2O89A

S. aureus thioredoxin p31t/c32s mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
AIVKVTDADFDSKVESGVQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Electron transport
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o89A00
4KW6A 1WJKA 1SYRA 1SYXA 1K0BA 4OWYA 1VF3A 1B8XA 2AHEA 3F63A 2IMEA 4KSOA 1QFNA 4TXOA 1F6MC 4JRRA 4HS1A 4ZL8A 2LNSA 4TR0A 3NIVA 3A2XA 4PXOA 2AYTA 1YY7A 2DJ1A 2LV3A 1YKAA 2CVKA 4EVMA 1IYHA 1GNEA 5ECNB 1SKRB 3FK8A 3IK9A 2NVLA 2C0GA 5G30A 2C0EA 1MD3A 3EE2A 2B5YA 2PVOC 2YANA 1Q4JA 1TK8B 4QQ7A 4EL1A 2VL9A 2HFDA 1O8WA 5ECQB 3C1SA 4KCAA 3UEMA 13GSA 3IBHA 3W8SA 5JCWA 2VOCA 1PL1A 4JR4A 1RK4A 19GSA 1QXHA 1R26A 2IJYA 4Q5QA 2HZEA 1T8EB 2VCQA 4HUAA 3GKMA 4CDOA 1QMVA 1F37A 3BJ5A 3FKFA 2N5BA 4F2IA 3HVSA 3QPMA 4MPFA 5G1KA 2JZRA 4EDZA 4OO4A 3DWVA 2MMAA 3KH7A 1Y6EA 6GSVA 1TI3A 1ERUA 3RBTA 3ZREA 2IN3A 2VLTA 1YJ6A 1GUKA 1M2DA 2WULA 4MDCA 1SK1A 4N0VA 1Z7PA 5AN1A 1OC9A 1PRXA 1NHYA 4TR3A 2V32A 4NPBA 1A8LA 3UVHA 2CZ2A 2E0QA 1GNWA 5JWQB 3ZFBA 4E8EA 2REMA 5AIVA 2VO4A 3N5OA 4BL7A 2AUVA 3ZRDA 1M2AA 1FO5A 3KMNA 4D73A 3QAGA 4HI7A 4ZXGA 4TR1A 3DKSA 1PX7A 4KUNA 1UVZA 1BJXA 1GL8A 4XCSA 1GTAA 2DIZA 5CNWA 2P5RA 4MK3A 2JACA 3GRXA 5LD0A 2L6CA 5ECKB 2LQQA 3GURA 5CREA 3M0FA 2VAFA 3P7XA 3BCKA 3KGKA 4XRDA 1K0MA 2HLSA 3E9JB 4TW5A 3TKSE 4CHSA 1SENA 2XC2A 1EGOA 4ISDA 3VFIA 4YH2A 2C4JA 1K0AA 1TXXA 2IIYA 1VRSD 3GIXA 4XS6A 3N9JA 5DAKA 1WPIA 3TJKA 4LMWA 1XOAA 1YZXA 1MTCA 4FYCA 1FHEA 2JADA 1B48A 2DJ2A 3H8QA 4MF7A 1TP9A 2L5OA 3IV4A 1SD8A 4TKYA 5CO3A 4JEDA 1TRWA 5ENUA 3F6FA 1FW1A 2P5QA 4KA0A 3D4TA 4GSSA 1F3AA 4HDEA 4DVCA 2YP6A 5L71A 3LEFA 5B8BA 3GKNA 3TOTA 3L4NA 1Q98A 2O87A 4HEA2 6GSSA 5KN3A 2G2QA 3CTGA 3VK9A 5CRGA 2OE0A 3HCZA 2IFQA 2PVQA 5HR1A 3I69A 1V2AA 3TKPA 2RLIA 2R4VA 3M8NA 5ID2A 5HR0A 4GSNA 1B4PA 2VD1A 3LG6A 2A2RA 3APSA 4KGIA 3TJGA 4BVXA 3KTBA 2FUG2 1XFLA 4F82A 4JE1A 4PQ1A 2M72A 1U88A 3HJOA 4I6XA 5D9WA 1V57A 2H0IA 1LBKA 3LORA 3Q6OA 1TU8A 4L8EA 3RHCA 4FH8A 3I6AA 4BVYA 2RUEA 3HA9A 3LYPA 2GVPA 2IWTA 3FZAA 2O85A 2VM2A 4BPYA 4K0NA 5CRHA 3ZVJA 6GSUA 2I81A 1WWJA 1BG5A 3UJ1A 14GSA 4PUAA 3PR8A 2H1GA 1VF1A 4K0GA 1YDKA 1R5PA 2DLXA 2WFCA 1MDIA 4KH7A 3I9V2 3D21A 5INYA 3GKKA 3RPNA 2GZZA 2HSYA 3APQA 3GH9A 4GTUA 3BD2A 4TR4A 1A2JA 1QQ2A 3HD5A 2K18A 2L57A 3DVWA 1EWXA 1T1VA 4MJBA 2JSYA 1R5AA 2DJ3A 1GSUA 5B6NA 4NHZA 1T3BA 1SKWB 1OC3A 4KSMA 3QFBC 1V98A 3RPPA 1OYJA 2WRTA 2JU5A 1AW9A 5AIXA 1PGTA 1V58A 2YWNA 4X0XA 3PH9A 4MP4A 1X9MB 4TN8A 4ZB8A 5D8IA 3IOSA 3M1GA 2A4VA 4JZQA 1TTZA 2FWEA 3RDWA 3F9UA 1J08A 1XIYA 5IMFA 4GLTA 3IPZA 3S9FA 1XWGA 2V6OA 1R7HA 3GV1A 3KZQA 3DGQA 3JCML 2TIRA 1DBYA 1ZZYA 2AJQB 4LLRA 5J9BA 1V40A 4AJ8A 2R6KA 10GSA 1LU4A 2Z9SA 4JBBA 3US3A 4Q5FA 2GT6A 2FA4A 2CX3A 3GX0A 3W8JA 1JLVA 3KEBA 4IJIA 2QGVA 3NZNA 1VF2A 4XRAA 1J9BA 2LEGA 4MH2A 1M9BA 4IN0A 3IA1A 3KP9A 2A2SA 2H72A 3CMIA 2G0FA 4J2FA 3TKSA 3MNGA 4KDUA 4K7NA 1JZDA 2HSHA 3VWWA 3KTLA 4XIHA 3CRUA 2GS3A 4V1Ag 1TRUA 2GSTA 3RAZA 3BOAA 5KN0A 5IO2A 4WF5A 1EP8A 1F3BA 1K3OA 3HKRA 5D73A 1ZCPA 2C80A 3ZMKA 1B4QA 2FNOA 1Z5YE 1FVJA 3FR6A 2HXKA 5IOXA 1AUCA 5IOWA 3ZFLA 2ZNMA 6GSWA 3K8NA 3DEXA 4MZCA 1JZOA 4NWYA 1AQXA 4TXVA 2FY6A 1QUWA 3D22A 3F3QA 4L5OA 3MDKA 5GSSA 5EPFA 2HRFA 2X8GA 3ZVJD 4ZIJA 5FWGA 4HZ2A 3IC4A 4EUYA 1BAYA 2KUCA 2IMDA 4AJ6A 2FLSA 1PSQA 1XVWA 3GNJA 5ABRA 9GSSA 5KN2A 3FZ4A 3A2WA 1WRYA 3IK7A 5DCGA 2N5FA 2FWFA 4L5LA 2C3TA 4YAVA 5H5QA 1AIUA 1GP1A 4RQXA 2VUPA 4O92A 1Z6NA 2H8LA 2AV4A 1TU7A 3UOMA 2LRNA 2PPTA 3CSHA 4AF2A 1DE1A 3WGXA 4DSSB 5CAXA 4HJ2A 2DSAA 3HZ8A 1M9AA 1A0FA 1OKTA 2DBCA 4K7OA 1GSYA 3C1RA 2GSQA 2ES7A 5GZZB 1BQ7A 5DALB 4WR5A 3ZTLA 3GSTA 4KAEA 5ELAA 2OBIA 2R2JA 5IMAA 3TJJA 2QSIA 4NHWA 2R37A 2AAWA 2JZTA 4WEYA 1NSWA 2GQMA 1U87A 3D4MA 3HVXA 4IQAA 2YJ7A 3IAS2 3EMXA 1SL2B 3H93A 5AGYA 1A24A 4N0ZA 2QC7A 11GSA 1C72A 2KOKA 4HQSA 3TDGA 2VL2C 3CSIA 4DSRA 4IHUA 2K6VA 1ERVA 3ZYWA 2K9FA 3VWVA 1A23A 1FB0A 2FA8A 5D9VA 4ML6A 1HQOA 3UAPA 4XS4B 2HZFA 4KX4A 1UA5A 3EU4A 1PN9A 5DVBA 5IPHA 4J56E 3GKXA 1TK0B 1X0RA 4V1Ap 5DQSA 3F0IA 5DJMA 1AC1A 1EZKA 2LRCA 2DC5A 2VIMA 3WYWA 3FYGA 4MF5A 4ECBA 2H0HA 4IJ3A 1XBSA 4GXZA 2WDUA 1BX9A 4BWSA 2QKEA 1ZMAA 4WKWA 2VCTA 5D93A 2FCHA 3IE3A 2LTKA 3Q19A 1SKSB 5IIZA 2M80A 1XVQA 3KH9A 1XWAA 2YCDA 3V1WA 2ALBA 4PNGA 2LS5A 2MZCA 3G7IA 4KDYA 4EF0A 3FEUA 2X64A 2KHPA 2H0GA 5GSTA 2H70A 3GL5A 3DRNA 3ZZXA 4KDXA 2F9SA 2RIIA 1K3YA 5H5SA 2C3QA 2NPBA 1M2BA 5G2ZA 3ED3A 3BBYA 4CW9A 2YV7A 3W6GA 1ZYQB 5A4VA 1M7TA 4RQRA 1G0TA 5DBQA 3D5JA 2VLUA 2VD0A 4MZBA 5C00A 5CRDA 2OKAA 1GSSA 4ECIA 3NOFA 2PGTA 4KE3A 3H4KA 3Q18A 1SL1B 5D96A 1XW6A 4YQUA 3U5RE 4ILFA 3WT2A 2F8AA 5ELGA 1ERTA 2H19A 3HVVA 4FO5A 1B9YC 4LL1B 2MBTA 1Z7RA 2LNTA 3L9UA 4JR6A 4IW9A 1GLQA 4G10A 3GSSA 2RM5A 2V1MA 3A5WA 5ECLB 1EV9A 4N10A 3UVTA 2L5LA 2IMFA 3ZLPA 1K0OA 3DVXA 2NTOA 6GSYA 1GLPA 4NV5A 3C73A 5A4WA 3HYPA 1O8XA 4KCEA 4O7HA 3A2VA 1QK8A 7GSSA 1HNAA 4IP6A 3CXGA 2O7KA 3VLNA 3LQ7A 3P2AA 4GCIA 3MWHA 2JZSA 3F3RA 3E0UA 1AAZA 3CSJA 2H6ZA 2I1UA 2EIQA 4RI7A 4K2DA 4PURA 3QAVA 1RQMA 2B1KA 1BEDA 2VCXA 4WBRD 4X43A 3GTUB 1W4VA 1G7EA 5HR3A 4PGTA 4TVEA 1GH2A 3HJPA 2HT9A 16GSA 1G6YA 3KJYA 2ZUPA 5GAPD 3FY7A 4WETA 2F8FA 3KXOA 4GQCA 1GSQA 4G2EA 3KMOA 2B7KA 2CA8A 1OKDA 4F0CA 1KNGA 2GQLA 2WB9A 4GQFA 2GLRA 4TR1B 4GRFA 3U6VA 3WD6A 1EP7A 1U6TA 1TDIA 4BWQA 3EVIA 2HI7A 5D9XA 2EC4A 4YQVA 2IPAA 1MEKA 5D9TA 1MDKA 3VWUA 4OCFA 2GT5A 5J4UA 1T4YA 1TKDB 2JL4A 3DMLA 4PNFA 1XWKA 1M0UA 1TK5B 3LYKA 4Q5NA 5DCHA 5ECRB 3SBCA 2HRNA 2CZ3A 4K9ZA 5HFGA 5DQYA 1Z6MA 5EVOA 4K1FA 3CYNA 4DSSA 1A0RP 2LJKA 2YOIA 2K8SA 2H1DA 3QD9A 3O6TA 1IYIA 2DJ0A 3GYKA 1TOFA 2AB6A 4KNDA 2LKUA 3HDCA 2GZYA 2H66A 1HNCA 3QR6A 2NDOA 1X5CA 3HHVA 3DD3A 4BA7A 3UL3A 2F51A 4MABA 1A2LA 1GSFA 3M9KA 3WGDA 1A2MA 4YAPA 4ZBAA 5ECSA 2IFQB 3UBLA 3ZL5A 2H71A 2XPDA 2CVDA 2L6DA 1YEXA 3APOA 4IKHA 1YF0A 4MA9A 22GSA 8GSSA 5C04A 1PX6A 3LJRA 3OR5A 4XS4A 5J9CA 3G9BA 2I9HA 1RW1A 1NW2A 2L4CA 3TUEA 3G7JA 1DE2A 4WF4A 2ON7A 1E6BA 3G7YA 1S3AA 2BJXA 3ZMLA 1FG4A 4PQHA 3H79A 3UMAA 5EY6A 4ID0A 5F0GA 4LA1A 3PINA 1XW5A 2PERA 3VWXA 3MSZA 3ERFA 2V2GA 3TCOA 3DIEA 4X1UA 4I2TA 3TGZA 4MCUA 1OE7A 5B8AA 1G7OA 3IR4A 3M9JA 2GSRA 2LRTA 2OJLA 4P3YB 1PA3A 2L59A 4IVFA 2DJJA 1NM3A 3CTFA 1I9DA 3HJMA 1GULA 2PWJA 5ECOB 1Y25A 3LXZA 4MPGA 1TJDA 2MMOA 3FR3A 5IPGA 2ON5A 3GFKA 3IDVA 4AGSA 2R5GA 2YNXA 2OADA 4OFNA 5HQPA 3EC3A 2MMNA 1THXA 4H86A 3GHAA 3LWAA 5HR2A 5DDLA 4HU9A 1XWCA 3H1NA 2LQOA 2V41A 3LGCA 3TJBA 4MJEA 4POLA 2CT6A 4OD7A 1OVNA 2VLVA 3D6IA 1THOA 3F4RA 3HXSA 1HNBA 2OE1A 2DMLA 2F3MA 3FZ5A 4OMVA 1YKCA 3CBUA 1H75A 4HU7A 4V2MA 5IO0A 3VPTA 1TW9A 1H4OA 18GSA 2KP1A 1URMA 4TRXA 5H5RA 3ERWA 4OFMA 2H6YA 1PKZA 2I3YA 5F8BA 1R4WA 4O32A 1EV4A 2YPMA 2XHFA 4POMA 2C8UA 1SK2A 3RHBA 2GSSA 3UARA 2XPEA 3I43A 1EEMA 1K0NA 4ZL7A 4N30A 5JCUA 3E3EA 4EDYA 4V2LA 1EGRA 1ABAA 3AY8A 4IGJA 3TKQA 3EU3A 2XBIA 3TOUA 4LL4B 1OAZA 2PU9C 3LXTA 4FYBA 4Z7XA 1X5EA 2GQKA 4ZILA 3TRXA 3QFAC 1CQGA 3L78A 3KP8A 4KB3A 1V9WA 1SJIA 1F2EA 3HY2A 3F6DA 2CX4A 2JSZA 4ZBDA 2GGTA 3GUSA 3F4SA 1GSDA 3MAKA 1PMTA 4ULXA 2DIYA 5FT3A 3FRCA 3QCPA 4K7IA 1UN2A 2PN8A 4OFTA 1K3LA 1PD21 3FZ9A 20GSA 1ON4A 2H74A 1SJ6A 3SWLA 4G9HA 5IMVA 5J3RA 1XOBA 5GAND 3VURA 1ACVA 5LNKe 3L0HA 1JFUA 4EE0A 1GWCA 3KD0A 1Z3EA 1PQNA 4ML1A 2YJHA 2E2GA 4ACSA 2YV9A 4HJMA 2H01A 3UIWA 3GTUA 3EINA 3PGTA 1O85A 1TRVA 2HYXA 5HFKA 3C8EA 1SL0B 1QGVA 4JU5A 4F0BA 3KCMA 2YN1A 5IMZA 2PUKC 2PBJA 1WIKA 2CV4A 1JHBA 2CVBA 3L9VA 5FHIA 3ZITA 2TRCP 4PQIA 5J5NA 3O3TA 4K8MA 2H30A 5ECMB 5DJLA 1YQ1A 2KP2A 2E7PA 1DSBA 2P0GA 4ZL9A 2CAQA 2GZPA 2N5AA 2VCWA 1Z9HA 1JLWA 4F03A 4I97A 5LCZA 1KEBA 3R2QA 1DUGA 1CQHA 4OCEA 1YF1A 5G31A 4ZB9A 3GMFA 3WT1A 4MLYA 4J57E 3C71A 1ILOA 2X8CA 1X5DA 3TJFA 5HFIA 1JZWA 1SD9A 4POKA 2C0DA 2FWHA 3TRPA 2OE3A 1K0DA 3GH6A 3UBKA 3EYTA 4TXOB 1WOUA 2O89A 4OO5A 2MMZA 1S3CA 2YZUA 4ZBBA 2VM1A 1ZYEA 2B5EA 4EC0A 2IL3A 1J0FA 3ME7A 2YZHA 5F07A 1USBA 2B7JA 4NV2A 1JZRA 4DEJA 5B6MA 2RUFA 2WGRA 1TI1A 4EXJA 1X9SB 4XS1A 1MD4A 3EMPA 1FVKA 3C7MA 2FD3A 5JWOB 4AJ7A 1O73A 4Q5RA 2FHEA 1EEJA 4GSTA 1U3IA 4V2NA 4MMMA 4HZ4A 2YWIA 1F9MA 3TKSC 1FAAA 5E59A 2HZEB 1GTUA 5IMCA 5JCGA 1HD2A 1ML6A 2VL2A 2OBKA 3GN3A 4RUVA 2VL3A 4IBPA 1XZOA 1N8JA 1BYEA 4NXIA 4F9ZA 5EL8A 1E2YA 1GTIA 2DJKA 1SK0A 5KN1A 1EOHA 5COHA 4GWRA 4IQ1A 3TRQA 2C1YA 1WE0A 4O5RA 5ECIB 1T4ZA 5A5KA 17GSA 2H6XA 1GUMA 1ZOFA 4FYUA 5IM9A 3J7Yk 4HOJA 4ECCA 1GTBA 1OC9B 5A4UA 4EO3A 1HYUA 1U3AA 4PX1A 1AQWA 1WP0A 2OA7A 5G5FA 4YQMA 1SJZA 5G1LA 5F05A 4XTSA 2WZ9A 3L9SA 2YWMA 2LJAA 2L4QA 3D0ZA 3BCIA 1N2AA 3F4TA 2ZCTA 1NHOA 4N11A 3P90A 3LSZA 3HZ4A 3ZIVA 3Q74A 4D73B 4ECJA 2WJUA 3LFLA 4G19A 3O76A 2H1BA 2X8HA 4HQZA 3ZIJA 1O6JA 3P8WA 1XPVA 3TB2A 2PMTA 2M46A 3GL3A 4WR4A 4NMUA 2LJRA 4QL7A 5KEJA 2C3NA 2GDRA 1KTEA 2HE3A 5B7CA 4E8HA 2FWGA 4L0UA 1ERWA 4EKZA 4FIWA 1UC7A 3M3MA 3VI7A 1XWBA 4PUFC 2DMMA 1TRSA 2FGXA 1OE8A 1XCCA 1O7UA 5DAKB 1XXUA 2J9HA 4K6XA 2XBQA 1GUHA 4RI6A 5DALA 4IS0A 4MH3A 2C0FA 4WXTA 1XW9A 1A8YA 2BMXA 3EURA 5CYYA 2IMIA 5CP1A 3J7Yb 4MJAA 1B9XC 2OACA 1AQVA 2K8VA 4I2UA 1K0CA 2H73A 1SU9A 3ERGA 2H76A 5ECPB 1WMJA 1T00A 3CRTA 5IMDA 2O8VB 2B6MA 4MZWA 2MBSA 1S3DA 4LMVA 1GRXA 2EIOA 2LSTA 3DYRA 2TRXA 4I8BA 4TOPA 12GSA 2P31A 3VI5A 2IMKA 3FR9A 2GTUA 5ID2B 3IXRA 1PL2A 2E2MA 1YEPA 3GX8A 4WBJA 2CAIA 3WGEA 2B5XA 1W89A 3QDNA 4I5QA 1OC8A 2NBSA 2R3XA 1X9WB 2B1LA 2CQ9A 1T7PB 4MJCA 1O81A 3A3TA 5E4WA 3GA4A 2V6KA 3TKRA 6GSXA 2LUSA 4ZB6A 4MF6A 2BTOT 5F06A 2VCZA 2WCIA 1GSEA 3KIJA 1EOGA 5JWRB 3FHKA 6GSTA 2D2ZA 2RM6A 3VPQA 1LJRA 2VCVA 3FW2A 4IELA 1KBNA 1M99A 2MYGA 4NAXA 3EWLA 3F8UA 3ME8A 1AXDA 4POBA 5J41A 2J23A 2KLXA 4XHMA 4DSQA 5AISA 1MDJA 5IQYA 2WS2A 3QAWA 3IRAA 4QL9A 2YWOA 2HNLA 1ST9A 1ZGNA 5G5EA 2H1AA 1ZL9A 2EIRA 3QOUA 3ISOA 2X99A 1VF4A 1FB6A 4GF0A 1PKWA 1I5GA 1FOVA 2B3SA 4L0WA 2H75A 4IP1A 1G6WA 3IHQA 5CRWA 5ECHB 3KM6A 1VGLA 3DXBA 3QMXA 2I4AA 3IAM2
