2O8AA

Rat pp1cgamma complexed with mouse inhibitor-2
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
295
structure length
295
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of protein phosphatase 1 by inhibitor-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 112
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2o8aA00
2O8AA 4ZX2A 3N5UA 2HYPA 2NPPC 2YVTA 3DSDA 3PSNA 4FBQA 4DT2A 3EGHA 5J28A 4G9JA 2Q8UA 4H1SA 3H64A 2HY1A 4B2OA 3QFNA 3FGAC 4O5GA 2QJCA 4H1YP 3C5WC 1S3NA 1XM7A 1AUIA 4OR9A 4NZVA 1HO5A 3H69A 3JYFA 3H60A 3THOB 2ZBMA 3TGHA 4O4KA 1FJMA 3ICFA 2BDXA 4LACC 2NYMC 3RQZA 3THNA 2CV9A 3E7AA 2WDEA 2R17A 4H2GA 1TCOA 3T1IA 4MOYA 5IOHA 2WDFA 1OIDA 2Z72A 5INBA 2WDCA 3IVDA 4J6OA 2AHDA 2KKNA 4HD0A 4TUGA 4M0VA 4ORAA 4I5LC 3CK2A 2DFJA 2IE3C 3H66A 3K7WC 4KBPA 1II7A 4LTYA 1MF8A 2WDDA 1IT6A 4ORBA 4O43A 3V4YA 4H2BA 4TUIA 3H62B 1Z2WA 2O8GA 4MP0A 4IL1A 1QFCA 5JJTA 3H61A 1T70A 3QFKA 3C9FA 2NXFA 4H2IA 3RL3A 4XPNA 4FCXA 1S70A 2Z1AA 2HYOA 4O24A 3K7VC 3ZU0A 1UTEA 4V0WA 4KKZA 2BCDA 2QFPA 1KBPA 2BQ8X 3E7BA 3H63A 5EQVA 1S8EA 3DW8C 3AUZA 4FBWA 4F0ZA 2A22A 4JA7A 4MOVA 3LL8A 2NYLC 4WWLA 1S95A 4DSYA 4V0VA 4UT3A 1M63A 4I5NC 3H68A 3P71C 1Z2XA 2XMOA 3IVEA 4JA9A 4UT3B 4ZVZA 4ORCA 1U32A 1XZWA 2IAEC 2QFRA 3HVQA 2Z06A 4UT2A 3QFMA 5DNYA 1T71A 4H2FA 1OI8A 1USHA 5HPEA 1OIEA 2JOGA 3H67A 3ZTVA 1SU1A 4Q7FA 3IB8A 3KBPA 4IYPC 4DHLA 3DSCA 1NNWA 4UWQA 1W24A 5F3WA 3RL5A 5JPEA 5C1VA 2IE4C 4FBKA 1UF3A 1WAO1 1JK7A 4V0XA 1V73A 1HP1A 3QFOA 5B8IA 3RL4A 3EGGA 5JPFA 2P6BA 1S3MA 2GJUA 3AV0A 1S3LA 1G5BA 1QHWA 1WARA 4LU9A 3PSOA 1HPUA 2USHA 3GVEA 3IB7A 5GTUA 3QG5C 4YKEA
chains in the Genus database with same CATH superfamily
2O8AA 4ZX2A 3N5UA 2HYPA 2NPPC 2YVTA 3DSDA 3PSNA 4FBQA 4DT2A 3EGHA 2DXLA 5J28A 4G9JA 2Q8UA 4H1SA 3H64A 2HY1A 4B2OA 3QFNA 3FGAC 4O5GA 2DXNA 2QJCA 4H1YP 3C5WC 1S3NA 1XM7A 1AUIA 4OR9A 4NZVA 1HO5A 3H69A 3JYFA 3H60A 3THOB 2ZBMA 2ZO9B 3TGHA 4O4KA 1FJMA 3ICFA 2BDXA 4LACC 2NYMC 3RQZA 3THNA 2CV9A 3E7AA 2WDEA 2R17A 4H2GA 1TCOA 3T1IA 4MOYA 5IOHA 2WDFA 1OIDA 2Z72A 5INBA 2WDCA 3IVDA 4J6OA 2AHDA 2KKNA 