3RPPA 1Z3EA 4FQUA 3KM6A 5E59A 5DCHA 4MJCA 3TRQA 3VFIA 10GSA 1EWXA 4ECIA 1THOA 1PL1A 4IP1A 4JR4A 1EZKA 1UN2A 3GYKA 1JHBA 2E0QA 3F63A 11GSA 1GP1A 4KSOA 4LMWA 1X9MB 4KB3A 1ZCPA 3F0IA 1F3BA 2PMTA 2AV4A 4KX4A 1R5PA 2GQKA 2X64A 2OBKA 3BCKA 4HQZA 1GNWA 5IMVA 2TRCP 5G30A 2CAQA 1USBA 1PSQA 2PN8A 5DQSA 4V2LA 1TRWA 5DDLA 2I1UA 3GKXA 4MABA 1OC8A 2GQLA 3MYDA 1O8WA 9GSSA 3TKSA 2K8SA 1M9BA 5B6NA 5IPGA 4MZCA 2HE3A 4KCEA 4HZ4A 5A5KA 4AF2A 2OJLA 3HY2A 4Z2UA 5ECPB 4GSTA 5IOWA 3UARA 5HR3A 2VCXA 1K0MA 1Z6MA 3FHKA 3BJ5A 2I81A 3F4TA 1N2AA 2CVBA 5D73A 1PKWA 3J7Yk 4AJ6A 2X8CA 4MH2A 2IMKA 5F0GA 1GLQA 4ECBA 3FK8A 1JFUA 1TRUA 3FZ9A 17GSA 4XS4B 3HDCA 3WYWA 2C0EA 4EO3A 22GSA 2QGVA 1U3IA 2QSIA 2GSRA 5FHIA 5G31A 1DE1A 1XWKA 3UVTA 5ELAA 2VIMA 2AHEA 1ZGNA 2LRCA 3FR6A 3I6AA 14GSA 4EC0A 2JADA 4MF7A 4KDXA 4HJMA 1M2DA 4ACSA 2A2SA 3GTUA 2R37A 5G5FA 4K7NA 2QKEA 5CYYA 4O5RA 2L59A 2B3SA 1EP7A 3UIWA 1M7TA 3D4MA 3KTBA 2DIZA 4P3YB 3U6VA 3KGKA 4OO4A 4BA7A 3KP9A 4ML6A 3G9BA 2H0GA 1UA5A 2FD3A 5JCWA 2EC4A 1CQGA 3M9JA 1XVWA 2WULA 3GX0A 1PRXA 4N30A 3CBUA 6GSWA 1M9AA 1EOGA 3KMNA 5ECOB 2LNSA 2B6MA 5E4WA 5A4UA 2GSTA 2MBSA 7GSSA 3MAKA 1OC3A 2VLTA 1WP0A 1XW6A 3P2AA 1PA3A 5F05A 5IMCA 4FH8A 1X0RA 3LXZA 4WR4A 5LCZA 2C3TA 2O87A 3L4NA 1FOHA 2I4AA 4TRXA 3UBKA 5ECLB 1BJXA 4G0LA 6GSTA 2DJ2A 5AISA 1B9YC 2CZ2A 1V58A 5ECSA 5IPHA 2XHFA 3TKSE 1WE0A 3HCZA 4NPBA 3C7MA 4MLYA 6GSYA 4K6XA 4V1Ap 3KP8A 4X43A 3ZMKA 2PVOC 3A5IA 1FW1A 3FR3A 2FWEA 5H5QA 2CVDA 4WBJA 3RDWA 3E0UA 5B8BA 5ECRB 3DEXA 3HVVA 1WRYA 1RW1A 4YKGA 2GVPA 2KP1A 2CAIA 3F4SA 1YEPA 3L0HA 4I2UA 4N0VA 1QUWA 2A4HA 1BX9A 2OE1A 2WRTA 3PR8A 1Z7RA 1YF0A 3Q18A 1J08A 1M0UA 2AYTA 3M8NA 1GSSA 4F03A 5C00A 3APOA 3QMXA 3DVWA 3ZVJA 4OMVA 3LG6A 5ECMB 3W8SA 4XRAA 1VGLA 3L9UA 1XXUA 4OO5A 1GRXA 3QAVA 3A5WA 1HYUA 2C4JA 2CA8A 4PNFA 3GL5A 2VCTA 4USSA 3LW9A 1ERTA 5DCGA 2YZHA 4ZL7A 3GRXA 1MD3A 1SENA 3MWHA 4MJAA 2QA2A 2H1DA 2MZCA 1SU9A 4DSRA 4XS6A 2L5LA 2L6CA 3KCMA 4GCIA 4NWYA 2DLXA 5F07A 5HFGA 3M0FA 2VL9A 1GSDA 2XBQA 2H6XA 4EVMA 3ME8A 3HKRA 5CNWA 4EF0A 4I8BA 4G9HA 5ECIB 3BBYA 3GL3A 1V57A 1JZDA 4XS1A 1PX7A 1TU8A 3MDKA 3QCPA 1YZXA 2WS2A 1SD8A 3CSJA 4G2EA 3ZFLA 2FA8A 2H1BA 2YWIA 1YQ1A 3DWVA 4PUFC 2H19A 4JRRA 3FZ4A 2P0GA 1AQVA 5AIXA 1GSQA 2I3YA 1F9MA 2CV4A 1XFLA 2BTOT 4N10A 5CP1A 4TVEA 1LJRA 5ABRA 4OFNA 1JLWA 1EGOA 1A2JA 1VRSD 4WKWA 3KTLA 4WXTA 3ZIJA 4F0CA 2RUEA 5ENUA 5L71A 1MEKA 1HNBA 5IO2A 5ECKB 2D2ZA 3QR6A 4MP4A 4MF6A 2FHEA 3TJBA 4JZQA 3D6IA 1YDKA 2DJ3A 1K0DA 2VCZA 3GMFA 12GSA 5JWQB 2LS5A 4XHMA 2VCQA 3IK7A 1E6BA 3EVIA 4TXOB 2C1YA 4IQAA 2H01A 2HZEB 1URMA 4NV2A 1H4OA 1J9BA 2JZSA 3Q74A 19GSA 5INYA 4ZB9A 4GF0A 1XOBA 3QOUA 3GIXA 2H1GA 2CZ3A 4YAPA 5ID2A 4DSSA 2GQMA 4K9ZA 1F3AA 2FUG2 1GSFA 1WPIA 3PH9A 4O32A 3VK9A 1AQWA 3FMWA 3WT2A 4I97A 1FAAA 3H1NA 2IL3A 4HS1A 3UVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSU A;  5IMD A;  3O76 A;  2HXK A;  2MMA A;  5IMZ A;  3G7J A;  1BYE A;  2PVQ A;  2M46 A;  5ECN B;  2RUF A;  1U3A A;  4F82 A;  3LEF A;  3QFB C;  3DML A;  2V6K A;  2A2R A;  2ZNM A;  3FW2 A;  4KDU A;  5KN0 A;  1HQO A;  5B6M A;  1EOH A;  1R5A A;  4KGI A;  4KA0 A;  1FVJ A;  2R6K A;  2E2M A;  2LST A;  2EIQ A;  4ZL9 A;  4G10 A;  1TTZ A;  2MMN A;  1AW9 A;  3VWX A;  3TRP A;  3MNG A;  1PN9 A;  2FY6 A;  2WGR A;  4HOJ A;  4TR1 A;  3JCM L;  2L4C A;  3UJ1 A;  3KEB A;  2P31 A;  1HD2 A;  2NTO A;  2YNX A;  5DJL A;  3LQ7 A;  1O81 A;  1ERU A;  1OE7 A;  1E2Y A;  4IJ3 A;  4IGJ A;  5HR2 A;  3GKN A;  4X1U A;  1KBN A;  4IBP A;  2OBI A;  5KN1 A;  3EMP A;  1W89 A;  4IS0 A;  1SYR A;  1XZO A;  2I9H A;  3VUR A;  2KOK A;  3ISO A;  2PBJ A;  3QD9 A;  2H76 A;  4K0N A;  3DVX A;  2M80 A;  2YAN A;  1T7P B;  3TOT A;  1NM3 A;  3NZN A;  1Z9H A;  2REM A;  3WD6 A;  4JR6 A;  2LQO A;  5AIV A;  1PD2 1;  2F3M A;  4YQV A;  4Q5Q A;  3HVS A;  3GH6 A;  1IYH A;  5F06 A;  1EGR A;  4O7H A;  3KH7 A;  1X9S B;  5CAX A;  2CQ9 A;  4OCE A;  1G7O A;  3TJG A;  4DSS B;  2GT5 A;  3BOA A;  4HI7 A;  4K0G A;  1V9W A;  2OAC A;  5AGY A;  5CRD A;  1TK0 B;  3HHV A;  3UAP A;  1G6W A;  1SKS B;  3EU4 A;  3VI5 A;  4EUY A;  4L0W A;  3HA9 A;  1TK5 B;  1OC9 A;  1B4Q A;  4PQH A;  4MZB A;  3WGX A;  1T4Y A;  4NHW A;  1ON4 A;  1U6T A;  4CDO A;  4F9Z A;  5LNK e;  3IPZ A;  5CO3 A;  1BQ7 A;  3LJR A;  4OFT A;  2C3Q A;  3HVX A;  4WBR D;  3F6F A;  3KXO A;  2KHP A;  4LMV A;  3G7Y A;  2KP2 A;  3IHQ A;  4BVX A;  1ACV A;  1WIK A;  4N11 A;  1CQH A;  1TK8 B;  1KTE A;  3CRT A;  4IQ1 A;  5EPF A;  4NAX A;  2NPB A;  1SJ6 A;  5ELG A;  1F37 A;  3LOR A;  1FB6 A;  1UC7 A;  4HU7 A;  1EEM A;  4O92 A;  5B7C A;  3ME7 A;  1OKT A;  4IEL A;  3KJY A;  1KEB A;  2XBI A;  1BG5 A;  2YCD A;  4I6X A;  4IHU A;  1S3D A;  1PQN A;  1NW2 A;  1NHY A;  1HNC A;  2YJ7 A;  4Q5F A;  1QFN A;  2WDU A;  1TOF A;  3VWV A;  3VWU A;  1QK8 A;  4I5Q A;  3FKF A;  1A24 A;  2MMO A;  2TIR A;  2O85 A;  4J57 E;  4D73 A;  1XW9 A;  3UBL A;  1AUC A;  2CT6 A;  4DEJ A;  3EUR A;  3ZVJ D;  1TJD A;  2VUP A;  3ZIV A;  2DJ0 A;  1V40 A;  5B8A A;  6GSV A;  1F6M C;  3OR5 A;  1XPV A;  3TOU A;  1K3Y A;  5FWG A;  4OWY A;  2GTU A;  1NHO A;  2H70 A;  1A2M A;  3APS A;  4Q5R A;  1T1V A;  4EKZ A;  5FT3 A;  3WT1 A;  2ZUP A;  4YQU A;  3GST A;  1H75 A;  1PX6 A;  3VWW A;  3D5J A;  2JSY A;  4F0B A;  3TKS C;  4GLT A;  3ZZX A;  3ZTL A;  3IBH A;  2HRN A;  3CSH A;  3ZIT A;  3WGD A;  4POM A;  2YOI A;  2DC5 A;  1VF3 A;  1MDI A;  2FWG A;  4ZBB A;  3A2X A;  1TRV A;  1M2A A;  4FIW A;  5D93 A;  2YV9 A;  2YP6 A;  3TCO A;  2IMI A;  2DSA A;  1XBS A;  2H0I A;  3ED3 A;  1PL2 A;  1GL8 A;  2B7J A;  1M2B A;  4V2M A;  3Q19 A;  2IJY A;  3CSI A;  4WF5 A;  5DQY A;  2DIY A;  2R3X A;  4K7O A;  4OCF A;  1WWJ A;  4DVC A;  4OD7 A;  1FHE A;  2VL2 A;  1MDK A;  4CW9 A;  2G2Q A;  2YWN A;  3HJO A;  3RHC A;  3DIE A;  2J9H A;  2VCV A;  2IPA A;  4PGT A;  4TW5 A;  2DJJ A;  1GTB A;  5J9C A;  2OAD A;  3SBC A;  1PGT A;  4RQX A;  