chains in the Genus database with same CATH superfamily
4KW6A 1WJKA 1SYRA 1SYXA 1K0BA 4OWYA 1VF3A 1B8XA 2AHEA 3F63A 2IMEA 4KSOA 1QFNA 4TXOA 2R0PA 1F6MC 4JRRA 4HS1A 4ZL8A 2LNSA 4HSCX 4TR0A 3NIVA 3A2XA 4PXOA 2AYTA 1YY7A 2DJ1A 2LV3A 1YKAA 2CVKA 4EVMA 1IYHA 1GNEA 5ECNB 1SKRB 3FK8A 3IK9A 2NVLA 2C0GA 5G30A 2C0EA 1MD3A 3EE2A 2B5YA 2PVOC 2YANA 1Q4JA 1TK8B 4QQ7A 4EL1A 1PFOA 2VL9A 2HFDA 1O8WA 5ECQB 3C1SA 4KCAA 3UEMA 13GSA 3IBHA 3W8SA 5JCWA 2VOCA 1PL1A 4JR4A 1RK4A 19GSA 1QXHA 1R26A 2IJYA 4Q5QA 3LW9A 2HZEA 1T8EB 2VCQA 4HUAA 3GKMA 4CDOA 1QMVA 1F37A 3BJ5A 3FKFA 2N5BA 4F2IA 3HVSA 3QPMA 4MPFA 5G1KA 2JZRA 4EDZA 4OO4A 3DWVA 2MMAA 3KH7A 1Y6EA 6GSVA 1TI3A 1ERUA 3RBTA 3ZREA 2IN3A 2VLTA 1XG8A 1YJ6A 1GUKA 1M2DA 2WULA 4MDCA 1SK1A 4N0VA 1Z7PA 5AN1A 1OC9A 1PRXA 1NHYA 4TR3A 2V32A 4NPBA 1A8LA 3EPTA 3UVHA 2CZ2A 2E0QA 1GNWA 5JWQB 3ZFBA 4E8EA 2REMA 5AIVA 2VO4A 3N5OA 4BL7A 2AUVA 3ZRDA 1M2AA 1FO5A 3KMNA 4D73A 3QAGA 4HI7A 4ZXGA 4TR1A 3DKSA 1PX7A 4KUNA 1UVZA 1BJXA 1GL8A 4XCSA 1GTAA 2DIZA 5CNWA 2P5RA 4MK3A 2JACA 3GRXA 5LD0A 2L6CA 2QA2A 5ECKB 2LQQA 5KOWA 3GURA 5CREA 3M0FA 2VAFA 3P7XA 3BCKA 3KGKA 4XRDA 1K0MA 2HLSA 3E9JB 4TW5A 3TKSE 3MYDA 1SENA 4CHSA 2XC2A 1EGOA 4ISDA 3VFIA 4YH2A 2C4JA 1K0AA 1TXXA 2IIYA 1VRSD 3GIXA 4XS6A 3N9JA 5DAKA 1WPIA 3TJKA 4LMWA 1XOAA 1YZXA 1MTCA 4FYCA 3IHGA 1FHEA 2JADA 1B48A 2DJ2A 3H8QA 4MF7A 1TP9A 2L5OA 3IV4A 1SD8A 4TKYA 5CO3A 4JEDA 1TRWA 5ENUA 3F6FA 1FW1A 2P5QA 4KA0A 3D4TA 4GSSA 1F3AA 4HDEA 4DVCA 2YP6A 5L71A 3LEFA 5B8BA 3GKNA 3TOTA 3L4NA 1Q98A 2O87A 4HEA2 6GSSA 5KN3A 2G2QA 3CTGA 3VK9A 5CRGA 2OE0A 3HCZA 2IFQA 2PVQA 5HR1A 3I69A 1V2AA 3TKPA 2RLIA 4YKFA 2R4VA 3M8NA 5ID2A 5HR0A 4GSNA 1B4PA 2VD1A 3LG6A 2A2RA 4MNNA 3APSA 4KGIA 3TJGA 4YKGA 4BVXA 3KTBA 2FUG2 1XFLA 4F82A 4JE1A 4PQ1A 2M72A 1U88A 3HJOA 4I6XA 5D9WA 3FMWA 1V57A 2H0IA 1LBKA 3LORA 3Q6OA 1TU8A 3PPUA 4L8EA 3RHCA 4FH8A 3I6AA 4BVYA 2RUEA 3HA9A 3LYPA 2GVPA 2IWTA 3FZAA 2O85A 2VM2A 4BPYA 1ZYPA 4K0NA 5CRHA 3ZVJA 6GSUA 2I81A 1WWJA 1BG5A 3UJ1A 14GSA 4PUAA 3PR8A 2H1GA 1VF1A 4K0GA 1YDKA 1R5PA 2DLXA 2WFCA 1MDIA 4KH7A 3I9V2 3D21A 5INYA 3GKKA 3RPNA 2GZZA 2HSYA 3APQA 3GH9A 4GTUA 3BD2A 4TR4A 1A2JA 1QQ2A 3HD5A 2K18A 2L57A 3DVWA 1EWXA 1T1VA 4MJBA 2JSYA 1R5AA 4K2XA 2DJ3A 1GSUA 5B6NA 4NHZA 1T3BA 1SKWB 3HVNA 1OC3A 4KSMA 3QFBC 1V98A 3RPPA 1OYJA 2WRTA 1FOHA 2JU5A 1AW9A 5AIXA 1PGTA 1V58A 2YWNA 2UZ8A 4X0XA 3PH9A 4MP4A 1X9MB 4TN8A 4ZB8A 2HRAA 5D8IA 3IOSA 3M1GA 2A4VA 4JZQA 1TTZA 2FWEA 3RDWA 3F9UA 1J08A 1XIYA 5IMFA 4GLTA 3IPZA 3S9FA 1XWGA 2V6OA 1R7HA 3GV1A 3KZQA 3DGQA 3JCML 2TIRA 1DBYA 1ZZYA 2AJQB 4LLRA 5J9BA 1V40A 4AJ8A 2R6KA 10GSA 1LU4A 2X49A 2Z9SA 4JBBA 3US3A 4Q5FA 2GT6A 2FA4A 3IC8A 2CX3A 3GX0A 3W8JA 1JLVA 3KEBA 4IJIA 2QGVA 3NZNA 4Z2UA 1VF2A 4XRAA 1J9BA 2LEGA 4MH2A 1M9BA 4IN0A 3IA1A 3KP9A 2A2SA 2H72A 3CMIA 2G0FA 4J2FA 3TKSA 3MNGA 4KDUA 4K7NA 1JZDA 2HSHA 3VWWA 3KTLA 4XIHA 3CRUA 2GS3A 2QA1A 4V1Ag 1TRUA 2GSTA 3RAZA 3BOAA 5KN0A 5IO2A 4WF5A 1EP8A 1F3BA 1K3OA 3HKRA 5D73A 1ZCPA 2C80A 3ZMKA 1B4QA 2FNOA 1Z5YE 1FVJA 3FR6A 2HXKA 5IOXA 1AUCA 5IOWA 3ZFLA 2ZNMA 6GSWA 3K8NA 3DEXA 4MZCA 1JZOA 4NWYA 1AQXA 4CY6A 4TXVA 2FY6A 1QUWA 3D22A 3F3QA 4L5OA 3MDKA 5GSSA 5EPFA 2HRFA 2X8GA 3ZVJD 4ZIJA 5FWGA 4HZ2A 3IC4A 4EUYA 5BRTA 1BAYA 2KUCA 2IMDA 4AJ6A 2FLSA 1PSQA 1XVWA 3GNJA 5ABRA 9GSSA 5KN2A 3FZ4A 3A2WA 1WRYA 3IK7A 5DCGA 2N5FA 2FWFA 4L5LA 2C3TA 4YAVA 5H5QA 1AIUA 1GP1A 4RQXA 2VUPA 2DKHA 4O92A 1Z6NA 2H8LA 2AV4A 1TU7A 3UOMA 2LRNA 2PPTA 3CSHA 4AF2A 1DE1A 3WGXA 4DSSB 5CAXA 4HJ2A 2DSAA 3HZ8A 1M9AA 1A0FA 1OKTA 2DBCA 4K7OA 1GSYA 4Z2RA 3C1RA 2GSQA 2ES7A 5GZZB 1BQ7A 4ICYA 5DALB 4WR5A 1M3IA 3ZTLA 3GSTA 4KAEA 5ELAA 2OBIA 2R2JA 4USSA 5IMAA 3TJJA 2QSIA 4NHWA 2R37A 2AAWA 2JZTA 4WEYA 1NSWA 2GQMA 1U87A 3D4MA 3HVXA 4IQAA 2YJ7A 3IAS2 3EMXA 1SL2B 3H93A 5AGYA 1A24A 4N0ZA 2QC7A 11GSA 1C72A 2KOKA 4HQSA 3TDGA 2VL2C 3CSIA 4DSRA 1S3RA 4IHUA 4BIKA 2K6VA 2HSMA 1ERVA 3ZYWA 2K9FA 3VWVA 4PTSA 1A23A 1FB0A 2FA8A 5D9VA 4ML6A 1HQOA 3UAPA 4XS4B 2HZFA 4KX4A 1UA5A 3EU4A 1PN9A 5DVBA 5IPHA 4J56E 3GKXA 1TK0B 1X0RA 4V1Ap 5DQSA 3F0IA 5DJMA 1AC1A 1EZKA 2LRCA 2DC5A 2VIMA 3WYWA 3FYGA 4MF5A 4ECBA 2H0HA 4IJ3A 1XBSA 4GXZA 2WDUA 1BX9A 4G0KA 4BWSA 2QKEA 1ZMAA 4WKWA 2VCTA 5D93A 2FCHA 3IE3A 4O5UA 2LTKA 3Q19A 1SKSB 5IIZA 2M80A 1XVQA 3KH9A 1XWAA 2YCDA 3V1WA 2ALBA 4PNGA 2LS5A 2MZCA 3G7IA 4KDYA 4EF0A 3FEUA 2X64A 2KHPA 2H0GA 5GSTA 2H70A 4A5PA 4EIQA 3GL5A 3DRNA 3ZZXA 4KDXA 2F9SA 2RIIA 1K3YA 5H5SA 2C3QA 2NPBA 1M2BA 5G2ZA 3ED3A 3BBYA 4CW9A 2YV7A 3W6GA 1ZYQB 5A4VA 1M7TA 4RQRA 1G0TA 5DBQA 3D5JA 2VLUA 2VD0A 4MZBA 5C00A 5CRDA 2OKAA 1GSSA 4ECIA 3NOFA 2PGTA 4KE3A 3H4KA 3Q18A 1SL1B 5D96A 1XW6A 4YQUA 3U5RE 4ILFA 3WT2A 2F8AA 5ELGA 1ERTA 2H19A 3HVVA 4FO5A 1B9YC 4LL1B 2MBTA 2X4AA 1Z7RA 2LNTA 3L9UA 4JR6A 4IW9A 1GLQA 4G10A 3GSSA 2RM5A 2V1MA 3A5WA 5ECLB 1EV9A 4N10A 3UVTA 1ZYNA 2L5LA 2IMFA 3ZLPA 1K0OA 3DVXA 2NTOA 6GSYA 1GLPA 4NV5A 3C73A 5A4WA 3HYPA 1O8XA 4KCEA 4O7HA 3A2VA 1QK8A 7GSSA 1HNAA 4IP6A 3CXGA 2O7KA 3VLNA 3LQ7A 3P2AA 4GCIA 4X4JA 3MWHA 2JZSA 3F3RA 3E0UA 1AAZA 3CSJA 2H6ZA 2I1UA 2EIQA 4RI7A 4K2DA 4PURA 3QAVA 1RQMA 2B1KA 1BEDA 2VCXA 4WBRD 4X43A 3GTUB 1W4VA 1G7EA 5HR3A 4PGTA 4TVEA 1GH2A 3HJPA 2HT9A 16GSA 1G6YA 3KJYA 2ZUPA 5GAPD 3FY7A 4WETA 2F8FA 3KXOA 4GQCA 1GSQA 4BL7B 4G2EA 3KMOA 2B7KA 2CA8A 1OKDA 4F0CA 1KNGA 1PN0A 2GQLA 2WB9A 4GQFA 2GLRA 4TR1B 4GRFA 3U6VA 3WD6A 1EP7A 1U6TA 1TDIA 4BWQA 3EVIA 2HI7A 5D9XA 2EC4A 4YQVA 2IPAA 1MEKA 5D9TA 1MDKA 3VWUA 4OCFA 3CQFA 2GT5A 5J4UA 1T4YA 1TKDB 2R0GA 2JL4A 3DMLA 4PNFA 1XWKA 1M0UA 4CY8A 1TK5B 3LYKA 4Q5NA 5DCHA 5ECRB 3SBCA 2HRNA 2CZ3A 4K9ZA 5HFGA 5DQYA 1Z6MA 5EVOA 4K1FA 3CYNA 4DSSA 1A0RP 2LJKA 2YOIA 2K8SA 2H1DA 3QD9A 3O6TA 1IYIA 2DJ0A 3GYKA 1TOFA 2AB6A 4KNDA 2LKUA 3HDCA 2GZYA 2H66A 1HNCA 2DKIA 3QR6A 2NDOA 4EIPA 1X5CA 3HHVA 3DD3A 4BA7A 3UL3A 2F51A 4MABA 1A2LA 2A2PA 1GSFA 3M9KA 3WGDA 1A2MA 4YAPA 4ZBAA 5ECSA 2IFQB 3UBLA 3ZL5A 2H71A 2XPDA 2CVDA 4G0IA 2L6DA 1YEXA 3APOA 4IKHA 1YF0A 4MA9A 22GSA 8GSSA 5C04A 1PX6A 3LJRA 3OR5A 4XS4A 5J9CA 3G9BA 2I9HA 1RW1A 1NW2A 2L4CA 3TUEA 3G7JA 1DE2A 4WF4A 2ON7A 1E6BA 3G7YA 1S3AA 2BJXA 4BVYB 3ZMLA 1FG4A 2A4HA 4PQHA 3H79A 3UMAA 5EY6A 4ID0A 5F0GA 4LA1A 3PINA 1XW5A 2PERA 3VWXA 3MSZA 3ERFA 2V2GA 3TCOA 3DIEA 4X1UA 4I2TA 3TGZA 4MCUA 1OE7A 5B8AA 1G7OA 3IR4A 3M9JA 2GSRA 2LRTA 2OJLA 4P3YB 1PA3A 2L59A 4IVFA 2DJJA 1NM3A 3CTFA 1I9DA 3HJMA 1GULA 2PWJA 5ECOB 1Y25A 3LXZA 4MPGA 1TJDA 4K5RA 2MMOA 3FR3A 5IPGA 2ON5A 3GFKA 3IDVA 4AGSA 2R5GA 2YNXA 2OADA 4OFNA 5HQPA 3EC3A 2MMNA 1THXA 3MIXA 4H86A 3GHAA 3LWAA 5HR2A 5DDLA 4HU9A 1XWCA 3H1NA 2LQOA 2V41A 3LGCA 3TJBA 4MJEA 2R0CA 4POLA 2CT6A 4OD7A 1OVNA 2VLVA 3D6IA 4FQUA 1THOA 3F4RA 3HXSA 1HNBA 2OE1A 2DMLA 2F3MA 3FZ5A 4OMVA 1YKCA 3CBUA 1H75A 4HU7A 4V2MA 5IO0A 3VPTA 1TW9A 1H4OA 18GSA 2KP1A 1URMA 4TRXA 5H5RA 3ERWA 4OFMA 2H6YA 1PKZA 2I3YA 5F8BA 1R4WA 4O32A 1EV4A 2YPMA 2XHFA 4POMA 2C8UA 1SK2A 3RHBA 2GSSA 3UARA 2XPEA 3I43A 1EEMA 1K0NA 4ZL7A 4N30A 5JCUA 3E3EA 4EDYA 4V2LA 1EGRA 1ABAA 3AY8A 4IGJA 3TKQA 3EU3A 2XBIA 3TOUA 4LL4B 1OAZA 2PU9C 3LXTA 4FYBA 4Z7XA 1X5EA 2GQKA 4ZILA 3TRXA 3QFAC 1CQGA 3L78A 3KP8A 4KB3A 1V9WA 1SJIA 1F2EA 3HY2A 3F6DA 2CX4A 2JSZA 4ZBDA 2GGTA 3GUSA 3F4SA 1GSDA 3MAKA 1PMTA 4ULXA 2DIYA 4K5SA 5FT3A 3FRCA 3QCPA 4K7IA 1UN2A 2PN8A 4OFTA 1K3LA 1PD21 3FZ9A 20GSA 1ON4A 2H74A 1SJ6A 3SWLA 4G9HA 5IMVA 5J3RA 1XOBA 5GAND 3VURA 1ACVA 5LNKe 3L0HA 1JFUA 4EE0A 1GWCA 3KD0A 1Z3EA 1PQNA 4ML1A 2YJHA 2E2GA 4ACSA 2YV9A 4HJMA 2H01A 3UIWA 3GTUA 3EINA 3PGTA 1O85A 1TRVA 2HYXA 5HFKA 3C8EA 1SL0B 1QGVA 4JU5A 4F0BA 3KCMA 2YN1A 5IMZA 2PUKC 2PBJA 1WIKA 2CV4A 1JHBA 2CVBA 3L9VA 5FHIA 3ZITA 2TRCP 4PQIA 5J5NA 3O3TA 4K8MA 2H30A 5ECMB 5DJLA 3R3EA 1YQ1A 2KP2A 2E7PA 1DSBA 2P0GA 4ZL9A 2CAQA 2GZPA 2N5AA 2VCWA 1Z9HA 1JLWA 4F03A 4I97A 5LCZA 1KEBA 3R2QA 1DUGA 1CQHA 4OCEA 1YF1A 5G31A 4ZB9A 3GMFA 3WT1A 4MLYA 4J57E 3C71A 1ILOA 2X8CA 1X5DA 3TJFA 5HFIA 1JZWA 1SD9A 4POKA 2C0DA 2FWHA 3TRPA 2OE3A 1K0DA 3GH6A 3UBKA 3EYTA 4TXOB 1WOUA 2O89A 4KF9A 4OO5A 2MMZA 1S3CA 2YZUA 4ZBBA 2VM1A 1ZYEA 2B5EA 4EC0A 2IL3A 1J0FA 3ME7A 2YZHA 5F07A 1USBA 2B7JA 4NV2A 1JZRA 4DEJA 5B6MA 2RUFA 2WGRA 1TI1A 4EXJA 1X9SB 4XS1A 1MD4A 3EMPA 1FVKA 3C7MA 2FD3A 5JWOB 4AJ7A 1O73A 4Q5RA 2FHEA 2HRKA 1EEJA 4GSTA 1U3IA 4V2NA 4MMMA 4HZ4A 2YWIA 1F9MA 3TKSC 1FAAA 5E59A 2HZEB 1GTUA 5IMCA 5JCGA 4Z2TA 1HD2A 1ML6A 5KOXA 2VL2A 2OBKA 3GN3A 4RUVA 2VL3A 4IBPA 1XZOA 1N8JA 1BYEA 4NXIA 4F9ZA 5EL8A 1E2YA 1GTIA 2DJKA 1SK0A 5KN1A 1EOHA 5COHA 4GWRA 4IQ1A 3TRQA 2C1YA 1WE0A 4O5RA 5ECIB 1T4ZA 5A5KA 17GSA 2H6XA 1GUMA 1ZOFA 4FYUA 5IM9A 3J7Yk 4HOJA 4ECCA 1GTBA 1OC9B 5A4UA 4EO3A 1HYUA 1U3AA 4PX1A 1AQWA 1WP0A 2OA7A 5G5FA 4YQMA 1M3JA 1SJZA 5G1LA 5F05A 4XTSA 2WZ9A 3L9SA 2YWMA 2LJAA 2L4QA 3D0ZA 3BCIA 1N2AA 3F4TA 2ZCTA 1NHOA 4N11A 3P90A 3LSZA 3HZ4A 3ZIVA 3Q74A 4D73B 4ECJA 2WJUA 3LFLA 4G19A 3O76A 2H1BA 2X8HA 4HQZA 3ZIJA 1O6JA 3P8WA 1XPVA 3TB2A 2PMTA 2M46A 3A5IA 3GL3A 4WR4A 4NMUA 2LJRA 4QL7A 5KEJA 2C3NA 2GDRA 1KTEA 2HE3A 5B7CA 4E8HA 2FWGA 4L0UA 1ERWA 4EKZA 4FIWA 1UC7A 3M3MA 3VI7A 5BMUA 1XWBA 4PUFC 2DMMA 1TRSA 2FGXA 1OE8A 1XCCA 1O7UA 5DAKB 1XXUA 2J9HA 4O5QA 4K6XA 2XBQA 1GUHA 4RI6A 5DALA 4IS0A 4MH3A 2C0FA 4WXTA 1XW9A 1A8YA 2BMXA 3EURA 5CYYA 2IMIA 5CP1A 3J7Yb 4MJAA 1B9XC 2OACA 1AQVA 2K8VA 4I2UA 1K0CA 2H73A 1SU9A 3ERGA 2H76A 5ECPB 1WMJA 1T00A 3CRTA 5IMDA 2O8VB 2B6MA 4MZWA 2MBSA 1S3DA 4LMVA 1GRXA 2EIOA 2LSTA 3DYRA 2TRXA 4I8BA 4TOPA 12GSA 2P31A 3VI5A 2IMKA 3FR9A 2GTUA 5ID2B 3IXRA 1PL2A 2E2MA 1YEPA 3GX8A 4WBJA 2CAIA 3WGEA 2B5XA 1W89A 3QDNA 4I5QA 1OC8A 2NBSA 2R3XA 4BVXB 1X9WB 2B1LA 2CQ9A 1T7PB 4MJCA 1O81A 3A3TA 5E4WA 3GA4A 2V6KA 3TKRA 6GSXA 2LUSA 4ZB6A 4MF6A 2BTOT 5F06A 2VCZA 2WCIA 1GSEA 3KIJA 1EOGA 5JWRB 3FHKA 6GSTA 2D2ZA 2RM6A 3VPQA 1LJRA 2VCVA 3FW2A 4IELA 1KBNA 1M99A 2MYGA 4NAXA 3EWLA 3F8UA 4G0LA 3ME8A 1AXDA 4POBA 5J41A 2J23A 2KLXA 4XHMA 4DSQA 5AISA 1MDJA 5IQYA 2WS2A 3QAWA 3IRAA 4QL9A 2YWOA 2HNLA 1ST9A 1ZGNA 5G5EA 2H1AA 1ZL9A 2EIRA 3QOUA 3ISOA 2X99A 1VF4A 1FB6A 4GF0A 1PKWA 1I5GA 1FOVA 2B3SA 4L0WA 2H75A 4IP1A 1G6WA 3IHQA 5CRWA 5ECHB 3KM6A 1VGLA 3DXBA 3QMXA 2I4AA 3IAM2
