2O8OA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
110
Chain Sequence
b'KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
molecule tags Hydrolase
source organism Clostridium histolyticum
publication title Induction of stable beta-sheet by Ca2+ in Clostridial collagen binding domain
rcsb
total genus 30
structure length 110
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2006-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8oA00
1KFXL 4DY3A 1KFUL 4DY5A 3BOWA 5FAXA 4G9SB 4I3GA 2XVGA 1WMFA 1WMDA 5FBZA 3JQWA 4DXZA 1U5IA 1WMEA 2O8OA 1DF0A 3DF0A 2LUWA 2XVKA 2XVLA 3JQXA 1NQDA 4HPKB 4DZGA 5SV5A 4HPKA 2QFEA 3AFGA 1QXPA 1NQJA
chains in the Genus database with same CATH superfamily
1AYM2 1KJLA 2WFF3 2RDNA 4L11A 3WDUA 1CAXB 4MGZE 4Y20A 3U37A 2JDKA 4ASMB 4L92A 2BEOA 3AP4A 4DXSA 1YEWA 1RINA 2GZWA 4UW4A 4AR2A 1GR3A 1J3PA 3CL1A 3PJQA 3H42B 4OHXA 4XIOA 2VE1A 2A5ZA 5T54A 1DQ4A 2P1BA 1UD1A 1H1AA 3I49A 5BNPA 4FXKB 1UX7A 1LJ7A 1ZBA2 3AKRA 1NCQC 2W9XA 3TBDA 3IKWA 5FOJB 1ZRFA 1ND3A 1UYYA 1YFWA 5ABJB 1W9TA 2F6BA 3CBNA 2C5DA 1H2NA 1HXS2 3AXEA 5AVPA 1SDWA 2AGSA 2W5FA 1JUHA 5CISA 4XCAA 3KZ4C 5F6KA 2N7GA 4OMDA 5F5AA 4AEDC 2P6CA 3GXUA 1RXGA 3E1F1 4JRAA 3C7FA 4OI4A 3TRSB 3QCWA 4JGZA 4K21A 1SCSA 3NVCA 2G4IA 1W9FA 1PZ8A 3UNPA 5KHIA 3ZYGA 4HSJA 2RDSA 4QKNA 1ZA4A 4QT6A 4IV1B 4XXAA 5BNOB 1HB3A 1CAWA 3OY8B 3RYRA 3ZN4A 4QD2A 2WYSA 4QX3A 3M3IA 3OB8A 1JW6A 4FPLA 2XVLA 2IXIA 4MZUA 3KVBA 2HWC3 2W92A 4YNIA 3I7DA 4CP1A 1ZM1A 1UKGA 5IYYA 5FP9A 1GNYA 2LW8A 2VOWA 4XETA 4IE7A 5EJ3A 1WW5A 4B3NA 4FAGA 3M8LA 5FO9B 2ARCA 5E16A 1QJU1 2D6OX 3MPPG 4KH9A 4LXLA 4PLOA 5HV0A 3LWCA 1HQLA 2QKDA 4CEYA 2DVFA 3T2QA 2IFWA 2IVIB 1S0JA 1FMD3 1WLTA 2HBUA 2UURA 4JQTA 2WDBA 1BKZA 4CDXB 1QDOA 2Y26A 4IGQA 1VBA3 4M3CB 2JKXA 1POV1 1XPWA 4KMQA 4A42A 1MQTB 1BXHA 1I1EA 4M00A 4UBGA 4Z07A 5LBFA 3UKTA 2ZX2A 2HEWF 1VBD3 3G7DA 1XNDA 4QQOA 3SEPA 4MLOA 3T2OA 1RUF3 5IUQA 3O7OA 3S6PA 3ZOIA 3Q8CA 1AZDA 3CJIC 4CDUB 3BIEA 3ZXGA 2BNOA 1NAEA 2E7QA 4RFT0 3WXPA 5SV8A 3T4HB 4C90A 1ZZ9A 3Q8FA 1DGLA 1OKOA 5IHRA 4XJUA 2HLEA 3RRDA 1L7QA 2BYVE 4JGZC 4LUKA 1IHMA 5JPMB 1E57A 2P3YA 1RUE1 1XYPA 1OVSA 3KD4A 2VU9A 3OBRA 2MEV1 5FCCA 4E4DX 1EV12 4NRQA 3WP3A 2GP5A 5FY7A 3WHTA 1GLHA 4XW3A 4BA6A 3DGTA 4EQVA 2YFUA 1EPWA 2DDUA 4MVTA 3APBA 4QQPA 2UY8A 4QKBA 4BIFA 1UIKA 3CO2A 4N9HA 5ANQA 3LKJA 4CCDA 3LSDA 1PGL2 1D4M1 3CJIB 4CDUC 1W8WA 1RJ8A 1W05A 2JWPA 5DAPA 2ID4A 2AC1A 2YYOA 4W50A 3HD8B 2WQ4A 1RUG3 4IEOA 2KA3A 4FFFA 4PLNA 2JE7A 1ND3C 2WT2A 4PI2A 3RS6A 2WO1A 2IFRA 4NJ4A 3VD7A 4AFDA 4Q4X3 4K8FA 3O1PA 3D5OA 2TEPA 4RL7A 4UFHA 1NLQA 2CSGA 2WFPA 2TUNA 3T08A 2CHHA 2GSYA 2DUQA 2J1VA 4AGRA 1NX9A 3OYWA 3KQRA 1WA4A 4P08A 3Q8AA 1V9U3 3AM2A 3PIGA 3E6CC 4XMAA 5FZDA 1NUKA 2OXBA 1RUF1 4ZXKA 2AACA 2WZPP 2FDFA 4QX2A 2ENRA 2FBEA 2R16A 1QJX1 2XJTA 4YGBA 3KHCA 2WWSA 1RHI1 3M3OA 3OGGA 5A33B 1POV3 3OBAA 5A7NA 1A8DA 4DB5A 4FPFA 3BOWA 3SKJE 3A7QA 4FOQA 4RR3A 1UAIA 2AEYA 2GDFA 4OLLA 1WMFA 3UJOA 2K9ZA 2BQPA 2ET1A 2GALA 4BK5A 4HVQA 1RUE2 5FZ8A 2GN7A 2JG8C 2MEV2 2FMYA 1ZZ7A 5IVYA 3W58A 1HW5A 4BQ2A 2A3WA 2JE9A 1LGBA 4ISRA 5L19A 2Z69A 4F83A 4CCCA 2AUYA 4XHXA 1XRUA 3TWIA 5L7OB 3ZPOA 2VZVA 4AHWA 1AR62 1JYVA 4AI3A 2JENA 3U14A 2HH9A 3X29B 5FO8B 3VUOA 3AL5A 2D3PA 2JICA 1HRV2 4RA0A 5IJRA 3V0AA 3ZSEA 1Z0HA 2CL2A 3I59A 3MW4A 4D7SA 5GJ6A 2WNEA 1N3OA 1ZNPA 4A6SA 1H1IA 1UZYA 1UYPA 3VHOA 3RZHA 3NKGA 1QHDA 1OH3A 3J9SA 1QF3A 3DYPA 2QQJA 4KWUA 3WHUA 1YFYA 2VMGA 2GC3A 2KD7A 2CV6A 2C1FA 2ETEA 3GHMA 1XE7A 3PUSA 4W8JA 2PAEA 1FOD2 1MS0A 2NMNA 3RQ0A 2I74A 5GZCA 2SBAA 5HBAA 5C3PA 3A0NA 5IW0A 4EN7B 2W91A 2DFBA 3OCPA 4Q4X1 1GP6A 1C28A 1QQP3 1VBB3 4NRPA 4LUMA 5T5JA 1CJPA 1XSRA 4BHPA 1YNAA 2IWGB 2L9LA 5GLWA 5CEHA 1AR82 2RS11 2W52A 4XF9A 3WNNA 3WUCA 5C8CB 1VBB2 1MS9A 2V72A 2D5FA 5AFBA 4NHYA 3AMHA 2VUCA 3NKTA 1D4M3 1TG7A 4GMP0 4YG3A 1COV1 2JB8A 3BN6A 3WDWA 3ZFGC 2K0GA 4KWKA 2VOTA 4P5HA 3FFZA 1R1A2 3QH7A 1F2NA 1HN0A 1RUI2 1NCRA 4IEZA 3BODA 2WBKA 2GC1A 1R64A 5A7PA 3SXWA 4X8PA 1SDDB 1JH5A 2YROA 4YYOA 1HRV3 3O12A 3I97A 1LR5A 2Z2SB 3P1IA 3M3EA 3LA7A 5LZ6A 1DGWA 2ZCWA 1MZFA 3E97A 1AR61 1J58A 3JBG3 5DAVA 2KM2A 2R073 4GXLA 5C8CC 5A7SA 4JHTA 5K8SA 4AHYA 1VRBA 1AUYA 3ZX7A 3K77A 2VG9A 3ZFGB 1AL22 1JU3A 5EV7A 3WP6A 1Q43A 3POEA 2PLV2 1WCSA 4BYYA 3RZKA 3MW2A 1JUIA 4HT1T 2VGDA 1UIJA 5A32A 1WLDA 3DYOA 1GUIA 3VBSB 3PUQA 3I2DA 4RS5B 3ZKYA 5I91A 4XFFA 4O7XA 4YSFA 1FOD1 1O5UA 5F6LB 1K5MB 3FHIB 3LPGA 3SKVA 4EZHA 1C5HA 1WMXA 1RMU3 2WZ8A 4OQ9A 5GZFA 3LOIA 4CXWA 4R9AA 2RS51 5F5IA 1BZWA 4Y1UA 1D7PM 2NP0A 1PNFA 2YC4A 5KHKA 3H9AA 5EHDA 5FP7A 4FQ4A 3ACLA 1DYKA 3H3LA 3JB4C 5H9SA 3HT2A 1VBB1 3VKMA 3POBA 2GU9A 3W59A 1SLTA 4LOTA 2LRPA 3N7KA 4Q4V2 3T0BA 3VZLA 1GFF2 5LB6A 4D6QA 2EA7A 1AR73 5A6QA 5LEKA 1HLCA 2VQUA 1IQDC 4TLGA 2WNVB 4NIIA 3O1TA 4BH9A 3MZHA 3P3NA 1YQCA 2FCTA 2QQPA 3LDRA 5F5QA 3B02A 1N3PA 2PQSA 4RS5C 3VL9A 1QJEA 4FAHA 1G6NA 1T6BX 4PI0A 2FCUA 3PVEA 3BTYA 3LSEA 1N1YA 5APAA 2GC0A 3B9IA 3JU9A 5JIAA 1DQ2A 1O4ZA 1GZWA 2AEZA 4I3GA 4IV3A 4NWWA 4Y4RA 4A3ZA 4OI0A 4BQ3A 5FZMA 1APNA 1KITA 4ASKA 1MZEA 2PQQA 3PLQA 