2O8AA

Rat pp1cgamma complexed with mouse inhibitor-2
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
295
structure length
295
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of protein phosphatase 1 by inhibitor-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 112
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2o8aA00
2QFRA 1QHWA 4KBPA 4Q7FA 3RL3A 2AHDA 1MF8A 3N5UA 4O4KA 4FBQA 4MOYA 4JA7A 4B2OA 4OR9A 3KBPA 5JPEA 3QFMA 1S95A 4UWQA 5HPEA 4V0WA 1HPUA 3H63A 3E7AA 1FJMA 4LU9A 4FCXA 3DSDA 4TUIA 2HYPA 4ORAA 4TUGA 4H1YP 4MOVA 1II7A 2QJCA 1S3LA 3C5WC 3EGHA 2DFJA 4UT3A 3T1IA 4M0VA 1OI8A 1AUIA 3H66A 3QG5C 4IYPC 3THOB 1U32A 1S8EA 3FGAC 4HD0A 4IL1A 2XMOA 3V4YA 3IVEA 4WWLA 1S3NA 1WAO1 2BDXA 2GJUA 4H2BA 4H2GA 4NZVA 3IB8A 4LTYA 4I5LC 4MP0A 4DSYA 3E7BA 1Z2WA 4J6OA 3CK2A 2NPPC 2P6BA 2IE3C 4DT2A 4KKZA 4ZVZA 1NNWA 3IVDA 3QFOA 3H62B 3HVQA 4F0ZA 1UF3A 3QFNA 2USHA 1SU1A 1OIDA 4FBKA 3K7VC 5INBA 5GTUA 2NYMC 1G5BA 3IB7A 1W24A 1HO5A 5JPFA 2WDDA 1T71A 1XM7A 1S3MA 2HY1A 2R17A 2YVTA 1S70A 2IAEC 3H69A 3AUZA 1M63A 4DHLA 2Z72A 2JOGA 3K7WC 4FBWA 4O5GA 3H67A 1Z2XA 1USHA 3RL5A 5B8IA 4XPNA 3THNA 4V0XA 4V0VA 2BCDA 3P71C 4H2IA 2ZBMA 3DW8C 2O8GA 1V73A 1WARA 3RL4A 4I5NC 4ORBA 3AV0A 5JJTA 3QFKA 5C1VA 3ICFA 1T70A 1HP1A 1JK7A 4H1SA 1OIEA 3EGGA 2A22A 3DSCA 1KBPA 2CV9A 5DNYA 2WDEA 3PSNA 3TGHA 2O8AA 2WDFA 4O24A 4ORCA 3ZU0A 3H60A 3LL8A 2WDCA 2NXFA 3H64A 1QFCA 1XZWA 4LACC 2QFPA 2BQ8X 2KKNA 1TCOA 2NYLC 4JA9A 5EQVA 4UT2A 4G9JA 3GVEA 3C9FA 3JYFA 5IOHA 3H61A 4H2FA 5F3WA 3ZTVA 3PSOA 2IE4C 3RQZA 1IT6A 4ZX2A 2HYOA 2Z06A 1UTEA 4O43A 4YKEA 2Z1AA 2Q8UA 5J28A 3H68A 4UT3B
chains in the Genus database with same CATH superfamily
2QFRA 1QHWA 4KBPA 4Q7FA 3RL3A 2AHDA 1MF8A 3N5UA 4O4KA 4FBQA 4MOYA 4JA7A 4B2OA 4OR9A 3KBPA 5JPEA 3QFMA 1S95A 4UWQA 5HPEA 4V0WA 1HPUA 3H63A 3E7AA 1FJMA 2ZO9B 4LU9A 4FCXA 3DSDA 4TUIA 2HYPA 4ORAA 4TUGA 4H1YP 4MOVA 1II7A 2QJCA 1S3LA 3C5WC 2ZOAA 3EGHA 2DFJA 3E0JA 4UT3A 3T1IA 4M0VA 1OI8A 1AUIA 3H66A 3QG5C 4IYPC 3THOB 1U32A 1S8EA 3FGAC 4HD0A 4IL1A 2XMOA 3D03A 3V4YA 3IVEA 4WWLA 1S3NA 1WAO1 2BDXA 