4HD0A 4TUGA 4M0VA 4ORAA 4I5LC 3CK2A 2DFJA 3FLOA 2IE3C 3H66A 3K7WC 4KBPA 1II7A 4LTYA 1MF8A 2WDDA 1IT6A 4ORBA 4O43A 3V4YA 4H2BA 4TUIA 3H62B 1Z2WA 2O8GA 4MP0A 4IL1A 1QFCA 5JJTA 3H61A 1T70A 3QFKA 3C9FA 2NXFA 4H2IA 3RL3A 4XPNA 4FCXA 1S70A 2Z1AA 2HYOA 4O24A 3K7VC 3ZU0A 1UTEA 4V0WA 4KKZA 2BCDA 2QFPA 1KBPA 2BQ8X 3E7BA 3H63A 5EQVA 1S8EA 3DW8C 3AUZA 4FBWA 4F0ZA 2A22A 4JA7A 4MOVA 3LL8A 2NYLC 4WWLA 1S95A 4DSYA 4V0VA 4UT3A 1M63A 4I5NC 3H68A 3P71C 1Z2XA 2XMOA 3IVEA 4JA9A 4UT3B 4ZVZA 4ORCA 1U32A 1XZWA 2IAEC 2QFRA 3E0JA 2Z06A 3HVQA 4UT2A 3QFMA 5DNYA 1T71A 4H2FA 1OI8A 1USHA 5HPEA 1OIEA 2JOGA 3H67A 3ZTVA 3D03A 1SU1A 4Q7FA 3IB8A 3KBPA 4IYPC 4DHLA 3DSCA 1NNWA 4UWQA 1W24A 5F3WA 3RL5A 5JPEA 5C1VA 2IE4C 4FBKA 1UF3A 1WAO1 1JK7A 4V0XA 1V73A 1HP1A 3QFOA 2YEQA 3RL4A 5B8IA 2ZOAA 3EGGA 5JPFA 2P6BA 1S3MA 2GJUA 3AV0A 1S3LA 1G5BA 1QHWA 1WARA 4LU9A 3PSOA 1HPUA 2USHA 3GVEA 3IB7A 5GTUA 3QG5C 4YKEA
chains in the Genus database with same CATH topology
2O8AA 4ZX2A 3N5UA 2HYPA 2NPPC 2YVTA 3DSDA 3PSNA 4FBQA 4DT2A 3EGHA 2DXLA 5J28A 4G9JA 2Q8UA 4H1SA 3H64A 2HY1A 4B2OA 3QFNA 3FGAC 4O5GA 2DXNA 2QJCA 4H1YP 3C5WC 1S3NA 1XM7A 1AUIA 4OR9A 4NZVA 1HO5A 3H69A 3JYFA 3H60A 3THOB 2ZBMA 2ZO9B 3TGHA 4O4KA 1FJMA 3ICFA 2BDXA 4LACC 2NYMC 3RQZA 3THNA 2CV9A 3E7AA 2WDEA 2R17A 4H2GA 1TCOA 3T1IA 4MOYA 5IOHA 2WDFA 1OIDA 2Z72A 5INBA 2WDCA 3IVDA 4J6OA 2AHDA 2KKNA 4HD0A 4TUGA 4M0VA 4ORAA 4I5LC 3CK2A 2DFJA 3FLOA 2IE3C 3H66A 3K7WC 4KBPA 1II7A 4LTYA 1MF8A 2WDDA 1IT6A 4ORBA 4O43A 3V4YA 4H2BA 4TUIA 3H62B 1Z2WA 2O8GA 4MP0A 4IL1A 1QFCA 5JJTA 3H61A 1T70A 3QFKA 3C9FA 2NXFA 4H2IA 3RL3A 4XPNA 4FCXA 1S70A 2Z1AA 2HYOA 4O24A 3K7VC 3ZU0A 1UTEA 4V0WA 4KKZA 2BCDA 2QFPA 1KBPA 2BQ8X 3E7BA 3H63A 5EQVA 1S8EA 3DW8C 3AUZA 4FBWA 4F0ZA 2A22A 4JA7A 4MOVA 3LL8A 2NYLC 4WWLA 1S95A 4DSYA 4V0VA 4UT3A 1M63A 4I5NC 3H68A 3P71C 1Z2XA 2XMOA 3IVEA 4JA9A 4UT3B 4ZVZA 4ORCA 1U32A 1XZWA 2IAEC 2QFRA 3E0JA 2Z06A 3HVQA 4UT2A 3QFMA 5DNYA 1T71A 4H2FA 1OI8A 1USHA 5HPEA 1OIEA 2JOGA 3H67A 3ZTVA 3D03A 1SU1A 4Q7FA 3IB8A 3KBPA 4IYPC 4DHLA 3DSCA 1NNWA 4UWQA 1W24A 5F3WA 3RL5A 5JPEA 5C1VA 2IE4C 