2UYBA 4M3CA 3JQWA 5DXDA 3WNXA 1GQHA 3LB9A 1LOCA 4WM7B 5ERLA 4CP9A 3PU8A 3DEMA 4URAA 4QU1A 4X6QB 2WA3A 5IVEA 2HEYF 4COYA 3WG1A 2WNVC 1MVQA 2Q8DA 1U12A 3AZVA 3CEWA 5T5PA 1WBFA 1GYKA 3GCWA 2DU0A 4CUGA 4Q2FA 4DINB 5JUVA 2XH6A 4DY3A 4E9KA 3I2FA 1KD7A 5HCHA 3WNMA 1OI6A 4Q4Y1 4AYUA 1SLBA 2JIJA 2E26A 1H8TB 1WKYA 4PHZA 5F1RA 4Q1PA 5I8TA 3H7YA 2PMWB 5IFTA 1OUSA 3ZPYA 4QPYA 2LALA 4CEYB 2V4VA 2WT0A 4XXPA 1FMD1 2ILMA 2W46A 5CZKA 1OVPA 3AP5A 3JXSA 3UESA 2J1UA 5D8AC 4Y22A 2WKKA 5JZGC 2GNMA 1CONA 2R061 1S1AA 3SITA 3ILNA 2CAUA 3UGFA 4BB3A 3L2YA 2YBKA 2XQRA 2G9ZA 4KU7A 2XXZA 3ACGA 4BWOA 2W87A 4Q4V3 2VW1A 2XBO3 2A6YA 3FLRA 4Z82A 3AKTA 4RSUA 2B9VA 4CDWA 3VBUA 3VBOC 2P3KA 1YRZA 4I01A 4OYUA 4YFWA 5CA6A 5K0UA 2WZR2 4P02B 2VD7A 1H8TC 2VW2A 2VCCA 3RJRA 4NHLA 1XXNA 1O8SA 1UF2C 2VBBA 4BQYA 1D0HA 4CTEA 4CEYC 1A3KA 4L8QA 5A7OA 2BERA 2BGOA 1CAWB 3CZUA 3OY8A 5BNOC 3V0BA 2R042 2VQ0A 3J8F2 5JSRA 3VLBB 1T2XA 4AXOA 2OUJA 3A0KA 1W06A 1YQ5A 3VDBA 4YM3A 2FQPA 4IESA 4BPZA 1KRIA 2OKXA 4QGMA 4Z92B 2XJQA 1R1ZA 3LE0A 1QJY1 1V6LA 3AYDA 4B4QA 2UY9A 1PK6B 1PX3A 3MFAA 1NA1B 2ZX1A 4H55A 4PBPA 4XFCA 4A45A 2DCYA 1QQP1 3VBOB 5FYSA 3BTXA 4XABA 1SLIA 1R081 4LBOA 1Q56A 1WCUA 2YUEA 4UW3A 4ZHNA 3H7JA 5FAXA 3V56A 5LA1A 2BP6A 1TMF2 2XJVA 2XHKA 2ZTNA 3NL1A 3KS7A 1V00A 2FZ1A 2OS2A 1NXD1 1H4GA 3NSTA 4YZ1A 5JXIA 1ZRDA 2TNFA 3GBWA 5F3IA 4CDXC 3WQ1A 3IB3A 4EWDA 4QHBA 3O1VA 4Q0PA 5CFDB 5KR7A 1RGSA 4IERA 5DUVA 3THCA 5LRSA 2XVKA 4E2QA 4YZ3A 2WS91 1OC1A 3NAPB 3O1SA 3AYEA 2XJPA 2G1MA 5DG1A 5FUPA 3ZYPA 2R072 2VY0A 3K48A 3PUAA 2XDVA 4XILA 1CIWA 5A3PA 4DS0A 3OPZA 1STMA 1TME1 1LHNA 5A1LA 2A6VA 5FZ3A 1QJU3 3WP4A 4IEXA 4LO6B 2P34A 4HONA 4PDWA 3L9JT 4PIZA 2C4XA 3FBYA 3NJXA 3FHAA 4KG0A 2Q5TA 5CFCB 4GH4C 1W6OB 4QWNA 1D2SA 3HT1A 4D6RA 2HEVF 5FMBA 4LHLA 5JR2A 1YI7A 3J7NA 2BWCA 3DF0A 1BVP1 1NLRA 1QKQA 2JKBA 3NNJA 2Y6LA 2JX9A 2ZGLA 3PU3A 3ZYIB 5KC6A 2WRAA 2JECA 5F2SA 3M3QA 4QX8A 4E2SA 1FT9A 2BNMA 2WSUA 1O91A 1QJY2 3AK0A 1GQPA 2BUKA 2BBAA 1V70A 2Q0AA 3M1HA 1YXWA 4Q26A 1IKPA 4JTOA 1JN2P 3WINE 4F3JA 3OTFA 3QACA 2FHRA 1LHOA 1QQP2 3HN3A 4FSJA 3QOPA 3WCSA 4Q1RA 5DUXA 1W6QA 5FPVA 4YM1A 3OBZA 4IE5A 4PCRA 2RHPA 4QM9A 4TXWA 1BHGA 2KR2A 4BMEA 1I3HA 4HMZA 2J22A 2J1AA 4QX1A 2ZGPA 1S0CA 3GBGA 1NE6A 4XTMA 3W20A 1DQ5A 3TOJA 4Z2AA 2Q8OA 1H2KA 2ORXA 1VALA 3DV8A 2QBXA 4BQ5A 1RUH3 1WW4A 1GZCA 3VBRC 4EN6B 3IM0A 3PVOA 2YY1A 1BCXA 3TN91 3ACHA 1HQWA 2UU8A 3NQHA 3ZXKA 5IK4A 4Q27A 1W0PA 3GZAA 3WSOA 2VH9A 3IPVB 4Y33A 3NNGA 4CP2A 1REDA 3BPZA 4HXCA 4NO4A 5I0DA 1RUI3 1RUC3 2GAUA 2PHTA 4EE2A 3IAQA 3GZEA 2VMIA 1RITA 1SG3A 4KQ7A 4QKFA 4DPNA 4GWNA 4XVHA 1J84A 3U11A 5CKQA 3GYDA 3BCWA 4COZA 4E4HA 4FOWA 1AR83 2I07B 4QB1A 1NYWA 4OHZA 2P4EA 4MHUA 5F8PA 5DUWA 2QQWA 2XKOA 4YW6A 4CZSA 4ZZ5A 2BTVC 2EAKA 4JX0A 2YGLA 2WNOA 1XYOA 2VZRA 3SH3A 4HKOA 2JDAA 4Y1XA 4YVSB 4LIUA 3EYPA 4FPHA 1C8M2 4D3WA 2DVAA 4WBBA 1RVF2 2HWD2 3THDA 1Q3EA 3OUIA 4QPIA 4N43A 4BISA 2PHUA 3LDBA 2ZACA 3VD4A 1PVC2 1BMV1 4AVAA 1DYOA 1RUJ3 4EN0A 1W6NA 2EALA 3K3NA 2XBO2 4AEDA 3PJYA 2VTXA 5LBCA 2E32A 1AR71 4HETA 5K7PA 2W08A 1HB1A 1DBNA 1N1SA 4GMP1 2PXJA 2RJKA 2W68A 1VBC1 2ZKNA 1S2BA 4QXBA 4D8MA 4GAZA 5KHHA 5I8YA 3H8OA 2D97A 3AMMA 3IDEA 3UKNA 5GLTA 4CCOA 2VMCA 3H1WA 1TE1B 3AVRA 2ZMLA 1TMF3 2DUPA 3KWVA 2VJXA 4P00B 1YQ6A 2DCKA 2UWAA 2VW0A 3ASIA 5F5CA 1WW6A 4JGZB 1W39A 3O1RA 4JKLA 4GMP3 1QXRA 3CLPA 1HJFA 2WQZC 3FE5A 5EFUA 2LS6A 4AE2A 3IWZA 3AMNA 2G19A 5BV6A 1XNBA 4KNCA 5DZFA 3OYWB 3PUIA 4YW3A 1ZBE1 2HWB1 3ENRA 4CCLA 1AR93 4Q29A 4C8DA 4IE6A 4JZRA 4P9GA 1DYPA 2QNKA 1PMJX 3LEKA 4JV4A 4HPKB 4LJHA 2ZOEB 1NZCA 5L36A 2XWBB 1W0OA 2DTYA 2DYCA 1BJQA 1CAUA 1LHWA 4CXXA 3B5LB 5JOYA 5BUVA 5C8WA 3C3VA 5I0SA 5FZ6A 1OURA 2RE9A 4AG4A 4HZFA 1W8OA 2D6PA 3ILFA 4RR3B 3OGJA 4V2VA 1VBC3 5JCTA 1W28A 1BYHA 2P3IA 1E5IA 4SBVA 3WQ7A 3ES1A 2WNUB 1X36A 5FBZA 1PVXA 1VBD2 2JD4A 1L3JA 5AFEA 1CN1A 1RVF1 2HWD1 1DCSA 2HBTA 3Q8BA 2EXHA 1XNAA 3PTYA 5BNNB 2JDZA 1JXNA 2VVDA 3RDIA 3ELNA 2ARXA 2X09A 5ACA3 5FZLA 1AR72 1OPMA 2WZR3 5T3NA 1GNHA 1OMIA 4CCJA 4E8DA 2YU1A 1DGRN 1JS9A 1NY72 3CHXA 4LIVA 1LB2A 4XF3A 1RUH1 5FZGA 4KWLA 3WQBA 1HQNA 5BYNA 2VZOA 3CU7A 4LMFA 4MGQA 1TNRA 3B69A 3DXTA 4S2FA 1AJOA 3CJXA 1P8JA 5FXZA 5ISLA 3UGHA 2OZJA 4G3YC 2CGPA 5IVBA 3SEEA 3CIHA 2ZGKA 2FDGA 1H0BA 4CU7A 5FR3A 2FDHA 2R063 1DZQA 3M3CA 2PHXA 2BGCA 1I6XA 3NV4A 3VN4A 2F17A 4HKLA 4QAWA 4JDOA 1QXPA 1GP5A 1JYCA 5KXEA 3KMHA 4FPYA 1M4WA 1O4YA 2Q1FA 3VZOA 2R0HA 1XNCA 2PN5A 3IT8A 3M4FA 3TNPB 1LHUA 1QOOA 5FP8A 5AC92 2PAMA 1DHKB 1ALYA 1F5JA 1UY1A 1GQGA 5CAZA 2R49A 1N1VA 3CMGA 2RMU2 3H1YA 1ND2A 4CP9B 3KCCA 3MBWA 4I0AA 4ZS2A 4YVWB 1ENQA 3WDYA 3BI3A 2YPJA 4UOJA 3D6EA 2YHJA 4YPJA 2I45A 4Z1VA 4LULA 4Q0SA 4XURA 3ZIWA 4BQWA 5IFPA 4JGYC 3BOPA 3OPWA 3ZMOA 4MHRA 4IDZA 5ABJA 5FOBB 4OHYA 3G6JB 2D3SA 3KF3A 1PGW2 1UZ0A 1XSQA 4CU9A 1HB4A 1RUG1 3DN7A 4KI5M 5D1IA 1JOPA 1NY71 1H30A 1W2UA 4LORA 3VD9A 1AYM3 2Y6KA 5FYMA 3GHNA 2WS93 1HV1A 4Q4W1 3ATGA 4HVOA 4N9IA 3ETQA 4CDQA 3FL7A 5D8AB 1VLNA 1LOFA 4P9LA 4AVVA 1CWPA 4AGVA 3GALA 5FZHA 2K46A 2C9KA 5BY5A 1JZ3A 4I3PA 5DUUA 4Y3OA 5G05L 1H6YA 1H9WA 4Q0VA 1AL23 