2O8OA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
110
Chain Sequence
b'KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
publication title Induction of stable beta-sheet by Ca2+ in Clostridial collagen binding domain
rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 30
structure length 110
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2006-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8oA00
4G9SB 1DF0A 1KFUL 4DY3A 1KFXL 1QXPA 2O8OA 3DF0A 2QFEA 5FAXA 5SV5A 3JQXA 4DY5A 2LUWA 4DXZA 1NQDA 1WMEA 1NQJA 1U5IA 3JQWA 5FBZA 2XVKA 4I3GA 2XVLA 1WMFA 4DZGA 3BOWA 4HPKA 4HPKB 2XVGA 1WMDA 3AFGA
chains in the Genus database with same CATH superfamily
1YXWA 4BQ1A 2JICA 1TME3 1VIWB 3VBFC 3LIHA 3H8RA 1W9SA 5BNOC 4XJWA 2GNBA 2G1MA 2R1BA 2Y33A 2ZMNA 1TVGA 5C9AC 1S0GA 3UGFA 1Q8QA 4IGPA 1KGYA 5GZDA 3WDVA 4DPNA 3CDZB 4Q29A 4GB31 3VDDC 1F2NA 4UAPA 1PGL2 5FZIA 5JXHA 2VPVA 1W05A 5FY5A 1QJFA 1ZYBA 1UYYA 2Q4SA 4KWKA 4Y5TA 4AHXA 5FP7A 2CY6A 1DYKA 4XQDA 1PVXA 2W1QA 4QAWA 1HJFA 4RFRB 1S1AA 3WHUA 3NAPB 4WM8A 1G9DA 2F6BA 1REDA 2XUEA 3V56A 1OLMA 2WNVA 2WLPA 3WXPA 2VW2A 4JGZB 4M4PA 4I3PA 3HT2A 3MEPA 4META 1S0IA 1IKQA 1TNFA 1C8M2 4NO4A 1GWMA 1RUJ3 1RUH3 3AZWA 5EJZB 1JU3A 2X05A 1H4GA 4E9KA 4Z92B 3HR9A 4JRAA 1JUHA 1EAH1 2QQJA 1FOD1 1KD7A 1OVPA 4GH4A 3B9IA 4HOOA 5FYVA 1RUG3 2JIGA 5KHIA 4L11A 4V2WA 5G04L 4XMIA 2HWB2 3JQWA 3MIBA 1S0EA 5FJHA 1RMU3 3ACIA 5DUXA 3ZYPA 2WNUA 4XXPA 4XCBA 3THTA 3R05A 4MH0E 5KBFA 1OOPC 2QQOA 5I0TA 4BA6A 3RMYA 2GP5A 4WVZA 4QQ2A 1GZWA 5BNQA 4MHUA 3W59A 2WSVA 1CJPA 3V0AB 3N9OA 2ZX4A 4JTOA 1W8HA 4XJAA 4IETA 1SLAA 2DV9A 1RUE3 3IZOA 5JXJA 5G05L 5ACA2 2JD4A 4BMBA 3HT1A 1OA2A 4FTBA 3WQ0A 1RUD1 3LPGA 1ENQA 2CV6A 2VZOA 3ELNA 4XAEA 2DCTA 2WWSA 4JGYA 1H1IA 2HWD2 3H8UA 4JDNA 2H0BA 1SACA 2RM21 2XJTA 3VZMA 1S0DA 4A44A 1RVF3 4AVVA 2VMDA 3AVSA 4TLGA 3B00A 3IAQA 5GLVA 2VCAA 2G19A 1DQ6A 4HSJA 1DF0A 5ABJA 4SBVA 4XJ8A 2EVXA 4IQPA 2PTMA 3VZOA 5FZHA 2P3KA 3PTRB 1J83A 5D1IA 1R083 2AH2A 2EF6A 1AX1A 5A32B 1AL0G 1XBFA 2PLV3 5DAWA 4FPGA 3CJIC 1ULOA 3KCYA 1RJ7A 3WQ1A 4C8DA 3TEYA 5JOXA 1P8JA 4NHYA 3M3QA 1W06A 5GZGA 2ATFA 2ZAHA 4FPFA 1H1MA 3I3BA 4CDWC 1CAWA 2WFF3 2ZKNA 2VQAA 3PVNA 4HZFA 4XHBA 5A33A 4BQ5A 1VBA2 4HXCA 1DGLA 4Y5Z0 3IMNA 3QACA 1AF9A 1N3QA 4FOWA 3BGAA 3NVCA 2ZZJA 3A22A 4PQ9A 4BIOA 5CFDB 