4FBKA 1UF3A 1WAO1 1JK7A 4V0XA 1V73A 1HP1A 3QFOA 2YEQA 3RL4A 5B8IA 2ZOAA 3EGGA 5JPFA 2P6BA 1S3MA 2GJUA 3AV0A 1S3LA 1G5BA 1QHWA 1WARA 4LU9A 3PSOA 1HPUA 2USHA 3GVEA 3IB7A 5GTUA 3QG5C 4YKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8A A;  4ZX2 A;  3N5U A;  2HYP A;  2NPP C;  2YVT A;  3DSD A;  3PSN A;  4FBQ A;  4DT2 A;  3EGH A;  5J28 A;  4G9J A;  2Q8U A;  4H1S A;  3H64 A;  2HY1 A;  4B2O A;  3QFN A;  3FGA C;  4O5G A;  2QJC A;  4H1Y P;  3C5W C;  1S3N A;  1XM7 A;  1AUI A;  4OR9 A;  4NZV A;  1HO5 A;  3H69 A;  3JYF A;  3H60 A;  3THO B;  2ZBM A;  3TGH A;  4O4K A;  1FJM A;  3ICF A;  2BDX A;  4LAC C;  2NYM C;  3RQZ A;  3THN A;  2CV9 A;  3E7A A;  2WDE A;  2R17 A;  4H2G A;  1TCO A;  3T1I A;  4MOY A;  5IOH A;  2WDF A;  1OID A;  2Z72 A;  5INB A;  2WDC A;  3IVD A;  4J6O A;  2AHD A;  2KKN A;  4HD0 A;  4TUG A;  4M0V A;  4ORA A;  4I5L C;  3CK2 A;  2DFJ A;  2IE3 C;  3H66 A;  3K7W C;  4KBP A;  1II7 A;  4LTY A;  1MF8 A;  2WDD A;  1IT6 A;  4ORB A;  4O43 A;  3V4Y A;  4H2B A;  4TUI A;  3H62 B;  1Z2W A;  2O8G A;  4MP0 A;  4IL1 A;  1QFC A;  5JJT A;  3H61 A;  1T70 A;  3QFK A;  3C9F A;  2NXF A;  4H2I A;  3RL3 A;  4XPN A;  4FCX A;  1S70 A;  2Z1A A;  2HYO A;  4O24 A;  3K7V C;  3ZU0 A;  1UTE A;  4V0W A;  4KKZ A;  2BCD A;  2QFP A;  1KBP A;  2BQ8 X;  3E7B A;  3H63 A;  5EQV A;  1S8E A;  3DW8 C;  3AUZ A;  4FBW A;  4F0Z A;  2A22 A;  4JA7 A;  4MOV A;  3LL8 A;  2NYL C;  4WWL A;  1S95 A;  4DSY A;  4V0V A;  4UT3 A;  1M63 A;  4I5N C;  3H68 A;  3P71 C;  1Z2X A;  2XMO A;  3IVE A;  4JA9 A;  4UT3 B;  4ZVZ A;  4ORC A;  1U32 A;  1XZW A;  2IAE C;  2QFR A;  3HVQ A;  2Z06 A;  4UT2 A;  3QFM A;  5DNY A;  1T71 A;  4H2F A;  1OI8 A;  1USH A;  5HPE A;  1OIE A;  2JOG A;  3H67 A;  3ZTV A;  1SU1 A;  4Q7F A;  3IB8 A;  3KBP A;  4IYP C;  4DHL A;  3DSC A;  1NNW A;  4UWQ A;  1W24 A;  5F3W A;  3RL5 A;  5JPE A;  5C1V A;  2IE4 C;  4FBK A;  1UF3 A;  1WAO 1;  1JK7 A;  4V0X A;  1V73 A;  1HP1 A;  3QFO A;  5B8I A;  3RL4 A;  3EGG A;  5JPF A;  2P6B A;  1S3M A;  2GJU A;  3AV0 A;  1S3L A;  1G5B A;  1QHW A;  1WAR A;  4LU9 A;  3PSO A;  1HPU A;  2USH A;  3GVE A;  3IB7 A;  5GTU A;  3QG5 C;  4YKE A; 