4PJYA 2NM1A 5C3OA 5C71A 3LQCA 2PA7A 4CCNA 1O8PA 5IK5A 1E5SA 5FBJA 1CPMA 4YW1A 2OUHA 2Y60A 1UX6A 3OEAA 5A3NA 1YJLA 4META 4E4ZA 2EF6A 2HWF1 4W65A 1MS4A 4AL9A 3USUA 4MADA 1S55A 3UL2A 1W03A 1XU2A 2VCMA 2XR4A 2VVEA 4O9EA 3ZN6B 4EV0A 2VOKA 5BNPB 1MZ6A 3MI8A 3AMPA 5AC91 1W2OA 5IVCA 2WAOA 1ULDA 1W6OA 4OUEA 4RHV2 5DDJ1 4N53C 4LKFA 4YWAA 3V64A 1W8HA 3ZN5A 1ZBE3 2HWB3 4A7KA 5IVVA 4K1YA 2RDRA 1QH7A 3L2HA 4RGAA 4PIXA 3RYKA 3PL0A 3N9NA 4GWMA 2B9UA 3FX3A 5B4NA 1GNZA 1NA1A 2AH2A 2NQYA 4BU2A 4RGKA 3WVJA 1YFXA 1WCQA 2VZUA 3O14A 2VMEA 2WC2A 3GGLA 5EYYA 4CCKA 2YG0A 1JBCA 5FYUA 5KXDA 3SQOA 2FD8A 3SH4A 1BEV1 1S0FA 5TSWA 4GULA 2ZHNA 3NNLA 2TBVA 5FKCA 3C7GA 2QCSB 1IG0A 1HRV1 3ZFFC 2CAVA 4AI1A 4AEMA 3P3PA 5CU1A 3AYCA 3A21A 1NCRC 2H6BA 4Q4W2 2ARAA 3VDCA 1AR91 1LCLA 1K12A 1FPN3 3IDBB 3N9MA 2ZKLA 2VOVA 3BIWE 1OA3A 1Y9MA 3SC7X 1XJAA 3IMNA 3M70A 2HWE1 3B01A 1RIRA 5JR7B 3WW2A 4V1PA 1K42A 3MW3A 5EIYB 4BDVB 4EN8B 2V5YA 5D21A 1C3HA 1DFQA 1EV11 2E53A 1AR81 5FLIA 2HWF2 2J7MA 1WLWA 2RS12 1JZ6A 5L9RA 4CP0A 5E6HA 5EJ1B 3AJZA 3DL3A 1MQTA 1AX2A 2YGMA 1DQ1A 5FQ0A 5CFDA 1DF0A 1BK0A 2VZPA 1NCRB 1JZ7A 1RTVA 2JG9B 4LKDA 4C1WA 5CG9A 3KT7A 2A6XA 5F32A 3J4UH 4FTBA 3DYMA 1UPIA 2RM22 3SCFA 2R32A 1RXFA 2ZZQA 3HEIA 1E5RA 4QB6A 3WDTA 4C0BA 4CDWB 3OGRA 3VZNA 2JDUA 2XMLA 4BQ4A 4R9CA 5FXXA 4DUVA 1NCQA 1SEFA 5KHJA 1UU4A 1WLCA 3ZXJA 1AYM1 4H7MA 4GJYA 2VM9A 3HQRA 1OQDA 2PHDA 3I59B 3WOGA 3WY6A 3NO8A 1REEA 1Z7S3 2MEV3 4O65A 5GZGA 1XNTA 2E9QA 1UY4A 4UW6A 1RUE3 1ZRCA 5GALA 2BW8A 4W6WA 5IVJA 2XL7A 3DXUA 5IK7A 1AYN2 3OD4A 5HCBA 5L9BA 1RB8G 1HRI1 3HN1A 4LBKA 4Q0QA 1RUF2 2GNTA 1ZRRA 4W6YA 4EN9B 3RZJA 2OPKA 1QJX2 2Y6HA 4N43C 4XDOA 2EVXA 2VZ3A 2B39A 3LPFA 3POGA 1RMU1 3VBRB 2BBVA 5CBLA 3S30A 3LA3A 2BNNA 4Y5SA 1KFUL 4PQQA 1HKDA 1PZ9A 4B29A 3TAYA 3CDZB 5FFOC 3H3ZA 3I4IA 3K2OA 5GLZA 1OQEA 1AX0A 3VBFA 1X82A 2OQ6A 5A6ZA 2WO3A 2IXJA 4QXCA 4B4RA 2XONA 5C9AB 3VDDB 4IV1A 3J26N 3B93A 2DCZA 4TWTA 5EP9A 4LR4A 3E5UA 4URTA 3KLSA 4ORFA 3OG2A 4RFRB 1IS6A 1KS5A 1W99A 2J1TA 4NPRA 3EMRA 2UYAA 3ZYHA 3HBKA 4JHZA 3F95A 1IOAA 4JAAA 4J1XA 3I2KA 4A6OA 1QNYA 2XL9A 1IZ3A 4XE9A 4OQ8A 1VMJA 5FP4A 2ERFA 2A7AA 2QDNA 1W6MB 4H2AA 4XTPA 1G9BA 2VCBA 1UZZA 4OMCA 4UXAA 4YZ5A 4AQTA 5KXBA 3ZXFA 2WNUA 4XDQA 3H8UA 4KBZA 1WBLA 1QOTA 1SBFA 2A75A 2R30A 4A41A 4UFKA 5L9VA 4ONUA 3FC0A 1B35C 1NLSA 3B9CA 1H4HA 2ZGUA 2OYZA 3WEZA 3T2PA 2Y0IA 2WYFA 1PIV1 3THPA 1AYN1 5A1AA 3IN9A 3DKQA 1CESA 3JBG1 4RS5A 2JEMA 3W5NA 5FPXA 2C9AA 2D3RA 3POYA 4JTNA 2C6SA 1K5MA 1QJFA 5FYCA 1FXZA 4EYUA 2RR12 2X5IA 1OSGA 3URFA 5K0UB 1GZTA 1WW7A 4ISQA 1QIQA 4CUCA 2XUEA 5F3GA 4FFHA 1UYZA 1IPSA 3J7MA 5C4WB 5G04L 3VL8A 3FZ3A 3VBFC 5FIXA 3LDKA 3K4ZA 4RQPC 1LU1A 3IDAA 4QPIC 4XMIA 5JI7A 1RUI1 2WFF2 2HWC2 3RJ2X 1PMIA 4WM8C 4QHZA 5CFCA 3AP7A 2A3YA 1W6NB 1JU4A 2NZ9A 3ZDSA 1G9CA 2W3JA 1JZ4A 5HCFA 1OF3A 1MR5A 2ZEZA 5A1FA 4PLMA 4QU2A 4XC9A 2Z4FA 4RHV3 1FYUA 1OFSA 1H9PA 3A23A 3O0VA 5EXOA 3VBUC 3VBOA 4AFAA 1ENXA 1WWYA 4QM8A 3CZJA 3GM8A 3R4SA 3TYJA 2GMEA 1J59A 5FZBA 4XUTA 1QU0A 3JCIA 5FPZA 2DCTA 4GZ9A 4E8CA 1POQA 4Y5Z0 2YPDA 5DAXA 3F2ZA 1LENA 1W8FA 5LBEA 3WCRA 4IL7A 5D8AA 3BGAA 2VCAA 4D69A 1TVGA 3POSA 4NIDA 4LO4B 2Z5WA 3H1MA 2GNBA 4D7YA 3J8F1 2CTVA 4DUXA 3ACIA 2WA4A 4X6RB 5FXVA 4LK6A 5FK7A 1LEMA 1C57A 2XLGA 3U4SA 5CFDC 4HLTA 3JBG2 2ZX0A 5T55A 5KC5A 1PM4A 3WG4A 2P5BA 2R1BA 3DKWA 4NPLA 1H8TA 2Q8CA 1OKQA 4BQXA 2RR11 2DBNA 4MUVA 2VBDA 4XJ8A 4BZ4A 5C3RA 1V9U1 4IV3B 1GWKA 2JE8A 3DCQA 4P9XA 1FNYA 4JDMA 5ABJC 1SACA 1FATA 3FWEA 4RN5A 3K51A 2XPJA 1UY3A 4QPGB 2VZTA 2RDQA 2ZHLA 5GKAC 2P3JA 1KS4A 2JDHA 2WO2A 3JD73 4C0HA 2X10A 4RD7A 1NQDA 1PM7A 4MYEA 2AENA 4N8MA 5FZFA 1Q8VA 1S0EA 1H2MA 1U5XA 4XAAA 2WLQA 4D0QA 2WS92 1XYNA 4Y24A 1TEIA 2VUAA 5FZEA 1FV3A 3HNYM 3IDCB 3PURA 3ZFFA 4K20A 2CDOA 4GD4A 4UFLA 4HSLA 4L97A 4BMBA 3P6BA 3I3BA 2XJRA 2V5DA 5ACA1 1H6XA 3M7AA 2GN3A 1NZIA 5FLJA 3OSDA 1C1LA 4PIYA 1VRH1 5JDBA 5LA0A 2J1EA 2ZGQA 3DECA 2JD9A 2C26A 1LRHA 3AYAA 5T5OA 4A4AA 2E6VA 4P9YA 2JG8B 4HL0A 1KJRA 3FLTA 1R092 4COUA 2WNVA 1DQ0A 3T1MA 4NHMA 1YYNA 3LEGA 4COVA 1O3TA 2OQ7A 2D6MA 4QXHA 1Y9GA 3AXDA 1Z7S1 4UWDA 5A3TA 4K3UA 4LHKA 4B7EA 4YW5A 1HDKA 4KG8A 2HYXA 4XUOA 3R4DB 4QHOA 3RI9A 3ZSLA 1SFYA 2RS53 4ARXA 1DQ6A 4DUWA 3U0ZA 5B2GB 4YW2A 4DY5A 1MQTC 2VQAA 3C7EA 5F39A 1MVEA 3WNLA 4DXTA 2VZQA 2VAUA 3U10A 2ZABA 2PYTA 5FYVA 2WZEA 2LM3A 1YC61 3O5SA 5EYXA 5FV3A 3VBHB 4OUSA 4HK8A 1NKGA 2R062 3WZ1A 1ENSA 1VB4A 1AF9A 2VOXA 3ZYFA 2G9FA 4CEWB 2V09A 5C5UA 5LEJA 3ZXEA 2O0OA 3FUOA 3I8TA 4YLZA 4YW4A 4MGSA 1GICA 1F15A 5LA9A 3ZM8A 1MEC2 3N35A 1N47A 3RMXA 4DOUA 1CAUB 2Y6JA 1YJKA 2X05A 3WF2A 1KQRA 4BLJA 4UFJA 1WGPA 3EBRA 1JTZX 1W6MA 1XE8A 3I54A 4PDWB 4AVSA 3CNAA 5JAXA 4BK4A 5FDBA 1GV9A 2ZGOA 4JKKA 5FTTC 4JGYA 4JQRA 3VKLA 3O1OA 4FP2A 2A1XA 4FPKA 4CDQC 4P9JA 2DURA 4CXYA 3AJYA 1OBNA 5FYTA 1YUDA 4AEDB 1VMFA 4BCUA 4BLIA 2XJUA 1U0AA 1VRH2 1ND2C 1EAH1 3C8XA 3K4DA 5DDJ3 5C33A 1TNFA 1LODA 3K4AA 4XJ9A 1IPKA 2VULA 1S0GA 2W94A 5FZ0A 3S7EA 1R091 4WV8A 3UGGA 4AEKA 1ASJ3 4MG2A 4L9BA 3HQUA 1SLLA 4XUPA 4A7ZA 2E51A 2ZX4A 4P14A 1TMF1 2QQNA 1JODA 1OPOA 3MDPA 3OEBA 