2LV3 A;  3GTU B;  1SJZ A;  3LGC A;  4KSM A;  5ECH B;  1A23 A;  2R4V A;  2IIY A;  1B9X C;  3C71 A;  2WJU A;  20GS A;  1V2A A;  3DRN A;  1YEX A;  4QQ7 A;  1U87 A;  3H4K A;  3IR4 A;  2IFQ A;  1G0T A;  4L5L A;  1AC1 A;  1GUK A;  4MPF A;  2LJK A;  1VF1 A;  2PU9 C;  3F6D A;  2B1K A;  5DAK A;  3GKK A;  1GNE A;  4MA9 A;  1T4Z A;  3ZFB A;  4AGS A;  1O73 A;  1B4P A;  1JZO A;  1R7H A;  1B48 A;  3FR9 A;  16GS A;  3GNJ A;  3DYR A;  3L9V A;  1T3B A;  2H75 A;  3HZ4 A;  4FYU A;  4IJI A;  2MYG A;  1QXH A;  3IK9 A;  3O3T A;  2ZCT A;  1XOA A;  1V98 A;  3S9F A;  2IMF A;  4HUA A;  2H1A A;  2GSQ A;  1Q4J A;  4ZB8 A;  5EY6 A;  1B8X A;  2WZ9 A;  4NV5 A;  1Z7P A;  4RI7 A;  3W8J A;  3TRX A;  1G7E A;  2YZU A;  2NBS A;  2GZZ A;  3O6T A;  1TDI A;  3C73 A;  3N9J A;  2B5E A;  1TRS A;  1ERW A;  6GSU A;  1TP9 A;  4WF4 A;  4LLR A;  2JZT A;  2H6Z A;  1R4W A;  3RPN A;  4MCU A;  5J4U A;  1A0R P;  5HFI A;  2LTK A;  3TB2 A;  2JU5 A;  2IME A;  3IA1 A;  4E8H A;  5A4W A;  2L5O A;  3EU3 A;  3EMX A;  4AJ8 A;  1LBK A;  2RM6 A;  2EIO A;  3BD2 A;  3UOM A;  1XW5 A;  3IAM 2;  3ERF A;  2C0G A;  2LRN A;  4ECJ A;  1BED A;  2VO4 A;  2HFD A;  1QGV A;  1F2E A;  5AN1 A;  3GFK A;  3GV1 A;  2WCI A;  3GX8 A;  1MDJ A;  3ERG A;  4YH2 A;  1X5E A;  4JU5 A;  4K8M A;  4FYC A;  3IV4 A;  4QL9 A;  1DUG A;  1TKD B;  2DJK A;  2YN1 A;  4L5O A;  3H79 A;  3I9V 2;  2TRX A;  3P90 A;  2H72 A;  2C8U A;  3EE2 A;  2CX3 A;  2GZY A;  3F3Q A;  1WMJ A;  2PWJ A;  6GSS A;  3G7I A;  4MK3 A;  1SK2 A;  1GSY A;  2HSY A;  5D9W A;  2P5R A;  2V2G A;  5LD0 A;  3TJK A;  1Y6E A;  5GAN D;  2FWF A;  3DD3 A;  2C3N A;  2K6V A;  4YQM A;  3GUR A;  1TI1 A;  3KIJ A;  1FVK A;  4LA1 A;  3L9S A;  2PGT A;  3UEM A;  2F9S A;  4JED A;  2IFQ B;  1SJI A;  1ZL9 A;  5D8I A;  4WET A;  2GGT A;  4BL7 A;  5DAK B;  1GUL A;  4AJ7 A;  1GUH A;  1MD4 A;  1HNA A;  2B7K A;  4PUA A;  2KUC A;  3D22 A;  4RI6 A;  2E7P A;  2C0F A;  1GWC A;  2LUS A;  3CRU A;  3NIV A;  1ZMA A;  3RHB A;  2O8V B;  2LNT A;  2N5F A;  4Z7X A;  2FGX A;  4NHZ A;  1A0F A;  2GDR A;  2JSZ A;  2LKU A;  3FY7 A;  4IKH A;  5KN3 A;  4POB A;  4HDE A;  4K7I A;  2Z9S A;  3VPQ A;  2N5A A;  5F8B A;  4GRF A;  5DBQ A;  2VL3 A;  1XVQ A;  2VD0 A;  4BWQ A;  3WGE A;  4GQC A;  4FYB A;  3LXT A;  3D4T A;  4MH3 A;  3EYT A;  4EXJ A;  3ZML A;  4ZBD A;  1SKR B;  1Y25 A;  2VAF A;  1AXD A;  1XWC A;  5J9B A;  4EDY A;  1OYJ A;  3C1S A;  5HR1 A;  4KDY A;  3ERW A;  3KD0 A;  1SK1 A;  3KZQ A;  1YKC A;  2NVL A;  5IMA A;  4IP6 A;  4TOP A;  3F8U A;  1XCC A;  2V32 A;  5A4V A;  1EP8 A;  3IDV A;  3QPM A;  4XTS A;  1PKZ A;  1FG4 A;  4PQI A;  2X99 A;  2WB9 A;  4MJE A;  4NMU A;  1AAZ A;  5CRE A;  5GSS A;  3J7Y b;  4PXO A;  1XWA A;  4IVF A;  5ID2 B;  2AAW A;  1SYX A;  4H86 A;  5HFK A;  2XC2 A;  5J41 A;  1JLV A;  4ECC A;  1ZOF A;  2H8L A;  1OVN A;  2MBT A;  2K18 A;  13GS A;  1Q98 A;  2VOC A;  1X5D A;  1I5G A;  4PUR A;  5CRG A;  4LL4 B;  4ZXG A;  4HEA 2;  2F8A A;  5HQP A;  4JE1 A;  1OKD A;  2K9F A;  2NDO A;  3P7X A;  2BJX A;  4HQS A;  1EEJ A;  4QL7 A;  3HZ8 A;  5IMF A;  3NOF A;  2F51 A;  2VD1 A;  3DGQ A;  3IRA A;  1TI3 A;  5H5S A;  2HLS A;  4J2F A;  4BVY A;  1QMV A;  1DE2 A;  1K3L A;  4K1F A;  3CXG A;  3ZL5 A;  3AY8 A;  2YPM A;  5D96 A;  2XPD A;  4HU9 A;  4WR5 A;  4XIH A;  4HJ2 A;  4RUV A;  2FA4 A;  3VPT A;  1JZW A;  4TN8 A;  2VM1 A;  3D21 A;  4KW6 A;  2RII A;  4E8E A;  3V1W A;  2GT6 A;  2R2J A;  5J3R A;  1U88 A;  3PIN A;  4G19 A;  5COH A;  4WEY A;  4NXI A;  3LYK A;  2B5X A;  3M9K A;  5G1L A;  3LSZ A;  3W6G A;  1ERV A;  5IM9 A;  1DSB A;  2N5B A;  5IOX A;  2DML A;  1GLP A;  2C80 A;  5C04 A;  4GTU A;  3F4R A;  3Q6O A;  3TKQ A;  1ML6 A;  2HNL A;  4N0Z A;  4TR1 B;  1K0B A;  2B1L A;  2JL4 A;  3E3E A;  1YY7 A;  1K0N A;  3DKS A;  4JBB A;  2AB6 A;  3QDN A;  1AIU A;  2HYX A;  1K0O A;  1M99 A;  1SK0 A;  4MPG A;  2DMM A;  2PER A;  2X8H A;  3CTF A;  1J0F A;  1MTC A;  4YAV A;  4BPY A;  4MMM A;  4PX1 A;  3GUS A;  5IIZ A;  3C1R A;  3M3M A;  4POK A;  2VM2 A;  2ON7 A;  3GHA A;  2YJH A;  6GSX A;  1FB0 A;  1GUM A;  4ZL8 A;  3L78 A;  2ON5 A;  1QQ2 A;  1SL1 B;  1O85 A;  2K8V A;  2ES7 A;  5G2Z A;  1C72 A;  1R26 A;  1XWG A;  1ZYQ B;  2WFC A;  2B5Y A;  4KND A;  1T00 A;  2ALB A;  2KLX A;  2E2G A;  3LYP A;  5JCU A;  3I69 A;  2GSS A;  5G5E A;  1A8Y A;  1SD9 A;  4IW9 A;  1BAY A;  5DAL A;  2HT9 A;  4KE3 A;  4CHS A;  3H93 A;  1X9W B;  3CTG A;  5GZZ B;  2OKA A;  5IQY A;  1O7U A;  1GSE A;  1NSW A;  1K3O A;  4TKY A;  3IOS A;  2EIR A;  2MMZ A;  4MJB A;  3QAG A;  2F8F A;  4TXV A;  1ABA A;  3FEU A;  4ZIJ A;  1GH2 A;  4TXO A;  4KAE A;  4MZW A;  3N5O A;  1SKW B;  4K2D A;  1OC9 B;  4RQR A;  2OA7 A;  1DBY A;  3HJP A;  2HZE A;  4X0X A;  5D9X A;  2FLS A;  3APQ A;  3TJJ A;  3U5R E;  2G0F A;  4MF5 A;  1A8L A;  3TUE A;  1SL2 B;  2GS3 A;  3EWL A;  4GSS A;  4I2T A;  4ZB6 A;  4V1A g;  1EV9 A;  4EDZ A;  2P5Q A;  4BWS A;  5J5N A;  1TU7 A;  2HRF A;  3ZYW A;  2JAC A;  4PQ1 A;  3GSS A;  1TXX A;  2IWT A;  2DJ1 A;  2O7K A;  2VLU A;  3ZLP A;  4TR4 A;  3HD5 A;  3TDG A;  1YKA A;  1O8X A;  3GKM A;  2AUV A;  2H6Y A;  3ZRD A;  1YJ6 A;  2DBC A;  5DJM A;  1VF2 A;  2X8G A;  2BMX A;  5D9T A;  1SL0 B;  3HXS A;  18GS A;  5GST A;  2C0D A;  3A2W A;  3F9U A;  4IN0 A;  2V41 A;  1W4V A;  3A2V A;  5KN2 A;  3VLN A;  5ECQ B;  2IMD A;  4F2I A;  2GZP A;  3MSZ A;  1GTI A;  2L57 A;  4KH7 A;  3TGZ A;  4ISD A;  1GTA A;  3DXB A;  3GA4 A;  5KEJ A;  4D73 B;  1AQX A;  2O89 A;  2IN3 A;  2LJR A;  1I9D A;  5JWR B;  2VCW A;  3IE3 A;  1X5C A;  2OE3 A;  3HJM A;  1WOU A;  3PGT A;  3TJF A;  3US3 A;  3P8W A;  8GSS A;  2XPE A;  4OFM A;  2GLR A;  2FNO A;  4ML1 A;  2FWH A;  4L8E A;  3LFL A;  1ILO A;  1KNG A;  2QC7 A;  2AJQ B;  2HSH A;  5EL8 A;  2FCH A;  1VF4 A;  1XWB A;  4DSQ A;  4TR0 A;  4HZ2 A;  3D0Z A;  1OE8 A;  3EC3 A;  1ZZY A;  2RM5 A;  4ZBA A;  5DAL B;  1WJK A;  2H30 A;  2OE0 