2GJUA 4H2BA 4H2GA 4NZVA 3IB8A 4LTYA 4I5LC 4MP0A 4DSYA 3E7BA 1Z2WA 4J6OA 3CK2A 2NPPC 2P6BA 2IE3C 4DT2A 4KKZA 4ZVZA 1NNWA 3IVDA 3QFOA 3H62B 3HVQA 4F0ZA 2YEQA 1UF3A 3QFNA 2USHA 1SU1A 1OIDA 4FBKA 3K7VC 5INBA 5GTUA 2NYMC 1G5BA 3IB7A 1W24A 1HO5A 5JPFA 2WDDA 1T71A 1XM7A 1S3MA 2HY1A 2R17A 2YVTA 1S70A 2IAEC 3H69A 3AUZA 1M63A 4DHLA 2Z72A 2JOGA 3K7WC 4FBWA 4O5GA 2DXLA 3H67A 1Z2XA 1USHA 3RL5A 5B8IA 4XPNA 3THNA 4V0XA 4V0VA 2DXNA 2BCDA 3P71C 4H2IA 2ZBMA 3DW8C 2O8GA 1V73A 1WARA 3RL4A 4I5NC 4ORBA 3AV0A 5JJTA 3QFKA 5C1VA 3ICFA 1T70A 1HP1A 1JK7A 4H1SA 1OIEA 3EGGA 2A22A 3DSCA 1KBPA 2CV9A 5DNYA 2WDEA 3PSNA 3TGHA 2O8AA 2WDFA 4O24A 4ORCA 3ZU0A 3H60A 3LL8A 2WDCA 2NXFA 3H64A 1QFCA 3FLOA 1XZWA 4LACC 2QFPA 2BQ8X 2KKNA 1TCOA 2NYLC 4JA9A 5EQVA 4UT2A 4G9JA 3GVEA 3C9FA 3JYFA 5IOHA 3H61A 4H2FA 5F3WA 3ZTVA 3PSOA 2IE4C 3RQZA 1IT6A 4ZX2A 2HYOA 2Z06A 1UTEA 4O43A 4YKEA 2Z1AA 2Q8UA 5J28A 3H68A 4UT3B
chains in the Genus database with same CATH topology
2QFRA 1QHWA 4KBPA 4Q7FA 3RL3A 2AHDA 1MF8A 3N5UA 4O4KA 4FBQA 4MOYA 4JA7A 4B2OA 4OR9A 3KBPA 5JPEA 3QFMA 1S95A 4UWQA 5HPEA 4V0WA 1HPUA 3H63A 3E7AA 1FJMA 2ZO9B 4LU9A 4FCXA 3DSDA 4TUIA 2HYPA 4ORAA 4TUGA 4H1YP 4MOVA 1II7A 2QJCA 1S3LA 3C5WC 2ZOAA 3EGHA 2DFJA 3E0JA 4UT3A 3T1IA 4M0VA 1OI8A 1AUIA 3H66A 3QG5C 4IYPC 3THOB 1U32A 1S8EA 3FGAC 4HD0A 4IL1A 2XMOA 3D03A 3V4YA 3IVEA 4WWLA 1S3NA 1WAO1 2BDXA 2GJUA 4H2BA 4H2GA 4NZVA 3IB8A 4LTYA 4I5LC 4MP0A 4DSYA 3E7BA 1Z2WA 4J6OA 3CK2A 2NPPC 2P6BA 2IE3C 4DT2A 4KKZA 4ZVZA 1NNWA 3IVDA 3QFOA 3H62B 3HVQA 4F0ZA 2YEQA 1UF3A 3QFNA 2USHA 1SU1A 1OIDA 4FBKA 3K7VC 5INBA 5GTUA 2NYMC 1G5BA 3IB7A 1W24A 1HO5A 5JPFA 2WDDA 1T71A 1XM7A 1S3MA 2HY1A 2R17A 2YVTA 1S70A 2IAEC 3H69A 3AUZA 1M63A 4DHLA 2Z72A 2JOGA 3K7WC 4FBWA 4O5GA 2DXLA 3H67A 1Z2XA 1USHA 3RL5A 5B8IA 4XPNA 3THNA 4V0XA 4V0VA 2DXNA 2BCDA 3P71C 4H2IA 2ZBMA 3DW8C 2O8GA 1V73A 1WARA 3RL4A 4I5NC 4ORBA 3AV0A 5JJTA 3QFKA 5C1VA 3ICFA 1T70A 1HP1A 1JK7A 4H1SA 1OIEA 3EGGA 2A22A 3DSCA 1KBPA 2CV9A 5DNYA 2WDEA 3PSNA 3TGHA 2O8AA 2WDFA 4O24A 4ORCA 3ZU0A 3H60A 3LL8A 2WDCA 2NXFA 3H64A 1QFCA 3FLOA 1XZWA 4LACC 2QFPA 