1PM7A 4Q0PA 4K21A 4LO4B 4QGNA 3PIJA 4HSLA 1VALA 1WCSA 4N43A 2F4PA 2FMDA 2GSYA 1POV1 2X8KA 5JPMB 1IHMA 1SLCA 3BI3A 5GJ6A 1ODNA 1RUH2 2BVVA 4GMP1 1XU2A 5LBFA 1VBE3 4RS5C 3IMMA 3NV1A 4FPHA 1ZZBA 2IXKA 1BK0A 2WQZC 2WQ8A 3HQUA 4ISQA 5FZ7A 3RG0A 3KGLA 4AGVA 1NLRA 1S0JA 3ME2A 2DCJA 4AQ6A 1F35A 5CKMA 1RMU2 4Q4X2 4IGOA 2Y60A 4D7SA 5FZ4A 4W65A 2ZZQA 5C7GA 2RR11 1ZRDA 4W50A 1ODMA 2RS12 3LWCA 5JZGA 4PLMA 1H30A 4QPWA 3ZXFA 3LEMA 1TMF1 2A5ZA 5L7OB 2DBNA 1DGWA 1PZ7A 1XYPA 4XE9A 5JSOA 3RZMA 3RZJA 3VZNA 3PUIA 5CNAA 1UQXA 4RR3A 4KBZA 1FI2A 3EQEA 3P6BA 2VZRA 4FI9A 2VD7A 4A6SA 1UAIA 5F5AA 5FLHA 5L9RA 1LOGA 1ST8A 3E1F1 3BALA 2D5FA 2XH6A 3OPTA 3AKSA 4P08A 3LA7A 3VBUB 1V6NA 3POBA 4KG8A 3UV9A 4CZSA 3AC0A 4FCAA 3ZXLA 3SLIA 1VRBA 3AKTA 4PBPA 2EIDA 4QKFA 1XXNA 1APNA 4CUCA 4IEOA 4I3GA 1ACCA 1RVF2 4OUSA 3O1MA 3JBG1 1NCRB 3IPVB 4TXWA 3ZYGA 1MR5A 3KT7A 1LOBA 4ASLA 4ZU7A 1ZBE2 2Y6HA 3ILNA 5GLWA 3AMPA 3H7JA 1R1A1 3RPQA 3ZX7A 1E5SA 1MZFA 2Q1ZB 2TEPA 3C2UA 3HNBM 3MIFA 1COV1 2EXHA 3KT1A 4XUQA 5JR7B 5DAPA 5EPAA 3HN1A 3R4DB 4GWMA 2D44A 1NXMA 2H6BA 2JB8A 2ZPXA 3FLTA 3POIA 4CUGA 5A3LA 1ALYA 1GLHA 2ARXA 1RC6A 1STMA 2HEVF 4AYUA 3I2FA 3ZFFC 1UCXA 2OW4A 2ZGRA 3ZXJA 2ENRA 2QTWB 4GB33 1C4RA 4XURA 4Y1UA 1AL23 1VAVA 1DHKB 3DKWA 4D6SA 3BUCA 2WFF2 4FXGB 4IW3A 1W39A 3BIWE 2D6NA 2RJLA 4ZS2A 5IK8A 4YGBA 1GKBA 1UZYA 5IYYA 1JODA 1XB9A 5EYXA 1DDLA 1ND3B 1DQ2A 1DU3D 2E7TA 3LDRA 3NL1A 1W0PA 2BV4A 4FAHA 2J1TA 1LGCA 2VY0A 1AR81 3AP6A 3HBZA 2VUAA 1QY4A 5L19A 1V6LA 1UKRA 4JKKA 1UL9A 1YRZA 1AJOA 2VC9A 3N7LA 3PUHA 4QX5A 5EZWA 3VBRB 4M00A 1CESA 4NWVA 3CZJA 3BTAA 3ZFGC 2J1RA 4XAAA 4XC9A 3CU7A 4XVHA 2R072 1Q3EA 5JIAA 1J58A 2IXHA 1JHJA 3FJSA 2D5HA 4NPRA 2R30A 4QDSA 5ERLA 3SC7X 4M4RA 2FDGA 5LATA 2X29A 2DWRA 3I49A 2ZMLA 3WHTA 3B7MA 3LCPA 1OD3A 3SCFA 2UY9A 3Q8EA 1ZRRA 2RMU3 3MI8A 1OKQA 4HBNA 1NT0A 1PM4A 2DVGA 2VO5A 1XYNA 1WD4A 3X29B 4UBGA 2SLIA 3O1RA 2PHRA 4MZUA 4AEDC 1HX6A 4UXAA 4MG2A 3U14A 1YIPA 1RL3A 3FN9A 3MW2A 3E5XA 3W20A 4RQPC 5D8AC 3JB8A 4HK9A 5FR3A 2ZAAA 5DZFA 4KWJA 2P3JA 3OEAA 1CONA 1O3RA 1SCRA 1J3RA 5K0UC 1KRIA 4H2AA 1N1SA 3PHMA 2UWAA 1YNAA 1FPN2 4QXKA 1QQP1 1UYZA 4PDWB 1W90A 2OUHA 1MEC2 4B4RA 4E2SA 5AC93 2D6OX 1W6PA 2XOMA 5DZGA 2JDPA 4DY3A 3BTYA 1KFXL 1OQ1A 4FPEA 3PTYA 5DAXA 4HFSA 2VOVA 3CQOA 3RSJA 1C3HA 3IIAA 4UI9L 4FFHA 2GN7A 5LK5A 2P6HA 1JYNA 