A;  2HZF A;  2YV7 A;  2RLI A;  1Z6N A;  1Z5Y E;  3HYP A;  3I43 A;  3UL3 A;  1ZYE A;  1PMT A;  2M72 A;  3GN3 A;  4EE0 A;  1T8E B;  3C8E A;  5JWO B;  3F3R A;  1OAZ A;  1EV4 A;  1K0C A;  2H74 A;  2L4Q A;  2PUK C;  1FO5 A;  2PPT A;  1YF1 A;  3RAZ A;  1JZR A;  5EVO A;  2L6D A;  1N8J A;  1TW9 A;  1G6Y A;  3KMO A;  1RK4 A;  5CRH A;  1FOV A;  4J56 E;  3ZRE A;  2CVK A;  2VL2 C;  4ZIL A;  3CYN A;  2LRT A;  2R5G A;  1S3A A;  4POL A;  1O6J A;  4PNG A;  3UMA A;  4Q5N A;  4L0U A;  2H73 A;  2LEG A;  3FZ5 A;  3IXR A;  3EIN A;  5DVB A;  3CMI A;  4V2N A;  3H8Q A;  5D9V A;  4GXZ A;  3FYG A;  4ILF A;  2H66 A;  3BCI A;  4GSN A;  3QFA C;  4KCA A;  2V1M A;  3FRC A;  2LQQ A;  4KUN A;  4XCS A;  1S3C A;  1XIY A;  1GTU A;  4EL1 A;  3A3T A;  3IC4 A;  1RQM A;  1ST9 A;  2LJA A;  4GWR A;  3FZA A;  1THX A;  4XS4 A;  3K8N A;  1LU4 A;  2VLV A;  5HR0 A;  3SWL A;  2V6O A;  2J23 A;  5JCG A;  4MDC A;  5CRW A;  3TKR A;  2A4V A;  3E9J B;  2CX4 A;  4XRD A;  4ID0 A;  4TR3 A;  3M1G A;  3IAS 2;  5GAP D;  3KH9 A;  3LWA A;  4ULX A;  5H5R A;  3RBT A;  3R2Q A;  5IO0 A;  3GH9 A;  2H71 A;  2JZR A;  3QAW A;  2H0H A;  1UVZ A;  5G1K A;  4GQF A;  2YWO A;  3TKP A;  1A2L A;  1K0A A;  2YWM A;  3VI7 A;  4FO5 A;  4LL1 B;  1IYI A;  2HI7 A;  3RPP A;  1Z3E A;  3KM6 A;  5E59 A;  5DCH A;  4MJC A;  3TRQ A;  3VFI A;  10GS A;  1EWX A;  4ECI A;  1THO A;  1PL1 A;  4IP1 A;  4JR4 A;  1EZK A;  1UN2 A;  3GYK A;  1JHB A;  2E0Q A;  3F63 A;  11GS A;  1GP1 A;  4KSO A;  4LMW A;  1X9M B;  4KB3 A;  1ZCP A;  3F0I A;  1F3B A;  2PMT A;  2AV4 A;  4KX4 A;  1R5P A;  2GQK A;  2X64 A;  2OBK A;  3BCK A;  4HQZ A;  1GNW A;  5IMV A;  2TRC P;  5G30 A;  2CAQ A;  1USB A;  1PSQ A;  2PN8 A;  5DQS A;  4V2L A;  1TRW A;  5DDL A;  2I1U A;  3GKX A;  4MAB A;  1OC8 A;  2GQL A;  1O8W A;  9GSS A;  3TKS A;  2K8S A;  1M9B A;  5B6N A;  5IPG A;  4MZC A;  2HE3 A;  4KCE A;  4HZ4 A;  5A5K A;  4AF2 A;  2OJL A;  3HY2 A;  5ECP B;  4GST A;  5IOW A;  3UAR A;  5HR3 A;  2VCX A;  1K0M A;  1Z6M A;  3FHK A;  3BJ5 A;  2I81 A;  3F4T A;  1N2A A;  2CVB A;  5D73 A;  1PKW A;  3J7Y k;  4AJ6 A;  2X8C A;  4MH2 A;  2IMK A;  5F0G A;  1GLQ A;  4ECB A;  3FK8 A;  1JFU A;  1TRU A;  3FZ9 A;  17GS A;  4XS4 B;  3HDC A;  3WYW A;  2C0E A;  4EO3 A;  22GS A;  2QGV A;  1U3I A;  2QSI A;  2GSR A;  5FHI A;  5G31 A;  1DE1 A;  1XWK A;  3UVT A;  5ELA A;  2VIM A;  2AHE A;  1ZGN A;  2LRC A;  3FR6 A;  3I6A A;  14GS A;  4EC0 A;  2JAD A;  4MF7 A;  4KDX A;  4HJM A;  1M2D A;  4ACS A;  2A2S A;  3GTU A;  2R37 A;  5G5F A;  4K7N A;  2QKE A;  5CYY A;  4O5R A;  2L59 A;  2B3S A;  1EP7 A;  3UIW A;  1M7T A;  3D4M A;  3KTB A;  2DIZ A;  4P3Y B;  3U6V A;  3KGK A;  4OO4 A;  4BA7 A;  3KP9 A;  4ML6 A;  3G9B A;  2H0G A;  1UA5 A;  2FD3 A;  5JCW A;  2EC4 A;  1CQG A;  3M9J A;  1XVW A;  2WUL A;  3GX0 A;  1PRX A;  4N30 A;  3CBU A;  6GSW A;  1M9A A;  1EOG A;  3KMN A;  5ECO B;  2LNS A;  2B6M A;  5E4W A;  5A4U A;  2GST A;  2MBS A;  7GSS A;  3MAK A;  1OC3 A;  2VLT A;  1WP0 A;  1XW6 A;  3P2A A;  1PA3 A;  5F05 A;  5IMC A;  4FH8 A;  1X0R A;  3LXZ A;  4WR4 A;  5LCZ A;  2C3T A;  2O87 A;  3L4N A;  2I4A A;  4TRX A;  3UBK A;  5ECL B;  1BJX A;  6GST A;  2DJ2 A;  5AIS A;  1B9Y C;  2CZ2 A;  1V58 A;  5ECS A;  5IPH A;  2XHF A;  3TKS E;  1WE0 A;  3HCZ A;  4NPB A;  3C7M A;  4MLY A;  6GSY A;  4K6X A;  4V1A p;  3KP8 A;  4X43 A;  3ZMK A;  2PVO C;  1FW1 A;  3FR3 A;  2FWE A;  5H5Q A;  2CVD A;  4WBJ A;  3RDW A;  3E0U A;  5B8B A;  5ECR B;  3DEX A;  3HVV A;  1WRY A;  1RW1 A;  2GVP A;  2KP1 A;  2CAI A;  3F4S A;  1YEP A;  3L0H A;  4I2U A;  4N0V A;  1QUW A;  1BX9 A;  2OE1 A;  2WRT A;  3PR8 A;  1Z7R A;  1YF0 A;  3Q18 A;  1J08 A;  1M0U A;  2AYT A;  3M8N A;  1GSS A;  4F03 A;  5C00 A;  3APO A;  3QMX A;  3DVW A;  3ZVJ A;  4OMV A;  3LG6 A;  5ECM B;  3W8S A;  4XRA A;  1VGL A;  3L9U A;  1XXU A;  4OO5 A;  1GRX A;  3QAV A;  3A5W A;  1HYU A;  2C4J A;  2CA8 A;  4PNF A;  3GL5 A;  2VCT A;  1ERT A;  5DCG A;  2YZH A;  4ZL7 A;  3GRX A;  1MD3 A;  1SEN A;  3MWH A;  4MJA A;  2H1D A;  2MZC A;  1SU9 A;  4DSR A;  4XS6 A;  2L5L A;  2L6C A;  3KCM A;  4GCI A;  4NWY A;  2DLX A;  5F07 A;  5HFG A;  3M0F A;  2VL9 A;  1GSD A;  2XBQ A;  2H6X A;  4EVM A;  3ME8 A;  3HKR A;  5CNW A;  4EF0 A;  4I8B A;  4G9H A;  5ECI B;  3BBY A;  3GL3 A;  1V57 A;  1JZD A;  4XS1 A;  1PX7 A;  1TU8 A;  3MDK A;  3QCP A;  1YZX A;  2WS2 A;  1SD8 A;  3CSJ A;  4G2E A;  3ZFL A;  2FA8 A;  2H1B A;  2YWI A;  1YQ1 A;  3DWV A;  4PUF C;  2H19 A;  4JRR A;  3FZ4 A;  2P0G A;  1AQV A;  5AIX A;  1GSQ A;  2I3Y A;  1F9M A;  2CV4 A;  1XFL A;  2BTO T;  4N10 A;  5CP1 A;  4TVE A;  1LJR A;  5ABR A;  4OFN A;  1JLW A;  1EGO A;  1A2J A;  1VRS D;  4WKW A;  3KTL A;  4WXT A;  3ZIJ A;  4F0C A;  2RUE A;  5ENU A;  5L71 A;  1MEK A;  1HNB A;  5IO2 A;  5ECK B;  2D2Z A;  3QR6 A;  4MP4 A;  4MF6 A;  2FHE A;  3TJB A;  4JZQ A;  3D6I A;  1YDK A;  2DJ3 A;  1K0D A;  2VCZ A;  3GMF A;  12GS A;  5JWQ B;  2LS5 A;  4XHM A;  2VCQ A;  3IK7 A;  1E6B A;  3EVI A;  4TXO B;  2C1Y A;  4IQA A;  2H01 A;  2HZE B;  1URM A;  4NV2 A;  1H4O A;  1J9B A;  2JZS A;  3Q74 A;  19GS A;  5INY A;  4ZB9 A;  4GF0 A;  1XOB A;  3QOU A;  3GIX A;  2H1G A;  2CZ3 A;  4YAP A;  5ID2 A;  4DSS A;  2GQM A;  4K9Z A;  1F3A A;  2FUG 2;  1GSF A;  1WPI A;  3PH9 A;  4O32 A;  3VK9 A;  1AQW A;  3WT2 A;  4I97 A;  1FAA A;  3H1N A;  2IL3 A;  4HS1 A;  3UVH A; 
#chains in the Genus database with same CATH topology