3MHZA 3WV6A 4CYDA 2ZX3A 4DFSA 1VIWB 3OUJA 5H9PA 2GMPA 4ZXEA 2EXKA 2NMOA 1GSLA 4DEVA 3WW3A 2D44A 4UBHA 5A70A 1B09A 5C3SA 4WVWA 2DTWA 3HJRA 1RUJ1 2FDKA 1L7LA 2JG8A 1D0GA 1VBE3 1RUD3 5FYZA 3RPQA 4BJ0A 3K46A 5A3MA 3ACFA 2ZAAA 4GQ7A 1QXJA 2Y0OA 1COV3 2QQOA 3KHBA 1YLLA 2RVAA 2VZ1A 2VC9A 3UKVA 2DFCA 4I09A 4OI2A 1W2NA 2JDYA 2WL1A 3GDBA 4IGPA 5L73A 3AL6A 3HNBM 2W0XA 2RS13 2RJLA 2HWF3 2WIIB 1MEC1 1ST8A 2VMFA 2CYFA 2E63A 4FI9A 3CQOA 4ATEA 1V0AA 3JZVA 3LGRA 1Q8SA 1W2AX 1S0BA 4E27A 2FZ2A 4IEPA 2IXLA 1W6QB 3B3QE 1W04A 3HOBA 4XBLA 3AC0A 4PF5A 5C9AA 1O5LA 1X8MA 3U78A 5FZ7A 3VHNA 1FV2A 2DVDA 4YM0A 4ZY9A 2OIIA 2YZ4A 2JG9A 3UV9A 4C1XA 4NIGA 1AYN3 1PX4A 1W6PB 1SPPB 3MPBA 1YWKA 5DG2A 4Y1VA 4XHBA 1EUUA 1UXZA 2XLAA 1SHWB 4NMIA 4Q4W3 1UN1A 1VMHA 3POJA 3S7IA 4F7ZA 2QJVA 4W6XA 1C8M3 4XF4A 4LHSA 4XQ4A 5FZAA 4OZXA 2UWCA 1ZVFA 2XUMA 2FMDA 1OQ1A 3D0JA 2PHWA 3KGZA 5FPLA 3I2IA 3NV1A 2YBPA 4ITCA 3KV9A 1A8MA 1SLCA 4L0PA 3O0WA 4NAOA 1XQNA 4IGOA 4Q4Y2 1UMZA 4TYSA 2ZZJA 2XQXA 3HR9A 1OD5A 5HXMA 4YW7A 5FY8A 4EWEA 3ZXAC 1S0DA 2DWRA 2PHLA 2OVUA 2PHFA 3C7OA 4XCBA 4XQWA 1QEXA 1LU2A 1LGCA 1RUC2 3GZTB 3WNKA 4EJRA 1DG6A 3N9LA 4B1LA 2B7YA 1O3RA 1CX1A 4NR1A 3WG2A 1UOJA 4IETA 1ONAA 3TN92 4FT8A 4LBJA 4LO5B 5FP3A 1HX6A 2PFWA 2WLPA 1EPZA 3GNEA 4AVCA 1PZ7A 2X5IB 4QQ2A 5FY5A 1S4CA 1UY2A 3KV5A 1RUH2 3OPTA 5F2WA 3D4KA 4R8HA 3ZDVA 4FOVA 4AI9A 1IG3A 2V73A 3KF5A 4XPVA 3TEZA 1EYBA 3MIDA 4V2WA 4OULA 4QKDA 5JSOA 4AVTA 3C2UA 4D7TA 5JZGB 5BXXA 2EICA 2E33A 4YG6A 3MV11 4X8NA 3UT0A 1A78A 2A6WA 1V6KA 4YG0A 4COWA 1Y4WA 4J1WA 1ND3B 1O4TA 1Z78A 2ATFA 4JCKA 3SH5A 1OOPA 2W2IA 1IS3A 1PO12 4RQPA 3N4MA 5E8AA 4HKWA 1XBFA 1LECA 2Y6GA 4Q0UA 3DPRA 2W39A 4CU6A 3MLLA 4WM8A 3CJIA 2VBPA 2IZWA 1GZWB 2X5IC 3ABZA 3LEIA 4FCAA 5FO7B 1PHMA 2WWJA 3IIAA 5F37A 2ES3A 1R082 3D8CA 1OFNA 2WT1A 5FZ4A 2HWE3 5L7OC 1F9KA 2D98A 2BOJA 1K5MC 1JYXA 4MV2A 1CIYA 2BVBA 2Q1MA 1UOGA 1WD4A 2LUWA 3N9QA 3WNPA 3GBFA 4UF0B 2WO7A 2RS31 5T50A 1UOFA 3NJYA 1XU1A 4O61A 4TN7A 1PK6C 1T6GC 5JWPA 1W3VA 2VVFA 3S57A 5FY0A 2D7FA 4OVEA 4CUAA 5I93A 1NE4A 1J3QA 2QQUA 5C4WC 3I3DA 2A6ZA 2AR6A 5T52A 2BOIA 1PGW1 4RGGA 4DNYA 1UOBA 2EXIA 3MGUA 4QPIB 1ASJ1 1ZBE2 1VJ2A 1LOBA 2BJSA 2HWB2 2XLFA 4QXKA 3R05A 3T09A 4TTGA 3WP5A 1U5YA 4Y22B 4ZKTB 3J7HA 4L99A 3KT4A 3ZYJB 1GOHA 1OD3A 1ODMA 3I3MA 2ZA9A 3IZOA 3MF9A 4ZPIA 3ZFEC 5BNPC 4ZONA 1PO22 3AP9A 5H9RA 3AZYA 2EXJA 1XE0A 3VBRA 5DQ0A 3VBUB 4AZZA 5K4LA 1YQ2A 1HJGA 3FLPA 4Y1ZA 4AHXA 5L7OA 4NHKA 4ZS3A 1CAXA 5FXWA 3TEWA 5LBBA 2QQVA 3BB6A 1LHVA 1GWLA 4NRMA 3IMMA 3GJAA 5EWSA 1QWRA 3SISA 5FPAA 1ACCA 4M01A 2P17A 5FZKA 4LITA 1BLZA 4R52A 4BM8A 4IQPA 2W1UA 3LZZA 1JHNA 2ARBA 3W9AA 4D94A 2K2SA 4Z8BA 3PVNA 1SZBA 3KM5A 4XOGA 3LD8A 1JZ5A 1UCXA 5JMOA 4GB31 5FPBA 4WVMB 1S2EA 1Y7BA 4Q8KA 1V6NA 5AC93 1JMUB 3RVHA 2YV8A 3QLQA 4E4SA 3WNOA 3WW4A 4JDNA 2XOMA 2D40A 1GWMA 3D3AA 1TQ5A 3WD5A 3INAA 1BEV2 5FPUA 2XHNA 1ZZCA 5FZOB 1HN1A 4QX7A 4GH4A 4J25A 2ZAHA 4M0HA 5LA2A 3NW4A 1RUD2 2B8MA 5HI0A 3FHQA 4XFGA 4WVVA 5I8SA 1LOEA 4NN0A 2FCVA 3H0OA 4HG6B 4XUNA 4CCMA 1CAVA 4HPKA 1AR92 2B5HA 2B45X 4FPJA 2ADEA 3USSA 2VXRA 1AVBA 4U36A 4XBQA 3I2OA 2QUOA 3OUHA 4YRDA 3H8RA 1CGPA 4QDRA 5A33A 4CCEA 5FY1A 2JDPA 4XDPA 4DQAA 2WN2A 3BALA 4WZCA 3VD5A 3WDVA 1Y9QA 1GOGA 1KGYA 3JUUA 4GKYA 3VBSC 2MPFA 1N3QA 1YIFA 4DXZA 5EZWA 4CPBA 1X9PA 4EWAA 4LLFA 5BNNA 5FY4A 4KGQA 2IUWA 3MIHA 5A3UA 3AVSA 4IUGA 1SQ4A 2EIDA 5CB7A 5ANNA 1U5ZA 4ZU7A 2QQLA 4TZDA 2BPA2 3H50A 3TEYA 2ZJCA 3Q8EA 4K8RB 1UL9A 5LY2A 2F4PA 1VBC2 1MZ5A 4LBQA 5LK7B 1KFXL 3R6SA 5A7WB 2E31A 3ZR5A 2YMZA 4A44A 2YC0A 3VD3A 2BFUS 4KBBA 1LOAA 1YHFA 3VHRA 3GJBA 4AFCA 3NNMA 3A4UA 5J3UA 1AXYA 3USUB 2BDRA 1RYYA 2DF7A 2G9GA 2JG9C 5A6XA 3NV2A 3NAPC 2OT7A 3VDDA 3WF1A 3WUDA 3ZN6A 4MOAA 4AK3A 1QJX3 2IXKA 3VHPA 5F7UA 1SFPA 5KBFA 3VB9A 1X8EA 1Q5OA 4CRQA 3BUCA 3N7MA 3VGIA 1PO23 3HBZA 3W21A 5JZGA 2J1SA 4H3WA 4KL1A 5HXVA 4YFZA 4PQ9A 4LK7A 1RUD1 5GM0A 1MS5A 3WT3A 2RV9A 5C9AC 3OJBA 2B4KA 4GJZA 4MXWA 2CNAA 2QFEA 4H7LA 2BGPA 1FNZA 1ULFA 4BXSV 4PT6A 4N53A 3MIBA 1IS4A 2LROA 1NG0A 5CADA 2F4LA 2EIEA 1JYNA 2IVJA 4LA3A 2VMDA 1CD3G 1LESA 5GZEA 1CX4A 1RMU2 1BQPA 5J98B 3MICA 4DRVA 5J1XA 4G9SB 3KQ4B 5JPNB 2J1RA 1C8NA 3ME2A 3KV4A 1ZYBA 4IXLA 5BPXA 2ZPXA 3V65A 4CDQB 5FZOA 1A6CA 4LQRA 3O0XA 5FKBA 3ZYBA 4P9WA 4FTSA 1SMVA 4MX3A 3U07A 1ND2B 4UYBA 4XAEA 4LA2A 2NN8A 1EP0A 2VL4A 3WX5A 2IXCA 1C4RA 3LIHA 4SLIA 2OA2A 4K9SA 3T2TA 1JZ8A 3OF1A 3O1UA 3MIFA 4A7YA 1RVF3 2HWD3 5E88A 3MUY1 4LTAA 4NIAA 2ADDA 5IT6A 1D4M2 3O1MA 1R083 2WABA 4XFHA 1HB2A 1Q8OA 1ULGA 2AREA 4IV3C 3U4XA 1AL21 1JYWA 1UKRA 5I0TA 1G86A 4UT5A 1MS1A 1ZBA1 4M0NA 5EQUA 4P9IA 4C91A 1IKQA 1O7FA 4Y1YA 3LAGA 2X29A 2ZMKA 3JD72 4CSWA 1PO13 3ZO0B 2GC2A 4QDQA 5FQ0B 2WN3A 4HANA 4YGDA 5LK5A 3I3EA 1FI2A 1HXS1 1DGWX 2HWE2 5CKMA 4HFSA 1PNGA 5E89A 5A3OA 3ZMNA 1DZTA 2VPVA 5DPNA 1LAJA 1YO8A 4IEUA 4HN0A 2HYKA 2ZHMA 1KDKA 3AKPA 1NCQB 4XUQA 4HN1A 2A71A 2H0BA 1RHI2 1YI9A 2CDPA 3OOXA 4AAXA 2BVVA 2PELA 2ZS6B 2VNGA 3HPNA 3WQ0A 2HKXA 4AOCA 4Q4V1 2VXJA 5J37A 5JXJA 3AFKA 3HMYA 2DBIA 3BTAA 1NA1C 1WMEA 2A73B 4QQLA 3U75A 5C5TA 1HRI3 1UW8A 2RM21 4XYXA 