chains in the Genus database with same CATH topology
4KW6A 1WJKA 1SYRA 1SYXA 1K0BA 4OWYA 1VF3A 1B8XA 2AHEA 3F63A 2IMEA 4KSOA 1QFNA 4TXOA 2R0PA 1F6MC 4JRRA 4HS1A 4ZL8A 2LNSA 4TR0A 3NIVA 3A2XA 4PXOA 2AYTA 1YY7A 2DJ1A 2LV3A 1YKAA 2CVKA 4EVMA 1IYHA 1GNEA 5ECNB 1SKRB 3FK8A 3IK9A 2NVLA 2C0GA 5G30A 2C0EA 1MD3A 3EE2A 2B5YA 2PVOC 2YANA 1Q4JA 1TK8B 4QQ7A 4EL1A 2VL9A 2HFDA 1O8WA 5ECQB 3C1SA 4KCAA 3UEMA 13GSA 3IBHA 3W8SA 5JCWA 2VOCA 1PL1A 4JR4A 1RK4A 19GSA 1QXHA 1R26A 2IJYA 4Q5QA 3LW9A 2HZEA 1T8EB 2VCQA 4HUAA 3GKMA 4CDOA 1QMVA 1F37A 3BJ5A 3FKFA 2N5BA 4F2IA 3HVSA 3QPMA 4MPFA 5G1KA 2JZRA 4EDZA 4OO4A 3DWVA 2MMAA 3KH7A 1Y6EA 6GSVA 1TI3A 1ERUA 3RBTA 3ZREA 2IN3A 2VLTA 1YJ6A 1GUKA 1M2DA 2WULA 4MDCA 1SK1A 4N0VA 1Z7PA 5AN1A 1OC9A 1PRXA 1NHYA 4TR3A 2V32A 4NPBA 1A8LA 3EPTA 3UVHA 2CZ2A 2E0QA 1GNWA 5JWQB 3ZFBA 4E8EA 2REMA 5AIVA 2VO4A 3N5OA 4BL7A 2AUVA 3ZRDA 1M2AA 1FO5A 3KMNA 4D73A 3QAGA 4HI7A 4ZXGA 4TR1A 3DKSA 1PX7A 4KUNA 1UVZA 1BJXA 1GL8A 4XCSA 1GTAA 2DIZA 5CNWA 2P5RA 4MK3A 2JACA 3GRXA 5LD0A 2L6CA 2QA2A 5ECKB 2LQQA 5KOWA 3GURA 5CREA 3M0FA 2VAFA 3P7XA 3BCKA 3KGKA 4XRDA 1K0MA 2HLSA 3E9JB 4TW5A 3TKSE 3MYDA 1SENA 4CHSA 2XC2A 1EGOA 4ISDA 3VFIA 4YH2A 2C4JA 1K0AA 1TXXA 2IIYA 1VRSD 3GIXA 4XS6A 3N9JA 5DAKA 1WPIA 3TJKA 4LMWA 1XOAA 1YZXA 1MTCA 4FYCA 3IHGA 1FHEA 2JADA 1B48A 2DJ2A 3H8QA 4MF7A 1TP9A 2L5OA 3IV4A 1SD8A 4TKYA 5CO3A 4JEDA 1TRWA 5ENUA 3F6FA 1FW1A 2P5QA 4KA0A 3D4TA 4GSSA 1F3AA 4HDEA 4DVCA 2YP6A 5L71A 3LEFA 5B8BA 3GKNA 3TOTA 3L4NA 1Q98A 2O87A 4HEA2 6GSSA 5KN3A 2G2QA 3CTGA 3VK9A 5CRGA 2OE0A 3HCZA 2IFQA 2PVQA 5HR1A 3I69A 1V2AA 3TKPA 2RLIA 4YKFA 2R4VA 3M8NA 5ID2A 5HR0A 4GSNA 1B4PA 2VD1A 3LG6A 2A2RA 4MNNA 3APSA 4KGIA 3TJGA 4YKGA 4BVXA 3KTBA 2FUG2 1XFLA 4F82A 4JE1A 4PQ1A 2M72A 1U88A 3HJOA 4I6XA 5D9WA 3FMWA 1V57A 2H0IA 1LBKA 3LORA 3Q6OA 1TU8A 3PPUA 4L8EA 3RHCA 4FH8A 3I6AA 4BVYA 2RUEA 3HA9A 3LYPA 2GVPA 2IWTA 3FZAA 2O85A 2VM2A 4BPYA 1ZYPA 4K0NA 5CRHA 3ZVJA 6GSUA 2I81A 1WWJA 1BG5A 3UJ1A 14GSA 4PUAA 3PR8A 2H1GA 1VF1A 4K0GA 1YDKA 1R5PA 2DLXA 2WFCA 1MDIA 4KH7A 3I9V2 3D21A 5INYA 3GKKA 3RPNA 2GZZA 2HSYA 3APQA 3GH9A 4GTUA 3BD2A 4TR4A 1A2JA 1QQ2A 3HD5A 2K18A 2L57A 3DVWA 1EWXA 1T1VA 4MJBA 2JSYA 1R5AA 4K2XA 2DJ3A 1GSUA 5B6NA 4NHZA 1T3BA 1SKWB 1OC3A 4KSMA 3QFBC 1V98A 3RPPA 1OYJA 2WRTA 1FOHA 2JU5A 1AW9A 5AIXA 1PGTA 1V58A 2YWNA 2UZ8A 4X0XA 3PH9A 4MP4A 1X9MB 4TN8A 4ZB8A 2HRAA 5D8IA 3IOSA 3M1GA 2A4VA 4JZQA 1TTZA 2FWEA 3RDWA 3F9UA 1J08A 1XIYA 5IMFA 4GLTA 3IPZA 3S9FA 1XWGA 2V6OA 1R7HA 3GV1A 3KZQA 3DGQA 3JCML 2TIRA 1DBYA 1ZZYA 2AJQB 4LLRA 5J9BA 1V40A 4AJ8A 2R6KA 10GSA 1LU4A 2X49A 2Z9SA 4JBBA 3US3A 4Q5FA 2GT6A 2FA4A 3IC8A 2CX3A 3GX0A 3W8JA 1JLVA 3KEBA 4IJIA 2QGVA 3NZNA 4Z2UA 1VF2A 4XRAA 1J9BA 2LEGA 4MH2A 1M9BA 4IN0A 3IA1A 3KP9A 2A2SA 2H72A 3CMIA 2G0FA 4J2FA 3TKSA 3MNGA 4KDUA 4K7NA 1JZDA 2HSHA 3VWWA 3KTLA 4XIHA 3CRUA 2GS3A 2QA1A 4V1Ag 1TRUA 2GSTA 3RAZA 3BOAA 5KN0A 5IO2A 4WF5A 1EP8A 1F3BA 1K3OA 3HKRA 5D73A 1ZCPA 2C80A 3ZMKA 1B4QA 2FNOA 1Z5YE 1FVJA 3FR6A 2HXKA 5IOXA 1AUCA 5IOWA 3ZFLA 2ZNMA 6GSWA 3K8NA 3DEXA 4MZCA 1JZOA 4NWYA 1AQXA 4CY6A 4TXVA 2FY6A 1QUWA 3D22A 3F3QA 4L5OA 3MDKA 5GSSA 5EPFA 2HRFA 2X8GA 3ZVJD 4ZIJA 5FWGA 4HZ2A 3IC4A 4EUYA 5BRTA 1BAYA 2KUCA 2IMDA 4AJ6A 2FLSA 1PSQA 1XVWA 3GNJA 5ABRA 9GSSA 5KN2A 3FZ4A 3A2WA 1WRYA 3IK7A 5DCGA 2N5FA 2FWFA 4L5LA 2C3TA 4YAVA 5H5QA 1AIUA 1GP1A 4RQXA 2VUPA 2DKHA 4O92A 1Z6NA 2H8LA 2AV4A 1TU7A 3UOMA 2LRNA 2PPTA 3CSHA 4AF2A 1DE1A 3WGXA 4DSSB 5CAXA 4HJ2A 2DSAA 3HZ8A 1M9AA 1A0FA 1OKTA 2DBCA 4K7OA 1GSYA 4Z2RA 3C1RA 2GSQA 2ES7A 5GZZB 1BQ7A 4ICYA 5DALB 4WR5A 3ZTLA 3GSTA 4KAEA 5ELAA 2OBIA 2R2JA 4USSA 5IMAA 3TJJA 2QSIA 4NHWA 2R37A 2AAWA 2JZTA 4WEYA 1NSWA 2GQMA 1U87A 3D4MA 3HVXA 4IQAA 2YJ7A 3IAS2 3EMXA 1SL2B 3H93A 5AGYA 1A24A 4N0ZA 2QC7A 11GSA 1C72A 2KOKA 4HQSA 3TDGA 2VL2C 3CSIA 4DSRA 4IHUA 2K6VA 2HSMA 1ERVA 3ZYWA 2K9FA 3VWVA 4PTSA 1A23A 1FB0A 2FA8A 5D9VA 4ML6A 1HQOA 3UAPA 4XS4B 2HZFA 4KX4A 1UA5A 3EU4A 1PN9A 5DVBA 5IPHA 4J56E 3GKXA 1TK0B 1X0RA 4V1Ap 5DQSA 3F0IA 5DJMA 1AC1A 1EZKA 2LRCA 2DC5A 2VIMA 3WYWA 3FYGA 4MF5A 4ECBA 2H0HA 4IJ3A 1XBSA 4GXZA 2WDUA 1BX9A 4G0KA 4BWSA 2QKEA 1ZMAA 4WKWA 2VCTA 5D93A 2FCHA 3IE3A 4O5UA 2LTKA 3Q19A 1SKSB 5IIZA 2M80A 1XVQA 3KH9A 1XWAA 2YCDA 3V1WA 2ALBA 4PNGA 2LS5A 2MZCA 3G7IA 4KDYA 4EF0A 3FEUA 2X64A 2KHPA 2H0GA 5GSTA 2H70A 4A5PA 4EIQA 3GL5A 3DRNA 3ZZXA 4KDXA 2F9SA 2RIIA 1K3YA 5H5SA 2C3QA 2NPBA 1M2BA 5G2ZA 3ED3A 3BBYA 4CW9A 2YV7A 3W6GA 1ZYQB 5A4VA 1M7TA 4RQRA 1G0TA 5DBQA 3D5JA 2VLUA 2VD0A 4MZBA 5C00A 5CRDA 2OKAA 1GSSA 4ECIA 3NOFA 2PGTA 4KE3A 3H4KA 3Q18A 1SL1B 5D96A 1XW6A 4YQUA 3U5RE 4ILFA 3WT2A 2F8AA 5ELGA 1ERTA 2H19A 3HVVA 4FO5A 1B9YC 4LL1B 2MBTA 2X4AA 1Z7RA 2LNTA 3L9UA 4JR6A 4IW9A 1GLQA 4G10A 3GSSA 2RM5A 2V1MA 3A5WA 5ECLB 1EV9A 4N10A 3UVTA 1ZYNA 2L5LA 2IMFA 3ZLPA 1K0OA 3DVXA 2NTOA 6GSYA 1GLPA 4NV5A 3C73A 5A4WA 3HYPA 1O8XA 4KCEA 4O7HA 3A2VA 1QK8A 7GSSA 1HNAA 4IP6A 3CXGA 2O7KA 3VLNA 3LQ7A 3P2AA 4GCIA 4X4JA 3MWHA 2JZSA 3F3RA 3E0UA 1AAZA 3CSJA 2H6ZA 2I1UA 2EIQA 4RI7A 4K2DA 4PURA 3QAVA 1RQMA 2B1KA 1BEDA 2VCXA 4WBRD 4X43A 3GTUB 1W4VA 1G7EA 5HR3A 4PGTA 4TVEA 1GH2A 3HJPA 2HT9A 16GSA 1G6YA 3KJYA 2ZUPA 5GAPD 3FY7A 4WETA 2F8FA 3KXOA 4GQCA 1GSQA 4BL7B 4G2EA 3KMOA 2B7KA 2CA8A 1OKDA 4F0CA 1KNGA 1PN0A 2GQLA 2WB9A 4GQFA 2GLRA 4TR1B 4GRFA 3U6VA 3WD6A 1EP7A 1U6TA 1TDIA 4BWQA 3EVIA 2HI7A 5D9XA 2EC4A 4YQVA 2IPAA 1MEKA 5D9TA 1MDKA 3VWUA 4OCFA 2GT5A 5J4UA 1T4YA 1TKDB 2R0GA 2JL4A 3DMLA 4PNFA 1XWKA 1M0UA 4CY8A 1TK5B 3LYKA 4Q5NA 5DCHA 5ECRB 3SBCA 2HRNA 2CZ3A 4K9ZA 5HFGA 5DQYA 1Z6MA 5EVOA 4K1FA 3CYNA 4DSSA 1A0RP 2LJKA 2YOIA 2K8SA 2H1DA 3QD9A 3O6TA 1IYIA 2DJ0A 3GYKA 1TOFA 2AB6A 4KNDA 2LKUA 3HDCA 2GZYA 2H66A 1HNCA 2DKIA 3QR6A 2NDOA 4EIPA 1X5CA 3HHVA 3DD3A 4BA7A 3UL3A 2F51A 4MABA 1A2LA 2A2PA 1GSFA 3M9KA 3WGDA 1A2MA 4YAPA 4ZBAA 5ECSA 2IFQB 3UBLA 3ZL5A 2H71A 2XPDA 2CVDA 4G0IA 2L6DA 1YEXA 3APOA 4IKHA 1YF0A 4MA9A 22GSA 8GSSA 5C04A 1PX6A 3LJRA 3OR5A 4XS4A 5J9CA 3G9BA 2I9HA 1RW1A 1NW2A 2L4CA 3TUEA 3G7JA 1DE2A 4WF4A 2ON7A 1E6BA 3G7YA 1S3AA 2BJXA 4BVYB 3ZMLA 1FG4A 2A4HA 4PQHA 3H79A 3UMAA 5EY6A 4ID0A 5F0GA 4LA1A 3PINA 1XW5A 2PERA 3VWXA 3MSZA 3ERFA 2V2GA 3TCOA 3DIEA 4X1UA 4I2TA 3TGZA 4MCUA 1OE7A 5B8AA 1G7OA 3IR4A 3M9JA 2GSRA 2LRTA 2OJLA 4P3YB 1PA3A 2L59A 4IVFA 2DJJA 1NM3A 3CTFA 1I9DA 3HJMA 1GULA 2PWJA 5ECOB 1Y25A 3LXZA 4MPGA 1TJDA 4K5RA 2MMOA 3FR3A 5IPGA 2ON5A 3GFKA 3IDVA 4AGSA 2R5GA 2YNXA 2OADA 4OFNA 5HQPA 3EC3A 2MMNA 1THXA 3MIXA 4H86A 3GHAA 3LWAA 5HR2A 5DDLA 4HU9A 1XWCA 3H1NA 2LQOA 2V41A 3LGCA 3TJBA 4MJEA 2R0CA 4POLA 2CT6A 4OD7A 1OVNA 2VLVA 3D6IA 4FQUA 1THOA 3F4RA 3HXSA 1HNBA 2OE1A 2DMLA 2F3MA 3FZ5A 4OMVA 1YKCA 3CBUA 1H75A 4HU7A 4V2MA 5IO0A 3VPTA 1TW9A 1H4OA 18GSA 2KP1A 1URMA 4TRXA 5H5RA 3ERWA 4OFMA 2H6YA 1PKZA 2I3YA 5F8BA 1R4WA 4O32A 1EV4A 2YPMA 2XHFA 4POMA 2C8UA 1SK2A 3RHBA 2GSSA 3UARA 2XPEA 3I43A 1EEMA 1K0NA 4ZL7A 4N30A 5JCUA 3E3EA 4EDYA 4V2LA 1EGRA 1ABAA 3AY8A 4IGJA 3TKQA 3EU3A 2XBIA 3TOUA 4LL4B 1OAZA 2PU9C 3LXTA 4FYBA 4Z7XA 1X5EA 2GQKA 4ZILA 3TRXA 3QFAC 1CQGA 3L78A 3KP8A 4KB3A 1V9WA 1SJIA 1F2EA 3HY2A 3F6DA 2CX4A 2JSZA 4ZBDA 2GGTA 3GUSA 3F4SA 1GSDA 3MAKA 1PMTA 4ULXA 2DIYA 4K5SA 5FT3A 3FRCA 3QCPA 4K7IA 1UN2A 2PN8A 4OFTA 1K3LA 1PD21 3FZ9A 20GSA 1ON4A 2H74A 1SJ6A 3SWLA 4G9HA 5IMVA 5J3RA 1XOBA 5GAND 3VURA 1ACVA 5LNKe 3L0HA 1JFUA 4EE0A 1GWCA 3KD0A 1Z3EA 1PQNA 4ML1A 2YJHA 2E2GA 4ACSA 2YV9A 4HJMA 2H01A 3UIWA 3GTUA 3EINA 3PGTA 1O85A 1TRVA 2HYXA 5HFKA 3C8EA 1SL0B 1QGVA 4JU5A 4F0BA 3KCMA 2YN1A 5IMZA 2PUKC 2PBJA 1WIKA 2CV4A 1JHBA 2CVBA 3L9VA 5FHIA 3ZITA 2TRCP 4PQIA 5J5NA 3O3TA 4K8MA 2H30A 5ECMB 5DJLA 3R3EA 1YQ1A 2KP2A 2E7PA 1DSBA 2P0GA 4ZL9A 2CAQA 2GZPA 2N5AA 2VCWA 1Z9HA 1JLWA 4F03A 4I97A 5LCZA 1KEBA 3R2QA 1DUGA 1CQHA 4OCEA 1YF1A 5G31A 4ZB9A 3GMFA 3WT1A 4MLYA 4J57E 3C71A 1ILOA 2X8CA 1X5DA 3TJFA 5HFIA 1JZWA 1SD9A 4POKA 2C0DA 2FWHA 3TRPA 2OE3A 1K0DA 3GH6A 3UBKA 3EYTA 4TXOB 1WOUA 2O89A 4KF9A 4OO5A 2MMZA 1S3CA 2YZUA 4ZBBA 2VM1A 1ZYEA 2B5EA 4EC0A 2IL3A 1J0FA 3ME7A 2YZHA 5F07A 1USBA 