 1GSU A;  5IMD A;  3O76 A;  2HXK A;  2MMA A;  5IMZ A;  3G7J A;  1BYE A;  2PVQ A;  2M46 A;  5ECN B;  2RUF A;  1U3A A;  4F82 A;  3LEF A;  3QFB C;  3DML A;  2V6K A;  2A2R A;  2ZNM A;  3FW2 A;  4KDU A;  5KN0 A;  1HQO A;  5B6M A;  1EOH A;  1R5A A;  4KGI A;  4EIQ A;  4KA0 A;  1FVJ A;  2R6K A;  2E2M A;  2LST A;  3EPT A;  2EIQ A;  4ZL9 A;  4G10 A;  1TTZ A;  2MMN A;  1AW9 A;  3VWX A;  3TRP A;  3MNG A;  4CY6 A;  1PN9 A;  2FY6 A;  2WGR A;  4HOJ A;  4TR1 A;  3R3E A;  3JCM L;  2L4C A;  3UJ1 A;  3KEB A;  2P31 A;  1HD2 A;  2NTO A;  2YNX A;  5DJL A;  3LQ7 A;  1O81 A;  1ERU A;  2QA1 A;  1OE7 A;  1E2Y A;  4IJ3 A;  4IGJ A;  5HR2 A;  3GKN A;  3HVN A;  4X1U A;  1KBN A;  4IBP A;  2OBI A;  5KN1 A;  3EMP A;  1W89 A;  4IS0 A;  1SYR A;  1XZO A;  2I9H A;  3VUR A;  2KOK A;  3ISO A;  2PBJ A;  3QD9 A;  2H76 A;  4K0N A;  3DVX A;  2M80 A;  2YAN A;  1T7P B;  3TOT A;  1NM3 A;  3NZN A;  1Z9H A;  2REM A;  3WD6 A;  4JR6 A;  2LQO A;  5AIV A;  3MIX A;  1PD2 1;  2F3M A;  4YQV A;  4Q5Q A;  3HVS A;  3GH6 A;  1IYH A;  5F06 A;  1EGR A;  4O7H A;  3KH7 A;  1X9S B;  5CAX A;  2CQ9 A;  4OCE A;  1G7O A;  3TJG A;  2R0C A;  4DSS B;  2GT5 A;  3BOA A;  4HI7 A;  4K0G A;  1V9W A;  2OAC A;  5AGY A;  4CY8 A;  5CRD A;  1TK0 B;  3HHV A;  3UAP A;  1G6W A;  1SKS B;  3EU4 A;  3VI5 A;  4EUY A;  4L0W A;  3HA9 A;  1TK5 B;  1OC9 A;  1B4Q A;  4PQH A;  4MZB A;  3WGX A;  1T4Y A;  4NHW A;  1ON4 A;  1U6T A;  4CDO A;  4F9Z A;  5LNK e;  3IPZ A;  5CO3 A;  1BQ7 A;  3LJR A;  4OFT A;  2C3Q A;  3HVX A;  4WBR D;  3F6F A;  3KXO A;  2KHP A;  4LMV A;  3G7Y A;  2KP2 A;  3IHQ A;  4BVX A;  1ACV A;  1WIK A;  2A2P A;  4N11 A;  1CQH A;  1TK8 B;  1KTE A;  3CRT A;  4IQ1 A;  5EPF A;  4NAX A;  2NPB A;  1SJ6 A;  5ELG A;  1F37 A;  3LOR A;  1FB6 A;  1UC7 A;  4HU7 A;  1EEM A;  4O92 A;  5B7C A;  3ME7 A;  1OKT A;  4IEL A;  3KJY A;  1KEB A;  2XBI A;  1BG5 A;  2YCD A;  4I6X A;  4IHU A;  1S3D A;  1PQN A;  1NW2 A;  1NHY A;  1ZYN A;  1HNC A;  2YJ7 A;  4Q5F A;  1QFN A;  2WDU A;  1TOF A;  3VWV A;  4EIP A;  5BMU A;  3VWU A;  1QK8 A;  2HRA A;  4I5Q A;  3FKF A;  1A24 A;  2MMO A;  2TIR A;  2O85 A;  4J57 E;  4D73 A;  1XW9 A;  3UBL A;  1AUC A;  2CT6 A;  4DEJ A;  3EUR A;  4X4J A;  3ZVJ D;  1TJD A;  2VUP A;  3ZIV A;  2DJ0 A;  1V40 A;  5B8A A;  6GSV A;  1F6M C;  3OR5 A;  4ICY A;  1XPV A;  3TOU A;  1K3Y A;  4O5U A;  5FWG A;  4OWY A;  2GTU A;  1NHO A;  5KOW A;  2H70 A;  1A2M A;  3APS A;  4Q5R A;  1T1V A;  4EKZ A;  5FT3 A;  3WT1 A;  2ZUP A;  4YQU A;  3GST A;  1H75 A;  1PX6 A;  3VWW A;  3D5J A;  2JSY A;  4F0B A;  3TKS C;  4GLT A;  3ZZX A;  3ZTL A;  3IBH A;  2HRN A;  3CSH A;  3ZIT A;  3WGD A;  4POM A;  2YOI A;  1PN0 A;  2DC5 A;  1VF3 A;  1MDI A;  2FWG A;  4ZBB A;  3A2X A;  1TRV A;  1M2A A;  4FIW A;  5D93 A;  4G0I A;  2YV9 A;  2YP6 A;  3TCO A;  2IMI A;  2DSA A;  1XBS A;  2H0I A;  3ED3 A;  1PL2 A;  1GL8 A;  2B7J A;  1M2B A;  4V2M A;  3Q19 A;  2IJY A;  3CSI A;  4WF5 A;  5DQY A;  2DIY A;  2R3X A;  4K7O A;  4OCF A;  1WWJ A;  4DVC A;  4OD7 A;  1FHE A;  2VL2 A;  1MDK A;  4CW9 A;  2G2Q A;  2YWN A;  3HJO A;  3RHC A;  3DIE A;  2J9H A;  2VCV A;  2IPA A;  4PGT A;  4TW5 A;  2DJJ A;  1GTB A;  5J9C A;  2OAD A;  3SBC A;  1PGT A;  4RQX A;  2LV3 A;  3GTU B;  1M3J A;  1SJZ A;  3LGC A;  4KSM A;  5ECH B;  1A23 A;  2R4V A;  2IIY A;  1B9X C;  3C71 A;  4G0K A;  2WJU A;  20GS A;  1V2A A;  3DRN A;  1YEX A;  4QQ7 A;  1U87 A;  3H4K A;  3IR4 A;  2IFQ A;  1G0T A;  4L5L A;  1AC1 A;  1GUK A;  4MPF A;  2LJK A;  1VF1 A;  2PU9 C;  3F6D A;  2B1K A;  5DAK A;  3GKK A;  1GNE A;  4MA9 A;  4K5S A;  1T4Z A;  3ZFB A;  4AGS A;  4Z2T A;  1O73 A;  1B4P A;  1JZO A;  1R7H A;  1B48 A;  3FR9 A;  16GS A;  3GNJ A;  3DYR A;  3L9V A;  1T3B A;  2H75 A;  3HZ4 A;  4FYU A;  4IJI A;  2MYG A;  1QXH A;  3IK9 A;  3O3T A;  2ZCT A;  1XOA A;  1V98 A;  3S9F A;  2IMF A;  4HUA A;  2H1A A;  2GSQ A;  1Q4J A;  4ZB8 A;  5EY6 A;  1B8X A;  2WZ9 A;  4NV5 A;  1Z7P A;  4RI7 A;  3W8J A;  3TRX A;  1G7E A;  2YZU A;  2NBS A;  2GZZ A;  3O6T A;  1TDI A;  3C73 A;  3N9J A;  2B5E A;  1TRS A;  1ERW A;  6GSU A;  4HSC X;  1TP9 A;  4WF4 A;  4LLR A;  2JZT A;  2H6Z A;  1R4W A;  3RPN A;  4MCU A;  5J4U A;  1A0R P;  2HSM A;  5HFI A;  2LTK A;  3TB2 A;  2JU5 A;  2IME A;  3IA1 A;  4E8H A;  5A4W A;  2L5O A;  3EU3 A;  3EMX A;  4AJ8 A;  1LBK A;  2RM6 A;  2EIO A;  3BD2 A;  3UOM A;  1XW5 A;  3IAM 2;  3ERF A;  2C0G A;  2LRN A;  2HRK A;  4ECJ A;  1BED A;  2VO4 A;  2HFD A;  2DKH A;  1QGV A;  1F2E A;  5AN1 A;  4PTS A;  3GFK A;  3GV1 A;  2WCI A;  3GX8 A;  1MDJ A;  3ERG A;  4YH2 A;  1X5E A;  4JU5 A;  4K8M A;  4FYC A;  3IV4 A;  4QL9 A;  1DUG A;  1TKD B;  2DJK A;  2YN1 A;  4L5O A;  3H79 A;  3I9V 2;  2TRX A;  3P90 A;  4K2X A;  2H72 A;  2C8U A;  3EE2 A;  2CX3 A;  2GZY A;  3F3Q A;  3IHG A;  1WMJ A;  4Z2R A;  2PWJ A;  6GSS A;  3G7I A;  4MK3 A;  1SK2 A;  1GSY A;  2HSY A;  5D9W A;  2P5R A;  2V2G A;  5LD0 A;  3TJK A;  1Y6E A;  5GAN D;  2FWF A;  1S3R A;  3DD3 A;  2C3N A;  2K6V A;  4YQM A;  3GUR A;  2DKI A;  1TI1 A;  3CQF A;  3KIJ A;  1FVK A;  4LA1 A;  3L9S A;  4A5P A;  2PGT A;  3UEM A;  2F9S A;  4JED A;  2IFQ B;  1SJI A;  1ZL9 A;  5D8I A;  4WET A;  2GGT A;  4BL7 A;  5DAK B;  1GUL A;  4AJ7 A;  1GUH A;  1MD4 A;  1HNA A;  2B7K A;  4PUA A;  2KUC A;  3D22 A;  4RI6 A;  2E7P A;  2C0F A;  1GWC A;  2LUS A;  3CRU A;  3NIV A;  1ZMA A;  3RHB A;  2O8V B;  2LNT A;  2N5F A;  4Z7X A;  2FGX A;  4NHZ A;  1A0F A;  2GDR A;  2JSZ A;  2LKU A;  3FY7 A;  4IKH A;  5KN3 A;  4POB A;  4HDE A;  4K7I A;  2Z9S A;  3VPQ A;  2N5A A;  5F8B A;  4GRF A;  5DBQ A;  2VL3 A;  4MNN A;  1XVQ A;  2VD0 A;  4BWQ A;  3WGE A;  4GQC A;  4FYB A;  3LXT A;  3D4T A;  4MH3 A;  3EYT A;  4EXJ A;  3ZML A;  4ZBD A;  1SKR B;  1Y25 A;  2VAF A;  1AXD A;  1XWC A;  5J9B A;  4EDY A;  1OYJ A;  3C1S A;  5HR1 A;  4KDY A;  3ERW A;  3KD0 A;  1SK1 A;  3KZQ A;  1YKC A;  2NVL A;  5IMA A;  4IP6 A;  4TOP A;  3F8U A;  1XCC A;  2V32 A;  5A4V A;  1EP8 A;  3IDV A;  3QPM A;  4XTS A;  1PKZ A;  1FG4 A;  4PQI A;  2X99 A;  2WB9 A;  4MJE A;  4NMU A;  1AAZ A;  5CRE A;  5GSS A;  3J7Y b;  4PXO A;  1XWA A;  4IVF A;  5ID2 B;  2AAW A;  1SYX A;  4H86 A;  5HFK A;  2XC2 A;  5J41 A;  1JLV A;  4ECC A;  1ZOF A;  2H8L A;  1OVN A;  2MBT A;  2K18 A;  13GS A;  1Q98 A;  2VOC A;  1X5D A;  1I5G A;  4PUR A;  5CRG A;  4LL4 B;  4ZXG A;  4HEA 2;  2F8A A;  5HQP A;  