1D4VB 1QJZA 1X9TA 2QVSB 2WSVA 1F8VA 2ZEXA 1WCKA 3ZXLA 4XFIA 2Y38A 3GF6A 2EIGA 1ZRIA 2YXSA 4RQPB 2P6HA 5KWRA 3KVAA 1RUOA 2WUHA 2FDJA 1WCDJ 1OA2A 1RHI3 4WM8B 1F4AA 4GIQA 4Q4Y3 2VQTA 4FPGA 2ZGSA 4PBOA 1PGSA 2H6CA 1OLRA 1QGLA 3NNFA 3QBQA 2ZHKA 1X33A 4I02A 1UU6A 3AKQA 4FPOB 4K6BA 1HRI2 3EJKA 1SLAA 1U5IA 4LBNA 3SHRA 2QZ3A 1Q8PA 3AZWA 4AGGA 3VKFC 2W1SA 4RR3C 3JD71 3N7JA 3MV01 2UWBA 3KSCA 3PUHA 3RFRA 1WD3A 2BFUL 3ETPA 4XZPA 5FYBA 5B4XA 1CQ9A 1F4HA 5J36A 2R043 3PTRB 4CUBA 5BNNC 1OA4A 1CVNA 2LTNA 5FY9A 5JOXA 4UFIA 2DV9A 4LPLA 4LO7A 4NROA 3BU0A 3LEMA 4A2UA 4Q4X2 4BIOA 1Q8QA 4LBMA 1ODNA 2RR13 4NAMA 1MS3A 2VTFA 4GA9A 4AF9A 1VB2A 2GH8A 2XB6C 3RNSA 3E6DA 4UFMA 4Y4YA 1H1MA 4FBFA 1ZZ8A 2WINB 1V9U2 3Q9OA 3HVDA 5JVVA 3ZFGA 4BQ1A 1K45A 1COV2 3LFMA 3C7HA 4ARYA 4QGNA 1UPSA 2HJIA 4LO8A 5A7QA 5IVFA 1PGL1 3JQXA 3LCPA 4BE3A 4INDA 4YGEA 3MO4A 2Q30A 1G7YA 4CDUA 3N7LA 4ES8A 1UYXA 4R9BA 1YQ8A 3BKZA 2XGXA 3LA2A 4FFGA 3SCHA 3DUIA 4OHWA 5LW9A 1UNBA 4MO3M 1AXZA 1IQAA 3NWKA 5C6CA 5CIRA 5DN2A 2H0VA 4NIHA 1DLLA 5FYIA 2YB7A 5HPOA 4IV1C 4S2HA 2C24A 4YVSC 2AZ5A 4XIKA 1DGRA 4OUMA 5LASA 4UW5A 1SPPA 3ZLIA 1W2TA 2O14A 2R1DA 3J8F3 3PDQA 4DMIA 4AI0A 4IEWA 5DAQA 1JYIA 4QQHA 1LULA 3N9OA 4J6GA 4L2NA 4MXWB 1VAKA 3AB0A 3NV3A 3QD6A 1WA6X 5F3CA 3BTZA 3OGVA 4XQDA 4G4FA 1BEV3 4LE4A 3RYPA 1K5JA 2HWC1 1S2KA 4GWJA 3RZZA 4NVPA 3VZJA 3IBMA 1H8VA 2BU9A 5JXGA 3RSJA 1RL3A 3LF7A 1DZRA 1XOYA 3EO6A 3MLJA 5EJZB 2VZSA 5F9TA 2WWUA 5FWJA 2RJ2A 3VKOA 1ULCA 1J1TA 3FUQA 4NE9A 4PDWC 2ZMNA 2NLRA 2PHRA 3K3OA 1ULOA 3R4UA 2RG4A 4DZGA 4EROA 3SMHA 1OLME 4YZ4A 3WW1A 1OOPC 5CKNA 3MYXA 3AZZA 1SFNA 4IE0A 3U1XA 4Y20B 1ZA7A 1D2QA 3VV1A 3ZFEA 1FX5A 2MHFA 3AZXA 5F3EA 4XFAA 1UXXX 3B00A 2CWMA 1I9RA 2YBSA 3CKHA 4JGYB 4R4ZA 5HCAA 2ORZA 3ALQA 1W8UA 4N90A 5H9QA 2FDIA 1QDCA 3PVBB 5HV4A 3GZUC 5K9YA 5M0TA 2O8QA 5FZ1A 2A3XA 3T3YA 2DCJA 2VUJA 2ZGRA 3NJZA 1LEDA 3HAGA 4IEQA 1R093 4JRLA 3T1LA 5SV5A 1KDMA 2WNUC 3VBSA 2WAAA 2PLV3 3UYJA 5JOWA 2OPWA 3DPRB 2OX0A 4O9GA 3SCGA 1AL0G 3MLKA 4S2GA 2XWJB 4FP3A 2BWAA 4NPMA 3S5AA 3LIGA 3WLUA 5C4WA 4N7UA 2NYYA 2BZDA 1G8WA 1VAVA 1HXS3 4NWVA 1GOFA 3ZSJA 4CU8A 3ILRA 5J7MA 1R1A1 3D0SA 5FK8A 2Y6FA 4CE8A 1W9WA 3WDXA 5JXHA 4MGYE 4I0BA 2BRTA 1CZVA 1FMD2 5GLVA 2PTMA 1UU5A 2Y8KA 4XF0A 3AKSA 5FYYA 4B1MA 3ZIXA 1RUJ2 1C1FA 4AWDA 5I0RA 1OT5A 1PVC3 2ZGNA 5FZIA 5IK8A 5D2AA 2VUDA 2EIBA 3MF6A 1R1A3 2YC2A 1UZWA 4FO9A 3T0DA 3DPRC 2R0FA 3TEXA 4ET7A 1MEC3 1B35A 2E7AA 3D82A 3EXUA 4AFBA 5DMYA 4E2GA 2ZGMA 1US3A 1JZ2A 2ZGTA 1FAYA 2WZR1 1N1TA 4OZOA 3EB7A 1W8TA 2PLV1 4IEVA 4LNVA 4M3CE 4DIQA 2JDMA 3B94A 3ZVXA 4RYDA 4BOWA 2JIGA 3R0RA 4XFBA 3SLIA 3KV6A 4JKMA 3RWNA 2CWSA 2ZEYA 2QE3A 1KXGA 4N7IA 5IWFA 2DVGA 2B42B 3T4VA 3VDAA 5BNQA 1W6PA 3JB8A 1CAVB 1GKBA 4QB2A 3I2HA 5DZEA 3S5QA 1PIV2 1X7NA 3M2MA 4OI1A 3H8XA 2RS52 1BBT3 1IGOA 1QH6A 3ZFFB 1G9DA 5A3LA 2R6QA 1W8NA 1BBT2 3RZLA 1W9SA 1UQXA 4XZUG 1NOVA 3PIJA 1PIV3 4H14A 4NOTA 3UK9A 2XVGA 3ECQA 3ITQA 2AYHA 5A3WA 3ZR6A 1KEXA 3V0BB 2W1WA 1F5FA 1J1LA 2D5HA 4AQ2A 4CDXA 4M3CF 3NJVA 3S0MA 4HOOA 4K7JA 1LTEA 2WFF1 2YFZA 4FXGB 4AEJA 1UY0A 2D93A 5FJKA 1QMJA 4MGIE 2GMMA 4QMAA 1TZOA 3WF0A 2Z42A 5J96B 3PMSA 4B4PA 1GZ9A 3MUZ1 2JDNA 1VPHA 4QGLA 2C0ZA 4OHVA 5AVAA 2B46X 4XJZA 4ZZ8A 1LKNA 1ULPA 2ZEWA 4OCTA 1QY4A 2JJ6A 4FPCA 3E5XA 5K0UC 5A7WA 2PAKA 3N3HA 4AQSA 3RZGA 3VBFB 5J48A 4ASLA 1QJY3 2JXAA 3AMQA 3RGBA 4FOYA 5JLVA 1TME2 2YU2A 3BPSA 2MNGA 4I2OA 5I0UA 1NXMA 4MGTA 2VMHA 5BNOA 1FOD3 1CPNA 1O6UA 4CDWC 1JOBA 1UZVA 1W0NA 4ZU4A 3ZYRA 2Y33A 5C7GA 2RS33 1XNKA 4Y26A 2RMU3 4CPBD 4BXFA 4A3XA 4FFIA 4KWJA 4Z2WA 4N53B 2D6KA 1BK1A 1OLMA 1L7RA 1YIPA 1PO11 4U2AA 5J09A 4LT5A 3LFIA 4PF1A 3ZSKA 4K1ZA 3EHKA 3LOBA 3E6BA 2QDRA 1AR63 3ST7A 4QX5A 3N36A 1REFA 1AXKA 1OLQA 2DU1A 2VNRA 3BYWA 4AI2A 3IPVA 2EAAA 4I0WB 1BBT1 3N9PA 1EY2A 3KCXA 5CNAA 2P2KA 2NPIA 3BU7A 4P5YA 1MS8A 2W95A 4GKXA 3ZKUA 1ULEA 3NRUA 4WM7A 3RG0A 2ZBJA 3HQXA 2CU5A 4MSVA 3OBTA 4KGGA 5C70A 5FZ9A 1O3SA 1O3QA 4LHNA 4D6SA 3T0AA 4M4PA 3POFA 1XB9A 2VO5A 3ON7A 4QDSA 1LOFC 3QH6A 4LLOA 2YDEA 2Z79A 5LCWL 1A34A 1GP4A 3TN93 3WF3A 5LRRA 4WVZA 1CJDA 4CVUA 5E1RA 3RZMA 1VBE1 2GP3A 1PMHX 1SCRA 1IPJA 1RC6A 3ZFEB 3T30A 4GB33 3PHMA 5GZDA 2R041 4YARA 1IS5A 3TB0A 4AAPA 3PMEA 5ACA2 1F35A 5GLUA 3IAPA 4YGCA 1ASJ2 4XJAA 5IAVA 1I5PA 1X50A 3AX4A 3MIGA 3P5BA 4YVWC 1Y43B 4AQ6A 4ES9A 3K75B 3B7MA 3KT1A 5A32B 3UETA 2A70A 4QPWA 3TNQA 3FN9A 4HK9A 4NUBA 3J7LA 3MIEA 4Q8LA 5LY1A 1UWWA 4Y5TA 5KXCA 1F31A 1NQJA 5FMOL 1E5HA 1ENRA 1PO21 4UI9L 1Z7S2 3I2GA 3FFQA 5FMCA 4IE4A 5FWEA 2VNVA 1HIXA 1EAH3 4AW7A 1FPN1 1VP6A 4HVRA 2RMU1 3V0AB 3HNMA 4UAPA 3UJQA 1DU3D 3AP6A 4DRRA 3FBMA 1OH4A 1C8M1 1ZREA 4XJWA 2QZ2A 3FMGA 4DO0A 1YCIA 2X8KA 5FRAA 5FUNA 2RM23 4CEWA 4WM7C 4QX0A 5FYHA 4IW3A 1OHFA 5FMDA 5DZGA 2R071 4IEYA 2WQ8A 1EV13 2E7TA 3H3UA 3MFCA 1RUG2 4WVMA 2QQIA 4FTEA 1LNSA 2O1QA 4GB32 2W1QA 2D6LX 1YFUA 3OD0A 4TSVA 1AX1A 2I2SA 2Q1ZB 4YVSA 2XKPA 4Q5OA 1MACA 1EUTA 1VAMA 5JOZA 1AHSA 1G9FA 2SLIA 3A22A 3KGLA 4NHXA 4S2DA 5CVRA 5DAWA 5C8CA 1G9AA 1UMIA 2P37A 4XF1A 1VBE2 4GALA 3ORJA 4M4RA 3RMYA 1OXCA 3VBHC 1WMDA 4LKEA 2X53S 1GMMA 