5IK5A 3BIEA 2BGOA 1JU4A 3I7DA 3TYJA 5HV0A 3DXUA 1W2TA 2YC0A 3E6BA 3RZLA 4BB3A 2BW8A 2PMWB 2DU1A 2EAAA 1O3SA 3KHBA 1SLIA 3U0ZA 3KVAA 5FY0A 1MS3A 2F17A 1AL22 5A3TA 3T2OA 1JTZX 2OZ6A 4BJ0A 4P9LA 2R041 1REFA 5A7NA 5FZKA 1G9FA 4YW1A 4LKSA 1Q43A 3IAPA 5CBLA 3MPBA 1IS4A 4PQQA 4WM8B 3B94A 4FTSA 3IWZA 4M3CA 5J1XA 3K4AA 3ZYJB 4C1XA 1OBNA 3H3LA 1RITA 1NYWA 2B8MA 2DUQA 3ILFA 3N9PA 3OPZA 2ERFA 2W91A 3WNOA 4OUMA 4AAXA 5AVPA 4A2UA 3VBHA 4GMP3 4IEWA 1CIYA 2Q5TA 4YRDA 4D3WA 2G9FA 5F39A 2ZBJA 2Y64A 1ASJ1 4GH4B 3SCHA 1WGPA 1DZQA 3LD8A 2G9ZA 2LROA 1AYM1 4GMP0 4GWIA 3CIHA 3DN7A 4QX0A 3VL8A 4ATFA 2VQTA 2XVKA 3J8F3 4UW3A 1LOAA 2W5FA 3ZYIB 4NWWA 4HKWA 4KH9A 1BBT2 3NNGA 2JEMA 4YG3A 2PHXA 3SXWA 1OLRA 1TMF3 2RMU2 2HJIA 1HV0A 2QQWA 4CDQC 2DVAA 3AMQA 4AFAA 4BXSV 4LEJA 4B4QA 3E6CC 1JOBA 2GC1A 4EN9B 4YZ5A 4P9WA 1GWKA 2VOKA 3RVHA 5C5TA 1CAVB 2MEV3 3MBWA 1BEV1 3MFCA 3NJZA 2AACA 2WS93 3Q8FA 4LLFA 5CKQA 4AQSA 4CCJA 1PO23 4ES9A 5A7OA 4CEWC 1ZRCA 5AFEA 1OF4A 3ZN5A 3ZOIA 1O4ZA 2QQUA 5IK4A 5GALA 1XQNA 3ZYFA 1A6CA 3FLRA 4V1PA 3P3NA 4XF4A 2A3YA 1LGBA 1VBD1 4OHWA 1D4M1 1MS0A 4XBLA 2AEYA 4D69A 2A6VA 5A80A 4DZGA 4XYXA 4EN6B 1MQTA 3H0OA 4XFGA 3NAPC 1AR72 1N3PA 4Y4RA 5LCWL 3ZN4A 4P5YA 1OA3A 3M3EA 3VD5A 4E8DA 4CXYA 2XPJA 3MZHA 2D98A 2WYSA 5A7PA 4UYBA 4EWDA 2AREA 1B35C 1COV3 2EXKA 3A0NA 3H1WA 4JQRA 4RGAA 5HI0A 2XMLA 1O5UA 1RYYA 2SBAA 4JAAA 4OHVA 2B45X 1HJGA 1NXD1 2Y0OA 4CUBA 1PHMA 3HWJA 4JVAA 4KG0A 2WA4A 2BZDA 3KV6A 3D0JA 1JXNA 2VZUA 2VTXJ 1ND2B 2W3JA 3CHXA 4DB5A 3GZAA 2QZ2A 2A7AA 3DUIA 5KHHA 4OFGA 4AG4A 1GSLA 1HXS3 1TE1B 5A33B 1YCIA 3WDWA 5IT6A 3VKLA 2CAUA 3AMMA 1U5XA 2EIBA 2OQ6A 3GDBA 3I3DA 3MIHA 5A7QA 3VDAA 1UMIA 2YG0A 1FMD3 3AMHA 5FZ9A 5D21A 1EPZA 4N43B 1X9TA 4QPIB 4XEZA 1PO11 4QQLA 1AR83 2ARBA 1H2MA 4I09A 5FP4A 1LB2A 1SLTA 5F3EA 4UF0B 2ZX3A 3H50A 4ZS3A 4YW2A 1V9U1 5DUWA 3VHNA 2LALA 1XE7A 4BDVB 3D4KA 3NKTA 1QOOA 1T6GC 2WABA 3ASIA 1J84A 1BMV1 2W94A 4K6BA 2D43A 2KR2A 2VOWA 3AJYA 1MPXA 3J8F2 4ZU5A 1IG0A 1J3PA 5LWBA 3TEXA 2B4KA 4IGQA 1LECA 4AXOA 1GZ9A 1WCUA 5JAXA 1W03A 2VH9A 2LUWA 3AP9A 5EJ1B 2B9VA 5FYUA 1C8M1 2A1XA 2QQPA 4A7KA 2B46X 4CDXC 4DQAA 2KA3A 5LRSA 1VBC2 1PGW2 4QB6A 2QFEA 1AYN2 1VB2A 2RS33 5DG2A 2D3RA 1VLNA 1Z7S2 2RS53 5J37A 5F6KA 1Z0HA 3M1HA 4BE3A 2YBPA 4NN0A 2HWC3 2MEV2 3TOJA 4AGGA 3LGRA 3U78A 3IT8A 4AI9A 1PO22 4CEYC 3B02A 