#chains in the Genus database with same CATH topology
 2O8A A;  4ZX2 A;  3N5U A;  2HYP A;  2NPP C;  2YVT A;  3DSD A;  3PSN A;  4FBQ A;  4DT2 A;  3EGH A;  2DXL A;  5J28 A;  4G9J A;  2Q8U A;  4H1S A;  3H64 A;  2HY1 A;  4B2O A;  3QFN A;  3FGA C;  4O5G A;  2DXN A;  2QJC A;  4H1Y P;  3C5W C;  1S3N A;  1XM7 A;  1AUI A;  4OR9 A;  4NZV A;  1HO5 A;  3H69 A;  3JYF A;  3H60 A;  3THO B;  2ZBM A;  2ZO9 B;  3TGH A;  4O4K A;  1FJM A;  3ICF A;  2BDX A;  4LAC C;  2NYM C;  3RQZ A;  3THN A;  2CV9 A;  3E7A A;  2WDE A;  2R17 A;  4H2G A;  1TCO A;  3T1I A;  4MOY A;  5IOH A;  2WDF A;  1OID A;  2Z72 A;  5INB A;  2WDC A;  3IVD A;  4J6O A;  2AHD A;  2KKN A;  4HD0 A;  4TUG A;  4M0V A;  4ORA A;  4I5L C;  3CK2 A;  2DFJ A;  3FLO A;  2IE3 C;  3H66 A;  3K7W C;  4KBP A;  1II7 A;  4LTY A;  1MF8 A;  2WDD A;  1IT6 A;  4ORB A;  4O43 A;  3V4Y A;  4H2B A;  4TUI A;  3H62 B;  1Z2W A;  2O8G A;  4MP0 A;  4IL1 A;  1QFC A;  5JJT A;  3H61 A;  1T70 A;  3QFK A;  3C9F A;  2NXF A;  4H2I A;  3RL3 A;  4XPN A;  4FCX A;  1S70 A;  2Z1A A;  2HYO A;  4O24 A;  3K7V C;  3ZU0 A;  1UTE A;  4V0W A;  4KKZ A;  2BCD A;  2QFP A;  1KBP A;  2BQ8 X;  3E7B A;  3H63 A;  5EQV A;  1S8E A;  3DW8 C;  3AUZ A;  4FBW A;  4F0Z A;  2A22 A;  4JA7 A;  4MOV A;  3LL8 A;  2NYL C;  4WWL A;  1S95 A;  4DSY A;  4V0V A;  4UT3 A;  1M63 A;  4I5N C;  3H68 A;  3P71 C;  1Z2X A;  2XMO A;  3IVE A;  4JA9 A;  4UT3 B;  4ZVZ A;  4ORC A;  1U32 A;  1XZW A;  2IAE C;  2QFR A;  3E0J A;  2Z06 A;  3HVQ A;  4UT2 A;  3QFM A;  5DNY A;  1T71 A;  4H2F A;  1OI8 A;  1USH A;  5HPE A;  1OIE A;  2JOG A;  3H67 A;  3ZTV A;  3D03 A;  1SU1 A;  4Q7F A;  3IB8 A;  3KBP A;  4IYP C;  4DHL A;  3DSC A;  1NNW A;  4UWQ A;  1W24 A;  5F3W A;  3RL5 A;  5JPE A;  5C1V A;  2IE4 C;  4FBK A;  1UF3 A;  1WAO 1;  1JK7 A;  4V0X A;  1V73 A;  1HP1 A;  3QFO A;  2YEQ A;  3RL4 A;  5B8I A;  2ZOA A;  3EGG A;  5JPF A;  2P6B A;  1S3M A;  2GJU A;  3AV0 A;  1S3L A;  1G5B A;  1QHW A;  1WAR A;  4LU9 A;  3PSO A;  1HPU A;  2USH A;  3GVE A;  3IB7 A;  5GTU A;  3QG5 C;  4YKE A; 