4JE1 A;  1OKD A;  2K9F A;  2NDO A;  3P7X A;  2BJX A;  4HQS A;  1EEJ A;  4QL7 A;  3HZ8 A;  5IMF A;  3NOF A;  2F51 A;  2VD1 A;  3DGQ A;  3IRA A;  1TI3 A;  5H5S A;  2HLS A;  4J2F A;  4BVY A;  2X4A A;  1QMV A;  1DE2 A;  1K3L A;  4K1F A;  3CXG A;  3ZL5 A;  3AY8 A;  2YPM A;  5D96 A;  2XPD A;  4HU9 A;  4WR5 A;  4XIH A;  4KF9 A;  4HJ2 A;  4RUV A;  2FA4 A;  3VPT A;  1JZW A;  4TN8 A;  2VM1 A;  3D21 A;  4KW6 A;  2RII A;  4E8E A;  3V1W A;  2GT6 A;  2R2J A;  5J3R A;  1U88 A;  3PIN A;  4G19 A;  5COH A;  4WEY A;  4NXI A;  3LYK A;  2B5X A;  3M9K A;  5G1L A;  4BL7 B;  3LSZ A;  3W6G A;  1ERV A;  5IM9 A;  1DSB A;  2N5B A;  5IOX A;  2DML A;  1GLP A;  4O5Q A;  2C80 A;  5C04 A;  4GTU A;  3F4R A;  3Q6O A;  3TKQ A;  1ML6 A;  2HNL A;  4N0Z A;  4TR1 B;  1K0B A;  2B1L A;  2JL4 A;  3E3E A;  1YY7 A;  1K0N A;  3DKS A;  4JBB A;  2AB6 A;  3QDN A;  1AIU A;  2HYX A;  1K0O A;  5KOX A;  1M99 A;  1SK0 A;  4MPG A;  2DMM A;  2PER A;  2X8H A;  3CTF A;  1J0F A;  1MTC A;  4YAV A;  4BPY A;  4MMM A;  4PX1 A;  3GUS A;  5IIZ A;  3C1R A;  3M3M A;  4POK A;  2VM2 A;  2ON7 A;  3GHA A;  2YJH A;  6GSX A;  1FB0 A;  1GUM A;  4ZL8 A;  3L78 A;  2ON5 A;  1QQ2 A;  1SL1 B;  1O85 A;  2K8V A;  2ES7 A;  5G2Z A;  1C72 A;  1R26 A;  1XWG A;  1ZYQ B;  5BRT A;  2WFC A;  2B5Y A;  4KND A;  1T00 A;  2ALB A;  2KLX A;  2E2G A;  3LYP A;  5JCU A;  3I69 A;  2GSS A;  5G5E A;  1A8Y A;  1SD9 A;  4IW9 A;  1BAY A;  5DAL A;  2HT9 A;  4KE3 A;  4CHS A;  3H93 A;  1X9W B;  3CTG A;  5GZZ B;  2OKA A;  5IQY A;  1O7U A;  1GSE A;  1NSW A;  1K3O A;  4TKY A;  3IOS A;  2EIR A;  2MMZ A;  4MJB A;  3QAG A;  2F8F A;  4TXV A;  1ABA A;  3FEU A;  4ZIJ A;  1GH2 A;  4TXO A;  4KAE A;  4MZW A;  3N5O A;  1SKW B;  4K2D A;  1OC9 B;  4RQR A;  2OA7 A;  1DBY A;  4BVY B;  3HJP A;  2HZE A;  4X0X A;  5D9X A;  2FLS A;  3APQ A;  3TJJ A;  3U5R E;  2G0F A;  3IC8 A;  4MF5 A;  1A8L A;  3TUE A;  1SL2 B;  2GS3 A;  3EWL A;  4GSS A;  4I2T A;  4ZB6 A;  4V1A g;  4BVX B;  1EV9 A;  4EDZ A;  2P5Q A;  4BWS A;  5J5N A;  1TU7 A;  2HRF A;  3ZYW A;  2JAC A;  4PQ1 A;  3GSS A;  1TXX A;  2IWT A;  2DJ1 A;  2O7K A;  2VLU A;  3ZLP A;  4TR4 A;  3HD5 A;  3TDG A;  1YKA A;  1O8X A;  3GKM A;  2AUV A;  2H6Y A;  3ZRD A;  4K5R A;  1YJ6 A;  2DBC A;  5DJM A;  1VF2 A;  2X8G A;  2BMX A;  5D9T A;  1SL0 B;  3HXS A;  18GS A;  5GST A;  2C0D A;  3A2W A;  3F9U A;  4IN0 A;  2V41 A;  1W4V A;  3A2V A;  5KN2 A;  3VLN A;  5ECQ B;  2IMD A;  4F2I A;  2GZP A;  3MSZ A;  1GTI A;  2L57 A;  4KH7 A;  3TGZ A;  4ISD A;  1GTA A;  3DXB A;  3GA4 A;  5KEJ A;  4D73 B;  1AQX A;  2O89 A;  2IN3 A;  2LJR A;  1I9D A;  5JWR B;  2VCW A;  3IE3 A;  1X5C A;  2OE3 A;  3HJM A;  1WOU A;  3PGT A;  3TJF A;  3US3 A;  3P8W A;  8GSS A;  2XPE A;  4OFM A;  2GLR A;  2FNO A;  4ML1 A;  2FWH A;  4L8E A;  3LFL A;  1ILO A;  1KNG A;  2QC7 A;  2AJQ B;  2HSH A;  5EL8 A;  1ZYP A;  2FCH A;  1VF4 A;  1XWB A;  4DSQ A;  4TR0 A;  4HZ2 A;  3D0Z A;  1OE8 A;  3EC3 A;  1ZZY A;  2RM5 A;  4ZBA A;  5DAL B;  1WJK A;  2H30 A;  2OE0 A;  2HZF A;  2YV7 A;  2RLI A;  1Z6N A;  1Z5Y E;  3HYP A;  3I43 A;  3UL3 A;  1ZYE A;  1PMT A;  4YKF A;  2M72 A;  3GN3 A;  4EE0 A;  1T8E B;  3C8E A;  5JWO B;  3F3R A;  1OAZ A;  1EV4 A;  1K0C A;  2H74 A;  2L4Q A;  2PUK C;  1FO5 A;  2PPT A;  1YF1 A;  3RAZ A;  1JZR A;  5EVO A;  2L6D A;  1N8J A;  1TW9 A;  1G6Y A;  3KMO A;  1RK4 A;  5CRH A;  1FOV A;  4J56 E;  3ZRE A;  2CVK A;  2VL2 C;  4ZIL A;  3CYN A;  2LRT A;  2R5G A;  1S3A A;  4POL A;  1O6J A;  4PNG A;  3UMA A;  4Q5N A;  4L0U A;  2H73 A;  2LEG A;  3FZ5 A;  2R0P A;  3IXR A;  3EIN A;  5DVB A;  3CMI A;  4V2N A;  3H8Q A;  4BIK A;  5D9V A;  4GXZ A;  3FYG A;  4ILF A;  2H66 A;  3BCI A;  4GSN A;  3QFA C;  4KCA A;  2V1M A;  3FRC A;  2LQQ A;  4KUN A;  4XCS A;  1S3C A;  3PPU A;  1XIY A;  2X49 A;  1GTU A;  4EL1 A;  3A3T A;  3IC4 A;  1RQM A;  1ST9 A;  2LJA A;  4GWR A;  3FZA A;  1THX A;  4XS4 A;  3K8N A;  1LU4 A;  2VLV A;  2UZ8 A;  5HR0 A;  3SWL A;  2V6O A;  2J23 A;  5JCG A;  4MDC A;  5CRW A;  3TKR A;  2A4V A;  3E9J B;  2CX4 A;  4XRD A;  4ID0 A;  4TR3 A;  3M1G A;  2R0G A;  3IAS 2;  5GAP D;  3KH9 A;  3LWA A;  4ULX A;  5H5R A;  3RBT A;  3R2Q A;  5IO0 A;  3GH9 A;  2H71 A;  2JZR A;  3QAW A;  2H0H A;  1UVZ A;  5G1K A;  4GQF A;  2YWO A;  3TKP A;  1A2L A;  1K0A A;  2YWM A;  3VI7 A;  4FO5 A;  4LL1 B;  1IYI A;  2HI7 A;  3RPP A;  1Z3E A;  4FQU A;  3KM6 A;  5E59 A;  1M3I A;  5DCH A;  4MJC A;  3TRQ A;  3VFI A;  10GS A;  1EWX A;  4ECI A;  1THO A;  1PL1 A;  4IP1 A;  4JR4 A;  1EZK A;  1UN2 A;  3GYK A;  1JHB A;  2E0Q A;  3F63 A;  11GS A;  1GP1 A;  4KSO A;  4LMW A;  1X9M B;  4KB3 A;  1ZCP A;  3F0I A;  1F3B A;  2PMT A;  2AV4 A;  4KX4 A;  1R5P A;  2GQK A;  2X64 A;  2OBK A;  3BCK A;  4HQZ A;  1GNW A;  5IMV A;  2TRC P;  5G30 A;  2CAQ A;  1USB A;  1PSQ A;  2PN8 A;  5DQS A;  4V2L A;  1TRW A;  5DDL A;  2I1U A;  3GKX A;  4MAB A;  1OC8 A;  2GQL A;  3MYD A;  1O8W A;  9GSS A;  3TKS A;  2K8S A;  1M9B A;  5B6N A;  5IPG A;  4MZC A;  2HE3 A;  4KCE A;  4HZ4 A;  5A5K A;  4AF2 A;  2OJL A;  3HY2 A;  4Z2U A;  5ECP B;  4GST A;  5IOW A;  3UAR A;  5HR3 A;  2VCX A;  1K0M A;  1Z6M A;  3FHK A;  3BJ5 A;  2I81 A;  3F4T A;  1N2A A;  2CVB A;  5D73 A;  1PKW A;  3J7Y k;  4AJ6 A;  2X8C A;  4MH2 A;  2IMK A;  5F0G A;  1GLQ A;  4ECB A;  3FK8 A;  1JFU A;  1TRU A;  3FZ9 A;  17GS A;  4XS4 B;  3HDC A;  3WYW A;  2C0E A;  4EO3 A;  22GS A;  2QGV A;  1U3I A;  2QSI A;  2GSR A;  5FHI A;  5G31 A;  1DE1 A;  1XWK A;  3UVT A;  5ELA A;  2VIM A;  2AHE A;  1ZGN A;  2LRC A;  3FR6 A;  3I6A A;  14GS A;  4EC0 A;  2JAD A;  4MF7 A;  4KDX A;  4HJM A;  1M2D A;  4ACS A;  2A2S A;  3GTU A;  2R37 A;  5G5F A;  4K7N A;  2QKE A;  5CYY A;  4O5R A;  2L59 A;  2B3S A;  1EP7 A;  3UIW A;  1M7T A;  3D4M A;  3KTB A;  2DIZ A;  4P3Y B;  3U6V A;  3KGK A;  4OO4 A;  4BA7 A;  3KP9 A;  4ML6 A;  3G9B A;  2H0G A;  1UA5 A;  2FD3 A;  5JCW A;  2EC4 A;  