2B7JA 4NV2A 1JZRA 4DEJA 5B6MA 2RUFA 2WGRA 1TI1A 4EXJA 1X9SB 4XS1A 1MD4A 3EMPA 1FVKA 3C7MA 2FD3A 5JWOB 4AJ7A 1O73A 4Q5RA 2FHEA 2HRKA 1EEJA 4GSTA 1U3IA 4V2NA 4MMMA 4HZ4A 2YWIA 1F9MA 3TKSC 1FAAA 5E59A 2HZEB 1GTUA 5IMCA 5JCGA 4Z2TA 1HD2A 1ML6A 5KOXA 2VL2A 2OBKA 3GN3A 4RUVA 2VL3A 4IBPA 1XZOA 1N8JA 1BYEA 4NXIA 4F9ZA 5EL8A 1E2YA 1GTIA 2DJKA 1SK0A 5KN1A 1EOHA 5COHA 4GWRA 4IQ1A 3TRQA 2C1YA 1WE0A 4O5RA 5ECIB 1T4ZA 5A5KA 17GSA 2H6XA 1GUMA 1ZOFA 4FYUA 5IM9A 3J7Yk 4HOJA 4ECCA 1GTBA 1OC9B 5A4UA 4EO3A 1HYUA 1U3AA 4PX1A 1AQWA 1WP0A 2OA7A 5G5FA 4YQMA 1SJZA 5G1LA 5F05A 4XTSA 2WZ9A 3L9SA 2YWMA 2LJAA 2L4QA 3D0ZA 3BCIA 1N2AA 3F4TA 2ZCTA 1NHOA 4N11A 3P90A 3LSZA 3HZ4A 3ZIVA 3Q74A 4D73B 4ECJA 2WJUA 3LFLA 4G19A 3O76A 2H1BA 2X8HA 4HQZA 3ZIJA 1O6JA 3P8WA 1XPVA 3TB2A 2PMTA 2M46A 3A5IA 3GL3A 4WR4A 4NMUA 2LJRA 4QL7A 5KEJA 2C3NA 2GDRA 1KTEA 2HE3A 5B7CA 4E8HA 2FWGA 4L0UA 1ERWA 4EKZA 4FIWA 1UC7A 3M3MA 3VI7A 5BMUA 1XWBA 4PUFC 2DMMA 1TRSA 2FGXA 1OE8A 1XCCA 1O7UA 5DAKB 1XXUA 2J9HA 4O5QA 4K6XA 2XBQA 1GUHA 4RI6A 5DALA 4IS0A 4MH3A 2C0FA 4WXTA 1XW9A 1A8YA 2BMXA 3EURA 5CYYA 2IMIA 5CP1A 3J7Yb 4MJAA 1B9XC 2OACA 1AQVA 2K8VA 4I2UA 1K0CA 2H73A 1SU9A 3ERGA 2H76A 5ECPB 1WMJA 1T00A 3CRTA 5IMDA 2O8VB 2B6MA 4MZWA 2MBSA 1S3DA 4LMVA 1GRXA 2EIOA 2LSTA 3DYRA 2TRXA 4I8BA 4TOPA 12GSA 2P31A 3VI5A 2IMKA 3FR9A 2GTUA 5ID2B 3IXRA 1PL2A 2E2MA 1YEPA 3GX8A 4WBJA 2CAIA 3WGEA 2B5XA 1W89A 3QDNA 4I5QA 1OC8A 2NBSA 2R3XA 4BVXB 1X9WB 2B1LA 2CQ9A 1T7PB 4MJCA 1O81A 3A3TA 5E4WA 3GA4A 2V6KA 3TKRA 6GSXA 2LUSA 4ZB6A 4MF6A 2BTOT 5F06A 2VCZA 2WCIA 1GSEA 3KIJA 1EOGA 5JWRB 3FHKA 6GSTA 2D2ZA 2RM6A 3VPQA 1LJRA 2VCVA 3FW2A 4IELA 1KBNA 1M99A 2MYGA 4NAXA 3EWLA 3F8UA 4G0LA 3ME8A 1AXDA 4POBA 5J41A 2J23A 2KLXA 4XHMA 4DSQA 5AISA 1MDJA 5IQYA 2WS2A 3QAWA 3IRAA 4QL9A 2YWOA 2HNLA 1ST9A 1ZGNA 5G5EA 2H1AA 1ZL9A 2EIRA 3QOUA 3ISOA 2X99A 1VF4A 1FB6A 4GF0A 1PKWA 1I5GA 1FOVA 2B3SA 4L0WA 2H75A 4IP1A 1G6WA 3IHQA 5CRWA 5ECHB 3KM6A 1VGLA 3DXBA 3QMXA 2I4AA 3IAM2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KW6 A;  1WJK A;  1SYR A;  1SYX A;  1K0B A;  4OWY A;  1VF3 A;  1B8X A;  2AHE A;  3F63 A;  2IME A;  4KSO A;  1QFN A;  4TXO A;  1F6M C;  4JRR A;  4HS1 A;  4ZL8 A;  2LNS A;  4TR0 A;  3NIV A;  3A2X A;  4PXO A;  2AYT A;  1YY7 A;  2DJ1 A;  2LV3 A;  1YKA A;  2CVK A;  4EVM A;  1IYH A;  1GNE A;  5ECN B;  1SKR B;  3FK8 A;  3IK9 A;  2NVL A;  2C0G A;  5G30 A;  2C0E A;  1MD3 A;  3EE2 A;  2B5Y A;  2PVO C;  2YAN A;  1Q4J A;  1TK8 B;  4QQ7 A;  4EL1 A;  2VL9 A;  2HFD A;  1O8W A;  5ECQ B;  3C1S A;  4KCA A;  3UEM A;  13GS A;  3IBH A;  3W8S A;  5JCW A;  2VOC A;  1PL1 A;  4JR4 A;  1RK4 A;  19GS A;  1QXH A;  1R26 A;  2IJY A;  4Q5Q A;  2HZE A;  1T8E B;  2VCQ A;  4HUA A;  3GKM A;  4CDO A;  1QMV A;  1F37 A;  3BJ5 A;  3FKF A;  2N5B A;  4F2I A;  3HVS A;  3QPM A;  4MPF A;  5G1K A;  2JZR A;  4EDZ A;  4OO4 A;  3DWV A;  2MMA A;  3KH7 A;  1Y6E A;  6GSV A;  1TI3 A;  1ERU A;  3RBT A;  3ZRE A;  2IN3 A;  2VLT A;  1YJ6 A;  1GUK A;  1M2D A;  2WUL A;  4MDC A;  1SK1 A;  4N0V A;  1Z7P A;  5AN1 A;  1OC9 A;  1PRX A;  1NHY A;  4TR3 A;  2V32 A;  4NPB A;  1A8L A;  3UVH A;  2CZ2 A;  2E0Q A;  1GNW A;  5JWQ B;  3ZFB A;  4E8E A;  2REM A;  5AIV A;  2VO4 A;  3N5O A;  4BL7 A;  2AUV A;  3ZRD A;  1M2A A;  1FO5 A;  3KMN A;  4D73 A;  3QAG A;  4HI7 A;  4ZXG A;  4TR1 A;  3DKS A;  1PX7 A;  4KUN A;  1UVZ A;  1BJX A;  1GL8 A;  4XCS A;  1GTA A;  2DIZ A;  5CNW A;  2P5R A;  4MK3 A;  2JAC A;  3GRX A;  5LD0 A;  2L6C A;  5ECK B;  2LQQ A;  3GUR A;  5CRE A;  3M0F A;  2VAF A;  3P7X A;  3BCK A;  3KGK A;  4XRD A;  1K0M A;  2HLS A;  3E9J B;  4TW5 A;  3TKS E;  4CHS A;  1SEN A;  2XC2 A;  1EGO A;  4ISD A;  3VFI A;  4YH2 A;  2C4J A;  1K0A A;  1TXX A;  2IIY A;  1VRS D;  3GIX A;  4XS6 A;  3N9J A;  5DAK A;  1WPI A;  3TJK A;  4LMW A;  1XOA A;  1YZX A;  1MTC A;  4FYC A;  1FHE A;  2JAD A;  1B48 A;  2DJ2 A;  3H8Q A;  4MF7 A;  1TP9 A;  2L5O A;  3IV4 A;  1SD8 A;  4TKY A;  5CO3 A;  4JED A;  1TRW A;  5ENU A;  3F6F A;  1FW1 A;  2P5Q A;  4KA0 A;  3D4T A;  4GSS A;  1F3A A;  4HDE A;  4DVC A;  2YP6 A;  5L71 A;  3LEF A;  5B8B A;  3GKN A;  3TOT A;  3L4N A;  1Q98 A;  2O87 A;  4HEA 2;  6GSS A;  5KN3 A;  2G2Q A;  3CTG A;  3VK9 A;  5CRG A;  2OE0 A;  3HCZ A;  2IFQ A;  2PVQ A;  5HR1 A;  3I69 A;  1V2A A;  3TKP A;  2RLI A;  2R4V A;  3M8N A;  5ID2 A;  5HR0 A;  4GSN A;  1B4P A;  2VD1 A;  3LG6 A;  2A2R A;  3APS A;  4KGI A;  3TJG A;  4BVX A;  3KTB A;  2FUG 2;  1XFL A;  4F82 A;  4JE1 A;  4PQ1 A;  2M72 A;  1U88 A;  3HJO A;  4I6X A;  5D9W A;  1V57 A;  2H0I A;  1LBK A;  3LOR A;  3Q6O A;  1TU8 A;  4L8E A;  3RHC A;  4FH8 A;  3I6A A;  4BVY A;  2RUE A;  3HA9 A;  3LYP A;  2GVP A;  2IWT A;  3FZA A;  2O85 A;  2VM2 A;  4BPY A;  4K0N A;  5CRH A;  3ZVJ A;  6GSU A;  2I81 A;  1WWJ A;  1BG5 A;  3UJ1 A;  14GS A;  4PUA A;  3PR8 A;  2H1G A;  1VF1 A;  4K0G A;  1YDK A;  1R5P A;  2DLX A;  2WFC A;  1MDI A;  4KH7 A;  3I9V 2;  3D21 A;  5INY A;  3GKK A;  3RPN A;  2GZZ A;  2HSY A;  3APQ A;  3GH9 A;  4GTU A;  3BD2 A;  4TR4 A;  1A2J A;  1QQ2 A;  3HD5 A;  2K18 A;  2L57 A;  3DVW A;  1EWX A;  1T1V A;  4MJB A;  2JSY A;  1R5A A;  2DJ3 A;  1GSU A;  5B6N A;  4NHZ A;  1T3B A;  1SKW B;  1OC3 A;  4KSM A;  3QFB C;  1V98 A;  3RPP A;  1OYJ A;  2WRT A;  2JU5 A;  1AW9 A;  5AIX A;  1PGT A;  1V58 A;  2YWN A;  4X0X A;  3PH9 A;  4MP4 A;  1X9M B;  4TN8 A;  4ZB8 A;  5D8I A;  3IOS A;  3M1G A;  2A4V A;  4JZQ A;  1TTZ A;  2FWE A;  3RDW A;  3F9U A;  1J08 A;  1XIY A;  5IMF A;  4GLT A;  3IPZ A;  3S9F A;  1XWG A;  2V6O A;  1R7H A;  3GV1 A;  3KZQ A;  3DGQ A;  3JCM L;  2TIR A;  1DBY A;  1ZZY A;  2AJQ B;  4LLR A;  5J9B A;  1V40 A;  4AJ8 A;  2R6K A;  10GS A;  1LU4 A;  2Z9S A;  4JBB A;  3US3 A;  4Q5F A;  2GT6 A;  2FA4 A;  2CX3 A;  3GX0 A;  3W8J A;  1JLV A;  3KEB A;  4IJI A;  2QGV A;  3NZN A;  1VF2 A;  4XRA A;  1J9B A;  2LEG A;  4MH2 A;  1M9B A;  4IN0 A;  3IA1 A;  3KP9 A;  2A2S A;  2H72 A;  3CMI A;  2G0F A;  4J2F A;  3TKS A;  3MNG A;  4KDU A;  4K7N A;  1JZD A;  2HSH A;  3VWW A;  3KTL A;  4XIH A;  3CRU A;  2GS3 A;  4V1A g;  1TRU A;  2GST A;  3RAZ A;  3BOA A;  5KN0 A;  5IO2 A;  4WF5 A;  1EP8 A;  1F3B A;  1K3O A;  3HKR A;  5D73 A;  1ZCP A;  2C80 A;  3ZMK A;  1B4Q A;  2FNO A;  1Z5Y E;  1FVJ A;  3FR6 A;  2HXK A;  5IOX A;  1AUC A;  5IOW A;  3ZFL A;  2ZNM A;  6GSW A;  3K8N A;  3DEX A;  4MZC A;  1JZO A;  4NWY A;  1AQX A;  4TXV A;  2FY6 A;  1QUW A;  3D22 A;  3F3Q A;  4L5O A;  3MDK A;  5GSS A;  5EPF A;  2HRF A;  2X8G A;  3ZVJ D;  4ZIJ A;  5FWG A;  4HZ2 A;  3IC4 A;  4EUY A;  1BAY A;  2KUC A;  2IMD A;  4AJ6 A;  2FLS A;  1PSQ A;  1XVW A;  3GNJ A;  5ABR A;  9GSS A;  5KN2 A;  3FZ4 A;  3A2W A;  1WRY A;  3IK7 A;  5DCG A;  2N5F A;  2FWF A;  4L5L A;  2C3T A;  4YAV A;  5H5Q A;  1AIU A;  1GP1 A;  4RQX A;  2VUP A;  4O92 A;  1Z6N A;  2H8L A;  2AV4 A;  1TU7 A;  3UOM A;  2LRN A;  2PPT A;  3CSH A;  4AF2 A;  1DE1 A;  3WGX A;  4DSS B;  5CAX A;  4HJ2 A;  2DSA A;  3HZ8 A;  1M9A A;  1A0F A;  1OKT A;  2DBC A;  4K7O A;  1GSY A;  3C1R A;  2GSQ A;  2ES7 A;  5GZZ B;  1BQ7 A;  5DAL B;  4WR5 A;  3ZTL A;  3GST A;  4KAE A;  5ELA A;  2OBI A;  2R2J A;  5IMA A;  3TJJ A;  2QSI A;  4NHW A;  2R37 A;  2AAW A;  2JZT A;  4WEY A;  1NSW A;  2GQM A;  1U87 A;  3D4M A;  3HVX A;  4IQA A;  2YJ7 A;  3IAS 2;  3EMX A;  1SL2 B;  3H93 A;  5AGY A;  1A24 A;  4N0Z A;  2QC7 A;  11GS A;  1C72 A;  2KOK A;  4HQS A;  3TDG A;  2VL2 C;  3CSI A;  4DSR A;  4IHU A;  2K6V A;  1ERV A;  3ZYW A;  2K9F A;  3VWV A;  1A23 A;  1FB0 A;  2FA8 A;  5D9V A;  4ML6 A;  1HQO A;  3UAP A;  4XS4 B;  2HZF A;  4KX4 A;  1UA5 A;  3EU4 A;  1PN9 A;  5DVB A;  5IPH A;  4J56 E;  3GKX A;  1TK0 B;  1X0R A;  4V1A p;  5DQS A;  3F0I A;  5DJM A;  1AC1 A;  1EZK A;  2LRC A;  2DC5 A;  2VIM A;  3WYW A;  3FYG A;  4MF5 A;  4ECB A;  2H0H A;  4IJ3 A;  1XBS A;  4GXZ A;  2WDU A;  1BX9 A;  4BWS A;  2QKE A;  1ZMA A;  4WKW A;  2VCT A;  5D93 A;  2FCH A;  3IE3 A;  2LTK A;  3Q19 A;  1SKS B;  5IIZ A;  2M80 A;  1XVQ A;  3KH9 A;  1XWA A;  2YCD A;  3V1W A;  2ALB A;  4PNG A;  2LS5 A;  2MZC A;  3G7I A;  4KDY A;  4EF0 A;  3FEU A;  2X64 A;  2KHP A;  2H0G A;  5GST A;  2H70 A;  3GL5 A;  3DRN A;  3ZZX A;  4KDX A;  2F9S A;  2RII A;  1K3Y A;  5H5S A;  2C3Q A;  2NPB A;  1M2B A;  5G2Z A;  3ED3 A;  3BBY A;  4CW9 A;  2YV7 A;  3W6G A;  1ZYQ B;  5A4V A;  1M7T A;  4RQR A;  1G0T A;  5DBQ A;  3D5J A;  2VLU A;  2VD0 A;  4MZB A;  5C00 A;  5CRD A;  2OKA A;  1GSS A;  4ECI A;  3NOF A;  2PGT A;  4KE3 A;  3H4K A;  3Q18 A;  1SL1 B;  5D96 A;  1XW6 A;  4YQU A;  3U5R E;  4ILF A;  3WT2 A;  2F8A A;  5ELG A;  1ERT A;  2H19 A;  3HVV A;  4FO5 A;  1B9Y C;  4LL1 B;  2MBT A;  1Z7R A;  2LNT A;  3L9U A;  4JR6 A;  4IW9 A;  1GLQ A;  4G10 A;  3GSS A;  2RM5 A;  2V1M A;  3A5W A;  5ECL B;  1EV9 A;  4N10 A;  3UVT A;  2L5L A;  2IMF A;  3ZLP A;  1K0O A;  3DVX A;  2NTO A;  6GSY A;  1GLP A;  4NV5 A;  3C73 A;  5A4W A;  3HYP A;  1O8X A;  4KCE A;  4O7H A;  3A2V A;  1QK8 A;  7GSS A;  1HNA A;  4IP6 A;  3CXG A;  2O7K A;  3VLN A;  3LQ7 A;  3P2A A;  4GCI A;  3MWH A;  2JZS A;  3F3R A;  3E0U A;  1AAZ A;  3CSJ A;  2H6Z A;  2I1U A;  2EIQ A;  4RI7 A;  4K2D A;  4PUR A;  3QAV A;  1RQM A;  2B1K A;  1BED A;  2VCX A;  4WBR D;  4X43 A;  3GTU B;  1W4V A;  1G7E A;  5HR3 A;  4PGT A;  4TVE A;  1GH2 