2O8KA

Nmr structure of the sigma-54 rpon domain bound to the-24 promoter element
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
HMLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSRERRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DNA recognition by the alternative sigma-factor, sigma54.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*TP*TP*TP*GP*GP*CP*AP*CP*GP*TP*TP*TP*C)-3'
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2o8kA01
1OJLA 3IH3A 4FCYA 1HLVA 2O9LA 3HOUJ 1U78A 5EG0A 1PUFA 2XRLA 2NS8A 2CUEA 2NVTJ 3S1RJ 1ETWA 1POGA 1NK2P 2MW8A 1FEXA 3G1MA 2TRTA 3BG9A 3CCYA 2DA1A 4Y52J 1TWGJ 3L1PA 3DEWA 1HDDC 1W0TA 1A5JA 2DA5A 5F1JA 4A3FJ 4IHYA 3HOVJ 2AHQA 2DJNA 3BR6A 1LFUP 1RESA 1MBKA 4HNVA 1XG1A 3HGYA 5DS9A 2E19A 5EGOA 3K2AA 5FKNA 3F0CA 4MFEA 2R5YA 4M3BA 2HXOA 1WPKA 2NVXJ 3HOXJ 1RPWA 3ZQLA 2M0CA 2HQ5A 5EDNA 3Q0WA 2TCTA 3K7AJ 1ZQ3P 2R5ZB 4J19A 1ETVA 1QVTA 3SDGA 2ME6A 3IH2A 4C2MJ 5K7FA 4MFDA 2GM4A 4X6AJ 1W0UA 3LSJA 2YU9J 4D7MA 3FK6A 3JRGA 3JRBA 4JYKA 1Y1WJ 4G12A 3G1LA 4M3EA 2HXIA 1Z0XA 2ECBA 3HOWJ 1FTTA 3ZQFA 3GBGA 4L5EA 3MVPA 2XPWA 3TW7A 4DZPA 2E2HJ 4RBOA 3BG3A 5GPAA 3JRHA 1H89C 2XPVA 2DA2A 3BTCA 2NS7A 3GTQJ 1XS9A 5EGOB 3A03A 2O8KA 1OFCX 1BA5A 3LSGA 4LOCA 2R5YB 1TWCJ 1LE8A 2EZLA 1JUSA 4S0HB 4A3MJ 3LSPA 4MLOA 2Y30A 4A3CJ 1GV5A 4FE7A 3QQAA 1FTZA 3FKIJ 3MN2A 3Q0UA 1IDZA 1AKHB 4Y7NJ 2ID6A 1FIPA 4A3DJ 3GTJJ 2FX0A 1SANA 3W6VA 2JA7J 2KDZA 5C4JJ 4A3GJ 5HODA 1VF9A 5IYDJ 1P7IA 3HOYJ 5IOZA 2OPTA 4FTHA 1WH7A 4BY7J 1X2MA 1GVDA 1UMQA 2L7MP 5IP9J 3JR9A 4DZJA 4A3KJ 3IH4A 3OSGA 1RR7A 4JX4A 3NAUA 5IPAA 3BG5A 5J1YA 4BKXA 4QTRA 1A6IA 1ETQA 2HOTA 5K7ZA 4D7NA 5F27A 3JRDA 3BR2A 1MBHA 3I4MJ 1JKPC 1IRZA 3Q0VA 3TW6A 1T56A 4DW6A 1AKHA 2JA6J 1WI3A 4M3DA 1MH3A 2W48A 2XB5A 5EZGA 1YRNA 3S2HJ 5EZHA 4A3BJ 4FE4A 5GPCA 1H88C 4BXXJ 1Z77A 2DMQA 3FISA 2HOAA 2DA4A 2ID3A 2R5ZA 1LFBA 2DMPA 2NOGA 4RDUA 4A3LJ 2YUSA 2D5VA 2EQRA 1RETA 3GTPJ 2CU7A 4I6ZA 5FJ8J 1XC5A 4AUXA 1JT0A 2K9SA 2OF7A 4ABZA 3ZOBA 4IHVA 4W1UA 1MSFC 2IEKA 1TWHJ 1IC8A 3HBLA 2JJ7A 2WB1N 2K9QA 1IV6A 3JRAA 2ME0A 3LOCA 5F08A 2X6OA 3LSRA 1BL0A 4IEJA 5JLXA 3BR1A 3OSFA 2CJJA 2YS9A 4V2FA 3S14J 1MBGA 2Y31A 1EF4A 2WV1A 5JLWA 4X1EA 5DTDA 4C3JJ 3HOZJ 1IGNA 5F0FA 1VNDA 1NK3P 5M5XJ 2LR8A 1H8AC 5FLVA 1JTYA 3ZQIA 4V2GA 3CMYA 1GV2A 2H8RA 5E3MA 4MO7A 2DMUA 3B6CA 4I76A 3UKGA 2XSDC 1U8BA 1ZTRA 3HM5A 3CDLA 3JRCA 4M6VA 4DYRA 1APLC 2X9DA 2M2EA 2CQQA 3MKLA 5EEAA 2DTZA 4B3AA 1OCTC 4A93J 1T33A 1HOMA 2LFBA 4JX6A 5EYRA 9ANTA 2NVQJ 1OCPA 2VKVA 1QRYA 2FJ1A 1E3OC 5FKKA 3VPRA 1AU7A 5E3LA 4W97A 5EG0B 5C3EJ 2XPUA 5BNGA 1CQTA 2LK2A 2DMNA 5C4XJ 1UG2A 1IUFA 1UHSA 1ZK8A 2HYJA 3SFIA 3BTLA 4B1RA 3BTJA 4C3HJ 1TWFJ 2E2IJ 2N8GA 3I4NJ 1JKQC 1MH4A 1ETOA 5GP9A 1BW5A 1ENHA 3GTKJ 3S1QJ 2ELKA 3HGGA 4QSHA 3TP3A 1TC3C 1B8IA 2VI6A 1ITYA 1K83J 2R93J 1GUUA 2VKEA 4JP0A 4BY1J 2HI3A 3Q3SA 4IHWA 1U9NA 3GTGJ 2L7ZA 2XGDA 2M8GX 3A01A 3HKZN 2L0KA 3GTMJ 2GBYA 4M3FA 3BR5A 2P81A 5F0CA 3QPLA 4MIMA 2B63J 2Y9ZA 1ETYA 3NARA 3FIWA 1VFCA 2WAQN 3TEDA 1IJWC 4FISA 3H0GJ 2XGEA 5M3MJ 1JGGA 2EBIA 5IYCJ 3C2BA 4BBRJ 3HB9A 4XRSG 1DU0A 1IG7A 4UUSB 1SFOJ 4D5FA 2M9HA 2LTPA 2R0QC 1ZR2A 2HOSA 1MBEA 1JKOC 4NDLA 1HDPA 1BJZA 1QVUA 1RKWA 1JUMA 2QF7A 2RAEA 4M3GA 4DYQA 2FD5A 1MNMC 5M3FJ 1B8IB 1U9OA 4BBSJ 1ZR4A 1TWAJ 2M34A 1GDTA 3IV5A 3TP0A 2CRGA 5M5YJ 1HCRA 2GLOA 1G2HA 4AC0A 1QPIA 5E3OA 3BQZA 4IHXA 1JUPA 2VUMJ 3A01B 2H1KA 2JN6A 5M5WJ 1MBJA 1S7EA 3PO2J 1Y1VJ 4XRSA 1O4XA 1WH5A 2E1OA 4CYCB 2QCOA 3S2DJ 1AHDP 2CUFA 2EH3A 3SJMA 1PUFB 2ZB9A 1X2NA 4A69C 1BW6A 5J1UA 3WHBA 3S1NJ 1F43A 1JTXA 5FKMA 3O8HA 5EF6A 3RZOJ 5IOYA 3B6AA 4UUSA 1R9TJ 2R7ZJ 4XICA 2HDDA 2Y2ZA 2EZHA 2DN0A 3GTOJ 3BT9A 5F0HA 3A02A 3RZDJ 1NTCA 1ETKA 2LKXA 2PMZN 3M4OJ 1B72B 1HF0A 2K40A 1WCMJ 2CQXA 1JKRC 3S17J 2E2JJ 3QPSA 3RQIA 2LP0A 5IP6A 2L7FP 2JA8J 1IDYA 3BR3A 2JK3A 5K7HA 3GTLJ 1ZGWA 1DU6A 4XRMA 2IBDA 4QIWN 1I6HJ 1JT6A 4DYCA 4CYCA 1YRNB 2JWTA 2IAIA 2MGQA 1JJ6C 4UUTA 3BQYA 2XGCA 1D5YA 3JRIA 2VPRA 2Y0SN 1I3QJ 2LY9A 3H3VK 1P7JA 3CQZJ 3RKQA 1ETXA 1JJ8C 3HEFA 1X58A 3ZQHA 1MBFA 4D5CA 1VI0A 3JREA 3LNQA 2JMWA 2MG4A 2XB0X 3S1MJ 2LLKA 2KT0A 4A3JJ 2DA3A 4C3IJ 3ZQCA 3PM1A 1F36A 2K9NA 3PO3J 1B72A 2LVSA 1FIAA 2MSYA 2NVYJ 4A3IJ 1LE8B 1FJLA 1GT0C 5C44J 1RKTA 2X48A 3S16J 3OOUA 5FKLA 5E3NA 4AYBN 1I50J 4GFBA 2DA6A 3BR0A 2EZKA 4EEFG 2DMTA 5IP7J 3JRFA 2JA5J 1MSEC 2G0EA 3BTIA 3G1OA 4XIDA 4JX5A 3DCFA 5IYBJ 3HDDA 1WGXA 3OIOA 3WHCA 3E7LA 4A3EJ 5J1RA 2DA7A 3S15J 4XK4A 2ECCA 4B4CA 2I10A 2Y9YA 5J3LA 3M3YJ 2FQ4A 5FKOA 1Q1VA 2L9RA 2O7OA 5FLMJ 1K61A 3FK7A 1ZKGA 2AO9A 2EZIA 2R92J 3ZQGA 5F04A 3O8GA 3D1NI 2COBA 2LD5A 1ORKA
chains in the Genus database with same CATH superfamily
1HLVA 2DW4A 1PUFA 4M74A 1K6YA 1HSTA 2K85A 2IA2A 3E6DA 5E18F 1T8IA 3PNVA 4LG0A 3FXUA 1POGA 2MW8A 1FEXA 2LOOA 2FU4A 3CCYA 4ZTFA 3DEWA 5F1JA 4II3A 2AQFA 2DJNA 5TISC 2CFOA 1LFUP 5IY5H 2LNBA 2XDVA 1Z05A 1LUJB 1QHHD 1WRJA 3K2AA 2OZ6A 2AS5F 1VQPI 4KISA 2R5YA 4E7SA 5AONA 1J09A 1RPWA 5F1RA 1S5LC 2M0CA 3ZQLA 3GX4X 3MAJA 3LA2A 2TCTA 4N9IA 2GA2A 3NRVA 2R5ZB 4M6YA 3C3WA 2XAQA 1P4AA 2KMUA 3IH2A 4MFDA 1SMYF 4X0GA 1PJRA 1FOKA 4P55A 1W0UA 4BQOA 1T98A 3IRRA 3LSJA 2LDUA 2CW8A 3O6BB 5HLTA 5ILVA 2O6GE 3I5UA 4HG2A 4MTDA 1D1CA 3UNGC 4PZJA 1OCZH 3DTKA 2EB7A 1BR4A 1Y1WJ 3ZMDA 4G12A 1K4SA 1W1WE 1B6AA 1ZGAA 3CUQC 3HOWJ 1YI2I 4LIVA 2H1LA 3BG6A 3GBGA 2MD0A 3MVPA 2LC2A 5D4SA 2HKXA 2HU9A 3FBIB 3TMOA 4BU2A 1FSHA 3RJPA 4IKFA 4RMNA 3L2UA 4RAFA 5L3CA 4RGXA 4BUPA 3CUOA 3OYLA 1LVKA 4CZZA 6PAXA 2F5EA 1U3EM 1OFCX 2PMZA 5AIQA 3U21A 3HUGB 2EZLA 4BL0B 2F5FA 5H6RA 3AG1H 2Y30A 3TOBA 3IP4B 4N0BA 4UB8C 2RNJA 3A2KA 2HDCA 1D5VA 1IDZA 4UY8I 2QQBA 1W36C 2DQRA 3CZ6A 4A3DJ 1D1BA 2J5OA 4XBFA 4JBAA 3GTJJ 2FNPA 2QLZA 3W6JB 2DYRH 1HKSA 2MD5A 2DQLA 2HPMA 5IYDJ 5IOZA 4G7OF 2CYYA 4U7BA 3CESA 2ZSIB 1WH7A 4BY7J 1X2MA 2XSJC 3L7WA 4ZYAA 1GVDA 1UMQA 4HF0A 5DDGA 3K70D 2ZJQF 1KU7A 3I3LA 1X3WB 4BQNA 2M1BA 1KQ0A 2VODA 5LRRA 3KLOA 1EA3A 2ISZA 3KP4A 2K3PA 1X3UA 4G6DA 3GEZA 5J1YA 2P6SA 3QYEA 4BKXA 1MGTA 3I55I 3I59A 5A2QZ 1QNTA 4D7NA 4RS8A 1WVRA 1XSXA 4U0YA 1B9NA 3JRDA 1IUYA 2PJRA 3HRTA 2E1MB 2JA2A 3BR2A 4KT6A 1G3WA 3HTUA 4RGSA 1OLTA 2UUZA 1YJNI 2HWVA 5LHIA 3IL2A 4M3DA 1YRNA 1D0XA 1IXSB 5EZGA 3S2HJ 2V6EA 2DMQA 3FISA 2XAFA 4XSXF 2DA4A 1R36A 2FRHA 3K10A 3WTSC 1U5TC 4RDUA 2L9VA 2DT7B 4RAYA 4A3LJ 4EM0B 5CVJA 5ICGA 4HF2A 1O3TA 1DPUA 1USSA 2EPFA 3I4PA 2JSPA 4KDPA 3F8NA 4NB5A 2PJPA 2EFQA 4W1UA 3GWZA 4YG2F 4D9JA 4E7KA 2RDPA 4CA0A 1IC8A 1LEAA 3K70C 2DK8A 2FF4A 2WADA 2X1EA 2E1NA 5L3FA 2DLLA 2COMA 3BPXA 3LSKA 2EV5A 2O0YA 2QYOA 2KRFA 2W57A 1IN4A 4V2FA 3S14J 2Y31A 2KRHA 1FLIA 3LSTA 3HOZJ 1LFPA 3LWFA 2RKHA 1JHFA 4EJWA 3OR2C 5F0FA 3H5NA 2MLGA 1HW2A 2LR8A 3F21A 5FLVA 4G94A 3ZQIA 1N78A 1GV2A 3CLQA 2DMUA 3B6CA 3WG9A 1D0YA 5J8FA 3UKGA 2LKSA 2OV7A 5ED4A 2KL4A 4CXFA 4IXAA 4DYRA 2XV4S 2FBKA 1ZYRF 2HNHA 4PSWA 3MKLA 1D1AA 2LFBA 9ANTA 4XRFA 1VQ4I 2V1UA 1OCOH 4G7ZF 2YR2A 1MMAA 2L02A 2NVQJ 3FXLA 3V8LA 1BR2A 1UZCA 4XLEA 5J8CA 5D5WB 3VPRA 2PFBA 4F55A 4XLHA 2DOFA 2WAEA 3TO6A 4CH7A 1XCVA 1IUFA 1FYKA 2ZJRF 3OL3A 3BTLA 3KIOA 1J5YA 4PFPA 3BTJA 3DEEA 2GZWA 2EFPA 5FB2A 2IPQX 1XPXA 4HAMA 2N8GA 1ZLJA 3EDPA 3T1BA 2D2WA 2BE5F 3ERMA 2XGXA 4GO1A 1V5GA 2VI6A 1K83J 1GUUA 1ON1A 1P6RA 3D0SA 3KP3A 1MDMA 1KQ8A 3IWFA 3EUHC 3H0DA 1QQIA 3G2BA 1CGPA 3GTGJ 3FHZA 1ON2A 2ZJ2A 1GXQA 3IAM2 3GTMJ 2V26A 5ICCA 3M8EA 2BW3B 1IF1A 3BR5A 3CMAI 2P81A 5IT9Z 5F0CA 5FD6A 2STWA 1A04A 3NARA 4R1HA 4ZYDA 1VFCA 3J7YJ 1S29A 4JK1X 3TEDA 4FISA 3H0GJ 4LG3A 3RYRA 4AIDA 1Y0UA 1YW8A 2AXLA 1IJWC 5CVUA 1J2XA 3X2QH 3HYIA 2WY7Q 5DYMA 2PMUA 3JW4A 1IG7A 3H9JA 2QSHX 2HOSA 1JKOC 3AFHA 2A68F 2QM3A 2GXBA 1SD7A 2CQNA 2FD5A 1MNMC 1NH3A 2W85A 1MIJA 4PGGA 2HTJA 1FZPB 1YLFA 4RLQA 2RQQA 2AXTC 3P5JA 3GXOA 3HOTA 2ZO4A 5BQTA 5LGUA 4LLLA 5K5QA 4WK8F 2BYVE 3FXJA 2CRGA 1R5ID 3TP0A 4JOMA 1G3YA 3IV5A 2D45A 1OPCA 1ZHFA 4DQ2A 3WTTC 1QPIA 1VQ7I 4C2TA 4L0ZB 2ICWG 4IHXA 3MQ0A 1JUPA 3K69A 2VUMJ 3CC2I 3I53A 5FROA 1UJ8A 2HQRA 1ZG1A 2O61A 3PNYA 4RM2A 5L3GA 4ZH4F 5HDNA 2E1OA 4E6KG 4CYCB 2FEZA 2VIXA 3MD2A 1AHDP 2EV0A 2CUFA 4CHUA 1NG7A 3MZ8A 2HTSA 3SJMA 5DD4A 2X6YA 4A69C 2FBIA 3CO6C 4HDVA 4EJTA 4ZTJA 3WHBA 2VJ4A 3S1NJ 2W82A 1T38A 1OR7C 5IOYA 4UUSA 2E60A 1YG2A 2PMHA 2WB1A 5KK1A 4AM3A 3C7JA 3COAC 2HDDA 2Y2ZA 2EZHA 3WGGA 2QSFX 3H1CA 3GZNB 1XGSA 3GTOJ 4MNUA 2OQRA 1U5TA 1NTCA 2PMZN 3M4OJ 2K40A 1HSJA 3S17J 2CQXA 1FBUA 3HKZA 2E2JJ 1N75A 3S32A 4F52A 2BVMA 3QPSA 5A2QK 5E17F 1HA8A 3DP7A 2P5KA 3DU6A 2WBMA 5IP6A 4RB2C 3FXRA 2L7FP 5LRSA 2JK3A 1U0JA 3ZCOA 4M6XA 1S3JA 5ERIA 2ZXHA 4U88A 5JHUA 1I6HJ 1MZBA 3HSEA 2QKMB 4E4HA 4YIIA 3VODA 2JQ7A 5FD5A 2MGQA 1JJ6C 2XIGA 3BQYA 3IUOA 1DP7P 