1GOGA 1DP0A 3QOPA 4DO0A 2RVAA 4QB1A 1O8SA 4LA2A 2VW0A 1H2LA 1VR3A 2NLRA 2YXSA 5KXCA 1CX1A 3ACFA 5A3NA 3RZGA 1DZRA 4LR4A 4AHWA 1SFNA 1ZBA2 3NV3A 4FOYA 1XNCA 4AQTA 1PZ8A 3WCRA 5CFDC 4YM0A 5LZ6A 3HQXA 1ZZ9A 1OFNA 3ITQA 3ZO0B 4LBLA 1DIWA 3TNPB 1RJ8A 3NO8A 3K3OA 5C8WA 1WW5A 2A6XA 1LOFC 1YJLA 3K4DA 3U10A 1X9PA 3AKQA 5IW0A 5FZ1A 3USUA 2RV9A 4GJZA 1HXS2 1R092 3RRDA 2VNGA 3RDIA 5JLVA 3LB9A 1GWLA 4L92A 2R043 3WF4A 4XF3A 1L7QA 5IVYA 3I8TA 4EQVA 2W92A 2GH2A 1WMDA 1F5FA 2PYTA 3N7KA 2JWPA 1AX2A 2YC4A 3D0SA 1RUI2 2ZGQA 3RWNA 5BNNA 5L7OC 2JG8C 5B2GB 3N35A 2JENA 3HAGA 5CFCA 3L9JT 5FZ3A 1AXYA 1YI7A 1W6OA 2Q8EA 4BXFA 3S5AA 4DEQA 3OGVA 4FFFA 4FPLA 1AJKA 4GD4A 4LMFA 5EQUA 5C4WB 1RUC1 2ZTNA 4O7XA 3QCWA 4PHZA 5F8PA 1ULGA 2WZ8A 1ASJ3 1VBA1 4ARYA 1N1TA 2XBO2 3WW4A 3W5NA 1NCQB 4ZHNA 2QZ3A 3AKPA 3DECA 1IGOA 4V2VA 3LZZA 5SV8A 3TEWA 2IFWA 2J1EA 4EE2A 4XBNA 4FPYA 4TWTA 1EPWA 3VBOB 4DFSA 4CSWA 2V73A 4OZXA 2NM1A 5KXDA 1FYUA 3JD71 5C3SA 1KDKA 3VD4A 3ES4A 1UZZA 3M70A 3PMSA 1XU1A 2VXJA 4JZRA 4LO8A 4M3CF 2XR4A 2E7AA 2HWE1 4ZZ5A 4M0HA 1NLSA 1QH6A 2RS52 1GZTA 3BU7A 3J7LA 3M4FA 1F5JA 4IEUA 2UWCA 2YV8A 4IESA 3W5MA 3I2OA 4ET7A 1DG6A 3GYDA 4G4FA 4IEQA 4Q4X1 1S2KA 3QD6A 5L73A 5A6ZA 3LPFA 4GIQA 3VGIA 4A42A 4IEXA 2RS11 3ZXAC 4XUOA 4XACA 4A3XA 3GBGA 2PQQA 1VBD3 1DGRA 2HH9A 2JDKA 2FCTA 3ZFEA 3CEWA 4GA9A 5LB6A 1BKZA 4P00B 2IXCA 1H9PA 1W6PB 1CQ9A 3FMGA 2UY8A 3WZ1A 3UYJA 2UWBA 4N53C 2A70A 1NY72 3RI8A 2V5DA 4PIZA 1YQ8A 4CP0A 5JIUA 1VAKA 3UESA 2ZGTA 3WCSA 1QJU2 5A3OA 3VBRC 2RDSA 2GZWA 1L3JA 1PVC2 4BQWA 1LENA 1UX7A 3POSA 2YY1A 2ADEA 2R0HA 4R9CA 2BDRA 1V6IA 5GM0A 1RXGA 2Z79A 3F95A 4EJRA 2JX9A 1UXZA 3DL3A 3FE5A 1CZTA 3MO4A 4QQPA 1W2AX 1YQCA 2P1BA 4Q0QA 1U5ZA 2TUNA 1SBFA 1TEIA 2PN5A 5FYCA 1VRH2 2VMGA 3LFMA 3CO2A 1W0NA 2FQPA 2R32A 3GCXA 3NSTA 4QX2A 4RA0A 4OYUA 4CDUA 4QXBA 2YMZA 3AZYA 1KXGA 4OI2A 4M3CB 2WZR2 5FPAA 1PMJX 3BB6A 4LBMA 2JDMA 3BCWA 4YW7A 5CKNA 4YWAA 5SV5A 2X09A 4XABA 5A1AA 4LNVA 1PO13 3RYPA 3GNEA 1SZBA 3LEIA 2E26A 5CB7A 3UKTA 2PAKA 1OURA 2YC2A 3T2TA 1Y9QA 1V9U3 2DTWA 2LRPA 4RHV1 5CU1A 1DQ5A 4GXLA 4OI1A 2LTNA 4X6RB 4QPGA 3ZLIA 1DFQA 3BU0A 2P17A 3JU9A 4NOTA 1TG7A 1ZZ8A 5C8CA 4ZONA 1N3OA 3S7EA 1O59A 4PDWC 4YW3A 2XL9A 2WO7A 1QXPA 5HXVA 1VBB1 4ITCA 3POEA 1I3HA 4LXLA 5BY5A 5GLTA 1QOSA 2P6CA 4AZZA 3PMEA 2R071 4FVVA 2V5YA 2JE7A 1RTVA 1US2A 