4GWIA 3VZKA 2D43A 1GBGA 2Y34A 4QPGA 2O8OA 1Y3TA 1VR3A 2IC1A 4FQZA 2QQKA 2ZXQA 1HV0A 5DABA 1DP0A 1V6IA 1VBA2 3E5QA 1V6JA 1NT0A 3VKNA 1SBEA 1CZSA 1EAH2 3FJSA 3VDDC 4JVAA 3HIFA 2VR4A 3I2JA 4AFMA 5LATA 2CGNA 3WR0A 1W8ZA 4LE3A 5C3QA 3SNMA 4ZU5A 1TME3 3ZXDA 4HBNA 1VE0A 1BVVA 4I30A 4K40A 4XACA 5A80A 1H2LA 3BVCA 2XJSA 5LWBA 4FPEA 4RHV1 4YZ2A 1VRH3 3KB5A 1S0IA 4LOSA 4TLFA 4N43B 2BV4A 1FPN2 5DDJ2 3ROUA 5KHGA 1DDLA 1I5ZA 1WUVA 1XC6A 2RS32 4YVWA 5FLHA 3EQEA 4FVVA 4MH0E 1M06G 1JHJA 1RUNA 1VBD1 1K3IA 1RJ7A 3THTA 4B7KA 4R9DA 1J83A 1V6OA 5IATA 3HWJA 1W9YA 1MPXA 3CF6E 1OF4A 2J42A 1JYTA 3I3QA 1SBDA 1LGNA 1URXA 1ZZBA 2OW4A 4LBQB 1B35B 4JC1A 1JI6A 1GU3A 5A6YA 5IAXA 1QNWA 2GNDA 2W47A 4F8AA 2Q4SA 2VTXJ 3MEPA 4QPGC 1GANA 4MGKE 1DLCA 5JI9A 3WG3A 2V4AA 5EPAA 4CA9A 3VBHA 4OFGA 5FREA 3RI8A 2WJSA 2IXHA 4MXVA 2ET7A 3WF4A 1UO9A 2DVBA 5JSPA 2D6NA 5CYYA 1UMHA 1O59A 3ES4A 4LEJA 2GH2A 4UF0A 2DUOA 2OZ6A 1POV0 5FZCA 2Q8EA 4DXRA 1ZZ6A 2Y64A 4LBQD 3VZMA 3NMBA 2QTWB 5JIUA 4W4ZA 1OOPB 1QOSA 1PK6A 1VBA1 5FMOS 1US2A 4YM2A 4WZFA 4AVBA 2KXLA 3IIIA 1CZTA 4LBLA 1CR7A 2JB4A 2VNOA 4CEWC 3POWA 1BMV2 4DEQA 1PVC1 5FUIA 4XBNA 3ZSMA 1V6MA 4LKSA 3OGSA 1JOJA 4KU8A 2XBO1 2CGOA 3W5MA 3RWKX 1ZBA3 2CY6A 5CFCC 4AHZA 2WR9A 1DIWA 1ZX5A 4GH4B 5T5LA 5JMCA 1C5IA 1J3RA 4EZ4A 4B8EA 5CG8A 1W90A 1W3XA 2QQMA 1OUXA 3PNAA 5FJHA 4R4XA 2VECA 3GCXA 1AJKA 1LOGA 3KCYA 3NAPA 3AFGA 2XG3A 4XEZA 4AI8A 4ATFA 2R7EB 1RUC1 1QJU2 1WZXA 3POIA
chains in the Genus database with same CATH topology
1AYM2 1KJLA 2WFF3 4L11A 3WDUA 1CAXB 4MGZE 4Y20A 4ASMB 4L92A 2BEOA 3AP4A 1RINA 2GZWA 4UW4A 1GR3A 1J3PA 3CL1A 3PJQA 4OHXA 4XIOA 5T54A 2A5ZA 1DQ4A 1UD1A 1H1AA 5BNPA 4FXKB 1LJ7A 1ZBA2 3AKRA 1NCQC 3TBDA 3IKWA 5FOJB 1ZRFA 1ND3A 1YFWA 5ABJB 2F6BA 2C5DA 1H2NA 1HXS2 3AXEA 5AVPA 1SDWA 2AGSA 1JUHA 3KZ4C 5F6KA 2N7GA 4AEDC 4JRAA 4OI4A 3TRSB 3QCWA 4JGZA 4K21A 1SCSA 3NVCA 2G4IA 1PZ8A 5KHIA 3ZYGA 4HSJA 4QT6A 1ZA4A 4XXAA 4IV1B 5BNOB 1CAWA 3OY8B 3RYRA 3ZN4A 4QD2A 3M3IA 4FPLA 1JW6A 2XVLA 2IXIA 4MZUA 2HWC3 4YNIA 3I7DA 4CP1A 1ZM1A 1UKGA 2VOWA 4XETA 5EJ3A 1WW5A 4B3NA 4FAGA 3M8LA 5FO9B 5E16A 1QJU1 2D6OX 3MPPG 4KH9A 4PLOA 3LWCA 1HQLA 2QKDA 4CEYA 2DVFA 2IFWA 1S0JA 1FMD3 1WLTA 2UURA 1BKZA 4CDXB 1QDOA 2Y26A 1VBA3 4M3CB 1POV1 1MQTB 1BXHA 1I1EA 4M00A 4UBGA 4Z07A 3UKTA 2ZX2A 2HEWF 1VBD3 3G7DA 1XNDA 4QQOA 4MLOA 1RUF3 5IUQA 3O7OA 3S6PA 1AZDA 3CJIC 4CDUB 3ZXGA 2BNOA 2E7QA 4RFT0 3WXPA 5SV8A 4C90A 1ZZ9A 1DGLA 4XJUA 3RRDA 2BYVE 4JGZC 4LUKA 1IHMA 5JPMB 1E57A 1RUE1 1XYPA 3KD4A 2VU9A 3OBRA 2MEV1 5FCCA 4E4DX 1EV12 3WP3A 3WHTA 1GLHA 4XW3A 4BA6A 3DGTA 1EPWA 4MVTA 3APBA 4QQPA 2UY8A 4BIFA 1UIKA 3CO2A 4N9HA 3LKJA 1PGL2 3LSDA 1D4M1 3CJIB 4CDUC 1RJ8A 2YYOA 3HD8B 2WQ4A 1RUG3 4IEOA 2KA3A 4PLNA 2JE7A 1ND3C 2WT2A 3RS6A 2IFRA 4AFDA 4Q4X3 4K8FA 3D5OA 2TEPA 4RL7A 2WFPA 2TUNA 2GSYA 2DUQA 4AGRA 3OYWA 3KQRA 1WA4A 3E6CC 3AM2A 1V9U3 4XMAA 1RUF1 4ZXKA 2WZPP 2ENRA 2FBEA 2R16A 1QJX1 2XJTA 4YGBA 2WWSA 1RHI1 3M3OA 3OGGA 5A33B 1POV3 1A8DA 4DB5A 4FPFA 3BOWA 4FOQA 4RR3A 1UAIA 2GDFA 4OLLA 3UJOA 1WMFA 2K9ZA 2BQPA 2ET1A 2GALA 4HVQA 1RUE2 2GN7A 2JG8C 2MEV2 2FMYA 1ZZ7A 3W58A 1HW5A 2A3WA 2JE9A 1LGBA 4ISRA 5L19A 2Z69A 4F83A 2AUYA 4XHXA 1XRUA 3TWIA 5L7OB 4AHWA 1AR62 4AI3A 2JENA 3X29B 5FO8B 3VUOA 2D3PA 2JICA 1HRV2 4RA0A 3V0AA 3ZSEA 1Z0HA 2CL2A 3I59A 3MW4A 4D7SA 5GJ6A 2WNEA 1N3OA 1ZNPA 1H1IA 1UZYA 3VHOA 3NKGA 1QHDA 3J9SA 1QF3A 3WHUA 1YFYA 2VMGA 2GC3A 3GHMA 2CV6A 2C1FA 2ETEA 3RQ0A 1XE7A 5HBAA 2PAEA 1FOD2 1MS0A 2NMNA 2I74A 5GZCA 2SBAA 3A0NA 4EN7B 2DFBA 3OCPA 4Q4X1 1C28A 1QQP3 1VBB3 4LUMA 5T5JA 1CJPA 4BHPA 1YNAA 2IWGB 5GLWA 1AR82 2RS11 2W52A 4XF9A 3WUCA 5C8CB 1VBB2 1MS9A 2D5FA 5AFBA 3AMHA 3NKTA 1D4M3 4GMP0 4YG3A 1COV1 3WDWA 3ZFGC 2K0GA 4KWKA 4P5HA 3FFZA 1R1A2 3QH7A 1F2NA 1RUI2 1NCRA 4IEZA 3BODA 2GC1A 3SXWA 4X8PA 1JH5A 2YROA 4YYOA 1HRV3 3O12A 1LR5A 2Z2SB 3M3EA 3LA7A 1DGWA 2ZCWA 1MZFA 3E97A 1AR61 1J58A 3JBG3 5C8CC 2KM2A 2R073 4GXLA 5K8SA 4AHYA 1AUYA 3ZX7A 2VG9A 3ZFGB 1AL22 5EV7A 3WP6A 1Q43A 2PLV2 1WCSA 4BYYA 3MW2A 1JUIA 4HT1T 2VGDA 1UIJA 5A32A 1WLDA 3VBSB 3I2DA 4RS5B 5I91A 4XFFA 4YSFA 1FOD1 1O5UA 5F6LB 1K5MB 3FHIB 1C5HA 1RMU3 5GZFA 3LOIA 4R9AA 2RS51 1BZWA 4Y1UA 2NP0A 1PNFA 5KHKA 3H9AA 4FQ4A 3ACLA 1DYKA 3JB4C 5H9SA 3HT2A 1VBB1 3VKMA 3W59A 2GU9A 1SLTA 3N7KA 4Q4V2 3VZLA 1GFF2 5LEKA 2EA7A 1AR73 1HLCA 2WNVB 4BH9A 3MZHA 3P3NA 2QQPA 5F5QA 3B02A 1N3PA 4RS5C 3VL9A 4FAHA 1G6NA 3PVEA 3LSEA 1N1YA 2GC0A 3B9IA 3JU9A 5JIAA 1DQ2A 1O4ZA 1GZWA 4I3GA 4IV3A 4NWWA 4OI0A 1APNA 1KITA 1MZEA 2PQQA 3PLQA 2UYBA 4M3CA 3JQWA 5DXDA 3WNXA 1GQHA 3LB9A 1LOCA 4WM7B 4X6QB 2WA3A 2HEYF 4COYA 3WG1A 2WNVC 1MVQA 1U12A 3AZVA 3CEWA 5T5PA 1WBFA 1GYKA 2DU0A 4DINB 4Q2FA 2XH6A 4DY3A 4E9KA 1KD7A 1OI6A 4Q4Y1 4AYUA 1SLBA 5I8TA 1H8TB 5F1RA 4Q1PA 3H7YA 3ZPYA 4QPYA 2LALA 4CEYB 2WT0A 4XXPA 1FMD1 2ILMA 3AP5A 5D8AC 4Y22A 2WKKA 5JZGC 2GNMA 1CONA 2R061 1S1AA 3SITA 3ILNA 2CAUA 3L2YA 4KU7A 4BWOA 4Q4V3 2VW1A 2XBO3 2A6YA 3FLRA 4Z82A 3AKTA 4RSUA 4CDWA 3VBUA 3VBOC 2P3KA 1YRZA 4I01A 4YFWA 5CA6A 5K0UA 2WZR2 1H8TC 2VW2A 3RJRA 4NHLA 1XXNA 1UF2C 4CTEA 1D0HA 4CEYC 1A3KA 4L8QA 5BNOC 