1D5YA 4IOCF 3PFIA 2Z9OA 5J47A 4A6EA 4HF1A 3CUQA 4C30A 3L9FA 3E1SA 1S7AA 3HRMA 4HPQA 4BHCA 4KIBA 1X58A 4CO8A 3LNQA 2VBXA 2JMWA 2XB0X 4OAZA 3MWMA 3GFLA 2DYSH 3ZMVA 5EJCA 1F36A 2OUMA 2HZTA 1B72A 5E20A 2IGMA 4ZDOA 3V4GA 5HS8A 1A36A 1LE8B 1RUNA 1GT0C 3DV8A 3BPVA 3MZHA 2X48A 1OYYA 3OOUA 3GLLA 1ZG5A 2MABA 2UWMA 2VXDA 3CC7I 3KX2A 2CW7A 3FX3A 3SFZA 3MFKA 4EEFG 1IRFA 2F5VA 5DCMB 5IP7J 2X0LA 2JA5J 1MSEC 1VTNC 2F4OB 3ZMUA 3G1OA 1W5SA 3DCFA 5HDGA 3HDDA 3M9AA 3WHCA 3E7LA 2DA7A 2ECCA 1TZLA 2I10A 3QP5A 4EV0A 3M3YJ 1JHHA 4FHTA 5BS6A 4ZC3A 2BY2A 1DPRA 1TTYA 1K4TA 2L9RA 3DF8A 2O7OA 2R4GA 4K2EA 4NC6A 4HYEA 3FK7A 4OMYA 2Q0OA 2R92J 3LAJA 5AIPA 1RC9A 2DPDA 1ZLKA 1ORKA 3OR1C 3OYCA 1OJLA 3E3VA 4XOPA 3MMYB 1U78A 5EG0A 3R0AA 1H9TA 2Z99A 3PUBA 3ELKA 5CQGA 2VQLA 3C2HA 4P1WA 2NVTJ 1ETWA 3G1MA 3F3XA 1F1ZA 3RKXA 2DA1A 1V3FA 3L1PA 4R79A 1HDDC 1W0TA 1Q1HA 4RA2A 3H3UA 3ISPA 1A5JA 2C6YA 2AHQA 2XROA 1OMIA 4I09A 2PQ8A 1BI3A 5KHDA 3JSPA 5KCMA 5TGTA 3FM3A 2XHKA 1MBKA 3LMMA 5LHGA 3HGYA 1FYLA 3IC7A 5LEJA 2V4JC 5EGOA 2Q8KA 4EJVA 4WXCA 3BZ6A 4M3BA 1RRJA 2JPCA 2X1DA 4LFUA 2HVSA 2OA4A 1F4KA 3N97A 4CCLA 2HGCA 2CUJA 1QGPA 2Y0MA 1SD4A 3Q0WA 3K7AJ 3PNTA 3MZYA 2OZUA 1WKMA 3GW2A 1YFHA 1ZQ3P 4J19A 4NBQA 1ETVA 3K1NA 2FXAA 3HXLA 3SDGA 2RNGA 4BDYA 3DBLB 1QHGA 4P5OA 2ELHA 4X6AJ 2Q1ZB 2YU9J 1PVEA 2VC0A 2Y0SA 4PJ0C 3OIQA 4D7MA 3FK6A 3JRGA 3EYIA 3JRBA 4KT5C 4JYKA 4U87A 2Z3YA 4YIRX 2HPIA 3GFJA 1YW7A 2K4BA 3QYFA 4M3EA 3EUAA 2V1XA 1IO2A 4EQQA 4E70A 2IGNA 2VJIA 3ZQFA 2CV2A 3K6GA 3GZ6A 1BI0A 3TGNA 3V7CA 2MLKA 4NQWA 2E2HJ 2V7FA 4RBOA 4EGZA 1Z1DA 1H89C 1MMSA 1RZ4A 2D1VA 2XAHA 2RC4A 2BY3A 3SQNA 2DA2A 5TRDA 3SXYA 1DGWY 3A03A 4XN0A 3LSGA 2Q2EA 1SVLA 1TWCJ 2LBFA 3KEOA 4XORA 2NRAC 1JUSA 3LSPA 4MLOA 3ZXSA 1GV5A 2CFXA 4FE7A 4Y13A 5E1ZB 1X19A 3H92A 3MN2A 5ILUA 3FZVA 2ID6A 4O3MA 3OMYA 2IXSA 1AWCA 4PJMA 2LRDA 3LAPA 4OU0A 3ERED 1IXRC 2JA7J 5DUIA 3BJ6A 2E71A 1W5TA 4GXOA 2IGKA 2BEOA 1VF9A 3HOYJ 1WFXA 3GLXA 2MC4A 3P9IA 4FTHA 2VT3A 1FC3A 4HA8A 2F5DA 5IT3A 1IV8A 1MD0A 1ULYA 5LGNA 3JR9A 1B59A 4A3KJ 2HVRA 2DPUA 4ENNA 4OIPF 3BG5A 5J4VA 2VOPA 4UVAA 1ETQA 3DWLE 3KFWX 4XKBA 3DKWA 1WJBA 2VBZA 1V5EA 3CP2A 2E34A 3CJTB 2LY2A 4EMSA 1MBHA 2DO7A 2X4HA 3ZR8X 4YFKF 4ON0A 1G59A 2BHYA 4PJNA 1WI3A 4B09A 2W48A 3A0BC 3ZGKA 4A3BJ 1Z77A 2OJED 3Q9SA 4OIOF 4XQFA 3OYIA 3T8RA 4Q48A 4OINF 4C2UA 2VPLA 4D1QA 2ID3A 3BLYA 2R5ZA 4KITB 1XGNA 1I1GA 1YQAA 2YUSA 2DU9A 1S6LA 1UAAA 1JT0A 1ZG3A 1GLNA 1MKMA 1OISA 3ULQB 4ABZA 3ZOBA 2HKOA 4DBRA 1V55H 4XSZF 1R58A 3KP6A 4MTEA 3ML6A 2F4MB 4QWQA 3KLNA 5E1WA 1BIAA 3HSFA 1H9GA 1MJ9A 2K9QA 3EETA 3O3KA 5GTHC 1ZGJA 5DM6F 2NVUB 3K4JA 2ME0A 3DPLC 3E5QA 3ECOA 3LOCA 3VYUB 2X6OA 4PFOA 1BL0A 2ZMEB 5JLXA 3ZMTA 1QZYA 2CJJA 4WXDA 2FSWA 2QWWA 5FRNA 1WQ2A 5TJJA 3U9GA 4M72A 2WV1A 4OWRB 2XF5A 4X1EA 5DTDA 3QOPA 4ZZLA 5HLIA 1VNDA 4ZYHA 1ZELA 1H8AC 3DKXA 1JTYA 2A3SA 2H8RA 3FDYA 5E3MA 4OIQF 5GADJ 3WTZA 2KIUA 2ZCWA 2XSDC 5CVIA 2HEOA 3JRCA 3CDLA 4M6VA 4I99C 3W2WA 2M2EA 1R4NB 3ZRGA 1OCTC 3LFUA 3PJRA 3AKZA 1QRYA 4CCOA 2JZYA 4YRVA 1AU7A 3GUDA 2R7TA 4W97A 1KYZA 1U6GA 4KUMA 5C3EJ 2XPUA 2ZXJA 5C4XJ 3M7GA 2KZVA 4LG0B 2QQ9A 1SFEA 2I8DA 4B1RA 1HW5A 4C3HJ 2Z5UA 3LQQA 3TDZC 2JSCA 5ILSA 1HQCA 2BXZA 2H09A 2IS4A 4UVBA 5D5UB 3G71I 2FA5A 3I4NJ 1BW5A 2QENA 3HGGA 2E1MC 3LFKA 2P8TA 2QBYB 3DQVC 1TC3C 2L01A 4B8XA 2WA0A 2DAOA 4YIFA 4DOZA 3VSLA 2VKEA 4BJ5C 3A1YA 1UFMA 5DEQA 4BY1J 3Q3SA 4IHWA 2WV0A 3W2VA 2EV6A 2OQGA 3QAHA 4E7HA 3F72A 3ASNH 2L0KA 3SZTA 2P5LC 1EKEA 1IN7A 2BZTA 2GBYA 1K78A 4BAYA 2A61A 3WU0A 2R7UA 1O3SA 1TQMA 2OC6A 2P6TA 5J4YA 3M1CA 1ETYA 5EEGA 4LMYA 2XAJA 3FIWA 1Z67A 3REOA 3RTRA 2GQQA 2X6XA 1YW9A 1BC7C 1XB4A 2XGEA 3H5RA 1JGGA 2HFHA 3NQOA 5IYCJ 4IRGA 4BBRJ 4D5FA 2R0QC 3KCCA 2GWRA 1JI8A 4MHGA 2R7VA 1BJZA 1QVUA 3VEPA 1RKWA 1JUMA 3ABTA 4A5NA 4I0BA 3K9TA 2L4MA 3E6BA 2YSRA 3PSIA 2HZDA 3E6CC 2DOEA 5M3FJ 4E7JA 1B8IB 3AG3H 3DLAA 2VL8A 3WTVC 2VKDA 4AVPA 2JPBA 2PEXA 5F6FA 3BOQA 3OYKA 2WAFA 1TNSA 5M5YJ 2V9VA 4WCGA 1R49A 3VWBA 1F9NA 3IAS2 1XCBA 3HJEA 3A01B 3CDHA 2H1KA 4HW0A 4I0AA 4XLCA 3GCMA 3KPHA 4HX8A 4AIJA 3CD6I 3GO5A 2QGUA 4KFCA 4XRSA 2IA0A 1O4XA 3OY9A 1LNWA 3C18A 2QCOA 3DTIA 3AAFA 5LD2C 5H6QA 3PQKA 3CTAA 3OYDA 2EH3A 1RR8C 3H9GA 3QPTA 3KYLA 4AD9A 5BOXA 2H94A 3WTXC 3KZIC 2K7LA 2V9KA 4XLAA 1F43A 4A6DA 5FKMA 3B6AA 4BJ6C 1R9TJ 3VYSB 2CG4A 1VQNI 4PCQA 1MNEA 2QA4I 1XDUA 2DN0A 3T5XA 2IS1A 4LK1F 5F0HA 3A02A 1WJCA 1ETKA 1MNDA 2LKXA 1HF0A 1WCMJ 1JKRC 3MKZA 3S3OA 3PQJA 4ZYGA 4PK4A 3I59B 4CCNA 2L2OA 1YJ9I 2ELJA 2JA8J 3BR3A 3F8BA 3PFYA 4XRMA 2Z33A 3LL7A 4IRHA 4QIWN 1Y56A 1I27A 1WJFA 1ERDA 1O3QA 3BROA 1J59A 1YRNB 2JWTA 1NHAA 1P9QC 1R7JA 1MDMB 5KAIC 3SEZA 1K6OA 2CGPA 3AL0C 2HQAA 2CMPA 3G6EI 2DK5A 5J40A 1RNLA 3WGIA 1YTYA 1WWXA 2L9NA 4Q5SF 1FMVA 2LY9A 1KQ9A 2BW3A 2VBYA 1FSEA 3CQZJ 2KHMA 3HPGA 2EILH 1ETXA 3QODA 4XLNF 4EJOA 1U2WA 5CKTA 1VQ9I 3ZQHA 1MBFA 5E8GA 4D5CA 2YPRA 2LH9A 1P4XA 2VN2A 2MG4A 1KA8A 1E0EA 3Q9VA 2KT0A 4A3JJ 3H5AA 3RCOA 2FQ3A 3LSHA 2LKPA 4C3IJ 4XN3A 3CCRI 4IRIA 4CSWA 2BHZA 3LA7A 1Y8RB 2P5VA 1FIAA 4LJZF 2MSYA 5B3SH 3I71A 2FMYA 3TL4X 1FJLA 2NNNA 4A12A 3CJRB 5C44J 2LYCA 4CCJA 1WSUA 4H0EA 5K1YA 5FKLA 5E3NA 2F6CA 3CCQI 4AYBN 2H6CA 3BR0A 2VASA 3CLOA 2YX4A 1BN5A 3KEQA 4HLXA 2L7KA 1TW2A 3BTIA 2GXGA 5E1XA 4FQGA 5IYBJ 2A6TA 1W36D 5JR3A 4XK4A 3H35A 2VJ5A 4B4CA 2L5QA 3BDDA 1R1VA 2FQ4A 4KN7X 4KMFA 1A6QA 2KQRA 5FLMJ 2VQHA 2AO9A 2UXXA 2CV1A 3J80Z 5CYVA 5LBQA 4XL9A 5F04A 3O8GA 2LD5A 3KE2A 1R6RA 2O9LA 1TL8A 4RGUA 2NS0A 5K5RA 2EINH 2XRLA 1IXCA 2V9PA 2CUEA 4HX4A 4BS9A 1YJWI 2NYXA 3E5XA 4F91B 3RI4A 1D8JA 3S1RJ 4N4NB 3RQ4A 1TWGJ 3BZKA 1SVOA 2DA5A 1DUXC 2HDWA 2X6WA 3ABUA 3BR6A 2BY1A 3WODF 1QPMA 1OQYA 3V8KA 4HNVA 1XG1A 5DS9A 2DFFA 3HUGA 2BBYA 2IS6A 2AQEA 4OIRF 2FOKA 2HXOA 1WPKA 4AIHA 4EM1A 3F22A 2NVXJ 4UUVA 3ZN1A 2HQ5A 3KP7A 4HLYA 1MMNA 1W7PB 1K79A 3VYRB 4C2MJ 5K7FA 4UHTA 3L2VA 2W4SA 4GGGA 4B43A 1CF7B 2ACJA 4NC7A 5KAFC 3BCAA 3BG7A 3L00A 2G9WA 5FFXA 4F92B 3AG4H 3OYNA 4P9FA 2IS2A 3L2QA 3K1PA 1X1DA 5CVVA 3EPZA 4IPAA 3G1LA 4KICA 2CWEA 2HXIA 2RV8A 2PI0A 1X1AA 1LDJA 1R5GA 2HQNA 1YYVA 2M30A 2W84A 3OYJA 2XPWA 2ZKZA 4KJZA 4ESJA 5KVRA 2ISYA 3HRUA 3NWTA 1RI7A 1T39A 2GA1A 3BG3A 1PP8F 1QA6A 1I5ZA 4UB6C 4ETSA 1SC7A 1HKQA 2XPVA 4IX7A 1LQ1A 1EH6A 3K4LA 2JVGA 4BQQA 3GTQJ 4LLNA 2KPMA 1HBXG 1XS9A 3RIRA 1Y6IA 1BA5A 4I2OA 4LOCA 3DFGA 1S9HA 3AG2H 3FMRA 3F6VA 2R5YB 1LE8A 1TT0A 2ZFUA 3VOEA 3JAMK 2PJRB 1X4PA 4A3MJ 5JVGF 2UV1A 3HOSA 3QQAA 1BM9A 2ZJPF 1FTZA 1Z7LA 3GZ5A 2GIVA 4XR6A 5DCMA 3FKIJ 3NEUA 2V1DA 3TDUC 1TNTA 4J00A 4B3XA 4DGWB 3SHFA 5E8IA 1FIPA 4NNJA 2FX0A 3W6VA 4HDUA 3L2RA 4RM3A 3PIPF 5C4JJ 2PBIA 2KDZA 1R71A 1O57A 5FLXZ 5HODA 4ESBA 1P7IA 2OPTA 4IQJA 4HOBA 3RDIA 2L7MP 2ADUA 2FUG2 4QLCU 4NHJA 4KNYA 1PUEE 5IP9J 1G6NA 3TOAA 2KIFA 2M4KA 4DZJA 3OYBA 2CS3A 2FMLA 3BCBA 3GFIA 4GDFA 1ZRFA 1RR7A 5IPAA 4XKWA 3QPHA 4QTRA 1A6IA 2HOTA 4PSXA 4Y3OA 3I0TA 1X1PA 2EIKH 3RYPA 3I4MJ 1I3AA 1EH8A 4E7IA 1IRZA 2P7VB 2XAUA 3OIPA 3Q0VA 4BDZA 4ASNA 4AIKA 3HHHA 3DKYA 1AKHA 2A5WA 1MH3A 3AL0B 4DJAA 5GPCA 1H88C 4BXXJ 5HVQC 3RKWA 2D1HA 3R6SA 1Z21A 4Q4ZF 2K5CA 4MGRA 3OYFA 3HC7A 3CCVI 1SD5A 2E36A 3FXOA 1O7LA 3G3ZA 2PLYA 3BZCA 5E79C 1S7OA 2A5YB 2GIZA 3I56I 1SFUA 1KU3A 2EQRA 1RETA 3WE2A 3M1EA 1OR7A 4HRIA 1WZ2A 2Z16A 1XN7A 2OF7A 2X51A 4IHVA 3W2AA 1USTA 1YX3A 1LKXA 2K9LA 3VFZA 1SMTA 2JJ7A 2WB1N 1C0WA 3ESWB 3EYYA 5JI6A 2KJBA 3SZGA 3JRAA 2WY8Q 5F08A 4FX4A 4O6JA 4HQMA 2NAZA 3BR1A 4B44A 2YS9A 1ODDA 1PDNC 1EF4A 2O8XA 4L5JA 1F5TA 1IGNA 3OYAA 4HX7A 3GYHX 5DUKA 2F2EA 1NK3P 2CQ7A 3J7AO 1RIOH 1FP2A 2ZBKA 4V2GA 3CMYA 4MO7A 1MJAA 3FMQA 3P9CA 4I76A 3CJNA 3CF5F 4AYBA 1U8BA 2VQGA 2F48A 1JE8A 4U7DA 1APLC 2IGOA 1SEUA 4S05A 5EEAA 2DTZA 4B3AA 4A93J 1FOYA 1REPC 2GAUA 3SDBA 2MA3A 5EYRA 4ZZDA 3V7RA 3S3MA 1OCPA 3IRQA 3DLLF 1W4MA 4CUGA 4RGRA 5FKKA 4O5VA 5E3LA 4BEHB 1S72I 1BIBA 1ZAOA 2KISA 2F5CA 1B4AA 1CQTA 2DMNA 2OTJI 4Y33A 3E6MA 3SFIA 4UVCA 5HNFA 4XM3A 2MH2A 3WE3A 4BH9A 3LQRA 4EGYA 1R1UA 1SFKA 1PP7U 5ICEA 3R0JA 1MH4A 1T0FA 1ETOA 3RPQA 1ENHA 3WTWC 3CCUI 1XGOA 4HZFA 3GTKJ 2ELKA 4HNTA 3U1KA 1P4WA 3KZYA 1FBSA 2M5WA 2RGVA 3ABKH 4F93B 3J81Z 2HVQA 2EK5A 4OOIA 1YIOA 3FXMA 1B8IA 1ITYA 3HHGA 5DM7F 2Y75A 3S93A 4JP0A 5HLGA 2OD5A 4L9TA 1XD7A 1FMWA 3HPHA 3GF2A 1T0FC 3L2WA 3TKYA 4BYYA 2M8GX 3MKWB 1FP1D 4FASD 3HZJA 2GOMA 2W24A 1X1BA 3JSOA 4M3FA 1BBYA 3QPLA 4MIMA 2R7SA 5B1BH 2E5ZA 3DPUA 2B63J 4M9ZA 4LB6B 3OYMA 2Y9ZA 5BMZA 3CCMI 3I58A 4S04A 2WAQN 4P9UA 2O03A 2DFIA 2ZNZA 3OYHA 2L9SA 3SEQA 5M3MJ 2YX7A 1ZARA 1EJ9A 2ESHA 4DNCA 4L5IA 1D3YA 4F7ZA 4AU7A 1WHUA 2XAGA 3HB9A 4MEYF 4XRSG 2HR3A 2NOJB 4UUSB 1DU0A 5CQEA 3A0HC 4MQ9F 1SFOJ 2M9HA 1BC8C 1ZR2A 4FX0A 5EEHA 1YIJI 5D6FA 4KIGA 1V5FA 