2VMCA 4HN0A 4CUAA 3SMHA 4YVWA 3SH4A 1HRI1 4GULA 1YFWA 1NA1C 1I1EA 1JH5A 3H1MA 3WOGA 3QBQA 1HRV2 2R061 5JSRA 3LEKA 5FFOC 5I0UA 4IEPA 5C70A 5FREA 4OI0A 1WW7A 1GP6A 1QJEA 2VUCA 5FPXA 1MQTB 2GNMA 2FZ2A 4QU2A 4HETA 1H4HA 4YZ1A 5LA1A 4AI0A 1G9CA 1QF3A 2RJ2A 1JS9A 3CNAA 5I0SA 1HQWA 1DGRN 1OH3A 2YB7A 4JQTA 3TN92 3FUOA 1UW8A 1GU3A 4Y1XA 3T09A 5L9VA 5FXWA 5DZEA 1JZ8A 4YG6A 4KGQA 4XIOA 1W0OA 4YVSB 4BWOA 3N4MA 1QJY1 4QPYA 3FLPA 1VJ2A 3I3QA 3B01A 1FPN1 2QKDA 2PELA 1MEC1 2QVSB 3HBKA 3GZEA 4ZY9A 3VD9A 2P3IA 4DRRA 4NAOA 3N7MA 2Y6LA 1DYPA 3IB3A 4P9XA 3ZDVA 1JYTA 1GR3A 3TB0A 1JYIA 2ZGNA 5BNPA 1B09A 4IV1C 2CSGA 4BQ2A 1UU6A 1MZ5A 4XJZA 5FIXA 3SH3A 4UFKA 4Y1ZA 4NRMA 2NYYA 4BOWA 5KC5A 1MVQA 4NHKA 1PNGA 3VBSA 1QKQA 3FFZA 3IIIA 1G86A 4UFIA 4NHLA 4COVA 4QD2A 1UZ0A 1QJX1 4FFIA 4GKXA 2RDQA 3VD7A 1OKOA 5A1FA 1E5HA 2Q8DA 5A70A 1GQPA 4MXVA 1RUC3 3RZKA 3VZLA 3I2IA 1MZ6A 1JN2P 3IDAA 5FPZA 1SEFA 3ZSJA 3URFA 2OT7A 1LJ7A 3OBZA 2XJVA 4RFT0 3I2HA 2Y34A 3ILRA 2E7QA 2HEWF 1FNZA 3VBFA 3ACLA 5FYZA 5BNOA 5GZCA 4AE2A 2DVDA 3ZM8A 5C9AA 1G8WA 3GCWA 4COZA 2WO3A 1OD5A 4Y22B 2ZA9A 4LHNA 4W6YA 3N9QA 4KMQA 2HWE3 3WX5A 1EY2A 5FY9A 2QQIA 2DUPA 1N47A 2EXIA 2WAAA 2K2SA 4Q4V1 5CG9A 1OLQA 3U4SA 1D2SA 3NJXA 4Q27A 3UL2A 2X5IC 4H7MA 3WR0A 3PDQA 1GP4A 5J48A 2IWGB 1ND2C 1PK6C 1UPSA 1BBT1 1JHNA 3KGZA 5LW9A 3O1SA 4B7KA 1F9KA 1HB4A 3RWKX 5DABA 1RUF1 1V6OA 5JSPA 4E2GA 1H1AA 5J09A 5L9BA 4QWNA 4Q4W1 1DZTA 1KQRA 1TME2 1IQAA 2VCCA 3JCIA 1H6YA 5FYBA 2Z2SB 5J98B 2D93A 3WDTA 1LR5A 3GF6A 2FCVA 4N43C 4QPIC 3GHMA 1K45A 2VW1A 3H3ZA 2VMHA 1G6NA 2WC2A 2OA2A 4XTPA 5FLJA 4MX3A 4OQ8A 2OXBA 3WEZA 4YSFA 2E53A 4YZ2A 5IJRA 2OZJA 5FZ8A 3ST7A 3P5BA 4XHXA 1IS6A 2IZWA 1OOPA 4XUNA 4HVQA 2KXLA 2A71A 4IUGA 3WG2A 4CYDA 1UF2C 1AR63 4HKOA 1I5ZA 1Q8OA 4DXRA 2NP0A 1W99A 1W2OA 2DCZA 3ZN6A 5BNNB 4ASKA 5B4XA 3DF0A 5B4NA 4LO6B 5DDJ3 2VXRA 3B93A 3B5LB 3E5UA 2CGOA 4QX1A 2WA3A 1BXHA 1RUJ2 4QKDA 5T50A 2NPIA 1OQDA 4LKEA 5FKBA 1ZREA 2I45A 2F4LA 1RUG2 2A3WA 4LITA 1CGPA 1H0BA 2ZHMA 3VV1A 5KHJA 1I5PA 3WUDA 1UOJA 3FHAA 3AYCA 4HPKA 4QDRA 4HK8A 1LAJA 2ADDA 4AEKA 4R4ZA 3M3OA 1KFUL 4X6QB 2C24A 2FCUA 3S57A 1OUXA 2XJRA 3U1XA 2P2KA 3AXEA 5HPOA 4JKLA 1RUE2 5H9RA 3EMRA 1O6UA 4GALA 5T3NA 3W9AA 4NIGA 1QGLA 3CJIA 3HJRA 3OCPA 4S2FA 4DMIA 3L2HA 4I0BA 4B29A 4A41A 1KITA 3KWVA 2C9KA 1YJKA 4CDWA 4XF0A 1HRI3 