3V0BA 1CAWB 3OY8A 2R042 2VQ0A 3J8F2 5JSRA 3VLBB 4AXOA 2OUJA 3A0KA 4YM3A 2FQPA 4IESA 4BPZA 1KRIA 4QGMA 4Z92B 2XJQA 1R1ZA 1QJY1 1V6LA 3AYDA 4B4QA 2UY9A 1PK6B 3MFAA 1NA1B 2ZX1A 4H55A 4PBPA 4XFCA 2DCYA 1QQP1 3VBOB 1SLIA 1R081 4LBOA 1Q56A 2YUEA 4UW3A 3H7JA 5FAXA 3V56A 1TMF2 2XJVA 2XHKA 2ZTNA 3NL1A 3KS7A 1V00A 2FZ1A 3NSTA 1NXD1 1H4GA 4YZ1A 1ZRDA 2TNFA 3GBWA 4CDXC 4EWDA 3WQ1A 4QHBA 4Q0PA 5CFDB 1RGSA 4IERA 5DUVA 5LRSA 2XVKA 4E2QA 4YZ3A 2WS91 3NAPB 3AYEA 2XJPA 5DG1A 3ZYPA 2R072 2VY0A 3K48A 4XILA 1CIWA 4DS0A 3OPZA 1TME1 1LHNA 2A6VA 1QJU3 3WP4A 4IEXA 4LO6B 2P34A 4PDWA 4PIZA 3L9JT 3FBYA 4KG0A 2Q5TA 5CFCB 4GH4C 1W6OB 1D2SA 3HT1A 2HEVF 4LHLA 1YI7A 2BWCA 3DF0A 1BVP1 1NLRA 1QKQA 2JKBA 2JX9A 2ZGLA 3ZYIB 5KC6A 2JECA 3M3QA 4E2SA 1FT9A 2BNMA 2WSUA 1O91A 1QJY2 3AK0A 3M1HA 2BUKA 2Q0AA 1V70A 4Q26A 4F3JA 1YXWA 1IKPA 4JTOA 1JN2P 3WINE 3OTFA 3QACA 2FHRA 1LHOA 1QQP2 4FSJA 3QOPA 3WCSA 4Q1RA 5DUXA 1W6QA 4YM1A 4QM9A 4PCRA 2RHPA 4BMEA 1I3HA 4HMZA 2ZGPA 1S0CA 3GBGA 1NE6A 4XTMA 1DQ5A 3TOJA 2Q8OA 1H2KA 1VALA 3DV8A 1RUH3 1WW4A 1GZCA 3VBRC 4EN6B 3IM0A 3PVOA 2YY1A 1BCXA 3TN91 1HQWA 2UU8A 3ZXKA 5IK4A 4Q27A 1W0PA 3GZAA 2VH9A 3IPVB 4CP2A 1REDA 3BPZA 4NO4A 1RUI3 1RUC3 2GAUA 2PHTA 2VMIA 1RITA 4KQ7A 4DPNA 4GWNA 3U11A 3GYDA 3BCWA 4COZA 4FOWA 1AR83 2I07B 1NYWA 4OHZA 5DUWA 2XKOA 4CZSA 2BTVC 2EAKA 2YGLA 3SH3A 1XYOA 4HKOA 4Y1XA 4YVSB 4FPHA 1C8M2 4D3WA 2DVAA 4WBBA 1RVF2 2HWD2 1Q3EA 4QPIA 4N43A 2PHUA 1BMV1 2ZACA 1PVC2 4AVAA 1RUJ3 4EN0A 1W6NA 2EALA 2XBO2 4AEDA 3PJYA 1AR71 4HETA 2W08A 1DBNA 1N1SA 4GMP1 2RJKA 2W68A 1VBC1 2ZKNA 1S2BA 5I8YA 5KHHA 2D97A 3AMMA 3IDEA 3UKNA 5GLTA 3H1WA 1TE1B 2ZMLA 1TMF3 2DUPA 2DCKA 2UWAA 2VW0A 3ASIA 1WW6A 4JGZB 1W39A 4GMP3 1QXRA 3CLPA 3FE5A 2WQZC 5EFUA 4AE2A 3IWZA 3AMNA 5BV6A 1XNBA 4KNCA 5DZFA 3OYWB 4YW3A 1ZBE1 2HWB1 3ENRA 1AR93 4Q29A 4P9GA 1DYPA 2QNKA 4JV4A 4HPKB 2ZOEB 1NZCA 5L36A 2XWBB 1W0OA 2DTYA 2DYCA 1BJQA 1CAUA 1LHWA 3B5LB 5JOYA 5BUVA 5C8WA 3C3VA 5I0SA 2RE9A 4AG4A 4HZFA 2D6PA 3ILFA 4RR3B 3OGJA 1VBC3 5JCTA 1BYHA 2P3IA 4SBVA 3WQ7A 3ES1A 2WNUB 1X36A 5FBZA 1PVXA 1VBD2 2JD4A 1L3JA 5AFEA 1CN1A 1RVF1 2HWD1 5BNNB 2EXHA 3PTYA 2JDZA 1JXNA 2VVDA 3RDIA 3ELNA 2ARXA 5ACA3 1AR72 1OPMA 2WZR3 5T3NA 1GNHA 1OMIA 1LB2A 1DGRN 1NY72 4XF3A 1RUH1 4KWLA 1HQNA 5BYNA 3CU7A 1TNRA 3B69A 4S2FA 1AJOA 3CJXA 2OZJA 4G3YC 2CGPA 2ZGKA 1H0BA 2R063 1DZQA 3M3CA 2PHXA 2BGCA 1I6XA 3NV4A 3VN4A 4HKLA 4JDOA 1QXPA 1JYCA 5KXEA 3KMHA 4FPYA 1M4WA 1O4YA 3VZOA 2R0HA 1XNCA 2PN5A 3IT8A 3M4FA 3TNPB 1LHUA 1QOOA 5AC92 2PAMA 1DHKB 1ALYA 1F5JA 5CAZA 1GQGA 2R49A 1N1VA 2RMU2 3H1YA 1ND2A 3KCCA 4I0AA 4YVWB 1ENQA 3WDYA 2YPJA 3D6EA 2YHJA 2I45A 4Z1VA 4LULA 4Q0SA 3ZIWA 5K7PA 4JGYC 3BOPA 3ZMOA 5ABJA 5FOBB 4OHYA 3G6JB 2D3SA 1PGW2 3DN7A 1RUG1 5D1IA 1NY71 1H30A 1W2UA 1AYM3 3GHNA 2WS93 1HV1A 4Q4W1 3ATGA 4HVOA 4N9IA 3ETQA 4CDQA 5D8AB 1VLNA 1LOFA 4P9LA 4AVVA 4AGVA 3GALA 5BY5A 4I3PA 5DUUA 1H9WA 4Q0VA 1AL23 4PJYA 2NM1A 2PA7A 5IK5A 1CPMA 4YW1A 2OUHA 1UX6A 1YJLA 4META 4E4ZA 2EF6A 2HWF1 4W65A 1MS4A 3USUA 1S55A 3UL2A 1XU2A 4EV0A 2VVEA 4O9EA 3ZN6B 2VOKA 5BNPB 1MZ6A 3MI8A 3AMPA 5AC91 1ULDA 1W6OA 4RHV2 5DDJ1 4N53C 3V64A 3ZN5A 1ZBE3 2HWB3 4A7KA 4K1YA 1QH7A 3L2HA 4RGAA 4PIXA 3RYKA 4GWMA 2B9UA 3FX3A 1GNZA 1NA1A 2AH2A 2NQYA 3WVJA 1YFXA 3O14A 2WC2A 5EYYA 5KXDA 1JBCA 3SH4A 1BEV1 1S0FA 5TSWA 4GULA 2ZHNA 2TBVA 2QCSB 1HRV1 3ZFFC 2CAVA 4AI1A 4AEMA 3P3PA 5CU1A 3AYCA 1NCRC 2H6BA 4Q4W2 1AR91 1LCLA 1FPN3 3IDBB 2ZKLA 2VOVA 3BIWE 1OA3A 3IMNA 3M70A 2HWE1 3B01A 1RIRA 5JR7B 3WW2A 4V1PA 3MW3A 4EN8B 2V5YA 1C3HA 1DFQA 1EV11 2E53A 1AR81 5FLIA 2HWF2 1WLWA 2RS12 4CP0A 3AJZA 3DL3A 1MQTA 1AX2A 2YGMA 1DQ1A 5FQ0A 5CFDA 1DF0A 1NCRB 1RTVA 2JG9B 4C1WA 5CG9A 3KT7A 2A6XA 4FTBA 3J4UH 1UPIA 2RM22 3SCFA 2R32A 2ZZQA 3WDTA 4CDWB 4C0BA 3VZNA 4R9CA 5KHJA 1NCQA 1SEFA 1UU4A 1WLCA 3ZXJA 1AYM1 4H7MA 1OQDA 2PHDA 3I59B 3WOGA 3WY6A 3NO8A 1REEA 1Z7S3 2MEV3 5GZGA 2E9QA 4UW6A 1RUE3 1ZRCA 5GALA 2BW8A 4W6WA 2XL7A 5IK7A 1AYN2 3OD4A 5HCBA 1RB8G 1HRI1 3HN1A 4LBKA 4Q0QA 1RUF2 2GNTA 1ZRRA 4W6YA 4EN9B 2OPKA 1QJX2 4N43C 2EVXA 2B39A 1RMU1 3VBRB 2BBVA 5CBLA 3S30A 3LA3A 2BNNA 1KFUL 1HKDA 1PZ9A 4B29A 3TAYA 5FFOC 3H3ZA 3I4IA 5GLZA 1OQEA 1AX0A 3VBFA 1X82A 2IXJA 4B4RA 5C9AB 3VDDB 4IV1A 3J26N 3B93A 2DCZA 4TWTA 4LR4A 3E5UA 4URTA 3KLSA 4ORFA 1IS6A 1KS5A 4NPRA 2UYAA 1IOAA 4JAAA 4J1XA 1QNYA 2XL9A 1IZ3A 4XE9A 2ERFA 2A7AA 2QDNA 1W6MB 4XTPA 1G9BA 1UZZA 4UXAA 4YZ5A 4AQTA 5KXBA 3ZXFA 2WNUA 4XDQA 3H8UA 1WBLA 1QOTA 1SBFA 2A75A 2R30A 4ONUA 3FC0A 1B35C 1NLSA 3B9CA 1H4HA 2ZGUA 2OYZA 2Y0IA 3THPA 1PIV1 1AYN1 3IN9A 1CESA 3JBG1 4RS5A 2JEMA 5FPXA 2C9AA 2D3RA 3POYA 4JTNA 1K5MA 1FXZA 2RR12 2X5IA 1OSGA 3URFA 5K0UB 1WW7A 4ISQA 5C4WB 3VL8A 3FZ3A 3VBFC 4RQPC 1LU1A 4QPIC 4XMIA 5JI7A 1RUI1 2WFF2 2HWC2 3RJ2X 1PMIA 4WM8C 5CFCA 3AP7A 2A3YA 1W6NB 2NZ9A 3ZDSA 1G9CA 5HCFA 1MR5A 4PLMA 4QU2A 4RHV3 1FYUA 1OFSA 1H9PA 3O0VA 5EXOA 3VBUC 3VBOA 4AFAA 1ENXA 4QM8A 3R4SA 3TYJA 2GMEA 1J59A 1QU0A 3JCIA 5FPZA 2DCTA 4Y5Z0 1LENA 3WCRA 4IL7A 5D8AA 4D69A 3POSA 4LO4B 2Z5WA 3H1MA 2GNBA 4D7YA 3J8F1 2CTVA 4X6RB 2WA4A 1LEMA 1C57A 2XLGA 5CFDC 4HLTA 3JBG2 