4BGDA 2V1NA 1IRGA 2K9MA 5CJ9A 3WGHA 4DYQA 1VQMI 4LIUA 1MMGA 1W7PD 2V79A 2ZNYA 3M8JA 2L4AA 1FOXA 1XDSA 3TO9A 1NG6A 4ESFA 2B0LA 2RVCA 2H6BA 1GDTA 4BQAA 2MH9A 1G2HA 2RQPA 4RB0A 1HCRA 4RB3C 2GLOA 5D5VB 4CGZA 1EV7A 2GOXB 3ASOH 2G7HA 3U2RA 5E3OA 4N4OB 2LREA 2K4JA 2JN6A 3DU5A 3HTSB 2W00A 3FMSA 5M5WJ 4G9YA 2HOEA 1S7EA 3S2WA 1Y1VJ 2EA2A 2JRMA 3J80K 3EQLF 3OS1A 1ACIA 1WJDA 3M07A 2XF6A 4OMZA 1Y8QB 3K4KA 1ZN2A 4YFXF 3F9KA 3RSNA 3S2DJ 3K4BA 2M7AA 1FTTA 2DFEA 2KP6A 3GFMA 1I39A 5JVTA 1B9MA 2A6HF 1PUFB 2ZB9A 4I02A 3P7NA 1Z6RA 2IT0A 1BW6A 4XONA 2LSOA 1JTXA 3O8HA 3FKJA 4XKCA 3RZOJ 1R23A 2R7ZJ 4XICA 2CQKA 4ITVA 2VE9A 1K7AA 1BJAA 3PUFA 1YOVB 3RPUD 4KN4X 3L09A 2DBBA 4G8XA 3F23A 3ZMSA 3J7AY 5FRMA 3FXQA 2M4GA 1B72B 3ZQQA 2NXNB 1PYVA 1YX5A 3OYEA 2VONA 4L9VA 1AA7A 2VLAA 4MEXF 1FY7A 1W5CC 1XMXA 3I54A 4RLFA 1QBJA 3CCSI 5K7HA 3GTLJ 1HKTA 1DU6A 1ZH5A 2IBDA 5D4RA 1P92A 4L18B 4DYCA 3VYTB 1T08B 2H8WA 1Z7UA 2CH0A 3GVAA 2IAIA 4GCVA 1T95A 3ONQA 2IVMA 4UUTA 3R61A 1X3ZB 2XGCA 3L2CA 2VPRA 5CLSA 5HS9A 5JHFA 2Z2SB 4HSTA 1P7JA 4H4KC 5D5XB 3ECHA 3RKYA 3KZZA 3HRSA 2XVCA 1FNNA 1LJ9A 1VI0A 3JREA 2IW5A 2DTRA 3S1MJ 4F3QA 2LLKA 4IHTA 2MBFA 3F8MA 4HV6A 1LPQA 3JCUC 3FM5A 5CVRA 1G8XA 5FLXK 2OU2A 4NC8A 4EATA 3S8PA 2CO5A 1J7KA 2W1OA 3P9KA 1I1SA 1SVMA 1Z6TA 1JGSA 3S16J 2QSGX 3CC4I 5CPRB 3ZPLA 1I50J 4GFBA 2DA6A 3K0LA 4CDGA 3QP6A 4WXHA 3PIOF 1XSDA 2EFNA 4JQFA 3PL8A 1HW1A 3OS0A 3W6KB 2OAZA 1VQ5I 3DBHB 3WTUC 3IKTA 2BOLA 4ENJA 1R1TA 3WU2C 2VBWA 2KJCA 1TBXA 5FFZA 3E0JB 5J1RA 3CP8A 1W7PA 5J3LA 1KYWA 2L54A 2R7FA 5ICFA 1X1CA 5FKOA 1DP3A 3BJAA 3C1DA 3BJOA 2I5UA 1K61A 4YFNF 1ZKGA 2M7BA 3ZQGA 2CW0F 1CF7A 3D1NI 2COBA 3MEXA 4Z2YA 5D8LB 3IH3A 4FCYA 3HOUJ 4IJAA 2IJLA 3T8TA 2NS8A 1D0ZA 4AWXB 5BPDA 3OWTA 1NK2P 4E7LA 3FXKA 2TRTA 3BG9A 4Y52J 4U0WA 1L3LA 2FNAA 4IHYA 4A3FJ 3HOVJ 3R60A 5B66C 1T2KA 3H36A 1OKRA 1RESA 3KYCB 3BWGA 2E19A 3MCZA 1XMKA 2IA1A 2V6CA 2Q2EB 5FKNA 3F0CA 4MFEA 2ETHA 5BPIA 1R5HA 5FO5A 3BP8A 3IHUA 3HOXJ 1AOYA 1TT5B 4I01A 5EDNA 3LSMA 3DEUA 4G6QA 4KA4A 2UZKA 2FOWA 2KLOA 1QVTA 2VJJA 2ME6A 2GM4A 1R4MB 1LDKB 2XUBA 1VQ8I 2VC1A 1OYWA 4PUSA 5DD8A 2Y48A 2R7DA 1WI9A 3DBRB 4CICA 1K78B 1E17A 1BI1A 3QU3A 1OCCH 1STZA 3OOPA 5F64A 1QZZA 4ZJZA 2DT6A 3K4NA 1KZHA 5GTIC 2TDXA 4EVIA 2OCEA 4I7HA 1Z0XA 2ECBA 3CCLI 4U0VA 2R7WA 1G3SA 4HNUA 2FBHA 4L5EA 1SFXA 4II2A 3TW7A 3E97A 3DPTA 2WTEA 2EFWA 4DZPA 2EA4A 2PX9A 1FYMA 3UR3C 1P2FA 2VB6A 5L3EA 3V42A 5GPAA 3JRHA 4WF2A 3BTCA 4GYIA 2NS7A 4Y15A 2R7RA 5D6EA 3FF5A 5EGOB 1SAUA 2KFDA 2O8KA 3ZQ7A 4IF4A 1WJ5A 2JUGA 4R8HA 1J9IA 1VQ6I 4HBLA 1VQLI 1WJAA 2DCEA 2K86A 3D5RC 1Z3XA 3EUHA 4YELA 5K5OA 4AVZA 1VQKI 4IHSA 4S0HB 2JUCA 1N25A 3QU6A 4A3CJ 4L9JA 2FE3A 2K3FA 4XMYA 1MW7A 2X1CA 3LA3A 2PN6A 3Q0UA 3SYTA 4BE1A 1AKHB 2EIJH 4Y7NJ 3ROUA 4UNOA 4EM2A 1SANA 1V4RA 3RPUA 2R7OA 2OCCH 4A3GJ 3D5LA 5LFAA 2DI3A 2X85A 2P4WA 2ZMEC 5D8KB 4B48A 2M8EA 4IL6C 1G3TA 3KYDB 3VDXA 5IT9K 1XSVA 4BE0A 2LMDA 1XGMA 2BVLA 5HLHA 5HNHA 3CCEI 3KETA 1R00A 2PG4A 5KNLA 3CF2A 4KYWA 1VQOI 2ZMEA 3E5UA 3IH4A 3OSGA 1TQPA 4JX4A 3NAUA 4B47A 1DQUA 1BI2A 1YITI 1Y39A 2W25A 5K7ZA 1J0RA 3ZP5A 5F27A 1KU9A 3J81K 2ZC2A 4A2UA 1JKPC 2XF7A 3S3NA 4KMUX 1UHMA 3TW6A 4BJTA 1T56A 1E3HA 2BV6A 2VQCA 4DW6A 1Z91A 2Z1DA 4UV8A 2JA6J 4GYGA 1UB9A 2XB5A 3HSRA 5EZHA 3CMMA 4FE4A 1FX7A 5HOOA 4UV9A 2BXYA 4M71A 3ZN0A 4C9YA 2HOAA 4Y4RA 1YHQI 3CUQB 1LFBA 2VOOA 2DMPA 1GVJA 2NOGA 1IN6A 2DODA 2R7QA 1FOWA 1Y0NA 2D5VA 3K4MA 4DBQA 1TLHB 2CU7A 4I6ZA 5FJ8J 3GTPJ 3NWSA 4LITA 3IWZA 1XC5A 2MFZA 3EUKL 4AUXA 2B9SA 2K9SA 2KIMA 2MYSA 3KP2A 2BGCA 4CZCA 4RAZA 1MSFC 3B02A 3G4SI 2IEKA 4HEA2 1TWHJ 3HBLA 4EJUA 4BEHA 1IV6A 1SD6A 5DCFA 4HSRA 3K1MA 2E1CA 4HQEA 3LSRA 2RN7A 4IEJA 1TQIA 2QVOA 2XRNA 3K2ZA 4LK0F 4BXFA 2M45A 2XKOA 2KKOA 1FBQA 4I98B 4E7ZA 4BACA 1XX5A 3OSFA 1BOBA 1MBGA 2VE8A 1G4DA 5HS7A 3U1DA 2LF7A 5JLWA 4C3JJ 3QRFF 1T6SA 2CSOA 3SZPA 1U8RA 2QBYA 2K27A 5M5XJ 2KZGA 4QPQA 3MKYB 3Q5FA 1D8KA 2LF8A 5GAEJ 5L3DA 1ZTRA 3HM5A 4L9NA 2VXZA 3N4MA 2DXIA 4KIFA 2EFOA 2X9DA 2CQQA 3KP5A 2F4IA 2CUZA 1T33A 4NUBA 1HOMA 1OCRH 2M0MA 4JX6A 3DTEA 2DFHA 4G6TB 2R3SA 2VKVA 2FJ1A 3TO7A 1O3RA 4IO9F 2E5NA 2VKHA 1E3OC 3BC8A 2ZXWH 5EG0B 3OL4A 2BY0A 1YS6A 5BNGA 1U5TB 2LK2A 1XMAA 1LVAA 1UG2A 1UHSA 1ZK8A 2HYJA 1L0OC 1Z9CA 1JXSA 2ZXIA 3WG7H 1TWFJ 2E2IJ 3LSIA 2GXAA 4UXNA 2VT2A 1JKQC 5GP9A 4WWCA 1M1EB 2RREA 1VZ0A 3S1QJ 2K02A 2DT5A 2YU3A 3W3CA 4QSHA 3TP3A 2QQ8A 4ZYEA 2ZFWA 2STTA 1I6XA 3ABLH 2R93J 1A35A 3ZMZA 3HL2A 1YS7A 3QYBA 3CMEI 2HI3A 4J01A 1U9NA 2WAQA 2L7ZA 2QKLB 2XGDA 4M9XA 5L3BA 5LGTA 2A6EF 5LHHA 3OYGA 3A01A 3HKZN 4PDKA 1UG0A 5B1AH 3HIFA 1RUOA 3KEYA 4QPOA 4IVNA 2WC2A 2LG4A 3JAMZ 2JTVA 3R4KA 5GAGJ 4G7HF 1IW7F 1X4OA 2JT1A 2KDOA 2M3AA 3A4CA 3C2GA 3FHNA 4Y17A 2A69F 3K4CA 4M9SA 1E2XA 1DDNA 4Z6YA 4IOAF 3JTGA 2EBIA 2JVHA 1LB2A 1ZRCA 3C2BA 5LLQA 5J6XA 3GMEA 1FT9A 3V8JA 4ANJA 2EJRA 2DJIA 2EWNA 1IRXA 2LTPA 2HYFA 4NQWB 4V19K 2KIQA 2QZ8A 1MBEA 3D5SC 1HDPA 4NDLA 2QF7A 2XASA 4PGHA 2RAEA 4M3GA 4CCMA 2J5PA 1S8NA 4BXUA 1A31A 2M87A 1EH7A 1U9OA 4BBSJ 2W7NA 1HXDA 3IKVA 2CV0A 3N05A 4GRIA 4RAGA 1ZR4A 1TWAJ 2M34A 1ZREA 2E7WA 1J75A 2E7XA 4AC0A 4LGWA 1FPQA 3BQZA 1H0MA 5H20A 2JRTA 1ONVA 4M73A 2DOAA 4A0XA 1MBJA 3PO2J 2G7UA 3ABMH 4XLPF 1WH5A 3I64A 3JTHA 2R7XA 2XC7A 5HDKA 1IZ1A 1X2NA 2XKPA 2ZSHB 5J1UA 2UXNA 1LEBA 1QZEA 4IZZA 5EF6A 4WX9A 3VSKA 3TQNA 1GXPA 4BNCA 2ESNA 3CCJI 3I9V2 2O3FA 1N77A 3TBIA 2E35A 1TP4A 3BT9A 3BY6A 3F6OA 3WTYC 4TV7A 2WWYA 3RZDJ 1KONA 2Y69H 2L3DA 3FBNB 4LD5A 2O5RA 3DXJF 1QU3A 3V7SA 2KRCA 2EIMH 5LEKA 4A0YA 2P7CB 3RQIA 4RB1A 2LP0A 2LY1A 3QOEA 1IDYA 4CCKA 4DIQA 3F8FA 2IRFG 1ZGWA 4XOTA 1KU2A 4YEJA 3WU1B 4ENMA 3H3ZA 3PSFA 3VB2A 1BOAA 1JT6A 3J7ZI 1UELB 4CYCA 1MJBA 3B73A 1UHWA 5FGMA 3OS2A 4ENKA 2HYGD 2QUFA 3OV8A 2H27A 1OYIA 3F8CA 3FWEA 1KGSA 4LLGF 4PJJA 3JRIA 2QEXI 2OTLI 2Y0SN 4L0YB 1I3QJ 4MQVA 3H3VK 1E3PA 4XLFA 3RKQA 1JJ8C 3HEFA 2NNYA 1Z3YA 1HC8A 4BHPA 4HV5A 1YO5C 5DV5A 4OAYA 3CO7C 4ZDLA 4ZDPA 1TW3A 2DA3A 2DDBA 4XKVA 1BR1A 4CYDA 3ZQCA 3PM1A 2B7EA 2K9NA 3M8FA 4FETA 4P96A 3PO3J 4FT8A 4D0PA 2LVSA 2HS5A 2NVYJ 1B1BA 2LBFB 2P0WA 4A3IJ 2DDAA 1RKTA 1YE9A 1QO0D 5GAHJ 3HG9A 3H9QA 1XTAA 1IN5A 1DGRM 3T0YA 3QWLA 2EZKA 3O2PE 5B5EC 1UCRA 5H2FC 1O7FA 2DMTA 4IQ4A 1IN8A 3JRFA 4BE2A 4A5MA 3CDIA 2QQAA 5JFRA 2G0EA 3G73A 1MMDA 4XIDA 1FWZA 4JX5A 1ZRDA 4BHBA 2IP2A 4N9HA 1R22A 1WGXA 3OIOA 4A3EJ 3S15J 1IAWA 2Y9YA 2A07F 1Q1VA 1V54H 4XNFA 3CJQB 2OBPA 4LB5A 1GHCA 1SAXA 4Q47A 2EZIA 2A05A 2MC3A 4PJLA 1WJEA 4A0ZA 1LDDA
chains in the Genus database with same CATH topology
1OJLA 3IH3A 4FCYA 1HLVA 2O9LA 3HOUJ 1U78A 5EG0A 1PUFA 2XRLA 2NS8A 2CUEA 2NVTJ 3S1RJ 1ETWA 1POGA 1NK2P 2MW8A 1FEXA 3G1MA 2TRTA 3BG9A 3CCYA 2DA1A 4Y52J 1TWGJ 3L1PA 3DEWA 1HDDC 1W0TA 1A5JA 2DA5A 5F1JA 4A3FJ 4IHYA 3HOVJ 2AHQA 2DJNA 3BR6A 1LFUP 1RESA 1MBKA 4HNVA 1XG1A 3HGYA 5DS9A 2E19A 5EGOA 3K2AA 5FKNA 3F0CA 4MFEA 2R5YA 4M3BA 2HXOA 1WPKA 2NVXJ 3HOXJ 1RPWA 3ZQLA 2M0CA 2HQ5A 5EDNA 3Q0WA 2TCTA 3K7AJ 1ZQ3P 2R5ZB 4J19A 1ETVA 1QVTA 3SDGA 2ME6A 3IH2A 4C2MJ 5K7FA 4MFDA 2GM4A 4X6AJ 1W0UA 3LSJA 2YU9J 4D7MA 3FK6A 3JRGA 3JRBA 4JYKA 1Y1WJ 4G12A 3G1LA 4M3EA 2HXIA 1Z0XA 2ECBA 3HOWJ 1FTTA 3ZQFA 3GBGA 4L5EA 3MVPA 2XPWA 3TW7A 4DZPA 2E2HJ 4RBOA 3BG3A 5GPAA 3JRHA 1H89C 2XPVA 2DA2A 3BTCA 2NS7A 3GTQJ 1XS9A 5EGOB 3A03A 2O8KA 1OFCX 1BA5A 3LSGA 4LOCA 2R5YB 1TWCJ 1LE8A 2EZLA 1JUSA 4S0HB 4A3MJ 3LSPA 4MLOA 2Y30A 4A3CJ 1GV5A 4FE7A 3QQAA 1FTZA 3FKIJ 3MN2A 3Q0UA 1IDZA 1AKHB 4Y7NJ 2ID6A 1FIPA 4A3DJ 3GTJJ 2FX0A 1SANA 3W6VA 2JA7J 2KDZA 5C4JJ 4A3GJ 5HODA 1VF9A 5IYDJ 1P7IA 3HOYJ 5IOZA 2OPTA 4FTHA 1WH7A 4BY7J 1X2MA 1GVDA 1UMQA 2L7MP 5IP9J 3JR9A 4DZJA 4A3KJ 3IH4A 3OSGA 1RR7A 4JX4A 3NAUA 5IPAA 3BG5A 5J1YA 4BKXA 4QTRA 1A6IA 1ETQA 2HOTA 5K7ZA 4D7NA 5F27A 3JRDA 3BR2A 1MBHA 3I4MJ 1JKPC 1IRZA 3Q0VA 3TW6A 1T56A 4DW6A 1AKHA 2JA6J 1WI3A 4M3DA 1MH3A 2W48A 2XB5A 5EZGA 1YRNA 3S2HJ 5EZHA 4A3BJ 4FE4A 5GPCA 1H88C 4BXXJ 1Z77A 2DMQA 3FISA 2HOAA 2DA4A 2ID3A 2R5ZA 1LFBA 2DMPA 2NOGA 4RDUA 4A3LJ 2YUSA 2D5VA 2EQRA 1RETA 3GTPJ 2CU7A 4I6ZA 5FJ8J 1XC5A 4AUXA 1JT0A 2K9SA 2OF7A 4ABZA 3ZOBA 4IHVA 4W1UA 1MSFC 2IEKA 1TWHJ 1IC8A 3HBLA 2JJ7A 2WB1N 2K9QA 1IV6A 3JRAA 2ME0A 3LOCA 5F08A 2X6OA 3LSRA 1BL0A 4IEJA 5JLXA 3BR1A 3OSFA 2CJJA 2YS9A 4V2FA 3S14J 1MBGA 2Y31A 1EF4A 2WV1A 5JLWA 4X1EA 5DTDA 4C3JJ 3HOZJ 1IGNA 5F0FA 1VNDA 1NK3P 5M5XJ 2LR8A 1H8AC 5FLVA 1JTYA 3ZQIA 4V2GA 3CMYA 1GV2A 2H8RA 5E3MA 4MO7A 2DMUA 3B6CA 4I76A 3UKGA 2XSDC 1U8BA 1ZTRA 3HM5A 3CDLA 3JRCA 4M6VA 4DYRA 1APLC 2X9DA 2M2EA 2CQQA 3MKLA 5EEAA 2DTZA 4B3AA 1OCTC 4A93J 1T33A 1HOMA 2LFBA 4JX6A 5EYRA 9ANTA 2NVQJ 1OCPA 2VKVA 1QRYA 2FJ1A 1E3OC 5FKKA 3VPRA 1AU7A 5E3LA 4W97A 5EG0B 5C3EJ 2XPUA 5BNGA 1CQTA 2LK2A 