A;  3HJP A;  2HT9 A;  16GS A;  1G6Y A;  3KJY A;  2ZUP A;  5GAP D;  3FY7 A;  4WET A;  2F8F A;  3KXO A;  4GQC A;  1GSQ A;  4G2E A;  3KMO A;  2B7K A;  2CA8 A;  1OKD A;  4F0C A;  1KNG A;  2GQL A;  2WB9 A;  4GQF A;  2GLR A;  4TR1 B;  4GRF A;  3U6V A;  3WD6 A;  1EP7 A;  1U6T A;  1TDI A;  4BWQ A;  3EVI A;  2HI7 A;  5D9X A;  2EC4 A;  4YQV A;  2IPA A;  1MEK A;  5D9T A;  1MDK A;  3VWU A;  4OCF A;  2GT5 A;  5J4U A;  1T4Y A;  1TKD B;  2JL4 A;  3DML A;  4PNF A;  1XWK A;  1M0U A;  1TK5 B;  3LYK A;  4Q5N A;  5DCH A;  5ECR B;  3SBC A;  2HRN A;  2CZ3 A;  4K9Z A;  5HFG A;  5DQY A;  1Z6M A;  5EVO A;  4K1F A;  3CYN A;  4DSS A;  1A0R P;  2LJK A;  2YOI A;  2K8S A;  2H1D A;  3QD9 A;  3O6T A;  1IYI A;  2DJ0 A;  3GYK A;  1TOF A;  2AB6 A;  4KND A;  2LKU A;  3HDC A;  2GZY A;  2H66 A;  1HNC A;  3QR6 A;  2NDO A;  1X5C A;  3HHV A;  3DD3 A;  4BA7 A;  3UL3 A;  2F51 A;  4MAB A;  1A2L A;  1GSF A;  3M9K A;  3WGD A;  1A2M A;  4YAP A;  4ZBA A;  5ECS A;  2IFQ B;  3UBL A;  3ZL5 A;  2H71 A;  2XPD A;  2CVD A;  2L6D A;  1YEX A;  3APO A;  4IKH A;  1YF0 A;  4MA9 A;  22GS A;  8GSS A;  5C04 A;  1PX6 A;  3LJR A;  3OR5 A;  4XS4 A;  5J9C A;  3G9B A;  2I9H A;  1RW1 A;  1NW2 A;  2L4C A;  3TUE A;  3G7J A;  1DE2 A;  4WF4 A;  2ON7 A;  1E6B A;  3G7Y A;  1S3A A;  2BJX A;  3ZML A;  1FG4 A;  4PQH A;  3H79 A;  3UMA A;  5EY6 A;  4ID0 A;  5F0G A;  4LA1 A;  3PIN A;  1XW5 A;  2PER A;  3VWX A;  3MSZ A;  3ERF A;  2V2G A;  3TCO A;  3DIE A;  4X1U A;  4I2T A;  3TGZ A;  4MCU A;  1OE7 A;  5B8A A;  1G7O A;  3IR4 A;  3M9J A;  2GSR A;  2LRT A;  2OJL A;  4P3Y B;  1PA3 A;  2L59 A;  4IVF A;  2DJJ A;  1NM3 A;  3CTF A;  1I9D A;  3HJM A;  1GUL A;  2PWJ A;  5ECO B;  1Y25 A;  3LXZ A;  4MPG A;  1TJD A;  2MMO A;  3FR3 A;  5IPG A;  2ON5 A;  3GFK A;  3IDV A;  4AGS A;  2R5G A;  2YNX A;  2OAD A;  4OFN A;  5HQP A;  3EC3 A;  2MMN A;  1THX A;  4H86 A;  3GHA A;  3LWA A;  5HR2 A;  5DDL A;  4HU9 A;  1XWC A;  3H1N A;  2LQO A;  2V41 A;  3LGC A;  3TJB A;  4MJE A;  4POL A;  2CT6 A;  4OD7 A;  1OVN A;  2VLV A;  3D6I A;  1THO A;  3F4R A;  3HXS A;  1HNB A;  2OE1 A;  2DML A;  2F3M A;  3FZ5 A;  4OMV A;  1YKC A;  3CBU A;  1H75 A;  4HU7 A;  4V2M A;  5IO0 A;  3VPT A;  1TW9 A;  1H4O A;  18GS A;  2KP1 A;  1URM A;  4TRX A;  5H5R A;  3ERW A;  4OFM A;  2H6Y A;  1PKZ A;  2I3Y A;  5F8B A;  1R4W A;  4O32 A;  1EV4 A;  2YPM A;  2XHF A;  4POM A;  2C8U A;  1SK2 A;  3RHB A;  2GSS A;  3UAR A;  2XPE A;  3I43 A;  1EEM A;  1K0N A;  4ZL7 A;  4N30 A;  5JCU A;  3E3E A;  4EDY A;  4V2L A;  1EGR A;  1ABA A;  3AY8 A;  4IGJ A;  3TKQ A;  3EU3 A;  2XBI A;  3TOU A;  4LL4 B;  1OAZ A;  2PU9 C;  3LXT A;  4FYB A;  4Z7X A;  1X5E A;  2GQK A;  4ZIL A;  3TRX A;  3QFA C;  1CQG A;  3L78 A;  3KP8 A;  4KB3 A;  1V9W A;  1SJI A;  1F2E A;  3HY2 A;  3F6D A;  2CX4 A;  2JSZ A;  4ZBD A;  2GGT A;  3GUS A;  3F4S A;  1GSD A;  3MAK A;  1PMT A;  4ULX A;  2DIY A;  5FT3 A;  3FRC A;  3QCP A;  4K7I A;  1UN2 A;  2PN8 A;  4OFT A;  1K3L A;  1PD2 1;  3FZ9 A;  20GS A;  1ON4 A;  2H74 A;  1SJ6 A;  3SWL A;  4G9H A;  5IMV A;  5J3R A;  1XOB A;  5GAN D;  3VUR A;  1ACV A;  5LNK e;  3L0H A;  1JFU A;  4EE0 A;  1GWC A;  3KD0 A;  1Z3E A;  1PQN A;  4ML1 A;  2YJH A;  2E2G A;  4ACS A;  2YV9 A;  4HJM A;  2H01 A;  3UIW A;  3GTU A;  3EIN A;  3PGT A;  1O85 A;  1TRV A;  2HYX A;  5HFK A;  3C8E A;  1SL0 B;  1QGV A;  4JU5 A;  4F0B A;  3KCM A;  2YN1 A;  5IMZ A;  2PUK C;  2PBJ A;  1WIK A;  2CV4 A;  1JHB A;  2CVB A;  3L9V A;  5FHI A;  3ZIT A;  2TRC P;  4PQI A;  5J5N A;  3O3T A;  4K8M A;  2H30 A;  5ECM B;  5DJL A;  1YQ1 A;  2KP2 A;  2E7P A;  1DSB A;  2P0G A;  4ZL9 A;  2CAQ A;  2GZP A;  2N5A A;  2VCW A;  1Z9H A;  1JLW A;  4F03 A;  4I97 A;  5LCZ A;  1KEB A;  3R2Q A;  1DUG A;  1CQH A;  4OCE A;  1YF1 A;  5G31 A;  4ZB9 A;  3GMF A;  3WT1 A;  4MLY A;  4J57 E;  3C71 A;  1ILO A;  2X8C A;  1X5D A;  3TJF A;  5HFI A;  1JZW A;  1SD9 A;  4POK A;  2C0D A;  2FWH A;  3TRP A;  2OE3 A;  1K0D A;  3GH6 A;  3UBK A;  3EYT A;  4TXO B;  1WOU A;  2O89 A;  4OO5 A;  2MMZ A;  1S3C A;  2YZU A;  4ZBB A;  2VM1 A;  1ZYE A;  2B5E A;  4EC0 A;  2IL3 A;  1J0F A;  3ME7 A;  2YZH A;  5F07 A;  1USB A;  2B7J A;  4NV2 A;  1JZR A;  4DEJ A;  5B6M A;  2RUF A;  2WGR A;  1TI1 A;  4EXJ A;  1X9S B;  4XS1 A;  1MD4 A;  3EMP A;  1FVK A;  3C7M A;  2FD3 A;  5JWO B;  4AJ7 A;  1O73 A;  4Q5R A;  2FHE A;  1EEJ A;  4GST A;  1U3I A;  4V2N A;  4MMM A;  4HZ4 A;  2YWI A;  1F9M A;  3TKS C;  1FAA A;  5E59 A;  2HZE B;  1GTU A;  5IMC A;  5JCG A;  1HD2 A;  1ML6 A;  2VL2 A;  2OBK A;  3GN3 A;  4RUV A;  2VL3 A;  4IBP A;  1XZO A;  1N8J A;  1BYE A;  4NXI A;  4F9Z A;  5EL8 A;  1E2Y A;  1GTI A;  2DJK A;  1SK0 A;  5KN1 A;  1EOH A;  5COH A;  4GWR A;  4IQ1 A;  3TRQ A;  2C1Y A;  1WE0 A;  4O5R A;  5ECI B;  1T4Z A;  5A5K A;  17GS A;  2H6X A;  1GUM A;  1ZOF A;  4FYU A;  5IM9 A;  3J7Y k;  4HOJ A;  4ECC A;  1GTB A;  1OC9 B;  5A4U A;  4EO3 A;  1HYU A;  1U3A A;  4PX1 A;  1AQW A;  1WP0 A;  2OA7 A;  5G5F A;  4YQM A;  1SJZ A;  5G1L A;  5F05 A;  4XTS A;  2WZ9 A;  3L9S A;  2YWM A;  2LJA A;  2L4Q A;  3D0Z A;  3BCI A;  1N2A A;  3F4T A;  2ZCT A;  1NHO A;  4N11 A;  3P90 A;  3LSZ A;  3HZ4 A;  3ZIV A;  3Q74 A;  4D73 B;  4ECJ A;  2WJU A;  3LFL A;  4G19 A;  3O76 A;  2H1B A;  2X8H A;  4HQZ A;  3ZIJ A;  1O6J A;  3P8W A;  1XPV A;  3TB2 A;  2PMT A;  2M46 A;  3GL3 A;  4WR4 A;  4NMU A;  2LJR A;  4QL7 A;  5KEJ A;  2C3N A;  2GDR A;  1KTE A;  2HE3 A;  5B7C A;  4E8H A;  2FWG A;  4L0U A;  1ERW A;  4EKZ A;  4FIW A;  1UC7 A;  3M3M A;  3VI7 A;  1XWB A;  4PUF C;  2DMM A;  1TRS A;  2FGX A;  1OE8 A;  1XCC A;  1O7U A;  5DAK B;  1XXU A;  2J9H A;  4K6X A;  2XBQ A;  1GUH A;  4RI6 A;  5DAL A;  4IS0 A;  4MH3 A;  2C0F A;  4WXT A;  1XW9 A;  1A8Y A;  2BMX A;  3EUR A;  5CYY A;  2IMI A;  5CP1 A;  3J7Y b;  4MJA A;  1B9X C;  2OAC A;  1AQV A;  2K8V A;  4I2U A;  1K0C A;  2H73 A;  1SU9 A;  3ERG A;  2H76 A;  5ECP B;  1WMJ A;  1T00 A;  3CRT A;  5IMD A;  2O8V B;  2B6M A;  4MZW A;  2MBS A;  1S3D A;  4LMV A;  1GRX A;  2EIO A;  2LST A;  3DYR A;  2TRX A;  4I8B A;  4TOP A;  12GS A;  2P31 A;  3VI5 A;  2IMK A;  3FR9 A;  2GTU A;  5ID2 B;  3IXR A;  1PL2 A;  2E2M A;  1YEP A;  3GX8 A;  4WBJ A;  2CAI A;  3WGE A;  2B5X A;  1W89 A;  3QDN A;  4I5Q A;  1OC8 A;  2NBS A;  2R3X A;  1X9W B;  2B1L A;  2CQ9 A;  1T7P B;  4MJC A;  1O81 A;  3A3T A;  5E4W A;  3GA4 A;  2V6K A;  3TKR A;  6GSX A;  2LUS A;  4ZB6 A;  4MF6 A;  2BTO T;  5F06 A;  2VCZ A;  2WCI A;  1GSE A;  3KIJ A;  1EOG A;  5JWR B;  3FHK A;  6GST A;  2D2Z A;  2RM6 A;  3VPQ A;  1LJR A;  2VCV A;  3FW2 A;  4IEL A;  1KBN A;  1M99 A;  2MYG A;  4NAX A;  3EWL A;  3F8U A;  3ME8 A;  1AXD A;  4POB A;  5J41 A;  2J23 A;  2KLX A;  4XHM A;  4DSQ A;  5AIS A;  1MDJ A;  5IQY A;  2WS2 A;  3QAW A;  3IRA A;  4QL9 A;  2YWO A;  2HNL A;  1ST9 A;  1ZGN A;  5G5E A;  2H1A A;  1ZL9 A;  2EIR A;  3QOU A;  3ISO A;  2X99 A;  1VF4 A;  1FB6 A;  4GF0 A;  1PKW A;  1I5G A;  1FOV A;  2B3S A;  4L0W A;  2H75 A;  4IP1 A;  1G6W A;  3IHQ A;  5CRW A;  5ECH B;  3KM6 A;  1VGL A;  3DXB A;  3QMX A;  2I4A A;  3IAM 2; 
#chains in the Genus database with same CATH topology
 4KW6 A;  1WJK A;  1SYR A;  1SYX A;  1K0B A;  4OWY A;  1VF3 A;  1B8X A;  2AHE A;  3F63 A;  2IME A;  4KSO A;  1QFN A;  4TXO A;  2R0P A;  1F6M C;  4JRR A;  4HS1 A;  4ZL8 A;  2LNS A;  4HSC X;  4TR0 A;  3NIV A;  3A2X A;  4PXO A;  2AYT A;  1YY7 A;  2DJ1 A;  2LV3 A;  1YKA A;  2CVK A;  4EVM A;  1IYH A;  1GNE A;  5ECN B;  1SKR B;  3FK8 A;  3IK9 A;  2NVL A;  2C0G A;  5G30 A;  2C0E A;  1MD3 A;  3EE2 A;  2B5Y A;  2PVO C;  2YAN A;  1Q4J A;  1TK8 B;  4QQ7 A;  4EL1 A;  1PFO A;  2VL9 A;  2HFD A;  1O8W A;  5ECQ B;  3C1S A;  4KCA A;  3UEM A;  13GS A;  3IBH A;  3W8S A;  5JCW A;  2VOC A;  1PL1 A;  4JR4 A;  1RK4 A;  19GS A;  1QXH A;  1R26 A;  2IJY A;  4Q5Q A;  3LW9 A;  2HZE A;  1T8E B;  2VCQ A;  4HUA A;  3GKM A;  4CDO A;  1QMV A;  1F37 A;  3BJ5 A;  3FKF A;  2N5B A;  4F2I A;  3HVS A;  3QPM A;  4MPF A;  5G1K A;  2JZR A;  4EDZ A;  4OO4 A;  3DWV A;  2MMA A;  3KH7 A;  1Y6E A;  6GSV A;  1TI3 A;  1ERU A;  3RBT A;  3ZRE A;  2IN3 A;  2VLT A;  1XG8 A;  1YJ6 A;  1GUK A;  1M2D A;  2WUL A;  4MDC A;  1SK1 A;  4N0V A;  1Z7P A;  5AN1 A;  1OC9 A;  1PRX A;  1NHY A;  4TR3 A;  2V32 A;  4NPB A;  1A8L A;  3EPT A;  3UVH A;  2CZ2 A;  2E0Q A;  1GNW A;  5JWQ B;  3ZFB A;  4E8E A;  2REM A;  5AIV A;  2VO4 A;  3N5O A;  4BL7 A;  2AUV A;  3ZRD A;  1M2A A;  1FO5 A;  3KMN A;  4D73 A;  3QAG A;  4HI7 A;  4ZXG A;  4TR1 A;  3DKS A;  1PX7 A;  4KUN A;  1UVZ A;  1BJX A;  1GL8 A;  4XCS A;  1GTA A;  2DIZ A;  5CNW A;  2P5R A;  4MK3 A;  2JAC A;  3GRX A;  5LD0 A;  2L6C A;  2QA2 A;  5ECK B;  2LQQ A;  5KOW A;  3GUR A;  5CRE A;  3M0F A;  2VAF A;  3P7X A;  3BCK A;  3KGK A;  4XRD A;  1K0M A;  2HLS A;  3E9J B;  4TW5 A;  3TKS E;  3MYD A;  1SEN A;  4CHS A;  2XC2 A;  1EGO A;  4ISD A;  3VFI A;  4YH2 A;  2C4J A;  1K0A A;  1TXX A;  2IIY A;  1VRS D;  3GIX A;  4XS6 A;  3N9J A;  5DAK A;  1WPI A;  3TJK A;  4LMW A;  1XOA A;  1YZX A;  1MTC A;  4FYC A;  3IHG A;  1FHE A;  2JAD A;  1B48 A;  2DJ2 A;  3H8Q A;  4MF7 A;  1TP9 A;  2L5O A;  3IV4 A;  1SD8 A;  4TKY A;  5CO3 A;  4JED A;  1TRW A;  5ENU A;  3F6F A;  1FW1 A;  2P5Q A;  4KA0 A;  3D4T A;  4GSS A;  1F3A A;  4HDE A;  4DVC A;  2YP6 A;  