2BQ8X 2KKNA 1TCOA 2NYLC 4JA9A 5EQVA 4UT2A 4G9JA 3GVEA 3C9FA 3JYFA 5IOHA 3H61A 4H2FA 5F3WA 3ZTVA 3PSOA 2IE4C 3RQZA 1IT6A 4ZX2A 2HYOA 2Z06A 1UTEA 4O43A 4YKEA 2Z1AA 2Q8UA 5J28A 3H68A 4UT3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFR A;  1QHW A;  4KBP A;  4Q7F A;  3RL3 A;  2AHD A;  1MF8 A;  3N5U A;  4O4K A;  4FBQ A;  4MOY A;  4JA7 A;  4B2O A;  4OR9 A;  3KBP A;  5JPE A;  3QFM A;  1S95 A;  4UWQ A;  5HPE A;  4V0W A;  1HPU A;  3H63 A;  3E7A A;  1FJM A;  4LU9 A;  4FCX A;  3DSD A;  4TUI A;  2HYP A;  4ORA A;  4TUG A;  4H1Y P;  4MOV A;  1II7 A;  2QJC A;  1S3L A;  3C5W C;  3EGH A;  2DFJ A;  4UT3 A;  3T1I A;  4M0V A;  1OI8 A;  1AUI A;  3H66 A;  3QG5 C;  4IYP C;  3THO B;  1U32 A;  1S8E A;  3FGA C;  4HD0 A;  4IL1 A;  2XMO A;  3V4Y A;  3IVE A;  4WWL A;  1S3N A;  1WAO 1;  2BDX A;  2GJU A;  4H2B A;  4H2G A;  4NZV A;  3IB8 A;  4LTY A;  4I5L C;  4MP0 A;  4DSY A;  3E7B A;  1Z2W A;  4J6O A;  3CK2 A;  2NPP C;  2P6B A;  2IE3 C;  4DT2 A;  4KKZ A;  4ZVZ A;  1NNW A;  3IVD A;  3QFO A;  3H62 B;  3HVQ A;  4F0Z A;  1UF3 A;  3QFN A;  2USH A;  1SU1 A;  1OID A;  4FBK A;  3K7V C;  5INB A;  5GTU A;  2NYM C;  1G5B A;  3IB7 A;  1W24 A;  1HO5 A;  5JPF A;  2WDD A;  1T71 A;  1XM7 A;  1S3M A;  2HY1 A;  2R17 A;  2YVT A;  1S70 A;  2IAE C;  3H69 A;  3AUZ A;  1M63 A;  4DHL A;  2Z72 A;  2JOG A;  3K7W C;  4FBW A;  4O5G A;  3H67 A;  1Z2X A;  1USH A;  3RL5 A;  5B8I A;  4XPN A;  3THN A;  4V0X A;  4V0V A;  2BCD A;  3P71 C;  4H2I A;  2ZBM A;  3DW8 C;  2O8G A;  1V73 A;  1WAR A;  3RL4 A;  4I5N C;  4ORB A;  3AV0 A;  5JJT A;  3QFK A;  5C1V A;  3ICF A;  1T70 A;  1HP1 A;  1JK7 A;  4H1S A;  1OIE A;  3EGG A;  2A22 A;  3DSC A;  1KBP A;  2CV9 A;  5DNY A;  2WDE A;  3PSN A;  3TGH A;  2O8A A;  2WDF A;  4O24 A;  4ORC A;  3ZU0 A;  3H60 A;  3LL8 A;  2WDC A;  2NXF A;  3H64 A;  1QFC A;  1XZW A;  4LAC C;  2QFP A;  2BQ8 X;  2KKN A;  1TCO A;  2NYL C;  4JA9 A;  5EQV A;  4UT2 A;  4G9J A;  3GVE A;  3C9F A;  3JYF A;  5IOH A;  3H61 A;  4H2F A;  5F3W A;  3ZTV A;  3PSO A;  2IE4 C;  3RQZ A;  1IT6 A;  4ZX2 A;  2HYO A;  2Z06 A;  1UTE A;  4O43 A;  4YKE A;  2Z1A A;  2Q8U A;  5J28 A;  3H68 A;  4UT3 B; 