2DMNA 5C4XJ 1UG2A 1IUFA 1UHSA 1ZK8A 2HYJA 3SFIA 3BTLA 4B1RA 3BTJA 4C3HJ 1TWFJ 2E2IJ 2N8GA 3I4NJ 1JKQC 1MH4A 1ETOA 5GP9A 1BW5A 1ENHA 3GTKJ 3S1QJ 2ELKA 3HGGA 4QSHA 3TP3A 1TC3C 1B8IA 2VI6A 1ITYA 1K83J 2R93J 1GUUA 2VKEA 4JP0A 4BY1J 2HI3A 3Q3SA 4IHWA 1U9NA 3GTGJ 2L7ZA 2XGDA 2M8GX 3A01A 3HKZN 2L0KA 3GTMJ 2GBYA 4M3FA 3BR5A 2P81A 5F0CA 3QPLA 4MIMA 2B63J 2Y9ZA 1ETYA 3NARA 3FIWA 1VFCA 2WAQN 3TEDA 1IJWC 4FISA 3H0GJ 2XGEA 5M3MJ 1JGGA 2EBIA 5IYCJ 3C2BA 4BBRJ 3HB9A 4XRSG 1DU0A 1IG7A 4UUSB 1SFOJ 4D5FA 2M9HA 2LTPA 2R0QC 1ZR2A 2HOSA 1MBEA 1JKOC 4NDLA 1HDPA 1BJZA 1QVUA 1RKWA 1JUMA 2QF7A 2RAEA 4M3GA 4DYQA 2FD5A 1MNMC 5M3FJ 1B8IB 1U9OA 4BBSJ 1ZR4A 1TWAJ 2M34A 1GDTA 3IV5A 3TP0A 2CRGA 5M5YJ 1HCRA 2GLOA 1G2HA 4AC0A 1QPIA 5E3OA 3BQZA 4IHXA 1JUPA 2VUMJ 3A01B 2H1KA 2JN6A 5M5WJ 1MBJA 1S7EA 3PO2J 1Y1VJ 4XRSA 1O4XA 1WH5A 2E1OA 4CYCB 2QCOA 3S2DJ 1AHDP 2CUFA 2EH3A 3SJMA 1PUFB 2ZB9A 1X2NA 4A69C 1BW6A 5J1UA 3WHBA 3S1NJ 1F43A 1JTXA 5FKMA 3O8HA 5EF6A 3RZOJ 5IOYA 3B6AA 4UUSA 1R9TJ 2R7ZJ 4XICA 2HDDA 2Y2ZA 2EZHA 2DN0A 3GTOJ 3BT9A 5F0HA 3A02A 3RZDJ 1NTCA 1ETKA 2LKXA 2PMZN 3M4OJ 1B72B 1HF0A 2K40A 1WCMJ 2CQXA 1JKRC 3S17J 2E2JJ 3QPSA 3RQIA 2LP0A 5IP6A 2L7FP 2JA8J 1IDYA 3BR3A 2JK3A 5K7HA 3GTLJ 1ZGWA 1DU6A 4XRMA 2IBDA 4QIWN 1I6HJ 1JT6A 4DYCA 4CYCA 1YRNB 2JWTA 2IAIA 2MGQA 1JJ6C 4UUTA 3BQYA 2XGCA 1D5YA 3JRIA 2VPRA 2Y0SN 1I3QJ 2LY9A 3H3VK 1P7JA 3CQZJ 3RKQA 1ETXA 1JJ8C 3HEFA 1X58A 3ZQHA 1MBFA 4D5CA 1VI0A 3JREA 3LNQA 2JMWA 2MG4A 2XB0X 3S1MJ 2LLKA 2KT0A 4A3JJ 2DA3A 4C3IJ 3ZQCA 3PM1A 1F36A 2K9NA 3PO3J 1B72A 2LVSA 1FIAA 2MSYA 2NVYJ 4A3IJ 1LE8B 1FJLA 1GT0C 5C44J 1RKTA 2X48A 3S16J 3OOUA 5FKLA 5E3NA 4AYBN 1I50J 4GFBA 2DA6A 3BR0A 2EZKA 4EEFG 2DMTA 5IP7J 3JRFA 2JA5J 1MSEC 2G0EA 3BTIA 3G1OA 4XIDA 4JX5A 3DCFA 5IYBJ 3HDDA 1WGXA 3OIOA 3WHCA 3E7LA 4A3EJ 5J1RA 2DA7A 3S15J 4XK4A 2ECCA 4B4CA 2I10A 2Y9YA 5J3LA 3M3YJ 2FQ4A 5FKOA 1Q1VA 2L9RA 2O7OA 5FLMJ 1K61A 3FK7A 1ZKGA 2AO9A 2EZIA 2R92J 3ZQGA 5F04A 3O8GA 3D1NI 2COBA 2LD5A 1ORKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJL A;  3IH3 A;  4FCY A;  1HLV A;  2O9L A;  3HOU J;  1U78 A;  5EG0 A;  1PUF A;  2XRL A;  2NS8 A;  2CUE A;  2NVT J;  3S1R J;  1ETW A;  1POG A;  1NK2 P;  2MW8 A;  1FEX A;  3G1M A;  2TRT A;  3BG9 A;  3CCY A;  2DA1 A;  4Y52 J;  1TWG J;  3L1P A;  3DEW A;  1HDD C;  1W0T A;  1A5J A;  2DA5 A;  5F1J A;  4A3F J;  4IHY A;  3HOV J;  2AHQ A;  2DJN A;  3BR6 A;  1LFU P;  1RES A;  1MBK A;  4HNV A;  1XG1 A;  3HGY A;  5DS9 A;  2E19 A;  5EGO A;  3K2A A;  5FKN A;  3F0C A;  4MFE A;  2R5Y A;  4M3B A;  2HXO A;  1WPK A;  2NVX J;  3HOX J;  1RPW A;  3ZQL A;  2M0C A;  2HQ5 A;  5EDN A;  3Q0W A;  2TCT A;  3K7A J;  1ZQ3 P;  2R5Z B;  4J19 A;  1ETV A;  1QVT A;  3SDG A;  2ME6 A;  3IH2 A;  4C2M J;  5K7F A;  4MFD A;  2GM4 A;  4X6A J;  1W0U A;  3LSJ A;  2YU9 J;  4D7M A;  3FK6 A;  3JRG A;  3JRB A;  4JYK A;  1Y1W J;  4G12 A;  3G1L A;  4M3E A;  2HXI A;  1Z0X A;  2ECB A;  3HOW J;  1FTT A;  3ZQF A;  3GBG A;  4L5E A;  3MVP A;  2XPW A;  3TW7 A;  4DZP A;  2E2H J;  4RBO A;  3BG3 A;  5GPA A;  3JRH A;  1H89 C;  2XPV A;  2DA2 A;  3BTC A;  2NS7 A;  3GTQ J;  1XS9 A;  5EGO B;  3A03 A;  2O8K A;  1OFC X;  1BA5 A;  3LSG A;  4LOC A;  2R5Y B;  1TWC J;  1LE8 A;  2EZL A;  1JUS A;  4S0H B;  4A3M J;  3LSP A;  4MLO A;  2Y30 A;  4A3C J;  1GV5 A;  4FE7 A;  3QQA A;  1FTZ A;  3FKI J;  3MN2 A;  3Q0U A;  1IDZ A;  1AKH B;  4Y7N J;  2ID6 A;  1FIP A;  4A3D J;  3GTJ J;  2FX0 A;  1SAN A;  3W6V A;  2JA7 J;  2KDZ A;  5C4J J;  4A3G J;  5HOD A;  1VF9 A;  5IYD J;  1P7I A;  3HOY J;  5IOZ A;  2OPT A;  4FTH A;  1WH7 A;  4BY7 J;  1X2M A;  1GVD A;  1UMQ A;  2L7M P;  5IP9 J;  3JR9 A;  4DZJ A;  4A3K J;  3IH4 A;  3OSG A;  1RR7 A;  4JX4 A;  3NAU A;  5IPA A;  3BG5 A;  5J1Y A;  4BKX A;  4QTR A;  1A6I A;  1ETQ A;  2HOT A;  5K7Z A;  4D7N A;  5F27 A;  3JRD A;  3BR2 A;  1MBH A;  3I4M J;  1JKP C;  1IRZ A;  3Q0V A;  3TW6 A;  1T56 A;  4DW6 A;  1AKH A;  2JA6 J;  1WI3 A;  4M3D A;  1MH3 A;  2W48 A;  2XB5 A;  5EZG A;  1YRN A;  3S2H J;  5EZH A;  4A3B J;  4FE4 A;  5GPC A;  1H88 C;  4BXX J;  1Z77 A;  2DMQ A;  3FIS A;  2HOA A;  2DA4 A;  2ID3 A;  2R5Z A;  1LFB A;  2DMP A;  2NOG A;  4RDU A;  4A3L J;  2YUS A;  2D5V A;  2EQR A;  1RET A;  3GTP J;  2CU7 A;  4I6Z A;  5FJ8 J;  1XC5 A;  4AUX A;  1JT0 A;  2K9S A;  2OF7 A;  4ABZ A;  3ZOB A;  4IHV A;  4W1U A;  1MSF C;  2IEK A;  1TWH J;  1IC8 A;  3HBL A;  2JJ7 A;  2WB1 N;  2K9Q A;  1IV6 A;  3JRA A;  2ME0 A;  3LOC A;  5F08 A;  2X6O A;  3LSR A;  1BL0 A;  4IEJ A;  5JLX A;  3BR1 A;  3OSF A;  2CJJ A;  2YS9 A;  4V2F A;  3S14 J;  1MBG A;  2Y31 A;  1EF4 A;  2WV1 A;  5JLW A;  4X1E A;  5DTD A;  4C3J J;  3HOZ J;  1IGN A;  5F0F A;  1VND A;  1NK3 P;  5M5X J;  2LR8 A;  1H8A C;  5FLV A;  1JTY A;  3ZQI A;  4V2G A;  3CMY A;  1GV2 A;  2H8R A;  5E3M A;  4MO7 A;  2DMU A;  3B6C A;  4I76 A;  3UKG A;  2XSD C;  1U8B A;  1ZTR A;  3HM5 A;  3CDL A;  3JRC A;  4M6V A;  4DYR A;  1APL C;  2X9D A;  2M2E A;  2CQQ A;  3MKL A;  5EEA A;  2DTZ A;  4B3A A;  1OCT C;  4A93 J;  1T33 A;  1HOM A;  2LFB A;  4JX6 A;  5EYR A;  9ANT A;  2NVQ J;  1OCP A;  2VKV A;  1QRY A;  2FJ1 A;  1E3O C;  5FKK A;  3VPR A;  1AU7 A;  5E3L A;  4W97 A;  5EG0 B;  5C3E J;  2XPU A;  5BNG A;  1CQT A;  2LK2 A;  2DMN A;  5C4X J;  1UG2 A;  1IUF A;  1UHS A;  1ZK8 A;  2HYJ A;  3SFI A;  3BTL A;  4B1R A;  3BTJ A;  4C3H J;  1TWF J;  2E2I J;  2N8G A;  3I4N J;  1JKQ C;  1MH4 A;  1ETO A;  5GP9 A;  1BW5 A;  1ENH A;  3GTK J;  3S1Q J;  2ELK A;  3HGG A;  4QSH A;  3TP3 A;  1TC3 C;  1B8I A;  2VI6 A;  1ITY A;  1K83 J;  2R93 J;  1GUU A;  2VKE A;  4JP0 A;  4BY1 J;  2HI3 A;  3Q3S A;  4IHW A;  1U9N A;  3GTG J;  2L7Z A;  2XGD A;  2M8G X;  3A01 A;  3HKZ N;  2L0K A;  3GTM J;  2GBY A;  4M3F A;  3BR5 A;  2P81 A;  5F0C A;  3QPL A;  4MIM A;  2B63 J;  2Y9Z A;  1ETY A;  3NAR A;  3FIW A;  1VFC A;  2WAQ N;  3TED A;  1IJW C;  4FIS A;  3H0G J;  2XGE A;  5M3M J;  1JGG A;  2EBI A;  5IYC J;  3C2B A;  4BBR J;  3HB9 A;  4XRS G;  1DU0 A;  1IG7 A;  4UUS B;  1SFO J;  4D5F A;  2M9H A;  2LTP A;  2R0Q C;  1ZR2 A;  2HOS A;  1MBE A;  1JKO C;  4NDL A;  1HDP A;  1BJZ A;  1QVU A;  1RKW A;  1JUM A;  2QF7 A;  2RAE A;  4M3G A;  4DYQ A;  2FD5 A;  1MNM C;  5M3F J;  1B8I B;  1U9O A;  4BBS J;  1ZR4 A;  1TWA J;  2M34 A;  1GDT A;  3IV5 A;  3TP0 A;  2CRG A;  5M5Y J;  1HCR A;  2GLO A;  1G2H A;  4AC0 A;  1QPI A;  5E3O A;  3BQZ A;  4IHX A;  1JUP A;  2VUM J;  3A01 B;  2H1K A;  2JN6 A;  5M5W J;  1MBJ A;  1S7E A;  3PO2 J;  1Y1V J;  4XRS A;  1O4X A;  1WH5 A;  2E1O A;  4CYC B;  2QCO A;  3S2D J;  1AHD P;  2CUF A;  2EH3 A;  3SJM A;  1PUF B;  2ZB9 A;  1X2N A;  4A69 C;  1BW6 A;  5J1U A;  3WHB A;  3S1N J;  1F43 A;  1JTX A;  5FKM A;  3O8H A;  5EF6 A;  3RZO J;  5IOY A;  3B6A A;  4UUS A;  1R9T J;  2R7Z J;  4XIC A;  2HDD A;  2Y2Z A;  2EZH A;  2DN0 A;  3GTO J;  3BT9 A;  5F0H A;  3A02 A;  3RZD J;  1NTC A;  1ETK A;  2LKX A;  2PMZ N;  3M4O J;  1B72 B;  1HF0 A;  2K40 A;  1WCM J;  2CQX A;  1JKR C;  3S17 J;  2E2J J;  3QPS A;  3RQI A;  2LP0 A;  5IP6 A;  2L7F P;  2JA8 J;  1IDY A;  3BR3 A;  2JK3 A;  5K7H A;  3GTL J;  1ZGW A;  1DU6 A;  4XRM A;  2IBD A;  4QIW N;  1I6H J;  1JT6 A;  4DYC A;  4CYC A;  1YRN B;  2JWT A;  2IAI A;  2MGQ A;  1JJ6 C;  4UUT A;  3BQY A;  2XGC A;  1D5Y A;  3JRI A;  2VPR A;  2Y0S N;  1I3Q J;  2LY9 A;  3H3V K;  1P7J A;  3CQZ J;  3RKQ A;  1ETX A;  1JJ8 C;  3HEF A;  1X58 A;  3ZQH A;  1MBF A;  4D5C A;  1VI0 A;  3JRE A;  3LNQ A;  2JMW A;  2MG4 A;  2XB0 X;  3S1M J;  2LLK A;  2KT0 A;  4A3J J;  2DA3 A;  4C3I J;  3ZQC A;  3PM1 A;  1F36 A;  2K9N A;  3PO3 J;  1B72 A;  2LVS A;  1FIA A;  2MSY A;  2NVY J;  4A3I J;  1LE8 B;  1FJL A;  1GT0 C;  5C44 J;  1RKT A;  2X48 A;  3S16 J;  3OOU A;  5FKL A;  5E3N A;  4AYB N;  1I50 J;  4GFB A;  2DA6 A;  3BR0 A;  2EZK A;  4EEF G;  2DMT A;  5IP7 J;  3JRF A;  2JA5 J;  1MSE C;  2G0E A;  3BTI A;  3G1O A;  4XID A;  4JX5 A;  3DCF A;  5IYB J;  3HDD A;  1WGX A;  3OIO A;  3WHC A;  3E7L A;  4A3E J;  5J1R A;  2DA7 A;  3S15 J;  4XK4 A;  2ECC A;  4B4C A;  2I10 A;  2Y9Y A;  5J3L A;  3M3Y J;  2FQ4 A;  5FKO A;  1Q1V A;  2L9R A;  2O7O A;  5FLM J;  1K61 A;  3FK7 A;  1ZKG A;  2AO9 A;  2EZI A;  2R92 J;  3ZQG A;  5F04 A;  3O8G A;  3D1N I;  2COB A;  2LD5 A;  1ORK A; 
#chains in the Genus database with same CATH topology