1CQG A;  3M9J A;  1XVW A;  2WUL A;  3GX0 A;  1PRX A;  4N30 A;  3CBU A;  6GSW A;  1M9A A;  1EOG A;  3KMN A;  5ECO B;  2LNS A;  2B6M A;  5E4W A;  5A4U A;  2GST A;  2MBS A;  7GSS A;  3MAK A;  1OC3 A;  2VLT A;  1WP0 A;  1XW6 A;  3P2A A;  1PA3 A;  5F05 A;  5IMC A;  4FH8 A;  1X0R A;  3LXZ A;  4WR4 A;  5LCZ A;  2C3T A;  2O87 A;  3L4N A;  1FOH A;  2I4A A;  4TRX A;  3UBK A;  5ECL B;  1BJX A;  4G0L A;  6GST A;  2DJ2 A;  5AIS A;  1B9Y C;  2CZ2 A;  1V58 A;  5ECS A;  5IPH A;  2XHF A;  3TKS E;  1WE0 A;  3HCZ A;  4NPB A;  3C7M A;  4MLY A;  6GSY A;  4K6X A;  4V1A p;  3KP8 A;  4X43 A;  3ZMK A;  2PVO C;  3A5I A;  1FW1 A;  3FR3 A;  2FWE A;  5H5Q A;  2CVD A;  4WBJ A;  3RDW A;  3E0U A;  5B8B A;  5ECR B;  3DEX A;  3HVV A;  1WRY A;  1RW1 A;  4YKG A;  2GVP A;  2KP1 A;  2CAI A;  3F4S A;  1YEP A;  3L0H A;  4I2U A;  4N0V A;  1QUW A;  2A4H A;  1BX9 A;  2OE1 A;  2WRT A;  3PR8 A;  1Z7R A;  1YF0 A;  3Q18 A;  1J08 A;  1M0U A;  2AYT A;  3M8N A;  1GSS A;  4F03 A;  5C00 A;  3APO A;  3QMX A;  3DVW A;  3ZVJ A;  4OMV A;  3LG6 A;  1XG8 A;  5ECM B;  3W8S A;  4XRA A;  1VGL A;  3L9U A;  1XXU A;  4OO5 A;  1GRX A;  3QAV A;  3A5W A;  1HYU A;  2C4J A;  2CA8 A;  4PNF A;  3GL5 A;  2VCT A;  4USS A;  3LW9 A;  1ERT A;  5DCG A;  2YZH A;  4ZL7 A;  3GRX A;  1MD3 A;  1SEN A;  3MWH A;  4MJA A;  2QA2 A;  2H1D A;  2MZC A;  1SU9 A;  4DSR A;  4XS6 A;  2L5L A;  2L6C A;  3KCM A;  4GCI A;  4NWY A;  2DLX A;  5F07 A;  5HFG A;  3M0F A;  2VL9 A;  1GSD A;  2XBQ A;  2H6X A;  4EVM A;  3ME8 A;  3HKR A;  5CNW A;  4EF0 A;  4I8B A;  4G9H A;  5ECI B;  3BBY A;  3GL3 A;  1V57 A;  1JZD A;  4XS1 A;  1PX7 A;  1TU8 A;  3MDK A;  3QCP A;  1YZX A;  2WS2 A;  1SD8 A;  3CSJ A;  4G2E A;  3ZFL A;  2FA8 A;  2H1B A;  2YWI A;  1YQ1 A;  3DWV A;  4PUF C;  2H19 A;  4JRR A;  3FZ4 A;  2P0G A;  1AQV A;  5AIX A;  1GSQ A;  2I3Y A;  1F9M A;  2CV4 A;  1XFL A;  2BTO T;  4N10 A;  5CP1 A;  4TVE A;  1LJR A;  5ABR A;  4OFN A;  1JLW A;  1EGO A;  1A2J A;  1VRS D;  4WKW A;  3KTL A;  4WXT A;  3ZIJ A;  4F0C A;  2RUE A;  5ENU A;  5L71 A;  1MEK A;  1HNB A;  5IO2 A;  5ECK B;  2D2Z A;  3QR6 A;  4MP4 A;  4MF6 A;  2FHE A;  3TJB A;  4JZQ A;  3D6I A;  1YDK A;  2DJ3 A;  1K0D A;  2VCZ A;  3GMF A;  12GS A;  5JWQ B;  2LS5 A;  4XHM A;  2VCQ A;  3IK7 A;  1E6B A;  1PFO A;  3EVI A;  4TXO B;  2C1Y A;  4IQA A;  2H01 A;  2HZE B;  1URM A;  4NV2 A;  1H4O A;  1J9B A;  2JZS A;  3Q74 A;  19GS A;  5INY A;  4ZB9 A;  4GF0 A;  1XOB A;  3QOU A;  3GIX A;  2H1G A;  2CZ3 A;  4YAP A;  5ID2 A;  4DSS A;  2GQM A;  4K9Z A;  1F3A A;  2FUG 2;  1GSF A;  1WPI A;  3PH9 A;  4O32 A;  3VK9 A;  1AQW A;  3FMW A;  3WT2 A;  4I97 A;  1FAA A;  3H1N A;  2IL3 A;  4HS1 A;  3UVH A; 
#chains in the Genus database with same CATH homology
 1GSU A;  5IMD A;  3O76 A;  2HXK A;  2MMA A;  5IMZ A;  3G7J A;  1BYE A;  2PVQ A;  2M46 A;  5ECN B;  2RUF A;  1U3A A;  4F82 A;  3LEF A;  3QFB C;  3DML A;  2V6K A;  2A2R A;  2ZNM A;  3FW2 A;  4KDU A;  5KN0 A;  1HQO A;  5B6M A;  1EOH A;  1R5A A;  4KGI A;  4EIQ A;  4KA0 A;  1FVJ A;  2R6K A;  2E2M A;  2LST A;  3EPT A;  2EIQ A;  4ZL9 A;  4G10 A;  1TTZ A;  2MMN A;  1AW9 A;  3VWX A;  3TRP A;  3MNG A;  4CY6 A;  1PN9 A;  2FY6 A;  2WGR A;  4HOJ A;  4TR1 A;  3R3E A;  3JCM L;  2L4C A;  3UJ1 A;  3KEB A;  2P31 A;  1HD2 A;  2NTO A;  2YNX A;  5DJL A;  3LQ7 A;  1O81 A;  1ERU A;  2QA1 A;  1OE7 A;  1E2Y A;  4IJ3 A;  4IGJ A;  5HR2 A;  3GKN A;  4X1U A;  1KBN A;  4IBP A;  2OBI A;  5KN1 A;  3EMP A;  1W89 A;  4IS0 A;  1SYR A;  1XZO A;  2I9H A;  3VUR A;  2KOK A;  3ISO A;  2PBJ A;  3QD9 A;  2H76 A;  4K0N A;  3DVX A;  2M80 A;  2YAN A;  1T7P B;  3TOT A;  1NM3 A;  3NZN A;  1Z9H A;  2REM A;  3WD6 A;  4JR6 A;  2LQO A;  5AIV A;  3MIX A;  1PD2 1;  2F3M A;  4YQV A;  4Q5Q A;  3HVS A;  3GH6 A;  1IYH A;  5F06 A;  1EGR A;  4O7H A;  3KH7 A;  1X9S B;  5CAX A;  2CQ9 A;  4OCE A;  1G7O A;  3TJG A;  2R0C A;  4DSS B;  2GT5 A;  3BOA A;  4HI7 A;  4K0G A;  1V9W A;  2OAC A;  5AGY A;  4CY8 A;  5CRD A;  1TK0 B;  3HHV A;  3UAP A;  1G6W A;  1SKS B;  3EU4 A;  3VI5 A;  4EUY A;  4L0W A;  3HA9 A;  1TK5 B;  1OC9 A;  1B4Q A;  4PQH A;  4MZB A;  3WGX A;  1T4Y A;  4NHW A;  1ON4 A;  1U6T A;  4CDO A;  4F9Z A;  5LNK e;  3IPZ A;  5CO3 A;  1BQ7 A;  3LJR A;  4OFT A;  2C3Q A;  3HVX A;  4WBR D;  3F6F A;  3KXO A;  2KHP A;  4LMV A;  3G7Y A;  2KP2 A;  3IHQ A;  4BVX A;  1ACV A;  1WIK A;  2A2P A;  4N11 A;  1CQH A;  1TK8 B;  1KTE A;  3CRT A;  4IQ1 A;  5EPF A;  4NAX A;  2NPB A;  1SJ6 A;  5ELG A;  1F37 A;  3LOR A;  1FB6 A;  1UC7 A;  4HU7 A;  1EEM A;  4O92 A;  5B7C A;  3ME7 A;  1OKT A;  4IEL A;  3KJY A;  1KEB A;  2XBI A;  1BG5 A;  2YCD A;  4I6X A;  4IHU A;  1S3D A;  1PQN A;  1NW2 A;  1NHY A;  1ZYN A;  1HNC A;  2YJ7 A;  4Q5F A;  1QFN A;  2WDU A;  1TOF A;  3VWV A;  4EIP A;  5BMU A;  3VWU A;  1QK8 A;  2HRA A;  4I5Q A;  3FKF A;  1A24 A;  2MMO A;  2TIR A;  2O85 A;  4J57 E;  4D73 A;  1XW9 A;  3UBL A;  1AUC A;  2CT6 A;  4DEJ A;  3EUR A;  4X4J A;  3ZVJ D;  1TJD A;  2VUP A;  3ZIV A;  2DJ0 A;  1V40 A;  5B8A A;  6GSV A;  1F6M C;  3OR5 A;  4ICY A;  1XPV A;  3TOU A;  1K3Y A;  4O5U A;  5FWG A;  4OWY A;  2GTU A;  1NHO A;  5KOW A;  2H70 A;  1A2M A;  3APS A;  4Q5R A;  1T1V A;  4EKZ A;  5FT3 A;  3WT1 A;  2ZUP A;  4YQU A;  3GST A;  1H75 A;  1PX6 A;  3VWW A;  3D5J A;  2JSY A;  4F0B A;  3TKS C;  4GLT A;  3ZZX A;  3ZTL A;  3IBH A;  2HRN A;  3CSH A;  3ZIT A;  3WGD A;  4POM A;  2YOI A;  1PN0 A;  2DC5 A;  1VF3 A;  1MDI A;  2FWG A;  4ZBB A;  3A2X A;  1TRV A;  1M2A A;  4FIW A;  5D93 A;  4G0I A;  2YV9 A;  2YP6 A;  3TCO A;  2IMI A;  2DSA A;  1XBS A;  2H0I A;  3ED3 A;  1PL2 A;  1GL8 A;  2B7J A;  1M2B A;  4V2M A;  3Q19 A;  2IJY A;  3CSI A;  4WF5 A;  5DQY A;  2DIY A;  2R3X A;  4K7O A;  4OCF A;  1WWJ A;  4DVC A;  4OD7 A;  1FHE A;  2VL2 A;  1MDK A;  4CW9 A;  2G2Q A;  2YWN A;  3HJO A;  3RHC A;  3DIE A;  2J9H A;  2VCV A;  2IPA A;  4PGT A;  