#chains in the Genus database with same CATH topology
 2QFR A;  1QHW A;  4KBP A;  4Q7F A;  3RL3 A;  2AHD A;  1MF8 A;  3N5U A;  4O4K A;  4FBQ A;  4MOY A;  4JA7 A;  4B2O A;  4OR9 A;  3KBP A;  5JPE A;  3QFM A;  1S95 A;  4UWQ A;  5HPE A;  4V0W A;  1HPU A;  3H63 A;  3E7A A;  1FJM A;  2ZO9 B;  4LU9 A;  4FCX A;  3DSD A;  4TUI A;  2HYP A;  4ORA A;  4TUG A;  4H1Y P;  4MOV A;  1II7 A;  2QJC A;  1S3L A;  3C5W C;  2ZOA A;  3EGH A;  2DFJ A;  3E0J A;  4UT3 A;  3T1I A;  4M0V A;  1OI8 A;  1AUI A;  3H66 A;  3QG5 C;  4IYP C;  3THO B;  1U32 A;  1S8E A;  3FGA C;  4HD0 A;  4IL1 A;  2XMO A;  3D03 A;  3V4Y A;  3IVE A;  4WWL A;  1S3N A;  1WAO 1;  2BDX A;  2GJU A;  4H2B A;  4H2G A;  4NZV A;  3IB8 A;  4LTY A;  4I5L C;  4MP0 A;  4DSY A;  3E7B A;  1Z2W A;  4J6O A;  3CK2 A;  2NPP C;  2P6B A;  2IE3 C;  4DT2 A;  4KKZ A;  4ZVZ A;  1NNW A;  3IVD A;  3QFO A;  3H62 B;  3HVQ A;  4F0Z A;  2YEQ A;  1UF3 A;  3QFN A;  2USH A;  1SU1 A;  1OID A;  4FBK A;  3K7V C;  5INB A;  5GTU A;  2NYM C;  1G5B A;  3IB7 A;  1W24 A;  1HO5 A;  5JPF A;  2WDD A;  1T71 A;  1XM7 A;  1S3M A;  2HY1 A;  2R17 A;  2YVT A;  1S70 A;  2IAE C;  3H69 A;  3AUZ A;  1M63 A;  4DHL A;  2Z72 A;  2JOG A;  3K7W C;  4FBW A;  4O5G A;  2DXL A;  3H67 A;  1Z2X A;  1USH A;  3RL5 A;  5B8I A;  4XPN A;  3THN A;  4V0X A;  4V0V A;  2DXN A;  2BCD A;  3P71 C;  4H2I A;  2ZBM A;  3DW8 C;  2O8G A;  1V73 A;  1WAR A;  3RL4 A;  4I5N C;  4ORB A;  3AV0 A;  5JJT A;  3QFK A;  5C1V A;  3ICF A;  1T70 A;  1HP1 A;  1JK7 A;  4H1S A;  1OIE A;  3EGG A;  2A22 A;  3DSC A;  1KBP A;  2CV9 A;  5DNY A;  2WDE A;  3PSN A;  3TGH A;  2O8A A;  2WDF A;  4O24 A;  4ORC A;  3ZU0 A;  3H60 A;  3LL8 A;  2WDC A;  2NXF A;  3H64 A;  1QFC A;  3FLO A;  1XZW A;  4LAC C;  2QFP A;  2BQ8 X;  2KKN A;  1TCO A;  2NYL C;  4JA9 A;  5EQV A;  4UT2 A;  4G9J A;  3GVE A;  3C9F A;  3JYF A;  5IOH A;  3H61 A;  4H2F A;  5F3W A;  3ZTV A;  3PSO A;  2IE4 C;  3RQZ A;  1IT6 A;  4ZX2 A;  2HYO A;  2Z06 A;  1UTE A;  4O43 A;  4YKE A;  2Z1A A;  2Q8U A;  5J28 A;  3H68 A;  4UT3 B; 