 1HLV A;  2DW4 A;  1PUF A;  4M74 A;  1K6Y A;  1HST A;  2K85 A;  2IA2 A;  3E6D A;  5E18 F;  1T8I A;  3PNV A;  4LG0 A;  3FXU A;  1POG A;  2MW8 A;  1FEX A;  2LOO A;  2FU4 A;  3CCY A;  4ZTF A;  3DEW A;  5F1J A;  4II3 A;  2AQF A;  2DJN A;  5TIS C;  2CFO A;  1LFU P;  5IY5 H;  2LNB A;  2XDV A;  1Z05 A;  1LUJ B;  1QHH D;  1WRJ A;  3K2A A;  2OZ6 A;  2AS5 F;  1VQP I;  4KIS A;  2R5Y A;  4E7S A;  5AON A;  1J09 A;  1RPW A;  5F1R A;  1S5L C;  2M0C A;  3ZQL A;  3GX4 X;  3MAJ A;  3LA2 A;  2TCT A;  4N9I A;  2GA2 A;  3NRV A;  2R5Z B;  4M6Y A;  3C3W A;  2XAQ A;  1P4A A;  2KMU A;  3IH2 A;  4MFD A;  1SMY F;  4X0G A;  1PJR A;  1FOK A;  4P55 A;  1W0U A;  4BQO A;  1T98 A;  3IRR A;  3LSJ A;  2LDU A;  2CW8 A;  3O6B B;  5HLT A;  5ILV A;  2O6G E;  3I5U A;  4HG2 A;  4MTD A;  1D1C A;  3UNG C;  4PZJ A;  1OCZ H;  3DTK A;  2EB7 A;  1BR4 A;  1Y1W J;  3ZMD A;  4G12 A;  1K4S A;  1W1W E;  1B6A A;  1ZGA A;  3CUQ C;  3HOW J;  1YI2 I;  4LIV A;  2H1L A;  3BG6 A;  3GBG A;  2MD0 A;  3MVP A;  2LC2 A;  5D4S A;  2HKX A;  2HU9 A;  3FBI B;  3TMO A;  4BU2 A;  1FSH A;  3RJP A;  4IKF A;  4RMN A;  3L2U A;  4RAF A;  5L3C A;  4RGX A;  4BUP A;  3CUO A;  3OYL A;  1LVK A;  4CZZ A;  6PAX A;  2F5E A;  1U3E M;  1OFC X;  2PMZ A;  5AIQ A;  3U21 A;  3HUG B;  2EZL A;  4BL0 B;  2F5F A;  5H6R A;  3AG1 H;  2Y30 A;  3TOB A;  3IP4 B;  4N0B A;  4UB8 C;  2RNJ A;  3A2K A;  2HDC A;  1D5V A;  1IDZ A;  4UY8 I;  2QQB A;  1W36 C;  2DQR A;  3CZ6 A;  4A3D J;  1D1B A;  2J5O A;  4XBF A;  4JBA A;  3GTJ J;  2FNP A;  2QLZ A;  3W6J B;  2DYR H;  1HKS A;  2MD5 A;  2DQL A;  2HPM A;  5IYD J;  5IOZ A;  4G7O F;  2CYY A;  4U7B A;  3CES A;  2ZSI B;  1WH7 A;  4BY7 J;  1X2M A;  2XSJ C;  3L7W A;  4ZYA A;  1GVD A;  1UMQ A;  4HF0 A;  5DDG A;  3K70 D;  2ZJQ F;  1KU7 A;  3I3L A;  1X3W B;  4BQN A;  2M1B A;  1KQ0 A;  2VOD A;  5LRR A;  3KLO A;  1EA3 A;  2ISZ A;  3KP4 A;  2K3P A;  1X3U A;  4G6D A;  3GEZ A;  5J1Y A;  2P6S A;  3QYE A;  4BKX A;  1MGT A;  3I55 I;  3I59 A;  5A2Q Z;  1QNT A;  4D7N A;  4RS8 A;  1WVR A;  1XSX A;  4U0Y A;  1B9N A;  3JRD A;  1IUY A;  2PJR A;  3HRT A;  2E1M B;  2JA2 A;  3BR2 A;  4KT6 A;  1G3W A;  3HTU A;  4RGS A;  1OLT A;  2UUZ A;  1YJN I;  2HWV A;  5LHI A;  3IL2 A;  4M3D A;  1YRN A;  1D0X A;  1IXS B;  5EZG A;  3S2H J;  2V6E A;  2DMQ A;  3FIS A;  2XAF A;  4XSX F;  2DA4 A;  1R36 A;  2FRH A;  3K10 A;  3WTS C;  1U5T C;  4RDU A;  2L9V A;  2DT7 B;  4RAY A;  4A3L J;  4EM0 B;  5CVJ A;  5ICG A;  4HF2 A;  1O3T A;  1DPU A;  1USS A;  2EPF A;  3I4P A;  2JSP A;  4KDP A;  3F8N A;  4NB5 A;  2PJP A;  2EFQ A;  4W1U A;  3GWZ A;  4YG2 F;  4D9J A;  4E7K A;  2RDP A;  4CA0 A;  1IC8 A;  1LEA A;  3K70 C;  2DK8 A;  2FF4 A;  2WAD A;  2X1E A;  2E1N A;  5L3F A;  2DLL A;  2COM A;  3BPX A;  3LSK A;  2EV5 A;  2O0Y A;  2QYO A;  2KRF A;  2W57 A;  1IN4 A;  4V2F A;  3S14 J;  2Y31 A;  2KRH A;  1FLI A;  3LST A;  3HOZ J;  1LFP A;  3LWF A;  2RKH A;  1JHF A;  4EJW A;  3OR2 C;  5F0F A;  3H5N A;  2MLG A;  1HW2 A;  2LR8 A;  3F21 A;  5FLV A;  4G94 A;  3ZQI A;  1N78 A;  1GV2 A;  3CLQ A;  2DMU A;  3B6C A;  3WG9 A;  1D0Y A;  5J8F A;  3UKG A;  2LKS A;  2OV7 A;  5ED4 A;  2KL4 A;  4CXF A;  4IXA A;  4DYR A;  2XV4 S;  2FBK A;  1ZYR F;  2HNH A;  4PSW A;  3MKL A;  1D1A A;  2LFB A;  9ANT A;  4XRF A;  1VQ4 I;  2V1U A;  1OCO H;  4G7Z F;  2YR2 A;  1MMA A;  2L02 A;  2NVQ J;  3FXL A;  3V8L A;  1BR2 A;  1UZC A;  4XLE A;  5J8C A;  5D5W B;  3VPR A;  2PFB A;  4F55 A;  4XLH A;  2DOF A;  2WAE A;  3TO6 A;  4CH7 A;  1XCV A;  1IUF A;  1FYK A;  2ZJR F;  3OL3 A;  3BTL A;  3KIO A;  1J5Y A;  4PFP A;  3BTJ A;  3DEE A;  2GZW A;  2EFP A;  5FB2 A;  2IPQ X;  1XPX A;  4HAM A;  2N8G A;  1ZLJ A;  3EDP A;  3T1B A;  2D2W A;  2BE5 F;  3ERM A;  2XGX A;  4GO1 A;  1V5G A;  2VI6 A;  1K83 J;  1GUU A;  1ON1 A;  1P6R A;  3D0S A;  3KP3 A;  1MDM A;  1KQ8 A;  3IWF A;  3EUH C;  3H0D A;  1QQI A;  3G2B A;  1CGP A;  3GTG J;  3FHZ A;  1ON2 A;  2ZJ2 A;  1GXQ A;  3IAM 2;  3GTM J;  2V26 A;  5ICC A;  3M8E A;  2BW3 B;  1IF1 A;  3BR5 A;  3CMA I;  2P81 A;  5IT9 Z;  5F0C A;  5FD6 A;  2STW A;  1A04 A;  3NAR A;  4R1H A;  4ZYD A;  1VFC A;  3J7Y J;  1S29 A;  4JK1 X;  3TED A;  4FIS A;  3H0G J;  4LG3 A;  3RYR A;  4AID A;  1Y0U A;  1YW8 A;  2AXL A;  1IJW C;  5CVU A;  1J2X A;  3X2Q H;  3HYI A;  2WY7 Q;  5DYM A;  2PMU A;  3JW4 A;  1IG7 A;  3H9J A;  2QSH X;  2HOS A;  1JKO C;  3AFH A;  2A68 F;  2QM3 A;  2GXB A;  1SD7 A;  2CQN A;  2FD5 A;  1MNM C;  1NH3 A;  2W85 A;  1MIJ A;  4PGG A;  2HTJ A;  1FZP B;  1YLF A;  4RLQ A;  2RQQ A;  2AXT C;  3P5J A;  3GXO A;  3HOT A;  2ZO4 A;  5BQT A;  5LGU A;  4LLL A;  5K5Q A;  4WK8 F;  2BYV E;  3FXJ A;  2CRG A;  1R5I D;  3TP0 A;  4JOM A;  1G3Y A;  3IV5 A;  2D45 A;  1OPC A;  1ZHF A;  4DQ2 A;  3WTT C;  1QPI A;  1VQ7 I;  4C2T A;  4L0Z B;  2ICW G;  4IHX A;  3MQ0 A;  1JUP A;  3K69 A;  2VUM J;  3CC2 I;  3I53 A;  5FRO A;  1UJ8 A;  2HQR A;  1ZG1 A;  2O61 A;  3PNY A;  4RM2 A;  5L3G A;  4ZH4 F;  5HDN A;  2E1O A;  4E6K G;  4CYC B;  2FEZ A;  2VIX A;  3MD2 A;  1AHD P;  2EV0 A;  2CUF A;  4CHU A;  1NG7 A;  3MZ8 A;  2HTS A;  3SJM A;  5DD4 A;  2X6Y A;  4A69 C;  2FBI A;  3CO6 C;  4HDV A;  4EJT A;  4ZTJ A;  3WHB A;  2VJ4 A;  3S1N J;  2W82 A;  1T38 A;  1OR7 C;  5IOY A;  4UUS A;  2E60 A;  1YG2 A;  2PMH A;  2WB1 A;  5KK1 A;  4AM3 A;  3C7J A;  3COA C;  2HDD A;  2Y2Z A;  2EZH A;  3WGG A;  2QSF X;  3H1C A;  3GZN B;  1XGS A;  3GTO J;  4MNU A;  2OQR A;  1U5T A;  1NTC A;  2PMZ N;  3M4O J;  2K40 A;  1HSJ A;  3S17 J;  2CQX A;  1FBU A;  3HKZ A;  2E2J J;  1N75 A;  3S32 A;  4F52 A;  2BVM A;  3QPS A;  5A2Q K;  5E17 F;  1HA8 A;  3DP7 A;  2P5K A;  3DU6 A;  2WBM A;  5IP6 A;  4RB2 C;  3FXR A;  2L7F P;  5LRS A;  2JK3 A;  1U0J A;  3ZCO A;  4M6X A;  1S3J A;  5ERI A;  2ZXH A;  4U88 A;  5JHU A;  1I6H J;  1MZB A;  3HSE A;  2QKM B;  4E4H A;  4YII A;  3VOD A;  2JQ7 A;  5FD5 A;  2MGQ A;  1JJ6 C;  2XIG A;  3BQY A;  3IUO A;  1DP7 P;  1D5Y A;  4IOC F;  3PFI A;  2Z9O A;  5J47 A;  4A6E A;  4HF1 A;  3CUQ A;  4C30 A;  3L9F A;  3E1S A;  1S7A A;  3HRM A;  4HPQ A;  4BHC A;  4KIB A;  1X58 A;  4CO8 A;  3LNQ A;  2VBX A;  2JMW A;  2XB0 X;  4OAZ A;  3MWM A;  3GFL A;  2DYS H;  3ZMV A;  5EJC A;  1F36 A;  2OUM A;  2HZT A;  1B72 A;  5E20 A;  2IGM A;  4ZDO A;  3V4G A;  5HS8 A;  1A36 A;  1LE8 B;  1RUN A;  1GT0 C;  3DV8 A;  3BPV A;  3MZH A;  2X48 A;  1OYY A;  3OOU A;  3GLL A;  1ZG5 A;  2MAB A;  2UWM A;  2VXD A;  3CC7 I;  3KX2 A;  2CW7 A;  3FX3 A;  3SFZ A;  3MFK A;  4EEF G;  1IRF A;  2F5V A;  5DCM B;  5IP7 J;  2X0L A;  2JA5 J;  1MSE C;  1VTN C;  2F4O B;  3ZMU A;  3G1O A;  1W5S A;  3DCF A;  5HDG A;  3HDD A;  3M9A A;  3WHC A;  3E7L A;  2DA7 A;  2ECC A;  1TZL A;  2I10 A;  3QP5 A;  4EV0 A;  3M3Y J;  1JHH A;  4FHT A;  5BS6 A;  4ZC3 A;  2BY2 A;  1DPR A;  1TTY A;  1K4T A;  2L9R A;  3DF8 A;  2O7O A;  2R4G A;  4K2E A;  4NC6 A;  4HYE A;  3FK7 A;  4OMY A;  2Q0O A;  2R92 J;  3LAJ A;  5AIP A;  1RC9 A;  2DPD A;  1ZLK A;  1ORK A;  3OR1 C;  3OYC A;  1OJL A;  3E3V A;  4XOP A;  3MMY B;  1U78 A;  5EG0 A;  3R0A A;  1H9T A;  2Z99 A;  3PUB A;  3ELK A;  5CQG A;  2VQL A;  3C2H A;  4P1W A;  2NVT J;  1ETW A;  3G1M A;  3F3X A;  1F1Z A;  3RKX A;  2DA1 A;  1V3F A;  3L1P A;  4R79 A;  1HDD C;  1W0T A;  1Q1H A;  4RA2 A;  3H3U A;  3ISP A;  1A5J A;  2C6Y A;  2AHQ A;  2XRO A;  1OMI A;  4I09 A;  2PQ8 A;  1BI3 A;  5KHD A;  3JSP A;  5KCM A;  5TGT A;  3FM3 A;  2XHK A;  1MBK A;  3LMM A;  5LHG A;  3HGY A;  1FYL A;  3IC7 A;  5LEJ A;  2V4J C;  5EGO A;  2Q8K A;  4EJV A;  4WXC A;  3BZ6 A;  4M3B A;  1RRJ A;  2JPC A;  2X1D A;  4LFU A;  2HVS A;  2OA4 A;  1F4K A;  3N97 A;  4CCL A;  2HGC A;  2CUJ A;  1QGP A;  2Y0M A;  1SD4 A;  3Q0W A;  3K7A J;  3PNT A;  3MZY A;  2OZU A;  1WKM A;  3GW2 A;  1YFH A;  1ZQ3 P;  4J19 A;  4NBQ A;  1ETV A;  3K1N A;  2FXA A;  3HXL A;  3SDG A;  2RNG A;  4BDY A;  3DBL B;  1QHG A;  4P5O A;  2ELH A;  4X6A J;  2Q1Z B;  2YU9 J;  1PVE A;  2VC0 A;  2Y0S A;  4PJ0 C;  3OIQ A;  4D7M A;  3FK6 A;  3JRG A;  3EYI A;  3JRB A;  4KT5 C;  4JYK A;  4U87 A;  2Z3Y A;  4YIR X;  2HPI A;  3GFJ A;  1YW7 A;  2K4B A;  3QYF A;  4M3E A;  3EUA A;  2V1X A;  1IO2 A;  4EQQ A;  4E70 A;  2IGN A;  2VJI A;  3ZQF A;  2CV2 A;  3K6G A;  3GZ6 A;  1BI0 A;  3TGN A;  3V7C A;  2MLK A;  4NQW A;  2E2H J;  2V7F A;  4RBO A;  4EGZ A;  1Z1D A;  1H89 C;  1MMS A;  1RZ4 A;  2D1V A;  2XAH A;  2RC4 A;  2BY3 A;  3SQN A;  2DA2 A;  5TRD A;  3SXY A;  1DGW Y;  3A03 A;  4XN0 A;  3LSG A;  2Q2E A;  1SVL A;  1TWC J;  2LBF A;  3KEO A;  4XOR A;  2NRA C;  1JUS A;  3LSP A;  4MLO A;  3ZXS A;  1GV5 A;  2CFX A;  4FE7 A;  4Y13 A;  5E1Z B;  1X19 A;  3H92 A;  3MN2 A;  5ILU A;  3FZV A;  2ID6 A;  4O3M A;  3OMY A;  2IXS A;  1AWC A;  4PJM A;  2LRD A;  3LAP A;  4OU0 A;  3ERE D;  1IXR C;  2JA7 J;  5DUI A;  3BJ6 A;  2E71 A;  1W5T A;  4GXO A;  2IGK A;  2BEO A;  1VF9 A;  3HOY J;  1WFX A;  3GLX A;  2MC4 A;  3P9I A;  4FTH A;  2VT3 A;  1FC3 A;  4HA8 A;  2F5D A;  5IT3 A;  1IV8 A;  