5L71 A;  3LEF A;  5B8B A;  3GKN A;  3TOT A;  3L4N A;  1Q98 A;  2O87 A;  4HEA 2;  6GSS A;  5KN3 A;  2G2Q A;  3CTG A;  3VK9 A;  5CRG A;  2OE0 A;  3HCZ A;  2IFQ A;  2PVQ A;  5HR1 A;  3I69 A;  1V2A A;  3TKP A;  2RLI A;  4YKF A;  2R4V A;  3M8N A;  5ID2 A;  5HR0 A;  4GSN A;  1B4P A;  2VD1 A;  3LG6 A;  2A2R A;  4MNN A;  3APS A;  4KGI A;  3TJG A;  4YKG A;  4BVX A;  3KTB A;  2FUG 2;  1XFL A;  4F82 A;  4JE1 A;  4PQ1 A;  2M72 A;  1U88 A;  3HJO A;  4I6X A;  5D9W A;  3FMW A;  1V57 A;  2H0I A;  1LBK A;  3LOR A;  3Q6O A;  1TU8 A;  3PPU A;  4L8E A;  3RHC A;  4FH8 A;  3I6A A;  4BVY A;  2RUE A;  3HA9 A;  3LYP A;  2GVP A;  2IWT A;  3FZA A;  2O85 A;  2VM2 A;  4BPY A;  1ZYP A;  4K0N A;  5CRH A;  3ZVJ A;  6GSU A;  2I81 A;  1WWJ A;  1BG5 A;  3UJ1 A;  14GS A;  4PUA A;  3PR8 A;  2H1G A;  1VF1 A;  4K0G A;  1YDK A;  1R5P A;  2DLX A;  2WFC A;  1MDI A;  4KH7 A;  3I9V 2;  3D21 A;  5INY A;  3GKK A;  3RPN A;  2GZZ A;  2HSY A;  3APQ A;  3GH9 A;  4GTU A;  3BD2 A;  4TR4 A;  1A2J A;  1QQ2 A;  3HD5 A;  2K18 A;  2L57 A;  3DVW A;  1EWX A;  1T1V A;  4MJB A;  2JSY A;  1R5A A;  4K2X A;  2DJ3 A;  1GSU A;  5B6N A;  4NHZ A;  1T3B A;  1SKW B;  3HVN A;  1OC3 A;  4KSM A;  3QFB C;  1V98 A;  3RPP A;  1OYJ A;  2WRT A;  1FOH A;  2JU5 A;  1AW9 A;  5AIX A;  1PGT A;  1V58 A;  2YWN A;  2UZ8 A;  4X0X A;  3PH9 A;  4MP4 A;  1X9M B;  4TN8 A;  4ZB8 A;  2HRA A;  5D8I A;  3IOS A;  3M1G A;  2A4V A;  4JZQ A;  1TTZ A;  2FWE A;  3RDW A;  3F9U A;  1J08 A;  1XIY A;  5IMF A;  4GLT A;  3IPZ A;  3S9F A;  1XWG A;  2V6O A;  1R7H A;  3GV1 A;  3KZQ A;  3DGQ A;  3JCM L;  2TIR A;  1DBY A;  1ZZY A;  2AJQ B;  4LLR A;  5J9B A;  1V40 A;  4AJ8 A;  2R6K A;  10GS A;  1LU4 A;  2X49 A;  2Z9S A;  4JBB A;  3US3 A;  4Q5F A;  2GT6 A;  2FA4 A;  3IC8 A;  2CX3 A;  3GX0 A;  3W8J A;  1JLV A;  3KEB A;  4IJI A;  2QGV A;  3NZN A;  4Z2U A;  1VF2 A;  4XRA A;  1J9B A;  2LEG A;  4MH2 A;  1M9B A;  4IN0 A;  3IA1 A;  3KP9 A;  2A2S A;  2H72 A;  3CMI A;  2G0F A;  4J2F A;  3TKS A;  3MNG A;  4KDU A;  4K7N A;  1JZD A;  2HSH A;  3VWW A;  3KTL A;  4XIH A;  3CRU A;  2GS3 A;  2QA1 A;  4V1A g;  1TRU A;  2GST A;  3RAZ A;  3BOA A;  5KN0 A;  5IO2 A;  4WF5 A;  1EP8 A;  1F3B A;  1K3O A;  3HKR A;  5D73 A;  1ZCP A;  2C80 A;  3ZMK A;  1B4Q A;  2FNO A;  1Z5Y E;  1FVJ A;  3FR6 A;  2HXK A;  5IOX A;  1AUC A;  5IOW A;  3ZFL A;  2ZNM A;  6GSW A;  3K8N A;  3DEX A;  4MZC A;  1JZO A;  4NWY A;  1AQX A;  4CY6 A;  4TXV A;  2FY6 A;  1QUW A;  3D22 A;  3F3Q A;  4L5O A;  3MDK A;  5GSS A;  5EPF A;  2HRF A;  2X8G A;  3ZVJ D;  4ZIJ A;  5FWG A;  4HZ2 A;  3IC4 A;  4EUY A;  5BRT A;  1BAY A;  2KUC A;  2IMD A;  4AJ6 A;  2FLS A;  1PSQ A;  1XVW A;  3GNJ A;  5ABR A;  9GSS A;  5KN2 A;  3FZ4 A;  3A2W A;  1WRY A;  3IK7 A;  5DCG A;  2N5F A;  2FWF A;  4L5L A;  2C3T A;  4YAV A;  5H5Q A;  1AIU A;  1GP1 A;  4RQX A;  2VUP A;  2DKH A;  4O92 A;  1Z6N A;  2H8L A;  2AV4 A;  1TU7 A;  3UOM A;  2LRN A;  2PPT A;  3CSH A;  4AF2 A;  1DE1 A;  3WGX A;  4DSS B;  5CAX A;  4HJ2 A;  2DSA A;  3HZ8 A;  1M9A A;  1A0F A;  1OKT A;  2DBC A;  4K7O A;  1GSY A;  4Z2R A;  3C1R A;  2GSQ A;  2ES7 A;  5GZZ B;  1BQ7 A;  4ICY A;  5DAL B;  4WR5 A;  1M3I A;  3ZTL A;  3GST A;  4KAE A;  5ELA A;  2OBI A;  2R2J A;  4USS A;  5IMA A;  3TJJ A;  2QSI A;  4NHW A;  2R37 A;  2AAW A;  2JZT A;  4WEY A;  1NSW A;  2GQM A;  1U87 A;  3D4M A;  3HVX A;  4IQA A;  2YJ7 A;  3IAS 2;  3EMX A;  1SL2 B;  3H93 A;  5AGY A;  1A24 A;  4N0Z A;  2QC7 A;  11GS A;  1C72 A;  2KOK A;  4HQS A;  3TDG A;  2VL2 C;  3CSI A;  4DSR A;  1S3R A;  4IHU A;  4BIK A;  2K6V A;  2HSM A;  1ERV A;  3ZYW A;  2K9F A;  3VWV A;  4PTS A;  1A23 A;  1FB0 A;  2FA8 A;  5D9V A;  4ML6 A;  1HQO A;  3UAP A;  4XS4 B;  2HZF A;  4KX4 A;  1UA5 A;  3EU4 A;  1PN9 A;  5DVB A;  5IPH A;  4J56 E;  3GKX A;  1TK0 B;  1X0R A;  4V1A p;  5DQS A;  3F0I A;  5DJM A;  1AC1 A;  1EZK A;  2LRC A;  2DC5 A;  2VIM A;  3WYW A;  3FYG A;  4MF5 A;  4ECB A;  2H0H A;  4IJ3 A;  1XBS A;  4GXZ A;  2WDU A;  1BX9 A;  4G0K A;  4BWS A;  2QKE A;  1ZMA A;  4WKW A;  2VCT A;  5D93 A;  2FCH A;  3IE3 A;  4O5U A;  2LTK A;  3Q19 A;  1SKS B;  5IIZ A;  2M80 A;  1XVQ A;  3KH9 A;  1XWA A;  2YCD A;  3V1W A;  2ALB A;  4PNG A;  2LS5 A;  2MZC A;  3G7I A;  4KDY A;  4EF0 A;  3FEU A;  2X64 A;  2KHP A;  2H0G A;  5GST A;  2H70 A;  4A5P A;  4EIQ A;  3GL5 A;  3DRN A;  3ZZX A;  4KDX A;  2F9S A;  2RII A;  1K3Y A;  5H5S A;  2C3Q A;  2NPB A;  1M2B A;  5G2Z A;  3ED3 A;  3BBY A;  4CW9 A;  2YV7 A;  3W6G A;  1ZYQ B;  5A4V A;  1M7T A;  4RQR A;  1G0T A;  5DBQ A;  3D5J A;  2VLU A;  2VD0 A;  4MZB A;  5C00 A;  5CRD A;  2OKA A;  1GSS A;  4ECI A;  3NOF A;  2PGT A;  4KE3 A;  3H4K A;  3Q18 A;  1SL1 B;  5D96 A;  1XW6 A;  4YQU A;  3U5R E;  4ILF A;  3WT2 A;  2F8A A;  5ELG A;  1ERT A;  2H19 A;  3HVV A;  4FO5 A;  1B9Y C;  4LL1 B;  2MBT A;  2X4A A;  1Z7R A;  2LNT A;  3L9U A;  4JR6 A;  4IW9 A;  1GLQ A;  4G10 A;  3GSS A;  2RM5 A;  2V1M A;  3A5W A;  5ECL B;  1EV9 A;  4N10 A;  3UVT A;  1ZYN A;  2L5L A;  2IMF A;  3ZLP A;  1K0O A;  3DVX A;  2NTO A;  6GSY A;  1GLP A;  4NV5 A;  3C73 A;  5A4W A;  3HYP A;  1O8X A;  4KCE A;  4O7H A;  3A2V A;  1QK8 A;  7GSS A;  1HNA A;  4IP6 A;  3CXG A;  2O7K A;  3VLN A;  3LQ7 A;  3P2A A;  4GCI A;  4X4J A;  3MWH A;  2JZS A;  3F3R A;  3E0U A;  1AAZ A;  3CSJ A;  2H6Z A;  2I1U A;  2EIQ A;  4RI7 A;  4K2D A;  4PUR A;  3QAV A;  1RQM A;  2B1K A;  1BED A;  2VCX A;  4WBR D;  4X43 A;  3GTU B;  1W4V A;  1G7E A;  5HR3 A;  4PGT A;  4TVE A;  1GH2 A;  3HJP A;  2HT9 A;  16GS A;  1G6Y A;  3KJY A;  2ZUP A;  5GAP D;  3FY7 A;  4WET A;  2F8F A;  3KXO A;  4GQC A;  1GSQ A;  4BL7 B;  4G2E A;  3KMO A;  2B7K A;  2CA8 A;  1OKD A;  4F0C A;  1KNG A;  1PN0 A;  2GQL A;  2WB9 A;  4GQF A;  2GLR A;  4TR1 B;  4GRF A;  3U6V A;  3WD6 A;  1EP7 A;  1U6T A;  1TDI A;  4BWQ A;  3EVI A;  2HI7 A;  5D9X A;  2EC4 A;  4YQV A;  2IPA A;  1MEK A;  5D9T A;  1MDK A;  3VWU A;  4OCF A;  3CQF A;  2GT5 A;  5J4U A;  1T4Y A;  1TKD B;  2R0G A;  2JL4 A;  3DML A;  4PNF A;  1XWK A;  1M0U A;  4CY8 A;  1TK5 B;  3LYK A;  4Q5N A;  5DCH A;  5ECR B;  3SBC A;  2HRN A;  2CZ3 A;  4K9Z A;  5HFG A;  5DQY A;  1Z6M A;  5EVO A;  4K1F A;  3CYN A;  4DSS A;  1A0R P;  2LJK A;  2YOI A;  2K8S A;  2H1D A;  3QD9 A;  3O6T A;  1IYI A;  2DJ0 A;  3GYK A;  1TOF A;  2AB6 A;  4KND A;  2LKU A;  3HDC A;  2GZY A;  2H66 A;  1HNC A;  2DKI A;  3QR6 A;  2NDO A;  4EIP A;  1X5C A;  3HHV A;  3DD3 A;  4BA7 A;  3UL3 A;  2F51 A;  4MAB A;  1A2L A;  2A2P A;  1GSF A;  3M9K A;  3WGD A;  1A2M A;  4YAP A;  4ZBA A;  5ECS A;  2IFQ B;  3UBL A;  3ZL5 A;  2H71 A;  2XPD A;  2CVD A;  4G0I A;  2L6D A;  1YEX A;  3APO A;  4IKH A;  1YF0 A;  4MA9 A;  22GS A;  8GSS A;  5C04 A;  1PX6 A;  3LJR A;  3OR5 A;  4XS4 A;  5J9C A;  3G9B A;  2I9H A;  1RW1 A;  1NW2 A;  2L4C A;  3TUE A;  3G7J A;  1DE2 A;  4WF4 A;  2ON7 A;  1E6B A;  3G7Y A;  1S3A A;  2BJX A;  4BVY B;  3ZML A;  1FG4 A;  2A4H A;  4PQH A;  3H79 A;  3UMA A;  5EY6 A;  4ID0 A;  5F0G A;  4LA1 A;  3PIN A;  1XW5 A;  2PER A;  3VWX A;  3MSZ A;  3ERF A;  2V2G A;  3TCO A;  3DIE A;  4X1U A;  4I2T A;  3TGZ A;  4MCU A;  1OE7 A;  5B8A A;  1G7O A;  3IR4 A;  3M9J A;  2GSR A;  2LRT A;  2OJL A;  4P3Y B;  1PA3 A;  2L59 A;  4IVF A;  2DJJ A;  1NM3 A;  3CTF A;  1I9D A;  3HJM A;  1GUL A;  2PWJ A;  5ECO B;  1Y25 A;  3LXZ A;  4MPG A;  1TJD A;  4K5R A;  2MMO A;  3FR3 A;  5IPG A;  2ON5 A;  3GFK A;  3IDV A;  4AGS A;  2R5G A;  2YNX A;  2OAD A;  4OFN A;  5HQP A;  3EC3 A;  2MMN A;  1THX A;  3MIX A;  4H86 A;  3GHA A;  3LWA A;  5HR2 A;  5DDL A;  4HU9 A;  1XWC A;  3H1N A;  2LQO A;  2V41 A;  3LGC A;  3TJB A;  4MJE A;  2R0C A;  4POL A;  2CT6 A;  4OD7 A;  1OVN A;  2VLV A;  3D6I A;  4FQU A;  1THO A;  3F4R A;  3HXS A;  1HNB A;  2OE1 A;  2DML A;  2F3M A;  3FZ5 A;  4OMV A;  1YKC A;  3CBU A;  1H75 A;  4HU7 A;  4V2M A;  5IO0 A;  3VPT A;  1TW9 A;  1H4O A;  18GS A;  2KP1 A;  1URM A;  4TRX A;  5H5R A;  3ERW A;  4OFM A;  2H6Y A;  1PKZ A;  2I3Y A;  5F8B A;  1R4W A;  4O32 A;  1EV4 A;  2YPM A;  2XHF A;  4POM A;  2C8U A;  1SK2 A;  3RHB A;  2GSS A;  3UAR A;  2XPE A;  3I43 A;  1EEM A;  1K0N A;  4ZL7 A;  4N30 A;  5JCU A;  3E3E A;  4EDY A;  4V2L A;  1EGR A;  1ABA A;  3AY8 A;  4IGJ A;  3TKQ A;  3EU3 A;  2XBI A;  3TOU A;  4LL4 B;  1OAZ A;  2PU9 C;  3LXT A;  4FYB A;  4Z7X A;  1X5E A;  2GQK A;  4ZIL A;  3TRX A;  3QFA C;  1CQG A;  3L78 A;  3KP8 A;  4KB3 A;  1V9W A;  1SJI A;  1F2E A;  3HY2 A;  3F6D A;  2CX4 A;  2JSZ A;  4ZBD A;  2GGT A;  3GUS A;  3F4S A;  1GSD A;  3MAK A;  1PMT A;  4ULX A;  2DIY A;  4K5S A;  5FT3 A;  3FRC A;  3QCP A;  4K7I A;  1UN2 A;  2PN8 A;  4OFT A;  1K3L A;  1PD2 1;  3FZ9 A;  20GS A;  1ON4 A;  2H74 A;  1SJ6 A;  3SWL A;  4G9H A;  5IMV A;  5J3R A;  1XOB A;  5GAN D;  3VUR A;  1ACV A;  5LNK e;  3L0H A;  1JFU A;  4EE0 A;  1GWC A;  3KD0 A;  1Z3E A;  1PQN A;  4ML1 A;  2YJH A;  2E2G A;  4ACS A;  2YV9 A;  4HJM A;  2H01 A;  3UIW A;  3GTU A;  3EIN A;  3PGT A;  1O85 A;  1TRV A;  2HYX A;  5HFK A;  3C8E A;  1SL0 B;  1QGV A;  4JU5 A;  4F0B A;  3KCM A;  2YN1 A;  5IMZ A;  2PUK C;  2PBJ A;  1WIK A;  2CV4 A;  1JHB A;  2CVB A;  3L9V A;  5FHI A;  3ZIT A;  2TRC P;  4PQI A;  5J5N A;  3O3T A;  4K8M A;  2H30 A;  5ECM B;  5DJL A;  3R3E A;  1YQ1 A;  2KP2 A;  2E7P A;  1DSB A;  2P0G