#chains in the Genus database with same CATH homology
 2QFR A;  1QHW A;  4KBP A;  4Q7F A;  3RL3 A;  2AHD A;  1MF8 A;  3N5U A;  4O4K A;  4FBQ A;  4MOY A;  4JA7 A;  4B2O A;  4OR9 A;  3KBP A;  5JPE A;  3QFM A;  1S95 A;  4UWQ A;  5HPE A;  4V0W A;  1HPU A;  3H63 A;  3E7A A;  1FJM A;  2ZO9 B;  4LU9 A;  4FCX A;  3DSD A;  4TUI A;  2HYP A;  4ORA A;  4TUG A;  4H1Y P;  4MOV A;  1II7 A;  2QJC A;  1S3L A;  3C5W C;  2ZOA A;  3EGH A;  2DFJ A;  3E0J A;  4UT3 A;  3T1I A;  4M0V A;  1OI8 A;  1AUI A;  3H66 A;  3QG5 C;  4IYP C;  3THO B;  1U32 A;  1S8E A;  3FGA C;  4HD0 A;  4IL1 A;  2XMO A;  3D03 A;  3V4Y A;  3IVE A;  4WWL A;  1S3N A;  1WAO 1;  2BDX A;  2GJU A;  4H2B A;  4H2G A;  4NZV A;  3IB8 A;  4LTY A;  4I5L C;  4MP0 A;  4DSY A;  3E7B A;  1Z2W A;  4J6O A;  3CK2 A;  2NPP C;  2P6B A;  2IE3 C;  4DT2 A;  4KKZ A;  4ZVZ A;  1NNW A;  3IVD A;  3QFO A;  3H62 B;  3HVQ A;  4F0Z A;  2YEQ A;  1UF3 A;  3QFN A;  2USH A;  1SU1 A;  1OID A;  4FBK A;  3K7V C;  5INB A;  5GTU A;  2NYM C;  1G5B A;  3IB7 A;  1W24 A;  1HO5 A;  5JPF A;  2WDD A;  1T71 A;  1XM7 A;  1S3M A;  2HY1 A;  2R17 A;  2YVT A;  1S70 A;  2IAE C;  3H69 A;  3AUZ A;  1M63 A;  4DHL A;  2Z72 A;  2JOG A;  3K7W C;  4FBW A;  4O5G A;  2DXL A;  3H67 A;  1Z2X A;  1USH A;  3RL5 A;  5B8I A;  4XPN A;  3THN A;  4V0X A;  4V0V A;  2DXN A;  2BCD A;  3P71 C;  4H2I A;  2ZBM A;  3DW8 C;  2O8G A;  1V73 A;  1WAR A;  3RL4 A;  4I5N C;  4ORB A;  3AV0 A;  5JJT A;  3QFK A;  5C1V A;  3ICF A;  1T70 A;  1HP1 A;  1JK7 A;  4H1S A;  1OIE A;  3EGG A;  2A22 A;  3DSC A;  1KBP A;  2CV9 A;  5DNY A;  2WDE A;  3PSN A;  3TGH A;  2O8A A;  2WDF A;  4O24 A;  4ORC A;  3ZU0 A;  3H60 A;  3LL8 A;  2WDC A;  2NXF A;  3H64 A;  1QFC A;  3FLO A;  1XZW A;  4LAC C;  2QFP A;  2BQ8 X;  2KKN A;  1TCO A;  2NYL C;  4JA9 A;  5EQV A;  4UT2 A;  4G9J A;  3GVE A;  3C9F A;  3JYF A;  5IOH A;  3H61 A;  4H2F A;  5F3W A;  3ZTV A;  3PSO A;  2IE4 C;  3RQZ A;  1IT6 A;  4ZX2 A;  2HYO A;  2Z06 A;  1UTE A;  4O43 A;  4YKE A;  2Z1A A;  2Q8U A;  5J28 A;  3H68 A;  4UT3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...