4TW5 A;  2DJJ A;  1GTB A;  5J9C A;  2OAD A;  3SBC A;  1PGT A;  4RQX A;  2LV3 A;  3GTU B;  1SJZ A;  3LGC A;  4KSM A;  5ECH B;  1A23 A;  2R4V A;  2IIY A;  1B9X C;  3C71 A;  4G0K A;  2WJU A;  20GS A;  1V2A A;  3DRN A;  1YEX A;  4QQ7 A;  1U87 A;  3H4K A;  3IR4 A;  2IFQ A;  1G0T A;  4L5L A;  1AC1 A;  1GUK A;  4MPF A;  2LJK A;  1VF1 A;  2PU9 C;  3F6D A;  2B1K A;  5DAK A;  3GKK A;  1GNE A;  4MA9 A;  4K5S A;  1T4Z A;  3ZFB A;  4AGS A;  4Z2T A;  1O73 A;  1B4P A;  1JZO A;  1R7H A;  1B48 A;  3FR9 A;  16GS A;  3GNJ A;  3DYR A;  3L9V A;  1T3B A;  2H75 A;  3HZ4 A;  4FYU A;  4IJI A;  2MYG A;  1QXH A;  3IK9 A;  3O3T A;  2ZCT A;  1XOA A;  1V98 A;  3S9F A;  2IMF A;  4HUA A;  2H1A A;  2GSQ A;  1Q4J A;  4ZB8 A;  5EY6 A;  1B8X A;  2WZ9 A;  4NV5 A;  1Z7P A;  4RI7 A;  3W8J A;  3TRX A;  1G7E A;  2YZU A;  2NBS A;  2GZZ A;  3O6T A;  1TDI A;  3C73 A;  3N9J A;  2B5E A;  1TRS A;  1ERW A;  6GSU A;  1TP9 A;  4WF4 A;  4LLR A;  2JZT A;  2H6Z A;  1R4W A;  3RPN A;  4MCU A;  5J4U A;  1A0R P;  2HSM A;  5HFI A;  2LTK A;  3TB2 A;  2JU5 A;  2IME A;  3IA1 A;  4E8H A;  5A4W A;  2L5O A;  3EU3 A;  3EMX A;  4AJ8 A;  1LBK A;  2RM6 A;  2EIO A;  3BD2 A;  3UOM A;  1XW5 A;  3IAM 2;  3ERF A;  2C0G A;  2LRN A;  2HRK A;  4ECJ A;  1BED A;  2VO4 A;  2HFD A;  2DKH A;  1QGV A;  1F2E A;  5AN1 A;  4PTS A;  3GFK A;  3GV1 A;  2WCI A;  3GX8 A;  1MDJ A;  3ERG A;  4YH2 A;  1X5E A;  4JU5 A;  4K8M A;  4FYC A;  3IV4 A;  4QL9 A;  1DUG A;  1TKD B;  2DJK A;  2YN1 A;  4L5O A;  3H79 A;  3I9V 2;  2TRX A;  3P90 A;  4K2X A;  2H72 A;  2C8U A;  3EE2 A;  2CX3 A;  2GZY A;  3F3Q A;  3IHG A;  1WMJ A;  4Z2R A;  2PWJ A;  6GSS A;  3G7I A;  4MK3 A;  1SK2 A;  1GSY A;  2HSY A;  5D9W A;  2P5R A;  2V2G A;  5LD0 A;  3TJK A;  1Y6E A;  5GAN D;  2FWF A;  3DD3 A;  2C3N A;  2K6V A;  4YQM A;  3GUR A;  2DKI A;  1TI1 A;  3KIJ A;  1FVK A;  4LA1 A;  3L9S A;  4A5P A;  2PGT A;  3UEM A;  2F9S A;  4JED A;  2IFQ B;  1SJI A;  1ZL9 A;  5D8I A;  4WET A;  2GGT A;  4BL7 A;  5DAK B;  1GUL A;  4AJ7 A;  1GUH A;  1MD4 A;  1HNA A;  2B7K A;  4PUA A;  2KUC A;  3D22 A;  4RI6 A;  2E7P A;  2C0F A;  1GWC A;  2LUS A;  3CRU A;  3NIV A;  1ZMA A;  3RHB A;  2O8V B;  2LNT A;  2N5F A;  4Z7X A;  2FGX A;  4NHZ A;  1A0F A;  2GDR A;  2JSZ A;  2LKU A;  3FY7 A;  4IKH A;  5KN3 A;  4POB A;  4HDE A;  4K7I A;  2Z9S A;  3VPQ A;  2N5A A;  5F8B A;  4GRF A;  5DBQ A;  2VL3 A;  4MNN A;  1XVQ A;  2VD0 A;  4BWQ A;  3WGE A;  4GQC A;  4FYB A;  3LXT A;  3D4T A;  4MH3 A;  3EYT A;  4EXJ A;  3ZML A;  4ZBD A;  1SKR B;  1Y25 A;  2VAF A;  1AXD A;  1XWC A;  5J9B A;  4EDY A;  1OYJ A;  3C1S A;  5HR1 A;  4KDY A;  3ERW A;  3KD0 A;  1SK1 A;  3KZQ A;  1YKC A;  2NVL A;  5IMA A;  4IP6 A;  4TOP A;  3F8U A;  1XCC A;  2V32 A;  5A4V A;  1EP8 A;  3IDV A;  3QPM A;  4XTS A;  1PKZ A;  1FG4 A;  4PQI A;  2X99 A;  2WB9 A;  4MJE A;  4NMU A;  1AAZ A;  5CRE A;  5GSS A;  3J7Y b;  4PXO A;  1XWA A;  4IVF A;  5ID2 B;  2AAW A;  1SYX A;  4H86 A;  5HFK A;  2XC2 A;  5J41 A;  1JLV A;  4ECC A;  1ZOF A;  2H8L A;  1OVN A;  2MBT A;  2K18 A;  13GS A;  1Q98 A;  2VOC A;  1X5D A;  1I5G A;  4PUR A;  5CRG A;  4LL4 B;  4ZXG A;  4HEA 2;  2F8A A;  5HQP A;  4JE1 A;  1OKD A;  2K9F A;  2NDO A;  3P7X A;  2BJX A;  4HQS A;  1EEJ A;  4QL7 A;  3HZ8 A;  5IMF A;  3NOF A;  2F51 A;  2VD1 A;  3DGQ A;  3IRA A;  1TI3 A;  5H5S A;  2HLS A;  4J2F A;  4BVY A;  2X4A A;  1QMV A;  1DE2 A;  1K3L A;  4K1F A;  3CXG A;  3ZL5 A;  3AY8 A;  2YPM A;  5D96 A;  2XPD A;  4HU9 A;  4WR5 A;  4XIH A;  4KF9 A;  4HJ2 A;  4RUV A;  2FA4 A;  3VPT A;  1JZW A;  4TN8 A;  2VM1 A;  3D21 A;  4KW6 A;  2RII A;  4E8E A;  3V1W A;  2GT6 A;  2R2J A;  5J3R A;  1U88 A;  3PIN A;  4G19 A;  5COH A;  4WEY A;  4NXI A;  3LYK A;  2B5X A;  3M9K A;  5G1L A;  4BL7 B;  3LSZ A;  3W6G A;  1ERV A;  5IM9 A;  1DSB A;  2N5B A;  5IOX A;  2DML A;  1GLP A;  4O5Q A;  2C80 A;  5C04 A;  4GTU A;  3F4R A;  3Q6O A;  3TKQ A;  1ML6 A;  2HNL A;  4N0Z A;  4TR1 B;  1K0B A;  2B1L A;  2JL4 A;  3E3E A;  1YY7 A;  1K0N A;  3DKS A;  4JBB A;  2AB6 A;  3QDN A;  1AIU A;  2HYX A;  1K0O A;  5KOX A;  1M99 A;  1SK0 A;  4MPG A;  2DMM A;  2PER A;  2X8H A;  3CTF A;  1J0F A;  1MTC A;  4YAV A;  4BPY A;  4MMM A;  4PX1 A;  3GUS A;  5IIZ A;  3C1R A;  3M3M A;  4POK A;  2VM2 A;  2ON7 A;  3GHA A;  2YJH A;  6GSX A;  1FB0 A;  1GUM A;  4ZL8 A;  3L78 A;  2ON5 A;  1QQ2 A;  1SL1 B;  1O85 A;  2K8V A;  2ES7 A;  5G2Z A;  1C72 A;  1R26 A;  1XWG A;  1ZYQ B;  5BRT A;  2WFC A;  2B5Y A;  4KND A;  1T00 A;  2ALB A;  2KLX A;  2E2G A;  3LYP A;  5JCU A;  3I69 A;  2GSS A;  5G5E A;  1A8Y A;  1SD9 A;  4IW9 A;  1BAY A;  5DAL A;  2HT9 A;  4KE3 A;  4CHS A;  3H93 A;  1X9W B;  3CTG A;  5GZZ B;  2OKA A;  5IQY A;  1O7U A;  1GSE A;  1NSW A;  1K3O A;  4TKY A;  3IOS A;  2EIR A;  2MMZ A;  4MJB A;  3QAG A;  2F8F A;  4TXV A;  1ABA A;  3FEU A;  4ZIJ A;  1GH2 A;  4TXO A;  4KAE A;  4MZW A;  3N5O A;  1SKW B;  4K2D A;  1OC9 B;  4RQR A;  2OA7 A;  1DBY A;  4BVY B;  3HJP A;  2HZE A;  4X0X A;  5D9X A;  2FLS A;  3APQ A;  3TJJ A;  3U5R E;  2G0F A;  3IC8 A;  4MF5 A;  1A8L A;  3TUE A;  1SL2 B;  2GS3 A;  3EWL A;  4GSS A;  4I2T A;  4ZB6 A;  4V1A g;  4BVX B;  1EV9 A;  4EDZ A;  2P5Q A;  4BWS A;  5J5N A;  1TU7 A;  2HRF A;  3ZYW A;  2JAC A;  4PQ1 A;  3GSS A;  1TXX A;  2IWT A;  2DJ1 A;  2O7K A;  2VLU A;  3ZLP A;  4TR4 A;  3HD5 A;  3TDG A;  1YKA A;  1O8X A;  3GKM A;  2AUV A;  2H6Y A;  3ZRD A;  4K5R A;  1YJ6 A;  2DBC A;  5DJM A;  1VF2 A;  2X8G A;  2BMX A;  5D9T A;  1SL0 B;  3HXS A;  18GS A;  5GST A;  2C0D A;  3A2W A;  3F9U A;  4IN0 A;  2V41 A;  1W4V A;  3A2V A;  5KN2 A;  3VLN A;  5ECQ B;  2IMD A;  4F2I A;  2GZP A;  3MSZ A;  1GTI A;  2L57 A;  4KH7 A;  3TGZ A;  4ISD A;  1GTA A;  3DXB A;  3GA4 A;  5KEJ A;  4D73 B;  1AQX A;  2O89 A;  2IN3 A;  2LJR A;  1I9D A;  5JWR B;  2VCW A;  3IE3 A;  1X5C A;  2OE3 A;  3HJM A;  1WOU A;  3PGT A;  3TJF A;  3US3 A;  3P8W