A;  4ZL9 A;  2CAQ A;  2GZP A;  2N5A A;  2VCW A;  1Z9H A;  1JLW A;  4F03 A;  4I97 A;  5LCZ A;  1KEB A;  3R2Q A;  1DUG A;  1CQH A;  4OCE A;  1YF1 A;  5G31 A;  4ZB9 A;  3GMF A;  3WT1 A;  4MLY A;  4J57 E;  3C71 A;  1ILO A;  2X8C A;  1X5D A;  3TJF A;  5HFI A;  1JZW A;  1SD9 A;  4POK A;  2C0D A;  2FWH A;  3TRP A;  2OE3 A;  1K0D A;  3GH6 A;  3UBK A;  3EYT A;  4TXO B;  1WOU A;  2O89 A;  4KF9 A;  4OO5 A;  2MMZ A;  1S3C A;  2YZU A;  4ZBB A;  2VM1 A;  1ZYE A;  2B5E A;  4EC0 A;  2IL3 A;  1J0F A;  3ME7 A;  2YZH A;  5F07 A;  1USB A;  2B7J A;  4NV2 A;  1JZR A;  4DEJ A;  5B6M A;  2RUF A;  2WGR A;  1TI1 A;  4EXJ A;  1X9S B;  4XS1 A;  1MD4 A;  3EMP A;  1FVK A;  3C7M A;  2FD3 A;  5JWO B;  4AJ7 A;  1O73 A;  4Q5R A;  2FHE A;  2HRK A;  1EEJ A;  4GST A;  1U3I A;  4V2N A;  4MMM A;  4HZ4 A;  2YWI A;  1F9M A;  3TKS C;  1FAA A;  5E59 A;  2HZE B;  1GTU A;  5IMC A;  5JCG A;  4Z2T A;  1HD2 A;  1ML6 A;  5KOX A;  2VL2 A;  2OBK A;  3GN3 A;  4RUV A;  2VL3 A;  4IBP A;  1XZO A;  1N8J A;  1BYE A;  4NXI A;  4F9Z A;  5EL8 A;  1E2Y A;  1GTI A;  2DJK A;  1SK0 A;  5KN1 A;  1EOH A;  5COH A;  4GWR A;  4IQ1 A;  3TRQ A;  2C1Y A;  1WE0 A;  4O5R A;  5ECI B;  1T4Z A;  5A5K A;  17GS A;  2H6X A;  1GUM A;  1ZOF A;  4FYU A;  5IM9 A;  3J7Y k;  4HOJ A;  4ECC A;  1GTB A;  1OC9 B;  5A4U A;  4EO3 A;  1HYU A;  1U3A A;  4PX1 A;  1AQW A;  1WP0 A;  2OA7 A;  5G5F A;  4YQM A;  1M3J A;  1SJZ A;  5G1L A;  5F05 A;  4XTS A;  2WZ9 A;  3L9S A;  2YWM A;  2LJA A;  2L4Q A;  3D0Z A;  3BCI A;  1N2A A;  3F4T A;  2ZCT A;  1NHO A;  4N11 A;  3P90 A;  3LSZ A;  3HZ4 A;  3ZIV A;  3Q74 A;  4D73 B;  4ECJ A;  2WJU A;  3LFL A;  4G19 A;  3O76 A;  2H1B A;  2X8H A;  4HQZ A;  3ZIJ A;  1O6J A;  3P8W A;  1XPV A;  3TB2 A;  2PMT A;  2M46 A;  3A5I A;  3GL3 A;  4WR4 A;  4NMU A;  2LJR A;  4QL7 A;  5KEJ A;  2C3N A;  2GDR A;  1KTE A;  2HE3 A;  5B7C A;  4E8H A;  2FWG A;  4L0U A;  1ERW A;  4EKZ A;  4FIW A;  1UC7 A;  3M3M A;  3VI7 A;  5BMU A;  1XWB A;  4PUF C;  2DMM A;  1TRS A;  2FGX A;  1OE8 A;  1XCC A;  1O7U A;  5DAK B;  1XXU A;  2J9H A;  4O5Q A;  4K6X A;  2XBQ A;  1GUH A;  4RI6 A;  5DAL A;  4IS0 A;  4MH3 A;  2C0F A;  4WXT A;  1XW9 A;  1A8Y A;  2BMX A;  3EUR A;  5CYY A;  2IMI A;  5CP1 A;  3J7Y b;  4MJA A;  1B9X C;  2OAC A;  1AQV A;  2K8V A;  4I2U A;  1K0C A;  2H73 A;  1SU9 A;  3ERG A;  2H76 A;  5ECP B;  1WMJ A;  1T00 A;  3CRT A;  5IMD A;  2O8V B;  2B6M A;  4MZW A;  2MBS A;  1S3D A;  4LMV A;  1GRX A;  2EIO A;  2LST A;  3DYR A;  2TRX A;  4I8B A;  4TOP A;  12GS A;  2P31 A;  3VI5 A;  2IMK A;  3FR9 A;  2GTU A;  5ID2 B;  3IXR A;  1PL2 A;  2E2M A;  1YEP A;  3GX8 A;  4WBJ A;  2CAI A;  3WGE A;  2B5X A;  1W89 A;  3QDN A;  4I5Q A;  1OC8 A;  2NBS A;  2R3X A;  4BVX B;  1X9W B;  2B1L A;  2CQ9 A;  1T7P B;  4MJC A;  1O81 A;  3A3T A;  5E4W A;  3GA4 A;  2V6K A;  3TKR A;  6GSX A;  2LUS A;  4ZB6 A;  4MF6 A;  2BTO T;  5F06 A;  2VCZ A;  2WCI A;  1GSE A;  3KIJ A;  1EOG A;  5JWR B;  3FHK A;  6GST A;  2D2Z A;  2RM6 A;  3VPQ A;  1LJR A;  2VCV A;  3FW2 A;  4IEL A;  1KBN A;  1M99 A;  2MYG A;  4NAX A;  3EWL A;  3F8U A;  4G0L A;  3ME8 A;  1AXD A;  4POB A;  5J41 A;  2J23 A;  2KLX A;  4XHM A;  4DSQ A;  5AIS A;  1MDJ A;  5IQY A;  2WS2 A;  3QAW A;  3IRA A;  4QL9 A;  2YWO A;  2HNL A;  1ST9 A;  1ZGN A;  5G5E A;  2H1A A;  1ZL9 A;  2EIR A;  3QOU A;  3ISO A;  2X99 A;  1VF4 A;  1FB6 A;  4GF0 A;  1PKW A;  1I5G A;  1FOV A;  2B3S A;  4L0W A;  2H75 A;  4IP1 A;  1G6W A;  3IHQ A;  5CRW A;  5ECH B;  3KM6 A;  1VGL A;  3DXB A;  3QMX A;  2I4A A;  3IAM 2; 
#chains in the Genus database with same CATH homology
 4KW6 A;  1WJK A;  1SYR A;  1SYX A;  1K0B A;  4OWY A;  1VF3 A;  1B8X A;  2AHE A;  3F63 A;  2IME A;  4KSO A;  1QFN A;  4TXO A;  2R0P A;  1F6M C;  4JRR A;  4HS1 A;  4ZL8 A;  2LNS A;  4TR0 A;  3NIV A;  3A2X A;  4PXO A;  2AYT A;  1YY7 A;  2DJ1 A;  2LV3 A;  1YKA A;  2CVK A;  4EVM A;  1IYH A;  1GNE A;  5ECN B;  1SKR B;  3FK8 A;  3IK9 A;  2NVL A;  2C0G A;  5G30 A;  2C0E A;  1MD3 A;  3EE2 A;  2B5Y A;  2PVO C;  2YAN A;  1Q4J A;  1TK8 B;  4QQ7 A;  4EL1 A;  2VL9 A;  2HFD A;  1O8W A;  5ECQ B;  3C1S A;  4KCA A;  3UEM A;  13GS A;  3IBH A;  3W8S A;  5JCW A;  2VOC A;  1PL1 A;  4JR4 A;  1RK4 A;  19GS A;  1QXH A;  1R26 A;  2IJY A;  4Q5Q A;  3LW9 A;  2HZE A;  1T8E B;  2VCQ A;  4HUA A;  3GKM A;  4CDO A;  1QMV A;  1F37 A;  3BJ5 A;  3FKF A;  2N5B A;  4F2I A;  3HVS A;  3QPM A;  4MPF A;  5G1K A;  2JZR A;  4EDZ A;  4OO4 A;  3DWV A;  2MMA A;  3KH7 A;  1Y6E A;  6GSV A;  1TI3 A;  1ERU A;  3RBT A;  3ZRE A;  2IN3 A;  2VLT A;  1YJ6 A;  1GUK A;  1M2D A;  2WUL A;  4MDC A;  1SK1 A;  4N0V A;  1Z7P A;  5AN1 A;  1OC9 A;  1PRX A;  1NHY A;  4TR3 A;  2V32 A;  4NPB A;  1A8L A;  3EPT A;  3UVH A;  2CZ2 A;  2E0Q A;  1GNW A;  5JWQ B;  3ZFB A;  4E8E A;  2REM A;  5AIV A;  2VO4 A;  3N5O A;  4BL7 A;  2AUV A;  3ZRD A;  1M2A A;  1FO5 A;  3KMN A;  4D73 A;  3QAG A;  4HI7 A;  4ZXG A;  4TR1 A;  3DKS A;  1PX7 A;  4KUN A;  1UVZ A;  1BJX A;  1GL8 A;  4XCS A;  1GTA A;  2DIZ A;  5CNW A;  2P5R A;  4MK3 A;  2JAC A;  3GRX A;  5LD0 A;  2L6C A;  2QA2 A;  5ECK B;  2LQQ A;  5KOW A;  3GUR A;  5CRE A;  3M0F A;  2VAF A;  3P7X A;  3BCK A;  3KGK A;  4XRD A;  1K0M A;  2HLS A;  3E9J B;  4TW5 A;  3TKS E;  3MYD A;  1SEN A;  4CHS A;  2XC2 A;  1EGO A;  4ISD A;  3VFI A;  4YH2 A;  2C4J A;  1K0A A;  1TXX A;  2IIY A;  1VRS D;  3GIX A;  4XS6 A;  3N9J A;  5DAK A;  1WPI A;  3TJK A;  4LMW A;  1XOA A;  1YZX A;  1MTC A;  4FYC A;  3IHG A;  1FHE A;  2JAD A;  1B48 A;  2DJ2 A;  3H8Q A;  4MF7 A;  1TP9 A;  2L5O A;  3IV4 A;  1SD8 A;  4TKY A;  5CO3 A;  4JED A;  1TRW A;  5ENU A;  3F6F A;  1FW1 A;  2P5Q A;  4KA0 A;  3D4T A;  4GSS A;  1F3A A;  4HDE A;  4DVC A;  2YP6 A;  5L71 A;  3LEF A;  5B8B A;  3GKN A;  3TOT A;  3L4N A;  1Q98 A;  2O87 A;  4HEA 2;  6GSS A;  5KN3 A;  2G2Q A;  3CTG A;  3VK9 A;  5CRG A;  2OE0 A;  3HCZ A;  2IFQ A;  2PVQ A;  5HR1 A;  3I69 A;  1V2A A;  3TKP A;  2RLI A;  4YKF A;  2R4V A;  3M8N A;  5ID2 A;  5HR0 A;  4GSN A;  1B4P A;  2VD1 A;  3LG6 A;  2A2R A;  4MNN A;  3APS A;  4KGI A;  3TJG A;  4YKG A;  4BVX A;  3KTB A;  2FUG 2;  1XFL A;  4F82 A;  4JE1 A;  4PQ1 A;  2M72 A;  1U88 A;  3HJO A;  4I6X A;  5D9W A;  3FMW A;  1V57 A;  2H0I A;  1LBK A;  3LOR A;  3Q6O A;  1TU8 A;  3PPU A;  4L8E A;  3RHC A;  4FH8 A;  3I6A A;  4BVY A;  2RUE A;  3HA9 A;  3LYP A;  2GVP A;  2IWT A;  3FZA A;  2O85 A;  2VM2 A;  4BPY A;  1ZYP A;  4K0N A;  5CRH A;  3ZVJ A;  6GSU A;  2I81 A;  1WWJ A;  1BG5 A;  3UJ1 A;  14GS A;  4PUA A;  3PR8 A;  2H1G A;  1VF1 A;  4K0G A;  1YDK A;  1R5P A;  2DLX A;  2WFC A;  1MDI A;  4KH7 A;  3I9V 2;  3D21 A;  5INY A;  3GKK A;  3RPN A;  2GZZ A;  2HSY A;  3APQ A;  3GH9 A;  4GTU A;  3BD2 A;  4TR4 A;  1A2J A;  1QQ2 A;  3HD5 A;  2K18 A;  2L57 A;  3DVW A;  1EWX A;  1T1V A;  4MJB A;  2JSY A;  1R5A A;  4K2X A;  2DJ3 A;  1GSU A;  5B6N A;  4NHZ A;  1T3B A;  1SKW B;  1OC3 A;  4KSM A;  3QFB C;  1V98 A;  3RPP A;  1OYJ A;  2WRT A;  1FOH A;  2JU5 A;  1AW9 A;  5AIX A;  1PGT A;  1V58 A;  2YWN A;  2UZ8 A;  4X0X A;  3PH9 A;  4MP4 A;  1X9M B;  4TN8 A;  4ZB8 A;  2HRA A;  5D8I A;  3IOS A;  3M1G A;  2A4V A;  4JZQ A;  1TTZ A;  2FWE A;  3RDW A;  3F9U A;  1J08 A;  1XIY A;  5IMF A;  4GLT A;  3IPZ A;  3S9F A;  1XWG A;  2V6O A;  1R7H A;  3GV1 A;  3KZQ A;  3DGQ A;  3JCM L;  2TIR A;  1DBY A;  1ZZY A;  2AJQ B;  4LLR A;  5J9B A;  1V40 A;  4AJ8 A;  2R6K A;  10GS A;  1LU4 A;  2X49 A;  2Z9S A;  4JBB A;  3US3 A;  4Q5F A;  2GT6 A;  2FA4 A;  3IC8 A;  2CX3 A;  3GX0 A;  3W8J A;  1JLV A;  3KEB A;  4IJI A;  2QGV A;  3NZN A;  4Z2U A;  1VF2 A;  4XRA A;  1J9B A;  2LEG A;  4MH2 A;  1M9B A;  4IN0 A;  3IA1 A;  3KP9 A;  2A2S A;  2H72 A;  3CMI A;  2G0F A;  4J2F A;  3TKS A;  3MNG A;  4KDU A;  4K7N A;  1JZD A;  2HSH A;  3VWW A;  3KTL A;  4XIH A;  3CRU A;  2GS3 A;  2QA1 A;  4V1A g;  1TRU A;  2GST A;  3RAZ A;  3BOA A;  5KN0 A;  5IO2 A;  4WF5 A;  1EP8 A;  1F3B A;  1K3O A;  3HKR A;  5D73 A;  1ZCP A;  2C80 A;  3ZMK A;  1B4Q A;  2FNO A;  1Z5Y E;  1FVJ A;  3FR6 A;  2HXK A;  5IOX A;  1AUC A;  5IOW A;  3ZFL A;  2ZNM A;  6GSW A;  3K8N A;  3DEX A;  4MZC A;  1JZO A;  4NWY A;  1AQX A;  4CY6 A;  4TXV A;  2FY6 A;  1QUW A;  3D22 A;  3F3Q A;  4L5O A;  3MDK A;  5GSS A;  5EPF A;  2HRF A;  2X8G A;  3ZVJ D;  4ZIJ A;  5FWG A;  4HZ2 A;  3IC4 A;  4EUY A;  5BRT A;  1BAY A;  2KUC A;  2IMD A;  4AJ6 A;  2FLS A;  1PSQ A;  1XVW A;  3GNJ A;  5ABR A;  9GSS A;  5KN2 A;  3FZ4 A;  3A2W A;  1WRY A;  3IK7 A;  5DCG A;  2N5F A;  2FWF A;  4L5L A;  2C3T A;  4YAV A;  5H5Q A;  1AIU A;  1GP1 A;  4RQX A;  2VUP A;  2DKH A;  4O92 A;  1Z6N A;  2H8L A;  2AV4 A;  1TU7 A;  3UOM A;  2LRN A;  2PPT A;  3CSH A;  4AF2 A;  1DE1 A;  3WGX A;  4DSS B;  5CAX A;  4HJ2 A;  2DSA A;  3HZ8 A;  1M9A A;  1A0F A;  1OKT A;  2DBC A;  4K7O A;  1GSY A;  4Z2R A;  3C1R A;  2GSQ A;  2ES7 A;  5GZZ B;  1BQ7 A;  4ICY A;  5DAL B;  4WR5 A;  3ZTL A;  3GST A;  4KAE A;  5ELA A;  2OBI A;  2R2J A;  4USS A;  5IMA A;  3TJJ A;  2QSI A;  4NHW A;  2R37 A;  2AAW A;  2JZT A;  4WEY A;  1NSW A;  2GQM A;  1U87 A;  3D4M A;  3HVX A;  4IQA A;  2YJ7 A;  3IAS 2;  3EMX A;  1SL2 B;  3H93 A;  5AGY A;  1A24 A;  4N0Z A;  2QC7 A;  11GS A;  1C72 A;  2KOK A;  4HQS A;  3TDG A;  2VL2 C;  3CSI A;  4DSR A;  4IHU A;  2K6V A;  