2ZX0A 5T55A 5KC5A 3WG4A 2R1BA 3DKWA 1H8TA 1OKQA 2RR11 4MUVA 4XJ8A 4BZ4A 1V9U1 4IV3B 4P9XA 1FNYA 4JDMA 5ABJC 1SACA 1FATA 3FWEA 3K51A 2XPJA 4QPGB 2ZHLA 5GKAC 2P3JA 1KS4A 3JD73 4C0HA 4RD7A 1NQDA 1PM7A 4MYEA 2AENA 1Q8VA 1S0EA 1H2MA 1U5XA 2WLQA 2WS92 1XYNA 4Y24A 1TEIA 2VUAA 1FV3A 3IDCB 3ZFFA 4K20A 4HSLA 4L97A 4BMBA 2XJRA 5ACA1 3M7AA 2GN3A 5FLJA 1C1LA 4PIYA 1VRH1 5JDBA 2ZGQA 3AYAA 1LRHA 5T5OA 2E6VA 4P9YA 2JG8B 4HL0A 1KJRA 3FLTA 1R092 4COUA 2WNVA 1DQ0A 3T1MA 4NHMA 1YYNA 4COVA 1O3TA 2D6MA 3AXDA 1Z7S1 4K3UA 4LHKA 4B7EA 4YW5A 1HDKA 4KG8A 3R4DB 3RI9A 3ZSLA 1SFYA 2RS53 1DQ6A 3U0ZA 5B2GB 4YW2A 4DY5A 1MQTC 2VQAA 1MVEA 3U10A 2ZABA 2PYTA 2LM3A 3O5SA 5EYXA 3VBHB 4OUSA 4HK8A 2R062 3WZ1A 1ENSA 1VB4A 1AF9A 2VOXA 2G9FA 4CEWB 2V09A 5LEJA 3ZXEA 2O0OA 3FUOA 3I8TA 4YLZA 4YW4A 1GICA 1MEC2 3N35A 1N47A 3RMXA 4DOUA 1CAUB 1YJKA 1KQRA 4BLJA 1WGPA 3EBRA 1JTZX 1W6MA 1XE8A 3I54A 4PDWB 4AVSA 3CNAA 5JAXA 5FDBA 1GV9A 2ZGOA 5FTTC 3VKLA 4JGYA 4JQRA 4FP2A 4FPKA 4CDQC 4P9JA 2DURA 3AJYA 1YUDA 4AEDB 4BCUA 4BLIA 2XJUA 1U0AA 1VRH2 1ND2C 1EAH1 5DDJ3 5C33A 1TNFA 1LODA 4XJ9A 1IPKA 2VULA 1S0GA 4A7ZA 3S7EA 1R091 4WV8A 4AEKA 1ASJ3 4L9BA 1SLLA 2E51A 2ZX4A 4P14A 1TMF1 1OPOA 3MDPA 3WV6A 4CYDA 2ZX3A 4DFSA 1VIWB 5H9PA 2GMPA 2EXKA 2NMOA 1GSLA 3WW3A 2D44A 4UBHA 1B09A 4WVWA 2DTWA 1RUJ1 2JG8A 1D0GA 1VBE3 1RUD3 3RPQA 5A3MA 2ZAAA 4GQ7A 1QXJA 2Y0OA 1COV3 1YLLA 3UKVA 2DFCA 4I09A 4OI2A 2WL1A 5L73A 2W0XA 2RS13 2RJLA 2HWF3 2WIIB 1MEC1 2CYFA 2E63A 4ATEA 3JZVA 3LGRA 1Q8SA 1S0BA 4E27A 2FZ2A 4IEPA 2IXLA 1W6QB 3B3QE 4XBLA 5C9AA 4PF5A 1O5LA 1X8MA 3VHNA 1FV2A 2DVDA 4YM0A 2OIIA 2YZ4A 2JG9A 3UV9A 4C1XA 1AYN3 1W6PB 3MPBA 1YWKA 5DG2A 4Y1VA 4XHBA 2XLAA 4Q4W3 1UN1A 3S7IA 4F7ZA 2QJVA 4W6XA 1C8M3 4XF4A 4XQ4A 4OZXA 2UWCA 1ZVFA 2XUMA 2FMDA 1OQ1A 3D0JA 2PHWA 3KGZA 3NV1A 4ITCA 1A8MA 1SLCA 3O0WA 1XQNA 4Q4Y2 1UMZA 4TYSA 2ZZJA 3HR9A 1OD5A 4EWEA 3ZXAC 1S0DA 2DWRA 2PHLA 2OVUA 2PHFA 4XQWA 1LU2A 1LGCA 1RUC2 3GZTB 4EJRA 1DG6A 2B7YA 1O3RA 4NR1A 3WG2A 4IETA 1ONAA 3TN92 4FT8A 4LBJA 4LO5B 1HX6A 2PFWA 2WLPA 1EPZA 3GNEA 4AVCA 1PZ7A 2X5IB 4QQ2A 1RUH2 3D4KA 4R8HA 4FOVA 2V73A 4XPVA 1EYBA 3MIDA 4OULA 5JSOA 4AVTA 3C2UA 4D7TA 5JZGB 5BXXA 4YG6A 4X8NA 1A78A 2A6WA 1V6KA 4YG0A 4COWA 4J1WA 1ND3B 1O4TA 1Z78A 2ATFA 4JCKA 3SH5A 1OOPA 1IS3A 1PO12 4RQPA 3N4MA 5E8AA 4HKWA 1LECA 4Q0UA 3DPRA 2W39A 3MLLA 4WM8A 3CJIA 2IZWA 1GZWB 2X5IC 5FO7B 4FCAA 1PHMA 3IIAA 2ES3A 1R082 3D8CA 1OFNA 2WT1A 2HWE3 5L7OC 1F9KA 2D98A 1K5MC 4MV2A 2BVBA 2Q1MA 1WD4A 2LUWA 3GBFA 5T50A 2RS31 1XU1A 1PK6C 1T6GC 5JWPA 2VVFA 2D7FA 4OVEA 5I93A 1NE4A 1J3QA 5C4WC 2A6ZA 2AR6A 5T52A 1PGW1 4RGGA 4DNYA 2EXIA 3MGUA 4QPIB 1ASJ1 1ZBE2 1VJ2A 1LOBA 2HWB2 2XLFA 4QXKA 3R05A 3WP5A 1U5YA 4Y22B 4ZKTB 4L99A 3KT4A 3ZYJB 2ZA9A 3MF9A 3ZFEC 5BNPC 1PO22 3AP9A 5H9RA 3AZYA 2EXJA 3VBRA 3VBUB 3FLPA 4Y1ZA 4AHXA 5L7OA 4NHKA 1CAXA 3BB6A 1LHVA 5EWSA 1QWRA 3SISA 4M01A 2P17A 4R52A 4BM8A 4IQPA 3LZZA 1JHNA 2ARBA 3W9AA 4D94A 2K2SA 4Z8BA 3PVNA 3KM5A 4XOGA 1UCXA 4GB31 4WVMB 1Y7BA 4Q8KA 1V6NA 5AC93 2YV8A 3QLQA 4E4SA 3WW4A 4JDNA 2D40A 1TQ5A 3WD5A 3INAA 1BEV2 1ZZCA 4GH4A 4M0HA 2ZAHA 3NW4A 1RUD2 2B8MA 5HI0A 4XFGA 4WVVA 5I8SA 1LOEA 4NN0A 3H0OA 1CAVA 4HPKA 1AR92 2B5HA 2B45X 4FPJA 3USSA 2VXRA 1AVBA 4U36A 4XBQA 1CGPA 2QUOA 4YRDA 5A33A 4DQAA 3BALA 4WZCA 3WDVA 1Y9QA 3JUUA 4GKYA 3VBSC 2MPFA 1N3QA 1YIFA 4DXZA 5EZWA 4EWAA 4LLFA 5BNNA 4KGQA 3MIHA 1SQ4A 5CB7A 1U5ZA 4ZU7A 4TZDA 2BPA2 3H50A 2ZJCA 1UL9A 2F4PA 1VBC2 1MZ5A 4LBQA 5LK7B 1KFXL 3R6SA 2YMZA 2YC0A 2BFUS 4KBBA 1LOAA 1YHFA 3VHRA 4AFCA 5J3UA 3A4UA 1AXYA 3USUB 2DF7A 2G9GA 2JG9C 3NV2A 3NAPC 3VDDA 3ZN6A 3WUDA 4AK3A 1QJX3 2IXKA 3VHPA 5KBFA 1X8EA 1Q5OA 4CRQA 3N7MA 3VGIA 1PO23 3HBZA 5JZGA 4YFZA 4H3WA 4KL1A 5HXVA 4PQ9A 1RUD1 5GM0A 1MS5A 3WT3A 5C9AC 3OJBA 4MXWA 2CNAA 2QFEA 4H7LA 1FNZA 1ULFA 4N53A 3MIBA 1IS4A 1NG0A 5CADA 4LA3A 5GZEA 1CD3G 1LESA 5J98B 1CX4A 1RMU2 1BQPA 4DRVA 3MICA 4G9SB 5JPNB 1C8NA 3ME2A 1ZYBA 4IXLA 5BPXA 2ZPXA 3V65A 4CDQB 1A6CA 3O0XA 4P9WA 4FTSA 1SMVA 4MX3A 3U07A 1ND2B 4LA2A 2NN8A 1EP0A 3WX5A 2IXCA 1C4RA 4SLIA 2OA2A 4K9SA 3T2TA 3OF1A 3MIFA 4A7YA 1RVF3 2HWD3 5E88A 4LTAA 5IT6A 1D4M2 1R083 4XFHA 1Q8OA 1ULGA 2AREA 4IV3C 3U4XA 1AL21 1UKRA 5I0TA 1G86A 1MS1A 1ZBA1 4M0NA 4P9IA 4C91A 1IKQA 1O7FA 4Y1YA 3LAGA 2X29A 2ZMKA 3JD72 1PO13 3ZO0B 2GC2A 5FQ0B 4HANA 4YGDA 5LK5A 1FI2A 1HXS1 1DGWX 2HWE2 4HFSA 1PNGA 5E89A 3ZMNA 1DZTA 2VPVA 1YO8A 4IEUA 4HN0A 2HYKA 2ZHMA 1KDKA 3AKPA 1NCQB 4HN1A 2A71A 2H0BA 1RHI2 1YI9A 5J37A 2BVVA 2PELA 2ZS6B 2VNGA 3WQ0A 2HKXA 4Q4V1 3AFKA 3HMYA 3BTAA 1NA1C 1WMEA 2A73B 4QQLA 1HRI3 1UW8A 2RM21 4XYXA 1D4VB 1QJZA 2QVSB 2WSVA 1F8VA 1WCKA 3ZXLA 4XFIA 2Y38A 3GF6A 2EIGA 2YXSA 4RQPB 5KWRA 1RUOA 1WCDJ 1OA2A 1RHI3 4WM8B 4GIQA 4Q4Y3 4FPGA 2ZGSA 4PBOA 1PGSA 2H6CA 1OLRA 1QGLA 3QBQA 2ZHKA 1X33A 4I02A 1UU6A 3AKQA 4FPOB 4K6BA 1HRI2 3EJKA 1SLAA 1U5IA 4LBNA 3SHRA 2QZ3A 1Q8PA 3AZWA 4AGGA 3VKFC 4RR3C 3JD71 3N7JA 2UWBA 3KSCA 1WD3A 2BFUL 4XZPA 5J36A 1CQ9A 2R043 5BNNC 1OA4A 1CVNA 2LTNA 5JOXA 2DV9A 4LO7A 4A2UA 4Q4X2 4BIOA 1Q8QA 4LBMA 2RR13 1MS3A 4GA9A 4AF9A 1VB2A 2GH8A 2XB6C 3RNSA 3E6DA 4Y4YA 1H1MA