A;  8GSS A;  2XPE A;  4OFM A;  2GLR A;  2FNO A;  4ML1 A;  2FWH A;  4L8E A;  3LFL A;  1ILO A;  1KNG A;  2QC7 A;  2AJQ B;  2HSH A;  5EL8 A;  1ZYP A;  2FCH A;  1VF4 A;  1XWB A;  4DSQ A;  4TR0 A;  4HZ2 A;  3D0Z A;  1OE8 A;  3EC3 A;  1ZZY A;  2RM5 A;  4ZBA A;  5DAL B;  1WJK A;  2H30 A;  2OE0 A;  2HZF A;  2YV7 A;  2RLI A;  1Z6N A;  1Z5Y E;  3HYP A;  3I43 A;  3UL3 A;  1ZYE A;  1PMT A;  4YKF A;  2M72 A;  3GN3 A;  4EE0 A;  1T8E B;  3C8E A;  5JWO B;  3F3R A;  1OAZ A;  1EV4 A;  1K0C A;  2H74 A;  2L4Q A;  2PUK C;  1FO5 A;  2PPT A;  1YF1 A;  3RAZ A;  1JZR A;  5EVO A;  2L6D A;  1N8J A;  1TW9 A;  1G6Y A;  3KMO A;  1RK4 A;  5CRH A;  1FOV A;  4J56 E;  3ZRE A;  2CVK A;  2VL2 C;  4ZIL A;  3CYN A;  2LRT A;  2R5G A;  1S3A A;  4POL A;  1O6J A;  4PNG A;  3UMA A;  4Q5N A;  4L0U A;  2H73 A;  2LEG A;  3FZ5 A;  2R0P A;  3IXR A;  3EIN A;  5DVB A;  3CMI A;  4V2N A;  3H8Q A;  5D9V A;  4GXZ A;  3FYG A;  4ILF A;  2H66 A;  3BCI A;  4GSN A;  3QFA C;  4KCA A;  2V1M A;  3FRC A;  2LQQ A;  4KUN A;  4XCS A;  1S3C A;  3PPU A;  1XIY A;  2X49 A;  1GTU A;  4EL1 A;  3A3T A;  3IC4 A;  1RQM A;  1ST9 A;  2LJA A;  4GWR A;  3FZA A;  1THX A;  4XS4 A;  3K8N A;  1LU4 A;  2VLV A;  2UZ8 A;  5HR0 A;  3SWL A;  2V6O A;  2J23 A;  5JCG A;  4MDC A;  5CRW A;  3TKR A;  2A4V A;  3E9J B;  2CX4 A;  4XRD A;  4ID0 A;  4TR3 A;  3M1G A;  2R0G A;  3IAS 2;  5GAP D;  3KH9 A;  3LWA A;  4ULX A;  5H5R A;  3RBT A;  3R2Q A;  5IO0 A;  3GH9 A;  2H71 A;  2JZR A;  3QAW A;  2H0H A;  1UVZ A;  5G1K A;  4GQF A;  2YWO A;  3TKP A;  1A2L A;  1K0A A;  2YWM A;  3VI7 A;  4FO5 A;  4LL1 B;  1IYI A;  2HI7 A;  3RPP A;  1Z3E A;  4FQU A;  3KM6 A;  5E59 A;  5DCH A;  4MJC A;  3TRQ A;  3VFI A;  10GS A;  1EWX A;  4ECI A;  1THO A;  1PL1 A;  4IP1 A;  4JR4 A;  1EZK A;  1UN2 A;  3GYK A;  1JHB A;  2E0Q A;  3F63 A;  11GS A;  1GP1 A;  4KSO A;  4LMW A;  1X9M B;  4KB3 A;  1ZCP A;  3F0I A;  1F3B A;  2PMT A;  2AV4 A;  4KX4 A;  1R5P A;  2GQK A;  2X64 A;  2OBK A;  3BCK A;  4HQZ A;  1GNW A;  5IMV A;  2TRC P;  5G30 A;  2CAQ A;  1USB A;  1PSQ A;  2PN8 A;  5DQS A;  4V2L A;  1TRW A;  5DDL A;  2I1U A;  3GKX A;  4MAB A;  1OC8 A;  2GQL A;  3MYD A;  1O8W A;  9GSS A;  3TKS A;  2K8S A;  1M9B A;  5B6N A;  5IPG A;  4MZC A;  2HE3 A;  4KCE A;  4HZ4 A;  5A5K A;  4AF2 A;  2OJL A;  3HY2 A;  4Z2U A;  5ECP B;  4GST A;  5IOW A;  3UAR A;  5HR3 A;  2VCX A;  1K0M A;  1Z6M A;  3FHK A;  3BJ5 A;  2I81 A;  3F4T A;  1N2A A;  2CVB A;  5D73 A;  1PKW A;  3J7Y k;  4AJ6 A;  2X8C A;  4MH2 A;  2IMK A;  5F0G A;  1GLQ A;  4ECB A;  3FK8 A;  1JFU A;  1TRU A;  3FZ9 A;  17GS A;  4XS4 B;  3HDC A;  3WYW A;  2C0E A;  4EO3 A;  22GS A;  2QGV A;  1U3I A;  2QSI A;  2GSR A;  5FHI A;  5G31 A;  1DE1 A;  1XWK A;  3UVT A;  5ELA A;  2VIM A;  2AHE A;  1ZGN A;  2LRC A;  3FR6 A;  3I6A A;  14GS A;  4EC0 A;  2JAD A;  4MF7 A;  4KDX A;  4HJM A;  1M2D A;  4ACS A;  2A2S A;  3GTU A;  2R37 A;  5G5F A;  4K7N A;  2QKE A;  5CYY A;  4O5R A;  2L59 A;  2B3S A;  1EP7 A;  3UIW A;  1M7T A;  3D4M A;  3KTB A;  2DIZ A;  4P3Y B;  3U6V A;  3KGK A;  4OO4 A;  4BA7 A;  3KP9 A;  4ML6 A;  3G9B A;  2H0G A;  1UA5 A;  2FD3 A;  5JCW A;  2EC4 A;  1CQG A;  3M9J A;  1XVW A;  2WUL A;  3GX0 A;  1PRX A;  4N30 A;  3CBU A;  6GSW A;  1M9A A;  1EOG A;  3KMN A;  5ECO B;  2LNS A;  2B6M A;  5E4W A;  5A4U A;  2GST A;  2MBS A;  7GSS A;  3MAK A;  1OC3 A;  2VLT A;  1WP0 A;  1XW6 A;  3P2A A;  1PA3 A;  5F05 A;  5IMC A;  4FH8 A;  1X0R A;  3LXZ A;  4WR4 A;  5LCZ A;  2C3T A;  2O87 A;  3L4N A;  1FOH A;  2I4A A;  4TRX A;  3UBK A;  5ECL B;  1BJX A;  4G0L A;  6GST A;  2DJ2 A;  5AIS A;  1B9Y C;  2CZ2 A;  1V58 A;  5ECS A;  5IPH A;  2XHF A;  3TKS E;  1WE0 A;  3HCZ A;  4NPB A;  3C7M A;  4MLY A;  6GSY A;  4K6X A;  4V1A p;  3KP8 A;  4X43 A;  3ZMK A;  2PVO C;  3A5I A;  1FW1 A;  3FR3 A;  2FWE A;  5H5Q A;  2CVD A;  4WBJ A;  3RDW A;  3E0U A;  5B8B A;  5ECR B;  3DEX A;  3HVV A;  1WRY A;  1RW1 A;  4YKG A;  2GVP A;  2KP1 A;  2CAI A;  3F4S A;  1YEP A;  3L0H A;  4I2U A;  4N0V A;  1QUW A;  2A4H A;  1BX9 A;  2OE1 A;  2WRT A;  3PR8 A;  1Z7R A;  1YF0 A;  3Q18 A;  1J08 A;  1M0U A;  2AYT A;  3M8N A;  1GSS A;  4F03 A;  5C00 A;  3APO A;  3QMX A;  3DVW A;  3ZVJ A;  4OMV A;  3LG6 A;  5ECM B;  3W8S A;  4XRA A;  1VGL A;  3L9U A;  1XXU A;  4OO5 A;  1GRX A;  3QAV A;  3A5W A;  1HYU A;  2C4J A;  2CA8 A;  4PNF A;  3GL5 A;  2VCT A;  4USS A;  3LW9 A;  1ERT A;  5DCG A;  2YZH A;  4ZL7 A;  3GRX A;  1MD3 A;  1SEN A;  3MWH A;  4MJA A;  2QA2 A;  2H1D A;  2MZC A;  1SU9 A;  4DSR A;  4XS6 A;  2L5L A;  2L6C A;  3KCM A;  4GCI A;  4NWY A;  2DLX A;  5F07 A;  5HFG A;  3M0F A;  2VL9 A;  1GSD A;  2XBQ A;  2H6X A;  4EVM A;  3ME8 A;  3HKR A;  5CNW A;  4EF0 A;  4I8B A;  4G9H A;  5ECI B;  3BBY A;  3GL3 A;  1V57 A;  1JZD A;  4XS1 A;  1PX7 A;  1TU8 A;  3MDK A;  3QCP A;  1YZX A;  2WS2 A;  1SD8 A;  3CSJ A;  4G2E A;  3ZFL A;  2FA8 A;  2H1B A;  2YWI A;  1YQ1 A;  3DWV A;  4PUF C;  2H19 A;  4JRR A;  3FZ4 A;  2P0G A;  1AQV A;  5AIX A;  1GSQ A;  2I3Y A;  1F9M A;  2CV4 A;  1XFL A;  2BTO T;  4N10 A;  5CP1 A;  4TVE A;  1LJR A;  5ABR A;  4OFN A;  1JLW A;  1EGO A;  1A2J A;  1VRS D;  4WKW A;  3KTL A;  4WXT A;  3ZIJ A;  4F0C A;  2RUE A;  5ENU A;  5L71 A;  1MEK A;  1HNB A;  5IO2 A;  5ECK B;  2D2Z A;  3QR6 A;  4MP4 A;  4MF6 A;  2FHE A;  3TJB A;  4JZQ A;  3D6I A;  1YDK A;  2DJ3 A;  1K0D A;  2VCZ A;  3GMF A;  12GS A;  5JWQ B;  2LS5 A;  4XHM A;  2VCQ A;  3IK7 A;  1E6B A;  3EVI A;  4TXO B;  2C1Y A;  4IQA A;  2H01 A;  2HZE B;  1URM A;  4NV2 A;  1H4O A;  1J9B A;  2JZS A;  3Q74 A;  19GS A;  5INY A;  4ZB9 A;  4GF0 A;  1XOB A;  3QOU A;  3GIX A;  2H1G A;  2CZ3 A;  4YAP A;  5ID2 A;  4DSS A;  2GQM A;  4K9Z A;  1F3A A;  2FUG 2;  1GSF A;  1WPI A;  3PH9 A;  4O32 A;  3VK9 A;  1AQW A;  3FMW A;  3WT2 A;  4I97 A;  1FAA A;  3H1N A;  2IL3 A;  4HS1 A;  3UVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...