2HSM A;  1ERV A;  3ZYW A;  2K9F A;  3VWV A;  4PTS A;  1A23 A;  1FB0 A;  2FA8 A;  5D9V A;  4ML6 A;  1HQO A;  3UAP A;  4XS4 B;  2HZF A;  4KX4 A;  1UA5 A;  3EU4 A;  1PN9 A;  5DVB A;  5IPH A;  4J56 E;  3GKX A;  1TK0 B;  1X0R A;  4V1A p;  5DQS A;  3F0I A;  5DJM A;  1AC1 A;  1EZK A;  2LRC A;  2DC5 A;  2VIM A;  3WYW A;  3FYG A;  4MF5 A;  4ECB A;  2H0H A;  4IJ3 A;  1XBS A;  4GXZ A;  2WDU A;  1BX9 A;  4G0K A;  4BWS A;  2QKE A;  1ZMA A;  4WKW A;  2VCT A;  5D93 A;  2FCH A;  3IE3 A;  4O5U A;  2LTK A;  3Q19 A;  1SKS B;  5IIZ A;  2M80 A;  1XVQ A;  3KH9 A;  1XWA A;  2YCD A;  3V1W A;  2ALB A;  4PNG A;  2LS5 A;  2MZC A;  3G7I A;  4KDY A;  4EF0 A;  3FEU A;  2X64 A;  2KHP A;  2H0G A;  5GST A;  2H70 A;  4A5P A;  4EIQ A;  3GL5 A;  3DRN A;  3ZZX A;  4KDX A;  2F9S A;  2RII A;  1K3Y A;  5H5S A;  2C3Q A;  2NPB A;  1M2B A;  5G2Z A;  3ED3 A;  3BBY A;  4CW9 A;  2YV7 A;  3W6G A;  1ZYQ B;  5A4V A;  1M7T A;  4RQR A;  1G0T A;  5DBQ A;  3D5J A;  2VLU A;  2VD0 A;  4MZB A;  5C00 A;  5CRD A;  2OKA A;  1GSS A;  4ECI A;  3NOF A;  2PGT A;  4KE3 A;  3H4K A;  3Q18 A;  1SL1 B;  5D96 A;  1XW6 A;  4YQU A;  3U5R E;  4ILF A;  3WT2 A;  2F8A A;  5ELG A;  1ERT A;  2H19 A;  3HVV A;  4FO5 A;  1B9Y C;  4LL1 B;  2MBT A;  2X4A A;  1Z7R A;  2LNT A;  3L9U A;  4JR6 A;  4IW9 A;  1GLQ A;  4G10 A;  3GSS A;  2RM5 A;  2V1M A;  3A5W A;  5ECL B;  1EV9 A;  4N10 A;  3UVT A;  1ZYN A;  2L5L A;  2IMF A;  3ZLP A;  1K0O A;  3DVX A;  2NTO A;  6GSY A;  1GLP A;  4NV5 A;  3C73 A;  5A4W A;  3HYP A;  1O8X A;  4KCE A;  4O7H A;  3A2V A;  1QK8 A;  7GSS A;  1HNA A;  4IP6 A;  3CXG A;  2O7K A;  3VLN A;  3LQ7 A;  3P2A A;  4GCI A;  4X4J A;  3MWH A;  2JZS A;  3F3R A;  3E0U A;  1AAZ A;  3CSJ A;  2H6Z A;  2I1U A;  2EIQ A;  4RI7 A;  4K2D A;  4PUR A;  3QAV A;  1RQM A;  2B1K A;  1BED A;  2VCX A;  4WBR D;  4X43 A;  3GTU B;  1W4V A;  1G7E A;  5HR3 A;  4PGT A;  4TVE A;  1GH2 A;  3HJP A;  2HT9 A;  16GS A;  1G6Y A;  3KJY A;  2ZUP A;  5GAP D;  3FY7 A;  4WET A;  2F8F A;  3KXO A;  4GQC A;  1GSQ A;  4BL7 B;  4G2E A;  3KMO A;  2B7K A;  2CA8 A;  1OKD A;  4F0C A;  1KNG A;  1PN0 A;  2GQL A;  2WB9 A;  4GQF A;  2GLR A;  4TR1 B;  4GRF A;  3U6V A;  3WD6 A;  1EP7 A;  1U6T A;  1TDI A;  4BWQ A;  3EVI A;  2HI7 A;  5D9X A;  2EC4 A;  4YQV A;  2IPA A;  1MEK A;  5D9T A;  1MDK A;  3VWU A;  4OCF A;  2GT5 A;  5J4U A;  1T4Y A;  1TKD B;  2R0G A;  2JL4 A;  3DML A;  4PNF A;  1XWK A;  1M0U A;  4CY8 A;  1TK5 B;  3LYK A;  4Q5N A;  5DCH A;  5ECR B;  3SBC A;  2HRN A;  2CZ3 A;  4K9Z A;  5HFG A;  5DQY A;  1Z6M A;  5EVO A;  4K1F A;  3CYN A;  4DSS A;  1A0R P;  2LJK A;  2YOI A;  2K8S A;  2H1D A;  3QD9 A;  3O6T A;  1IYI A;  2DJ0 A;  3GYK A;  1TOF A;  2AB6 A;  4KND A;  2LKU A;  3HDC A;  2GZY A;  2H66 A;  1HNC A;  2DKI A;  3QR6 A;  2NDO A;  4EIP A;  1X5C A;  3HHV A;  3DD3 A;  4BA7 A;  3UL3 A;  2F51 A;  4MAB A;  1A2L A;  2A2P A;  1GSF A;  3M9K A;  3WGD A;  1A2M A;  4YAP A;  4ZBA A;  5ECS A;  2IFQ B;  3UBL A;  3ZL5 A;  2H71 A;  2XPD A;  2CVD A;  4G0I A;  2L6D A;  1YEX A;  3APO A;  4IKH A;  1YF0 A;  4MA9 A;  22GS A;  8GSS A;  5C04 A;  1PX6 A;  3LJR A;  3OR5 A;  4XS4 A;  5J9C A;  3G9B A;  2I9H A;  1RW1 A;  1NW2 A;  2L4C A;  3TUE A;  3G7J A;  1DE2 A;  4WF4 A;  2ON7 A;  1E6B A;  3G7Y A;  1S3A A;  2BJX A;  4BVY B;  3ZML A;  1FG4 A;  2A4H A;  4PQH A;  3H79 A;  3UMA A;  5EY6 A;  4ID0 A;  5F0G A;  4LA1 A;  3PIN A;  1XW5 A;  2PER A;  3VWX A;  3MSZ A;  3ERF A;  2V2G A;  3TCO A;  3DIE A;  4X1U A;  4I2T A;  3TGZ A;  4MCU A;  1OE7 A;  5B8A A;  1G7O A;  3IR4 A;  3M9J A;  2GSR A;  2LRT A;  2OJL A;  4P3Y B;  1PA3 A;  2L59 A;  4IVF A;  2DJJ A;  1NM3 A;  3CTF A;  1I9D A;  3HJM A;  1GUL A;  2PWJ A;  5ECO B;  1Y25 A;  3LXZ A;  4MPG A;  1TJD A;  4K5R A;  2MMO A;  3FR3 A;  5IPG A;  2ON5 A;  3GFK A;  3IDV A;  4AGS A;  2R5G A;  2YNX A;  2OAD A;  4OFN A;  5HQP A;  3EC3 A;  2MMN A;  1THX A;  3MIX A;  4H86 A;  3GHA A;  3LWA A;  5HR2 A;  5DDL A;  4HU9 A;  1XWC A;  3H1N A;  2LQO A;  2V41 A;  3LGC A;  3TJB A;  4MJE A;  2R0C A;  4POL A;  2CT6 A;  4OD7 A;  1OVN A;  2VLV A;  3D6I A;  4FQU A;  1THO A;  3F4R A;  3HXS A;  1HNB A;  2OE1 A;  2DML A;  2F3M A;  3FZ5 A;  4OMV A;  1YKC A;  3CBU A;  1H75 A;  4HU7 A;  4V2M A;  5IO0 A;  3VPT A;  1TW9 A;  1H4O A;  18GS A;  2KP1 A;  1URM A;  4TRX A;  5H5R A;  3ERW A;  4OFM A;  2H6Y A;  1PKZ A;  2I3Y A;  5F8B A;  1R4W A;  4O32 A;  1EV4 A;  2YPM A;  2XHF A;  4POM A;  2C8U A;  1SK2 A;  3RHB A;  2GSS A;  3UAR A;  2XPE A;  3I43 A;  1EEM A;  1K0N A;  4ZL7 A;  4N30 A;  5JCU A;  3E3E A;  4EDY A;  4V2L A;  1EGR A;  1ABA A;  3AY8 A;  4IGJ A;  3TKQ A;  3EU3 A;  2XBI A;  3TOU A;  4LL4 B;  1OAZ A;  2PU9 C;  3LXT A;  4FYB A;  4Z7X A;  1X5E A;  2GQK A;  4ZIL A;  3TRX A;  3QFA C;  1CQG A;  3L78 A;  3KP8 A;  4KB3 A;  1V9W A;  1SJI A;  1F2E A;  3HY2 A;  3F6D A;  2CX4 A;  2JSZ A;  4ZBD A;  2GGT A;  3GUS A;  3F4S A;  1GSD A;  3MAK A;  1PMT A;  4ULX A;  2DIY A;  4K5S A;  5FT3 A;  3FRC A;  3QCP A;  4K7I A;  1UN2 A;  2PN8 A;  4OFT A;  1K3L A;  1PD2 1;  3FZ9 A;  20GS A;  1ON4 A;  2H74 A;  1SJ6 A;  3SWL A;  4G9H A;  5IMV A;  5J3R A;  1XOB A;  5GAN D;  3VUR A;  1ACV A;  5LNK e;  3L0H A;  1JFU A;  4EE0 A;  1GWC A;  3KD0 A;  1Z3E A;  1PQN A;  4ML1 A;  2YJH A;  2E2G A;  4ACS A;  2YV9 A;  4HJM A;  2H01 A;  3UIW A;  3GTU A;  3EIN A;  3PGT A;  1O85 A;  1TRV A;  2HYX A;  5HFK A;  3C8E A;  1SL0 B;  1QGV A;  4JU5 A;  4F0B A;  3KCM A;  2YN1 A;  5IMZ A;  2PUK C;  2PBJ A;  1WIK A;  2CV4 A;  1JHB A;  2CVB A;  3L9V A;  5FHI A;  3ZIT A;  2TRC P;  4PQI A;  5J5N A;  3O3T A;  4K8M A;  2H30 A;  5ECM B;  5DJL A;  3R3E A;  1YQ1 A;  2KP2 A;  2E7P A;  1DSB A;  2P0G A;  4ZL9 A;  2CAQ A;  2GZP A;  2N5A A;  2VCW A;  1Z9H A;  1JLW A;  4F03 A;  4I97 A;  5LCZ A;  1KEB A;  3R2Q A;  1DUG A;  1CQH A;  4OCE A;  1YF1 A;  5G31 A;  4ZB9 A;  3GMF A;  3WT1 A;  4MLY A;  4J57 E;  3C71 A;  1ILO A;  2X8C A;  1X5D A;  3TJF A;  5HFI A;  1JZW A;  1SD9 A;  4POK A;  2C0D A;  2FWH A;  3TRP A;  2OE3 A;  1K0D A;  3GH6 A;  3UBK A;  3EYT A;  4TXO B;  1WOU A;  2O89 A;  4KF9 A;  4OO5 A;  2MMZ A;  1S3C A;  2YZU A;  4ZBB A;  2VM1 A;  1ZYE A;  2B5E A;  4EC0 A;  2IL3 A;  1J0F A;  3ME7 A;  2YZH A;  5F07 A;  1USB A;  2B7J A;  4NV2 A;  1JZR A;  4DEJ A;  5B6M A;  2RUF A;  2WGR A;  1TI1 A;  4EXJ A;  1X9S B;  4XS1 A;  1MD4 A;  3EMP A;  1FVK A;  3C7M A;  2FD3 A;  5JWO B;  4AJ7 A;  1O73 A;  4Q5R A;  2FHE A;  2HRK A;  1EEJ A;  4GST A;  1U3I A;  4V2N A;  4MMM A;  4HZ4 A;  2YWI A;  1F9M A;  3TKS C;  1FAA A;  5E59 A;  2HZE B;  1GTU A;  5IMC A;  5JCG A;  4Z2T A;  1HD2 A;  1ML6 A;  5KOX A;  2VL2 A;  2OBK A;  3GN3 A;  4RUV A;  2VL3 A;  4IBP A;  1XZO A;  1N8J A;  1BYE A;  4NXI A;  4F9Z A;  5EL8 A;  1E2Y A;  1GTI A;  2DJK A;  1SK0 A;  5KN1 A;  1EOH A;  5COH A;  4GWR A;  4IQ1 A;  3TRQ A;  2C1Y A;  1WE0 A;  4O5R A;  5ECI B;  1T4Z A;  5A5K A;  17GS A;  2H6X A;  1GUM A;  1ZOF A;  4FYU A;  5IM9 A;  3J7Y k;  4HOJ A;  4ECC A;  1GTB A;  1OC9 B;  5A4U A;  4EO3 A;  1HYU A;  1U3A A;  4PX1 A;  1AQW A;  1WP0 A;  2OA7 A;  5G5F A;  4YQM A;  1SJZ A;  5G1L A;  5F05 A;  4XTS A;  2WZ9 A;  3L9S A;  2YWM A;  2LJA A;  2L4Q A;  3D0Z A;  3BCI A;  1N2A A;  3F4T A;  2ZCT A;  1NHO A;  4N11 A;  3P90 A;  3LSZ A;  3HZ4 A;  3ZIV A;  3Q74 A;  4D73 B;  4ECJ A;  2WJU A;  3LFL A;  4G19 A;  3O76 A;  2H1B A;  2X8H A;  4HQZ A;  3ZIJ A;  1O6J A;  3P8W A;  1XPV A;  3TB2 A;  2PMT A;  2M46 A;  3A5I A;  3GL3 A;  4WR4 A;  4NMU A;  2LJR A;  4QL7 A;  5KEJ A;  2C3N A;  2GDR A;  1KTE A;  2HE3 A;  5B7C A;  4E8H A;  2FWG A;  4L0U A;  1ERW A;  4EKZ A;  4FIW A;  1UC7 A;  3M3M A;  3VI7 A;  5BMU A;  1XWB A;  4PUF C;  2DMM A;  1TRS A;  2FGX A;  1OE8 A;  1XCC A;  1O7U A;  5DAK B;  1XXU A;  2J9H A;  4O5Q A;  4K6X A;  2XBQ A;  1GUH A;  4RI6 A;  5DAL A;  4IS0 A;  4MH3 A;  2C0F A;  4WXT A;  1XW9 A;  1A8Y A;  2BMX A;  3EUR A;  5CYY A;  2IMI A;  5CP1 A;  3J7Y b;  4MJA A;  1B9X C;  2OAC A;  1AQV A;  2K8V A;  4I2U A;  1K0C A;  2H73 A;  1SU9 A;  3ERG A;  2H76 A;  5ECP B;  1WMJ A;  1T00 A;  3CRT A;  5IMD A;  2O8V B;  2B6M A;  4MZW A;  2MBS A;  1S3D A;  4LMV A;  1GRX A;  2EIO A;  2LST A;  3DYR A;  2TRX A;  4I8B A;  4TOP A;  12GS A;  2P31 A;  3VI5 A;  2IMK A;  3FR9 A;  2GTU A;  5ID2 B;  3IXR A;  1PL2 A;  2E2M A;  1YEP A;  3GX8 A;  4WBJ A;  2CAI A;  3WGE A;  2B5X A;  1W89 A;  3QDN A;  4I5Q A;  1OC8 A;  2NBS A;  2R3X A;  4BVX B;  1X9W B;  2B1L A;  2CQ9 A;  1T7P B;  4MJC A;  1O81 A;  3A3T A;  5E4W A;  3GA4 A;  2V6K A;  3TKR A;  6GSX A;  2LUS A;  4ZB6 A;  4MF6 A;  2BTO T;  5F06 A;  2VCZ A;  2WCI A;  1GSE A;  3KIJ A;  1EOG A;  5JWR B;  3FHK A;  6GST A;  2D2Z A;  2RM6 A;  3VPQ A;  1LJR A;  2VCV A;  3FW2 A;  4IEL A;  1KBN A;  1M99 A;  2MYG A;  4NAX A;  3EWL A;  3F8U A;  4G0L A;  3ME8 A;  1AXD A;  4POB A;  5J41 A;  2J23 A;  2KLX A;  4XHM A;  4DSQ A;  5AIS A;  1MDJ A;  5IQY A;  2WS2 A;  3QAW A;  3IRA A;  4QL9 A;  2YWO A;  2HNL A;  1ST9 A;  1ZGN A;  5G5E A;  2H1A A;  1ZL9 A;  2EIR A;  3QOU A;  3ISO A;  2X99 A;  1VF4 A;  1FB6 A;  4GF0 A;  1PKW A;  1I5G A;  1FOV A;  2B3S A;  4L0W A;  2H75 A;  4IP1 A;  1G6W A;  3IHQ A;  5CRW A;  5ECH B;  3KM6 A;  1VGL A;  3DXB A;  3QMX A;  2I4A A;  3IAM 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...