2AYHA 3FBMA 3VLBB 5IFPA 3LF7A 2J22A 5IFTA 2BRTA 1UIJA 2D40A 2WNEA 4IL7A 2R063 1AXKA 2X53S 3AL5A 3R0RA 4KL1A 2DVBA 5FZOB 5E88A 5JUVA 4BLJA 4MOAA 1L7LA 4B8EA 1UMZA 3BTXA 1AR93 5HCFA 1SLLA 1GBGA 1FAYA 1PGW1 2GALA 3C7FA 1AYN1 3DCQA 3OJBA 4KQ7A 5DN2A 4E2QA 5JR2A 2JDAA 2OVUA 1DBNA 3NJYA 1OT5A 4FT8A 1Z7S1 4Z2WA 5FZ0A 3SITA 4JCKA 4HLTA 3NNJA 3T1MA 3A23A 1R082 4J1XA 4FPKA 3ZKYA 4S2DA 1GNZA 2PLV2 4XQ4A 3BN6A 3HMYA 4ZXEA 4NE9A 5C4WC 3JB4C 1NE6A 3J7MA 3OUIA 3V65A 2MHFA 3WF3A 4K8FA 1MS4A 1SPPA 4LA3A 1PIV1 4ONUA 4QMAA 1NCQC 1S55A 1ZBA1 5F3CA 4GQ7A 1FV3A 3PU3A 1AR62 1V6KA 4LE4A 2BNNA 3OBRA 1JI6A 2EALA 1H8TB 1HIXA 3RZZA 3OYWA 4L8QA 5AFBA 3Q8BA 3TWIA 3VBOC 1BCXA 4AVAA 4COYA 1MVEA 3AP7A 4FOQA 2EIEA 3K48A 4Q8LA 5FZCA 4YYOA 3GJBA 1S2BA 1YQ6A 4LHKA 1VBE2 1VP6A 3WT3A 5C71A 1V6MA 4QKBA 4Y24A 2DYCA 1H8VA 1R091 1EAH3 4JRLA 2Y0IA 4XFFA 1FOD3 3EO6A 4XETA 4EYUA 3CL1A 1X7NA 3O5SA 2QUOA 5I8SA 4AEMA 1JYWA 1RIRA 4R52A 2C0ZA 1SLBA 5C8CB 4K7JA 1S0BA 3HQRA 4CU6A 3MF6A 3HVDA 4CXWA 1POQA 1SFPA 5T5LA 5FDBA 1WLDA 3ETPA 5JWPA 1O3QA 4LUMA 1YIFA 5DPNA 3QLQA 3SCGA 1O3TA 4O61A 2HLEA 3MUY1 2FMYA 3U11A 3ZFFA 2FZ1A 2WSUA 3WV6A 2DFBA 3K51A 2XG3A 4YVWB 4LKDA 5FY1A 4L99A 4NR1A 1RUD3 1YC61 3GJAA 1XE8A 3AMNA 3OEBA 2QCSB 3U4XA 1CR7A 4HKLA 3UKNA 4UFLA 1CPMA 1FXZA 3DPRC 3UKVA 3GHNA 5FO7B 2RM23 1XE0A 5EYYA 1RUF3 5LY1A 2J1AA 2WINB 1TNRA 4J1WA 3EHKA 3IM0A 1W2NA 3J7NA 4H14A 3LQCA 4L97A 2HWF1 2A3XA 2IXIA 2TBVA 4Q4W3 2QQMA 4MLOA 4W8JA 4ZXKA 5C3RA 1PGSA 1O7FA 5FY7A 4NUBA 1X8MA 2MNGA 4P9JA 1D7PM 2OUJA 3ZFGA 4AI8A 4Q0VA 2N7GA 1Y9GA 4XW3A 2J42A 2IUWA 2JKBA 2QDNA 2VG9A 1DQ4A 1EV11 2VVFA 4YW6A 4GB32 1K5MA 2BERA 4Q2FA 5ISLA 3CLPA 3KQRA 4B1LA 3S0MA 4FFGA 3FFQA 2IVJA 3LSEA 3NWKA 1S2EA 5F5IA 3CF6E 5FRAA 3MLKA 2ORXA 3WNNA 1H2NA 4A6OA 1WA4A 4QX8A 4NIHA 4LBKA 2XVGA 5F37A 4AFMA 2JD9A 3H3UA 1UOBA 3WDXA 3IDEA 1JZ4A 1LHOA 2WNVB 1I6XA 2AZ5A 1WCQA 4R4XA 4UW5A 1H2KA 4AEDA 1QJU1 1PVC1 3VD3A 5ANNA 3USSA 2C6SA 1POV3 3V64A 2XB6C 2V4VA 3AL6A 4OMCA 2W1WA 5E1RA 2R7EB 5FXXA 2LS6A 2VULA 4OQ9A 1CX4A 2J1UA 1G9BA 3M7AA 5LK7B 5K0UA 4XUTA 1EAH2 5C6CA 1POV0 4R9DA 1VMJA 1VRH1 1EUTA 1NOVA 1PNFA 5LA0A 3RZHA 2VBPA 1KS4A 4LPLA 3DV8A 5KXEA 3OSDA 4QKNA 2WNUB 2W95A 2PFWA 2RR13 4LJHA 3KSCA 2DVFA 1J1LA 1GZWB 2BGCA 3N3HA 2QDRA 1C28A 3H42B 5BNOB 1CN1A 5C9AB 1KS5A 5FJKA 5FP8A 2YPJA 3RJ2X 3RQ0A 