1MD0 A;  1ULY A;  5LGN A;  3JR9 A;  1B59 A;  4A3K J;  2HVR A;  2DPU A;  4ENN A;  4OIP F;  3BG5 A;  5J4V A;  2VOP A;  4UVA A;  1ETQ A;  3DWL E;  3KFW X;  4XKB A;  3DKW A;  1WJB A;  2VBZ A;  1V5E A;  3CP2 A;  2E34 A;  3CJT B;  2LY2 A;  4EMS A;  1MBH A;  2DO7 A;  2X4H A;  3ZR8 X;  4YFK F;  4ON0 A;  1G59 A;  2BHY A;  4PJN A;  1WI3 A;  4B09 A;  2W48 A;  3A0B C;  3ZGK A;  4A3B J;  1Z77 A;  2OJE D;  3Q9S A;  4OIO F;  4XQF A;  3OYI A;  3T8R A;  4Q48 A;  4OIN F;  4C2U A;  2VPL A;  4D1Q A;  2ID3 A;  3BLY A;  2R5Z A;  4KIT B;  1XGN A;  1I1G A;  1YQA A;  2YUS A;  2DU9 A;  1S6L A;  1UAA A;  1JT0 A;  1ZG3 A;  1GLN A;  1MKM A;  1OIS A;  3ULQ B;  4ABZ A;  3ZOB A;  2HKO A;  4DBR A;  1V55 H;  4XSZ F;  1R58 A;  3KP6 A;  4MTE A;  3ML6 A;  2F4M B;  4QWQ A;  3KLN A;  5E1W A;  1BIA A;  3HSF A;  1H9G A;  1MJ9 A;  2K9Q A;  3EET A;  3O3K A;  5GTH C;  1ZGJ A;  5DM6 F;  2NVU B;  3K4J A;  2ME0 A;  3DPL C;  3E5Q A;  3ECO A;  3LOC A;  3VYU B;  2X6O A;  4PFO A;  1BL0 A;  2ZME B;  5JLX A;  3ZMT A;  1QZY A;  2CJJ A;  4WXD A;  2FSW A;  2QWW A;  5FRN A;  1WQ2 A;  5TJJ A;  3U9G A;  4M72 A;  2WV1 A;  4OWR B;  2XF5 A;  4X1E A;  5DTD A;  3QOP A;  4ZZL A;  5HLI A;  1VND A;  4ZYH A;  1ZEL A;  1H8A C;  3DKX A;  1JTY A;  2A3S A;  2H8R A;  3FDY A;  5E3M A;  4OIQ F;  5GAD J;  3WTZ A;  2KIU A;  2ZCW A;  2XSD C;  5CVI A;  2HEO A;  3JRC A;  3CDL A;  4M6V A;  4I99 C;  3W2W A;  2M2E A;  1R4N B;  3ZRG A;  1OCT C;  3LFU A;  3PJR A;  3AKZ A;  1QRY A;  4CCO A;  2JZY A;  4YRV A;  1AU7 A;  3GUD A;  2R7T A;  4W97 A;  1KYZ A;  1U6G A;  4KUM A;  5C3E J;  2XPU A;  2ZXJ A;  5C4X J;  3M7G A;  2KZV A;  4LG0 B;  2QQ9 A;  1SFE A;  2I8D A;  4B1R A;  1HW5 A;  4C3H J;  2Z5U A;  3LQQ A;  3TDZ C;  2JSC A;  5ILS A;  1HQC A;  2BXZ A;  2H09 A;  2IS4 A;  4UVB A;  5D5U B;  3G71 I;  2FA5 A;  3I4N J;  1BW5 A;  2QEN A;  3HGG A;  2E1M C;  3LFK A;  2P8T A;  2QBY B;  3DQV C;  1TC3 C;  2L01 A;  4B8X A;  2WA0 A;  2DAO A;  4YIF A;  4DOZ A;  3VSL A;  2VKE A;  4BJ5 C;  3A1Y A;  1UFM A;  5DEQ A;  4BY1 J;  3Q3S A;  4IHW A;  2WV0 A;  3W2V A;  2EV6 A;  2OQG A;  3QAH A;  4E7H A;  3F72 A;  3ASN H;  2L0K A;  3SZT A;  2P5L C;  1EKE A;  1IN7 A;  2BZT A;  2GBY A;  1K78 A;  4BAY A;  2A61 A;  3WU0 A;  2R7U A;  1O3S A;  1TQM A;  2OC6 A;  2P6T A;  5J4Y A;  3M1C A;  1ETY A;  5EEG A;  4LMY A;  2XAJ A;  3FIW A;  1Z67 A;  3REO A;  3RTR A;  2GQQ A;  2X6X A;  1YW9 A;  1BC7 C;  1XB4 A;  2XGE A;  3H5R A;  1JGG A;  2HFH A;  3NQO A;  5IYC J;  4IRG A;  4BBR J;  4D5F A;  2R0Q C;  3KCC A;  2GWR A;  1JI8 A;  4MHG A;  2R7V A;  1BJZ A;  1QVU A;  3VEP A;  1RKW A;  1JUM A;  3ABT A;  4A5N A;  4I0B A;  3K9T A;  2L4M A;  3E6B A;  2YSR A;  3PSI A;  2HZD A;  3E6C C;  2DOE A;  5M3F J;  4E7J A;  1B8I B;  3AG3 H;  3DLA A;  2VL8 A;  3WTV C;  2VKD A;  4AVP A;  2JPB A;  2PEX A;  5F6F A;  3BOQ A;  3OYK A;  2WAF A;  1TNS A;  5M5Y J;  2V9V A;  4WCG A;  1R49 A;  3VWB A;  1F9N A;  3IAS 2;  1XCB A;  3HJE A;  3A01 B;  3CDH A;  2H1K A;  4HW0 A;  4I0A A;  4XLC A;  3GCM A;  3KPH A;  4HX8 A;  4AIJ A;  3CD6 I;  3GO5 A;  2QGU A;  4KFC A;  4XRS A;  2IA0 A;  1O4X A;  3OY9 A;  1LNW A;  3C18 A;  2QCO A;  3DTI A;  3AAF A;  5LD2 C;  5H6Q A;  3PQK A;  3CTA A;  3OYD A;  2EH3 A;  1RR8 C;  3H9G A;  3QPT A;  3KYL A;  4AD9 A;  5BOX A;  2H94 A;  3WTX C;  3KZI C;  2K7L A;  2V9K A;  4XLA A;  1F43 A;  4A6D A;  5FKM A;  3B6A A;  4BJ6 C;  1R9T J;  3VYS B;  2CG4 A;  1VQN I;  4PCQ A;  1MNE A;  2QA4 I;  1XDU A;  2DN0 A;  3T5X A;  2IS1 A;  4LK1 F;  5F0H A;  3A02 A;  1WJC A;  1ETK A;  1MND A;  2LKX A;  1HF0 A;  1WCM J;  1JKR C;  3MKZ A;  3S3O A;  3PQJ A;  4ZYG A;  4PK4 A;  3I59 B;  4CCN A;  2L2O A;  1YJ9 I;  2ELJ A;  2JA8 J;  3BR3 A;  3F8B A;  3PFY A;  4XRM A;  2Z33 A;  3LL7 A;  4IRH A;  4QIW N;  1Y56 A;  1I27 A;  1WJF A;  1ERD A;  1O3Q A;  3BRO A;  1J59 A;  1YRN B;  2JWT A;  1NHA A;  1P9Q C;  1R7J A;  1MDM B;  5KAI C;  3SEZ A;  1K6O A;  2CGP A;  3AL0 C;  2HQA A;  2CMP A;  3G6E I;  2DK5 A;  5J40 A;  1RNL A;  3WGI A;  1YTY A;  1WWX A;  2L9N A;  4Q5S F;  1FMV A;  2LY9 A;  1KQ9 A;  2BW3 A;  2VBY A;  1FSE A;  3CQZ J;  2KHM A;  3HPG A;  2EIL H;  1ETX A;  3QOD A;  4XLN F;  4EJO A;  1U2W A;  5CKT A;  1VQ9 I;  3ZQH A;  1MBF A;  5E8G A;  4D5C A;  2YPR A;  2LH9 A;  1P4X A;  2VN2 A;  2MG4 A;  1KA8 A;  1E0E A;  3Q9V A;  2KT0 A;  4A3J J;  3H5A A;  3RCO A;  2FQ3 A;  3LSH A;  2LKP A;  4C3I J;  4XN3 A;  3CCR I;  4IRI A;  4CSW A;  2BHZ A;  3LA7 A;  1Y8R B;  2P5V A;  1FIA A;  4LJZ F;  2MSY A;  5B3S H;  3I71 A;  2FMY A;  3TL4 X;  1FJL A;  2NNN A;  4A12 A;  3CJR B;  5C44 J;  2LYC A;  4CCJ A;  1WSU A;  4H0E A;  5K1Y A;  5FKL A;  5E3N A;  2F6C A;  3CCQ I;  4AYB N;  2H6C A;  3BR0 A;  2VAS A;  3CLO A;  2YX4 A;  1BN5 A;  3KEQ A;  4HLX A;  2L7K A;  1TW2 A;  3BTI A;  2GXG A;  5E1X A;  4FQG A;  5IYB J;  2A6T A;  1W36 D;  5JR3 A;  4XK4 A;  3H35 A;  2VJ5 A;  4B4C A;  2L5Q A;  3BDD A;  1R1V A;  2FQ4 A;  4KN7 X;  4KMF A;  1A6Q A;  2KQR A;  5FLM J;  2VQH A;  2AO9 A;  2UXX A;  2CV1 A;  3J80 Z;  5CYV A;  5LBQ A;  4XL9 A;  5F04 A;  3O8G A;  2LD5 A;  3KE2 A;  1R6R A;  2O9L A;  1TL8 A;  4RGU A;  2NS0 A;  5K5R A;  2EIN H;  2XRL A;  1IXC A;  2V9P A;  2CUE A;  4HX4 A;  4BS9 A;  1YJW I;  2NYX A;  3E5X A;  4F91 B;  3RI4 A;  1D8J A;  3S1R J;  4N4N B;  3RQ4 A;  1TWG J;  3BZK A;  1SVO A;  2DA5 A;  1DUX C;  2HDW A;  2X6W A;  3ABU A;  3BR6 A;  2BY1 A;  3WOD F;  1QPM A;  1OQY A;  3V8K A;  4HNV A;  1XG1 A;  5DS9 A;  2DFF A;  3HUG A;  2BBY A;  2IS6 A;  2AQE A;  4OIR F;  2FOK A;  2HXO A;  1WPK A;  4AIH A;  4EM1 A;  3F22 A;  2NVX J;  4UUV A;  3ZN1 A;  2HQ5 A;  3KP7 A;  4HLY A;  1MMN A;  1W7P B;  1K79 A;  3VYR B;  4C2M J;  5K7F A;  4UHT A;  3L2V A;  2W4S A;  4GGG A;  4B43 A;  1CF7 B;  2ACJ A;  4NC7 A;  5KAF C;  3BCA A;  3BG7 A;  3L00 A;  2G9W A;  5FFX A;  4F92 B;  3AG4 H;  3OYN A;  4P9F A;  2IS2 A;  3L2Q A;  3K1P A;  1X1D A;  5CVV A;  3EPZ A;  4IPA A;  3G1L A;  4KIC A;  2CWE A;  2HXI A;  2RV8 A;  2PI0 A;  1X1A A;  1LDJ A;  1R5G A;  2HQN A;  1YYV A;  2M30 A;  2W84 A;  3OYJ A;  2XPW A;  2ZKZ A;  4KJZ A;  4ESJ A;  5KVR A;  2ISY A;  3HRU A;  3NWT A;  1RI7 A;  1T39 A;  2GA1 A;  3BG3 A;  1PP8 F;  1QA6 A;  1I5Z A;  4UB6 C;  4ETS A;  1SC7 A;  1HKQ A;  2XPV A;  4IX7 A;  1LQ1 A;  1EH6 A;  3K4L A;  2JVG A;  4BQQ A;  3GTQ J;  4LLN A;  2KPM A;  1HBX G;  1XS9 A;  3RIR A;  1Y6I A;  1BA5 A;  4I2O A;  4LOC A;  3DFG A;  1S9H A;  3AG2 H;  3FMR A;  3F6V A;  2R5Y B;  1LE8 A;  1TT0 A;  2ZFU A;  3VOE A;  3JAM K;  2PJR B;  1X4P A;  4A3M J;  5JVG F;  2UV1 A;  3HOS A;  3QQA A;  1BM9 A;  2ZJP F;  1FTZ A;  1Z7L A;  3GZ5 A;  2GIV A;  4XR6 A;  5DCM A;  3FKI J;  3NEU A;  2V1D A;  3TDU C;  1TNT A;  4J00 A;  4B3X A;  4DGW B;  3SHF A;  5E8I A;  1FIP A;  4NNJ A;  2FX0 A;  3W6V A;  4HDU A;  3L2R A;  4RM3 A;  3PIP F;  5C4J J;  2PBI A;  2KDZ A;  1R71 A;  1O57 A;  5FLX Z;  5HOD A;  4ESB A;  1P7I A;  2OPT A;  4IQJ A;  4HOB A;  3RDI A;  2L7M P;  2ADU A;  2FUG 2;  4QLC U;  4NHJ A;  4KNY A;  1PUE E;  5IP9 J;  1G6N A;  3TOA A;  2KIF A;  2M4K A;  4DZJ A;  3OYB A;  2CS3 A;  2FML A;  3BCB A;  3GFI A;  4GDF A;  1ZRF A;  1RR7 A;  5IPA A;  4XKW A;  3QPH A;  4QTR A;  1A6I A;  2HOT A;  4PSX A;  4Y3O A;  3I0T A;  1X1P A;  2EIK H;  3RYP A;  3I4M J;  1I3A A;  1EH8 A;  4E7I A;  1IRZ A;  2P7V B;  2XAU A;  3OIP A;  3Q0V A;  4BDZ A;  4ASN A;  4AIK A;  3HHH A;  3DKY A;  1AKH A;  2A5W A;  1MH3 A;  3AL0 B;  4DJA A;  5GPC A;  1H88 C;  4BXX J;  5HVQ C;  3RKW A;  2D1H A;  3R6S A;  1Z21 A;  4Q4Z F;  2K5C A;  4MGR A;  3OYF A;  3HC7 A;  3CCV I;  1SD5 A;  2E36 A;  3FXO A;  1O7L A;  3G3Z A;  2PLY A;  3BZC A;  5E79 C;  1S7O A;  2A5Y B;  2GIZ A;  3I56 I;  1SFU A;  1KU3 A;  2EQR A;  1RET A;  3WE2 A;  3M1E A;  1OR7 A;  4HRI A;  1WZ2 A;  2Z16 A;  1XN7 A;  2OF7 A;  2X51 A;  4IHV A;  3W2A A;  1UST A;  1YX3 A;  1LKX A;  2K9L A;  3VFZ A;  1SMT A;  2JJ7 A;  2WB1 N;  1C0W A;  3ESW B;  3EYY A;  5JI6 A;  2KJB A;  3SZG A;  3JRA A;  2WY8 Q;  5F08 A;  4FX4 A;  4O6J A;  4HQM A;  2NAZ A;  3BR1 A;  4B44 A;  2YS9 A;  1ODD A;  1PDN C;  1EF4 A;  2O8X A;  4L5J A;  1F5T A;  1IGN A;  3OYA A;  4HX7 A;  3GYH X;  5DUK A;  2F2E A;  1NK3 P;  2CQ7 A;  3J7A O;  1RIO H;  1FP2 A;  2ZBK A;  4V2G A;  3CMY A;  4MO7 A;  1MJA A;  3FMQ A;  3P9C A;  4I76 A;  3CJN A;  3CF5 F;  4AYB A;  1U8B A;  2VQG A;  2F48 A;  1JE8 A;  4U7D A;  1APL C;  2IGO A;  1SEU A;  4S05 A;  5EEA A;  2DTZ A;  4B3A A;  4A93 J;  1FOY A;  1REP C;  2GAU A;  3SDB A;  2MA3 A;  5EYR A;  4ZZD A;  3V7R A;  3S3M A;  1OCP A;  3IRQ A;  3DLL F;  1W4M A;  4CUG A;  4RGR A;  5FKK A;  4O5V A;  5E3L A;  