#chains in the Genus database with same CATH homology
 2O8A A;  4ZX2 A;  3N5U A;  2HYP A;  2NPP C;  2YVT A;  3DSD A;  3PSN A;  4FBQ A;  4DT2 A;  3EGH A;  2DXL A;  5J28 A;  4G9J A;  2Q8U A;  4H1S A;  3H64 A;  2HY1 A;  4B2O A;  3QFN A;  3FGA C;  4O5G A;  2DXN A;  2QJC A;  4H1Y P;  3C5W C;  1S3N A;  1XM7 A;  1AUI A;  4OR9 A;  4NZV A;  1HO5 A;  3H69 A;  3JYF A;  3H60 A;  3THO B;  2ZBM A;  2ZO9 B;  3TGH A;  4O4K A;  1FJM A;  3ICF A;  2BDX A;  4LAC C;  2NYM C;  3RQZ A;  3THN A;  2CV9 A;  3E7A A;  2WDE A;  2R17 A;  4H2G A;  1TCO A;  3T1I A;  4MOY A;  5IOH A;  2WDF A;  1OID A;  2Z72 A;  5INB A;  2WDC A;  3IVD A;  4J6O A;  2AHD A;  2KKN A;  4HD0 A;  4TUG A;  4M0V A;  4ORA A;  4I5L C;  3CK2 A;  2DFJ A;  3FLO A;  2IE3 C;  3H66 A;  3K7W C;  4KBP A;  1II7 A;  4LTY A;  1MF8 A;  2WDD A;  1IT6 A;  4ORB A;  4O43 A;  3V4Y A;  4H2B A;  4TUI A;  3H62 B;  1Z2W A;  2O8G A;  4MP0 A;  4IL1 A;  1QFC A;  5JJT A;  3H61 A;  1T70 A;  3QFK A;  3C9F A;  2NXF A;  4H2I A;  3RL3 A;  4XPN A;  4FCX A;  1S70 A;  2Z1A A;  2HYO A;  4O24 A;  3K7V C;  3ZU0 A;  1UTE A;  4V0W A;  4KKZ A;  2BCD A;  2QFP A;  1KBP A;  2BQ8 X;  3E7B A;  3H63 A;  5EQV A;  1S8E A;  3DW8 C;  3AUZ A;  4FBW A;  4F0Z A;  2A22 A;  4JA7 A;  4MOV A;  3LL8 A;  2NYL C;  4WWL A;  1S95 A;  4DSY A;  4V0V A;  4UT3 A;  1M63 A;  4I5N C;  3H68 A;  3P71 C;  1Z2X A;  2XMO A;  3IVE A;  4JA9 A;  4UT3 B;  4ZVZ A;  4ORC A;  1U32 A;  1XZW A;  2IAE C;  2QFR A;  3E0J A;  2Z06 A;  3HVQ A;  4UT2 A;  3QFM A;  5DNY A;  1T71 A;  4H2F A;  1OI8 A;  1USH A;  5HPE A;  1OIE A;  2JOG A;  3H67 A;  3ZTV A;  3D03 A;  1SU1 A;  4Q7F A;  3IB8 A;  3KBP A;  4IYP C;  4DHL A;  3DSC A;  1NNW A;  4UWQ A;  1W24 A;  5F3W A;  3RL5 A;  5JPE A;  5C1V A;  2IE4 C;  4FBK A;  1UF3 A;  1WAO 1;  1JK7 A;  4V0X A;  1V73 A;  1HP1 A;  3QFO A;  2YEQ A;  3RL4 A;  5B8I A;  2ZOA A;  3EGG A;  5JPF A;  2P6B A;  1S3M A;  2GJU A;  3AV0 A;  1S3L A;  1G5B A;  1QHW A;  1WAR A;  4LU9 A;  3PSO A;  1HPU A;  2USH A;  3GVE A;  3IB7 A;  5GTU A;  3QG5 C;  4YKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...