4CCEA 5FUPA 1JYCA 2VVEA 3UJQA 2B5HA 5FZBA 4LO5B 2XL7A 4WBBA 3MW4A 5BYNA 5FMDA 2VMIA 1LEMA 4Y20A 4DXTA 4YVSC 2YFUA 2XQXA 1PX4A 5F5CA 3KLSA 5FZLA 3KV9A 4JGYB 4A7YA 4Q4Y1 4BK5A 2WRAA 4XF1A 4AFBA 1CD3G 2HEYF 4BQXA 3R4SA 4Z07A 1IOAA 4UOJA 3SKJE 3I2KA 4CP1A 4I01A 1BZWA 2WL1A 3IDBB 2ZMKA 3JBG3 3Q8AA 3K77A 4N7IA 2CWSA 3OG2A 5ABJB 1L7RA 2R49A 4IE7A 1NX9A 1W6MA 1R1A3 1G9AA 4JGZC 4B1MA 3PU8A 2ETEA 2YGMA 4C0BA 4H3WA 3PJYA 1HQLA 5FWJA 1E5IA 2O0OA 2JE8A 4NROA 4LBOA 3P3PA 1HRV1 4XDQA 2DURA 3WP5A 3FX3A 4PF5A 2DF7A 4XXAA 5FUNA 1CZVA 1RHI1 2PHLA 4QX3A 4OVEA 1OQEA 1OOPB 2WT2A 2WUHA 3MDPA 4K9SA 1CAWB 5FMOS 2ZHLA 5E89A 4IV3A 4HG6B 3ZYRA 1SQ4A 1Y43B 2GMMA 2CDPA 2E6VA 3I2GA 1K3IA 3JXSA 2VAUA 4MGSA 4YGCA 4YZ4A 4G9SB 4CDQA 1YQ5A 3BPZA 3EYPA 4W6XA 1ZA4A 2ES3A 3B3QE 4R8HA 4U36A 4XFCA 5DAQA 1QU0A 2VR4A 4Q1PA 3T2QA 1ULEA 4BCUA 4CCMA 5IVFA 1FT9A 5A1LA 4HT1T 2KM2A 3J7HA 1JW6A 1QIQA 1UX6A 1PGL1 4CEWA 1C5HA 3KZ4C 5GLUA 5T55A 3KM5A 4AAPA 5APAA 4GAZA 3HPNA 1BQPA 1F31A 2DCKA 4F8AA 4YZ3A 2VMFA 3RI9A 3APBA 2Q30A 2QBXA 4L9BA 2JE9A 4YARA 3T0AA 1IPSA 1UY2A 4H7LA 4HPKB 5JZGB 3KD4A 2VZTA 2VU9A 1B35A 4ORFA 4GWJA 2LW8A 1BLZA 1TMF2 2ZXQA 3NKGA 2AGSA 5T5PA 1YEWA 3O0XA 3S5QA 1ZA7A 4C0HA 4SLIA 1JUIA 1O91A 1W8OA 1YUDA 4RR3B 4BMEA 4B7EA 1IQDC 3M3CA 3O0VA 2CNAA 4ISRA 1RINA 3R6SA 1DQ1A 4FP3A 3G7DA 5EV7A 4ZU4A 2HWB1 2WS92 4Z82A 1LEDA 5FK7A 5JVVA 3MYXA 3S6PA 4Y4YA 1X36A 4N9IA 4UFMA 2AEZA 4NIAA 2OS2A 2QE3A 5FZMA 3ROUA 3T1LA 4NJ4A 4K3UA 1UWWA 1FATA 2HBTA 4J6GA 5FYTA 4WV8A 1DCSA 1W8WA 3JBG2 4PLOA 1QQP3 2VCBA 5CYYA 5FYHA 5ACA1 3NQHA 5BNNC 2W39A 3A7QA 1XJAA 2Z42A 1R1A2 3THCA 4CCCA 4DOUA 3HOBA 5IVVA 2IC1A 1COV2 1CVNA 1ZRIA 5LEJA 1HB3A 2BQPA 4L0PA 3RYKA 3POWA 2XLGA 5I0DA 2HWD1 1WBFA 3N9NA 4OZOA 4XZPA 3POJA 2VGDA 1DLCA 3UGGA 2RE9A 4Q26A 1LRHA 1UXXX 2YHJA 1KJLA 1UYXA 4Y33A 2GC3A 2VECA 5FPVA 5BPXA 4LORA 5T52A 3WUCA 1AXZA 5K4LA 4I0AA 3AVRA 1TME1 4NHMA 5F2SA 2FDIA 5F9TA 4CDXA 4LIVA 2BWAA 4O9GA 1UU4A 2FDJA 2VZVA 1FMD2 2XWBB 5EWSA 1N1VA 2BNMA 4Y5SA 5FXVA 3SEPA 4BHPA 1UD1A 1GNHA 1LHNA 2I2SA 3JQXA 1AR82 5FK8A 2XUMA 3KS7A 1QDOA 2QQVA 4CEYA 4NAMA 5JCTA 1H6XA 1NQDA 4H55A 3KB5A 4FAGA 2V72A 1WMEA 2RG4A 1WLCA 3BOPA 5T5OA 2KD7A 3QH6A 4D7YA 2Z5WA 3DGTA 4QQHA 1ENXA 3VBUC 3NNFA 1AYM3 3NV2A 5FQ0A 1QXJA 2O8QA 3D5OA 2J1SA 1UY4A 4XJUA 5CFDA 3U75A 1SMVA 1NCRC 1ZZCA 3UJOA 