4BEH B;  1S72 I;  1BIB A;  1ZAO A;  2KIS A;  2F5C A;  1B4A A;  1CQT A;  2DMN A;  2OTJ I;  4Y33 A;  3E6M A;  3SFI A;  4UVC A;  5HNF A;  4XM3 A;  2MH2 A;  3WE3 A;  4BH9 A;  3LQR A;  4EGY A;  1R1U A;  1SFK A;  1PP7 U;  5ICE A;  3R0J A;  1MH4 A;  1T0F A;  1ETO A;  3RPQ A;  1ENH A;  3WTW C;  3CCU I;  1XGO A;  4HZF A;  3GTK J;  2ELK A;  4HNT A;  3U1K A;  1P4W A;  3KZY A;  1FBS A;  2M5W A;  2RGV A;  3ABK H;  4F93 B;  3J81 Z;  2HVQ A;  2EK5 A;  4OOI A;  1YIO A;  3FXM A;  1B8I A;  1ITY A;  3HHG A;  5DM7 F;  2Y75 A;  3S93 A;  4JP0 A;  5HLG A;  2OD5 A;  4L9T A;  1XD7 A;  1FMW A;  3HPH A;  3GF2 A;  1T0F C;  3L2W A;  3TKY A;  4BYY A;  2M8G X;  3MKW B;  1FP1 D;  4FAS D;  3HZJ A;  2GOM A;  2W24 A;  1X1B A;  3JSO A;  4M3F A;  1BBY A;  3QPL A;  4MIM A;  2R7S A;  5B1B H;  2E5Z A;  3DPU A;  2B63 J;  4M9Z A;  4LB6 B;  3OYM A;  2Y9Z A;  5BMZ A;  3CCM I;  3I58 A;  4S04 A;  2WAQ N;  4P9U A;  2O03 A;  2DFI A;  2ZNZ A;  3OYH A;  2L9S A;  3SEQ A;  5M3M J;  2YX7 A;  1ZAR A;  1EJ9 A;  2ESH A;  4DNC A;  4L5I A;  1D3Y A;  4F7Z A;  4AU7 A;  1WHU A;  2XAG A;  3HB9 A;  4MEY F;  4XRS G;  2HR3 A;  2NOJ B;  4UUS B;  1DU0 A;  5CQE A;  3A0H C;  4MQ9 F;  1SFO J;  2M9H A;  1BC8 C;  1ZR2 A;  4FX0 A;  5EEH A;  1YIJ I;  5D6F A;  4KIG A;  1V5F A;  4BGD A;  2V1N A;  1IRG A;  2K9M A;  5CJ9 A;  3WGH A;  4DYQ A;  1VQM I;  4LIU A;  1MMG A;  1W7P D;  2V79 A;  2ZNY A;  3M8J A;  2L4A A;  1FOX A;  1XDS A;  3TO9 A;  1NG6 A;  4ESF A;  2B0L A;  2RVC A;  2H6B A;  1GDT A;  4BQA A;  2MH9 A;  1G2H A;  2RQP A;  4RB0 A;  1HCR A;  4RB3 C;  2GLO A;  5D5V B;  4CGZ A;  1EV7 A;  2GOX B;  3ASO H;  2G7H A;  3U2R A;  5E3O A;  4N4O B;  2LRE A;  2K4J A;  2JN6 A;  3DU5 A;  3HTS B;  2W00 A;  3FMS A;  5M5W J;  4G9Y A;  2HOE A;  1S7E A;  3S2W A;  1Y1V J;  2EA2 A;  2JRM A;  3J80 K;  3EQL F;  3OS1 A;  1ACI A;  1WJD A;  3M07 A;  2XF6 A;  4OMZ A;  1Y8Q B;  3K4K A;  1ZN2 A;  4YFX F;  3F9K A;  3RSN A;  3S2D J;  3K4B A;  2M7A A;  1FTT A;  2DFE A;  2KP6 A;  3GFM A;  1I39 A;  5JVT A;  1B9M A;  2A6H F;  1PUF B;  2ZB9 A;  4I02 A;  3P7N A;  1Z6R A;  2IT0 A;  1BW6 A;  4XON A;  2LSO A;  1JTX A;  3O8H A;  3FKJ A;  4XKC A;  3RZO J;  1R23 A;  2R7Z J;  4XIC A;  2CQK A;  4ITV A;  2VE9 A;  1K7A A;  1BJA A;  3PUF A;  1YOV B;  3RPU D;  4KN4 X;  3L09 A;  2DBB A;  4G8X A;  3F23 A;  3ZMS A;  3J7A Y;  5FRM A;  3FXQ A;  2M4G A;  1B72 B;  3ZQQ A;  2NXN B;  1PYV A;  1YX5 A;  3OYE A;  2VON A;  4L9V A;  1AA7 A;  2VLA A;  4MEX F;  1FY7 A;  1W5C C;  1XMX A;  3I54 A;  4RLF A;  1QBJ A;  3CCS I;  5K7H A;  3GTL J;  1HKT A;  1DU6 A;  1ZH5 A;  2IBD A;  5D4R A;  1P92 A;  4L18 B;  4DYC A;  3VYT B;  1T08 B;  2H8W A;  1Z7U A;  2CH0 A;  3GVA A;  2IAI A;  4GCV A;  1T95 A;  3ONQ A;  2IVM A;  4UUT A;  3R61 A;  1X3Z B;  2XGC A;  3L2C A;  2VPR A;  5CLS A;  5HS9 A;  5JHF A;  2Z2S B;  4HST A;  1P7J A;  4H4K C;  5D5X B;  3ECH A;  3RKY A;  3KZZ A;  3HRS A;  2XVC A;  1FNN A;  1LJ9 A;  1VI0 A;  3JRE A;  2IW5 A;  2DTR A;  3S1M J;  4F3Q A;  2LLK A;  4IHT A;  2MBF A;  3F8M A;  4HV6 A;  1LPQ A;  3JCU C;  3FM5 A;  5CVR A;  1G8X A;  5FLX K;  2OU2 A;  4NC8 A;  4EAT A;  3S8P A;  2CO5 A;  1J7K A;  2W1O A;  3P9K A;  1I1S A;  1SVM A;  1Z6T A;  1JGS A;  3S16 J;  2QSG X;  3CC4 I;  5CPR B;  3ZPL A;  1I50 J;  4GFB A;  2DA6 A;  3K0L A;  4CDG A;  3QP6 A;  4WXH A;  3PIO F;  1XSD A;  2EFN A;  4JQF A;  3PL8 A;  1HW1 A;  3OS0 A;  3W6K B;  2OAZ A;  1VQ5 I;  3DBH B;  3WTU C;  3IKT A;  2BOL A;  4ENJ A;  1R1T A;  3WU2 C;  2VBW A;  2KJC A;  1TBX A;  5FFZ A;  3E0J B;  5J1R A;  3CP8 A;  1W7P A;  5J3L A;  1KYW A;  2L54 A;  2R7F A;  5ICF A;  1X1C A;  5FKO A;  1DP3 A;  3BJA A;  3C1D A;  3BJO A;  2I5U A;  1K61 A;  4YFN F;  1ZKG A;  2M7B A;  3ZQG A;  2CW0 F;  1CF7 A;  3D1N I;  2COB A;  3MEX A;  4Z2Y A;  5D8L B;  3IH3 A;  4FCY A;  3HOU J;  4IJA A;  2IJL A;  3T8T A;  2NS8 A;  1D0Z A;  4AWX B;  5BPD A;  3OWT A;  1NK2 P;  4E7L A;  3FXK A;  2TRT A;  3BG9 A;  4Y52 J;  4U0W A;  1L3L A;  2FNA A;  4IHY A;  4A3F J;  3HOV J;  3R60 A;  5B66 C;  1T2K A;  3H36 A;  1OKR A;  1RES A;  3KYC B;  3BWG A;  2E19 A;  3MCZ A;  1XMK A;  2IA1 A;  2V6C A;  2Q2E B;  5FKN A;  3F0C A;  4MFE A;  2ETH A;  5BPI A;  1R5H A;  5FO5 A;  3BP8 A;  3IHU A;  3HOX J;  1AOY A;  1TT5 B;  4I01 A;  5EDN A;  3LSM A;  3DEU A;  4G6Q A;  4KA4 A;  2UZK A;  2FOW A;  2KLO A;  1QVT A;  2VJJ A;  2ME6 A;  2GM4 A;  1R4M B;  1LDK B;  2XUB A;  1VQ8 I;  2VC1 A;  1OYW A;  4PUS A;  5DD8 A;  2Y48 A;  2R7D A;  1WI9 A;  3DBR B;  4CIC A;  1K78 B;  1E17 A;  1BI1 A;  3QU3 A;  1OCC H;  1STZ A;  3OOP A;  5F64 A;  1QZZ A;  4ZJZ A;  2DT6 A;  3K4N A;  1KZH A;  5GTI C;  2TDX A;  4EVI A;  2OCE A;  4I7H A;  1Z0X A;  2ECB A;  3CCL I;  4U0V A;  2R7W A;  1G3S A;  4HNU A;  2FBH A;  4L5E A;  1SFX A;  4II2 A;  3TW7 A;  3E97 A;  3DPT A;  2WTE A;  2EFW A;  4DZP A;  2EA4 A;  2PX9 A;  1FYM A;  3UR3 C;  1P2F A;  2VB6 A;  5L3E A;  3V42 A;  5GPA A;  3JRH A;  4WF2 A;  3BTC A;  4GYI A;  2NS7 A;  4Y15 A;  2R7R A;  5D6E A;  3FF5 A;  5EGO B;  1SAU A;  2KFD A;  2O8K A;  3ZQ7 A;  4IF4 A;  1WJ5 A;  2JUG A;  4R8H A;  1J9I A;  1VQ6 I;  4HBL A;  1VQL I;  1WJA A;  2DCE A;  2K86 A;  3D5R C;  1Z3X A;  3EUH A;  4YEL A;  5K5O A;  4AVZ A;  1VQK I;  4IHS A;  4S0H B;  2JUC A;  1N25 A;  3QU6 A;  4A3C J;  4L9J A;  2FE3 A;  2K3F A;  4XMY A;  1MW7 A;  2X1C A;  3LA3 A;  2PN6 A;  3Q0U A;  3SYT A;  4BE1 A;  1AKH B;  2EIJ H;  4Y7N J;  3ROU A;  4UNO A;  4EM2 A;  1SAN A;  1V4R A;  3RPU A;  2R7O A;  2OCC H;  4A3G J;  3D5L A;  5LFA A;  2DI3 A;  2X85 A;  2P4W A;  2ZME C;  5D8K B;  4B48 A;  2M8E A;  4IL6 C;  1G3T A;  3KYD B;  3VDX A;  5IT9 K;  1XSV A;  4BE0 A;  2LMD A;  1XGM A;  2BVL A;  5HLH A;  5HNH A;  3CCE I;  3KET A;  1R00 A;  2PG4 A;  5KNL A;  3CF2 A;  4KYW A;  1VQO I;  2ZME A;  3E5U A;  3IH4 A;  3OSG A;  1TQP A;  4JX4 A;  3NAU A;  4B47 A;  1DQU A;  1BI2 A;  1YIT I;  1Y39 A;  2W25 A;  5K7Z A;  1J0R A;  3ZP5 A;  5F27 A;  1KU9 A;  3J81 K;  2ZC2 A;  4A2U A;  1JKP C;  2XF7 A;  3S3N A;  4KMU X;  1UHM A;  3TW6 A;  4BJT A;  1T56 A;  1E3H A;  2BV6 A;  2VQC A;  4DW6 A;  1Z91 A;  2Z1D A;  4UV8 A;  2JA6 J;  4GYG A;  1UB9 A;  2XB5 A;  3HSR A;  5EZH A;  3CMM A;  4FE4 A;  1FX7 A;  5HOO A;  4UV9 A;  2BXY A;  4M71 A;  3ZN0 A;  4C9Y A;  2HOA A;  4Y4R A;  1YHQ I;  3CUQ B;  1LFB A;  2VOO A;  2DMP A;  1GVJ A;  2NOG A;  1IN6 A;  2DOD A;  2R7Q A;  1FOW A;  1Y0N A;  2D5V A;  3K4M A;  4DBQ A;  1TLH B;  2CU7 A;  4I6Z A;  5FJ8 J;  3GTP J;  3NWS A;  4LIT A;  3IWZ A;  1XC5 A;  2MFZ A;  3EUK L;  4AUX A;  2B9S A;  2K9S A;  2KIM A;  2MYS A;  3KP2 A;  2BGC A;  4CZC A;  4RAZ A;  1MSF C;  3B02 A;  3G4S I;  2IEK A;  4HEA 2;  1TWH J;  3HBL A;  4EJU A;  4BEH A;  1IV6 A;  1SD6 A;  5DCF A;  4HSR A;  3K1M A;  2E1C A;  4HQE A;  3LSR A;  2RN7 A;  4IEJ A;  1TQI A;  2QVO A;  2XRN A;  3K2Z A;  4LK0 F;  4BXF A;  2M45 A;  2XKO A;  2KKO A;  1FBQ A;  4I98 B;  4E7Z A;  4BAC A;  1XX5 A;  3OSF A;  1BOB A;  1MBG A;  2VE8 A;  1G4D A;  5HS7 A;  3U1D A;  2LF7 A;  5JLW A;  4C3J J;  3QRF F;  1T6S A;  2CSO A;  3SZP A;  1U8R A;  2QBY A;  2K27 A;  5M5X J;  2KZG A;  4QPQ A;  3MKY B;  3Q5F A;  1D8K A;  2LF8 A;  5GAE J;  5L3D A;  1ZTR A;  3HM5 A;  4L9N A;  2VXZ A;  3N4M A;  2DXI A;  4KIF A;  2EFO A;  2X9D A;  2CQQ A;  3KP5 A;  2F4I A;  2CUZ A;  1T33 A;  4NUB A;  1HOM A;  1OCR H;  2M0M A;  4JX6 A;  3DTE A;  2DFH A;  4G6T B;  2R3S A;  2VKV A;  2FJ1 A;  3TO7 A;  1O3R A;  4IO9 F;  2E5N A;  2VKH A;  1E3O C;  3BC8 A;  2ZXW H;  5EG0 B;  3OL4 A;  2BY0 A;  1YS6 A;  5BNG A;  1U5T B;  2LK2 A;  1XMA A;  1LVA A;  1UG2 A;  1UHS A;  1ZK8 A;  2HYJ A;  1L0O C;  1Z9C A;  1JXS A;  2ZXI A;  3WG7 H;  1TWF J;  2E2I J;  3LSI A;  2GXA A;  4UXN A;  2VT2 A;  1JKQ C;  5GP9 A;  4WWC A;  1M1E B;  2RRE A;  1VZ0 A;  3S1Q J;  2K02 A;  2DT5 A;  2YU3 A;  3W3C A;  4QSH A;  3TP3 A;  2QQ8 A;  4ZYE A;  2ZFW A;  2STT A;  1I6X A;  3ABL H;  2R93 J;  1A35 A;  3ZMZ A;  3HL2 A;  1YS7 A;  3QYB A;  3CME I;  2HI3 A;  4J01 A;  1U9N A;  2WAQ A;  2L7Z A;  2QKL B;  2XGD A;  4M9X A;  5L3B A;  5LGT A;  2A6E F;  5LHH A;  3OYG A;  3A01 A;  3HKZ N;  4PDK A;  1UG0 A;  5B1A H;  3HIF A;  1RUO A;  3KEY A;  4QPO A;  4IVN A;  2WC2 A;  2LG4 A;  3JAM Z;  2JTV A;  3R4K A;  5GAG J;  4G7H F;  1IW7 F;  1X4O A;  2JT1 A;  2KDO A;  2M3A A;  3A4C A;  3C2G A;  3FHN A;  4Y17 A;  2A69 F;  3K4C A;  4M9S A;  1E2X A;  1DDN A;  4Z6Y A;  4IOA F;  3JTG A;  2EBI A;  2JVH A;  1LB2 A;  1ZRC A;  3C2B A;  5LLQ A;  5J6X A;  3GME A;  1FT9 A;  3V8J A;  4ANJ A;  2EJR A;  2DJI A;  2EWN A;  1IRX A;  2LTP A;  2HYF A;  4NQW B;  4V19 K;  2KIQ A;  2QZ8 A;  1MBE A;  3D5S C;  1HDP A;  4NDL A;  2QF7 A;  2XAS A;  4PGH A;  2RAE A;  4M3G A;  4CCM A;  2J5P A;  1S8N A;  4BXU A;  1A31 A;  2M87 A;  1EH7 A;  1U9O A;  4BBS J;  2W7N A;  1HXD A;  3IKV A;  2CV0 A;  3N05 A;  4GRI A;  4RAG A;  1ZR4 A;  1TWA J;  2M34 A;  1ZRE A;  2E7W A;  1J75 A;  2E7X A;  4AC0 A;  4LGW A;  1FPQ A;  3BQZ A;  1H0M A;  5H20 A;  2JRT A;  1ONV A;  4M73 A;  2DOA A;  4A0X A;  1MBJ A;  3PO2 J;  2G7U A;  3ABM H;  4XLP F;  1WH5 A;  3I64 A;  3JTH A;  2R7X A;  2XC7 A;  5HDK A;  1IZ1 A;  1X2N A;  2XKP A;  2ZSH B;  5J1U A;  2UXN A;  1LEB A;  1QZE A;  4IZZ A;  5EF6 A;  4WX9 A;  3VSK A;  3TQN A;  1GXP A;  4BNC A;  2ESN A;  3CCJ I;  3I9V 2;  2O3F A;  1N77 A;  3TBI A;  2E35 A;  1TP4 A;  3BT9 A;  3BY6 A;  3F6O A;  3WTY C;  4TV7 A;  2WWY A;  3RZD J;  1KON A;  2Y69 H;  2L3D A;  3FBN B;  4LD5 A;  2O5R A;  3DXJ F;  1QU3 A;  3V7S A;  2KRC A;  2EIM H;  5LEK A;  4A0Y A;  2P7C B;  3RQI A;  4RB1 A;  2LP0 A;  2LY1 A;  3QOE A;  1IDY A;  4CCK A;  4DIQ A;  3F8F A;  2IRF G;  1ZGW A;  4XOT A;  1KU2 A;  4YEJ A;  3WU1 B;  4ENM A;  3H3Z A;  3PSF A;  3VB2 A;  1BOA A;  1JT6 A;  3J7Z I;  1UEL B;  4CYC A;  1MJB A;  3B73 A;  1UHW A;  5FGM A;  3OS2 A;  4ENK A;  2HYG D;  2QUF A;  3OV8 A;  2H27 A;  1OYI A;  3F8C A;  3FWE A;  1KGS A;  4LLG F;  4PJJ A;  3JRI A;  2QEX I;  2OTL I;  2Y0S N;  4L0Y B;  1I3Q J;  4MQV A;  3H3V K;  1E3P A;  4XLF A;  3RKQ A;  1JJ8 C;  3HEF A;  2NNY A;  1Z3Y A;  1HC8 A;  4BHP A;  4HV5 A;  1YO5 C;  5DV5 A;  4OAY A;  3CO7 C;  4ZDL A;  4ZDP A;  1TW3 A;  2DA3 A;  2DDB A;  4XKV A;  1BR1 A;  4CYD A;  3ZQC A;  3PM1 A;  2B7E A;  2K9N A;  3M8F A;  4FET A;  4P96 A;  3PO3 J;  4FT8 A;  4D0P A;  2LVS A;  2HS5 A;  2NVY J;  1B1B A;  2LBF B;  2P0W A;  4A3I J;  2DDA A;  1RKT A;  1YE9 A;  1QO0 D;  5GAH J;  3HG9 A;  3H9Q A;  1XTA A;  1IN5 A;  1DGR M;  3T0Y A;  3QWL A;  2EZK A;  3O2P E;  5B5E C;  1UCR A;  5H2F C;  1O7F A;  2DMT A;  4IQ4 A;  1IN8 A;  3JRF A;  4BE2 A;  4A5M A;  3CDI A;  2QQA A;  5JFR A;  2G0E A;  3G73 A;  1MMD A;  4XID A;  1FWZ A;  4JX5 A;  1ZRD A;  4BHB A;  2IP2 A;  4N9H A;  1R22 A;  1WGX A;  3OIO A;  4A3E J;  3S15 J;  1IAW A;  2Y9Y A;  2A07 F;  1Q1V A;  1V54 H;  4XNF A;  3CJQ B;  2OBP A;  4LB5 A;  1GHC A;  1SAX A;  4Q47 A;  2EZI A;  2A05 A;  2MC3 A;  4PJL A;  1WJE A;  4A0Z A;  1LDD A; 
#chains in the Genus database with same CATH homology
 1OJL A;  3IH3 A;  4FCY A;  1HLV A;  2O9L A;  3HOU J;  1U78 A;  5EG0 A;  1PUF A;  2XRL A;  2NS8 A;  2CUE A;  2NVT J;  3S1R J;  1ETW A;  1POG A;  1NK2 P;  2MW8 A;  1FEX A;  3G1M A;  2TRT A;  3BG9 A;  3CCY A;  2DA1 A;  4Y52 J;  1TWG J;  3L1P A;  3DEW A;  1HDD C;  1W0T A;  1A5J A;  2DA5 A;  5F1J A;  4A3F J;  4IHY A;  3HOV J;  2AHQ A;  2DJN A;  3BR6 A;  1LFU P;  1RES A;  1MBK A;  4HNV A;  1XG1 A;  3HGY A;  5DS9 A;  2E19 A;  5EGO A;  3K2A A;  5FKN A;  3F0C A;  4MFE A;  2R5Y A;  4M3B A;  2HXO A;  1WPK A;  2NVX J;  3HOX J;  1RPW A;  3ZQL A;  2M0C A;  2HQ5 A;  5EDN A;  3Q0W A;  2TCT A;  3K7A J;  1ZQ3 P;  2R5Z B;  4J19 A;  1ETV A;  1QVT A;  3SDG A;  2ME6 A;  3IH2 A;  4C2M J;  5K7F A;  4MFD A;  2GM4 A;  4X6A J;  1W0U A;  3LSJ A;  2YU9 J;  4D7M A;  3FK6 A;  3JRG A;  3JRB A;  4JYK A;  1Y1W J;  4G12 A;  3G1L A;  4M3E A;  2HXI A;  1Z0X A;  2ECB A;  3HOW J;  1FTT A;  3ZQF A;  3GBG A;  4L5E A;  3MVP A;  2XPW A;  3TW7 A;  4DZP A;  2E2H J;  4RBO A;  3BG3 A;  5GPA A;  3JRH A;  1H89 C;  2XPV A;  2DA2 A;  3BTC A;  2NS7 A;  3GTQ J;  1XS9 A;  5EGO B;  3A03 A;  2O8K A;  1OFC X;  1BA5 A;  3LSG A;  4LOC A;  2R5Y B;  1TWC J;  1LE8 A;  2EZL A;  1JUS A;  4S0H B;  4A3M J;  3LSP A;  4MLO A;  2Y30 A;  4A3C J;  1GV5 A;  4FE7 A;  3QQA A;  1FTZ A;  3FKI J;  3MN2 A;  3Q0U A;  1IDZ A;  1AKH B;  4Y7N J;  2ID6 A;  1FIP A;  4A3D J;  3GTJ J;  2FX0 A;  1SAN A;  3W6V A;  2JA7 J;  2KDZ A;  5C4J J;  4A3G J;  5HOD A;  1VF9 A;  5IYD J;  1P7I A;  3HOY J;  5IOZ A;  2OPT A;  4FTH A;  1WH7 A;  4BY7 J;  1X2M A;  1GVD A;  1UMQ A;  2L7M P;  5IP9 J;  3JR9 A;  4DZJ A;  4A3K J;  3IH4 A;  3OSG A;  1RR7 A;  4JX4 A;  3NAU A;  5IPA A;  3BG5 A;  5J1Y A;  4BKX A;  4QTR A;  1A6I A;  1ETQ A;  2HOT A;  5K7Z A;  4D7N A;  5F27 A;  3JRD A;  3BR2 A;  1MBH A;  3I4M J;  1JKP C;  1IRZ A;  3Q0V A;  3TW6 A;  1T56 A;  4DW6 A;  1AKH A;  2JA6 J;  1WI3 A;  4M3D A;  1MH3 A;  2W48 A;  2XB5 A;  5EZG A;  1YRN A;  3S2H J;  5EZH A;  4A3B J;  4FE4 A;  5GPC A;  1H88 C;  4BXX J;  1Z77 A;  2DMQ A;  3FIS A;  2HOA A;  2DA4 A;  2ID3 A;  2R5Z A;  1LFB A;  2DMP A;  2NOG A;  4RDU A;  4A3L J;  2YUS A;  2D5V A;  2EQR A;  1RET A;  3GTP J;  2CU7 A;  4I6Z A;  5FJ8 J;  1XC5 A;  4AUX A;  1JT0 A;  2K9S A;  2OF7 A;  4ABZ A;  3ZOB A;  4IHV A;  4W1U A;  1MSF C;  2IEK A;  1TWH J;  1IC8 A;  3HBL A;  2JJ7 A;  2WB1 N;  2K9Q A;  1IV6 A;  3JRA A;  2ME0 A;  3LOC A;  5F08 A;  2X6O A;  3LSR A;  1BL0 A;  4IEJ A;  5JLX A;  3BR1 A;  3OSF A;  2CJJ A;  2YS9 A;  4V2F A;  3S14 J;  1MBG A;  2Y31 A;  1EF4 A;  2WV1 A;  5JLW A;  4X1E A;  5DTD A;  4C3J J;  3HOZ J;  1IGN A;  5F0F A;  1VND A;  1NK3 P;  5M5X J;  2LR8 A;  1H8A C;  5FLV A;  1JTY A;  3ZQI A;  4V2G A;  3CMY A;  1GV2 A;  2H8R A;  5E3M A;  4MO7 A;  2DMU A;  3B6C A;  4I76 A;  3UKG A;  2XSD C;  1U8B A;  1ZTR A;  3HM5 A;  3CDL A;  3JRC A;  4M6V A;  4DYR A;  1APL C;  2X9D A;  2M2E A;  2CQQ A;  3MKL A;  5EEA A;  2DTZ A;  4B3A A;  1OCT C;  4A93 J;  1T33 A;  1HOM A;  2LFB A;  4JX6 A;  5EYR A;  9ANT A;  2NVQ J;  1OCP A;  2VKV A;  1QRY A;  2FJ1 A;  1E3O C;  5FKK A;  3VPR A;  1AU7 A;  5E3L A;  4W97 A;  5EG0 B;  5C3E J;  2XPU A;  5BNG A;  1CQT A;  2LK2 A;  2DMN A;  5C4X J;  1UG2 A;  1IUF A;  1UHS A;  1ZK8 A;  2HYJ A;  3SFI A;  3BTL A;  4B1R A;  3BTJ A;  4C3H J;  1TWF J;  2E2I J;  2N8G A;  3I4N J;  1JKQ C;  1MH4 A;  1ETO A;  5GP9 A;  1BW5 A;  1ENH A;  3GTK J;  3S1Q J;  2ELK A;  3HGG A;  4QSH A;  3TP3 A;  1TC3 C;  1B8I A;  2VI6 A;  1ITY A;  1K83 J;  2R93 J;  1GUU A;  2VKE A;  4JP0 A;  4BY1 J;  2HI3 A;  3Q3S A;  4IHW A;  1U9N A;  3GTG J;  2L7Z A;  2XGD A;  2M8G X;  3A01 A;  3HKZ N;  2L0K A;  3GTM J;  2GBY A;  4M3F A;  3BR5 A;  2P81 A;  5F0C A;  3QPL A;  4MIM A;  2B63 J;  2Y9Z A;  1ETY A;  3NAR A;  3FIW A;  1VFC A;  2WAQ N;  3TED A;  1IJW C;  4FIS A;  3H0G J;  2XGE A;  5M3M J;  1JGG A;  2EBI A;  5IYC J;  3C2B A;  4BBR J;  3HB9 A;  4XRS G;  1DU0 A;  1IG7 A;  4UUS B;  1SFO J;  4D5F A;  2M9H A;  2LTP A;  2R0Q C;  1ZR2 A;  2HOS A;  1MBE A;  1JKO C;  4NDL A;  1HDP A;  1BJZ A;  1QVU A;  1RKW A;  1JUM A;  2QF7 A;  2RAE A;  4M3G A;  4DYQ A;  2FD5 A;  1MNM C;  5M3F J;  1B8I B;  1U9O A;  4BBS J;  1ZR4 A;  1TWA J;  2M34 A;  1GDT A;  3IV5 A;  3TP0 A;  2CRG A;  5M5Y J;  1HCR A;  2GLO A;  1G2H A;  4AC0 A;  1QPI A;  5E3O A;  3BQZ A;  4IHX A;  1JUP A;  2VUM J;  3A01 B;  2H1K A;  2JN6 A;  5M5W J;  1MBJ A;  1S7E A;  3PO2 J;  1Y1V J;  4XRS A;  1O4X A;  1WH5 A;  2E1O A;  4CYC B;  2QCO A;  3S2D J;  1AHD P;  2CUF A;  2EH3 A;  3SJM A;  1PUF B;  2ZB9 A;  1X2N A;  4A69 C;  1BW6 A;  5J1U A;  3WHB A;  3S1N J;  1F43 A;  1JTX A;  5FKM A;  3O8H A;  5EF6 A;  3RZO J;  5IOY A;  3B6A A;  4UUS A;  1R9T J;  2R7Z J;  4XIC A;  2HDD A;  2Y2Z A;  2EZH A;  2DN0 A;  3GTO J;  3BT9 A;  5F0H A;  3A02 A;  3RZD J;  1NTC A;  1ETK A;  2LKX A;  2PMZ N;  3M4O J;  1B72 B;  1HF0 A;  2K40 A;  1WCM J;  2CQX A;  1JKR C;  3S17 J;  2E2J J;  3QPS A;  3RQI A;  2LP0 A;  5IP6 A;  2L7F P;  2JA8 J;  1IDY A;  3BR3 A;  2JK3 A;  5K7H A;  3GTL J;  1ZGW A;  1DU6 A;  4XRM A;  2IBD A;  4QIW N;  1I6H J;  1JT6 A;  4DYC A;  4CYC A;  1YRN B;  2JWT A;  2IAI A;  2MGQ A;  1JJ6 C;  4UUT A;  3BQY A;  2XGC A;  1D5Y A;  3JRI A;  2VPR A;  2Y0S N;  1I3Q J;  2LY9 A;  3H3V K;  1P7J A;  3CQZ J;  3RKQ A;  1ETX A;  1JJ8 C;  3HEF A;  1X58 A;  3ZQH A;  1MBF A;  4D5C A;  1VI0 A;  3JRE A;  3LNQ A;  2JMW A;  2MG4 A;  2XB0 X;  3S1M J;  2LLK A;  2KT0 A;  4A3J J;  2DA3 A;  4C3I J;  3ZQC A;  3PM1 A;  1F36 A;  2K9N A;  3PO3 J;  1B72 A;  2LVS A;  1FIA A;  2MSY A;  2NVY J;  4A3I J;  1LE8 B;  1FJL A;  1GT0 C;  5C44 J;  1RKT A;  2X48 A;  3S16 J;  3OOU A;  5FKL A;  5E3N A;  4AYB N;  1I50 J;  4GFB A;  2DA6 A;  3BR0 A;  2EZK A;  4EEF G;  2DMT A;  5IP7 J;  3JRF A;  2JA5 J;  1MSE C;  2G0E A;  3BTI A;  3G1O A;  4XID A;  4JX5 A;  3DCF A;  5IYB J;  3HDD A;  1WGX A;  3OIO A;  3WHC A;  3E7L A;  4A3E J;  5J1R A;  2DA7 A;  3S15 J;  4XK4 A;  2ECC A;  4B4C A;  2I10 A;  2Y9Y A;  5J3L A;  3M3Y J;  2FQ4 A;  5FKO A;  1Q1V A;  2L9R A;  2O7O A;  5FLM J;  1K61 A;  3FK7 A;  1ZKG A;  2AO9 A;  2EZI A;  2R92 J;  3ZQG A;  5F04 A;  3O8G A;  3D1N I;  2COB A;  2LD5 A;  1ORK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...