4PI2A 1CAUA 1RUH1 1RUJ1 1Y4WA 3ZDSA 2BBAA 3ATGA 2W47A 1X8EA 5T54A 3T0DA 3KMHA 4CVUA 4NIDA 3HN3A 1LOFA 1FNYA 1JOJA 2RS32 3VDCA 3ZFFB 2FDFA 1US3A 1AZDA 1W04A 4XOGA 4TZDA 1RUG1 4A7ZA 2HWC2 5K7PA 3UK9A 4GJYA 4UT5A 3A4UA 5KWRA 2WJSA 1GQHA 1BEV3 1RMU1 1YQ2A 1LNSA 1YWKA 3MIGA 2VJXA 5HCHA 4OHXA 4D6QA 3BTZA 2YBSA 1W8NA 3KVBA 2ZGLA 5CEHA 5TSWA 1Z78A 2BWCA 2D6LX 5L7OA 3AX4A 1EP0A 1AUYA 1D4M3 2JG8A 3T2PA 1RUE1 4YNIA 4YM3A 1H8TC 2XHKA 5JOZA 4MGZE 3WG3A 1ND3C 4D0QA 1YO8A 4J25A 1WWYA 3PUQA 1W6NA 4Q0UA 2JXAA 5CA6A 3ZFGB 3AP5A 2VUJA 2QQKA 5C3PA 4LTAA 1ULPA 3K75B 2G4IA 3EXUA 3PUSA 1W28A 2WN3A 2VVDA 4COWA 5C33A 3NRUA 1W8UA 5FYIA 1GOHA 3RYRA 1K5MB 1XYOA 5FY4A 5GZEA 4KWLA 1RVF1 2E9QA 2EXJA 4XCAA 4QM9A 3VZJA 1GFF2 3TNQA 5IAVA 1JZ7A 1ZBE1 4AVSA 2R042 2VM9A 4LQRA 4YW4A 5F7UA 3W21A 2QNKA 2VZQA 3BODA 4CRQA 2BEOA 5C8CC 2PHTA 1ZZ6A 4A3ZA 1R081 5KHGA 4AEDB 4AVBA 1O8PA 2JDYA 5EJ3A 1VB4A 2PLV1 4FTEA 4LULA 1LKNA 4YFWA 4E4HA 2WZPP 3VBHB 3JUUA 2VBBA 3RS6A 3IN9A 3LOBA 2FDHA 2GH8A 4YVWC 1GNYA 1NE4A 2WFF1 2RDRA 2RJKA 1ASJ2 5C3OA 1AHSA 3FWEA 5A3WA 1X33A 1Q8VA 1AYM2 4GZ9A 1XNAA 3MV01 4LBNA 5FPUA 4TN7A 2BFUS 4UBHA 2YZ4A 1C1LA 1O5LA 3AFGA 4FQZA 5FP9A 4N53A 3LFIA 3AP4A 3LKJA 1M4WA 5E6HA 1C8M3 1QEXA 1OHFA 3HD8B 1E5RA 2PQSA 4BH9A 3VBRA 4XMAA 4BK4A 1A78A 5DDJ2 3WNXA 4CCNA 3I3MA 5EFUA 2NMOA 5I0RA 1QWRA 4Y20B 2UU8A 3K4ZA 1BK1A 1RUOA 3D8CA 3E97A 4LE3A 4BISA 2CWMA 1U0AA 4AK3A 2HWB3 2C5DA 4P5HA 1NQJA 1TQ5A 4AEJA 4JDMA 3RJRA 3DEMA 2BOJA 3ZIXA 5FV3A 3SHRA 5CISA 1VBD2 3IKWA 4AI1A 1VMFA 1UOFA 3DXTA 3UETA 4WM8C 3POYA 4S2HA 3RNSA 4MGKE 1KEXA 3FUQA 1UY1A 2WNVC 1ZZ7A 4LK7A 1W9TA 2XJQA 1W6MB 4IE4A 1QHDA 1ENSA 2GMEA 4MGYE 2R16A 2BVBA 1URXA 1HB1A 4KGGA 1S0FA 4DINB 3WF0A 1OSGA 5CAZA 4CU9A 2LM3A 3LA2A 4FXKB 1NZIA 4GH4C 4K1YA 2ZGMA 1GV9A 1OPOA 4RN5A 2GNDA 2B9UA 3POGA 4IV3B 1MS1A 4PDWA 1CPNA 2WNUC 3VHRA 3WW2A 3O14A 3K46A 1D0GA 4CDQB 4WM7A 1O4TA 4K1ZA 1MS8A 3ZSMA 4KWUA 2XHNA 2Q8OA 4UW6A 2JG9A 3PL0A 1HQNA 3AZVA 1PO12 3PIGA 1S4CA 4QU1A 4AFDA 2GC2A 4CEWB 1NA1A 1A8MA 4P9IA 5HCBA 3S30A 2CGNA 1AL21 2C1FA 1V9U2 2BP6A 3BYWA 3C7HA 4MGQA 4MUVA 1BMV2 1ZX5A 4JGYC 1VBA3 3AXDA 5LEKA 3C7EA 4JDOA 3WSOA 1XNBA 4LBJA 2EA7A 4YLZA 2VNRA 3WNMA 5A6QA 1IG3A 4AGRA 3HIFA 2Q8CA 4OHYA 3WP3A 2MPFA 1B35B 3VKFC 5JPNB 1X82A 5ABJC 1MACA 3TRSB 2WNOA 4YFZA 1IPKA 1YFYA 2EICA 3JD73 2PHWA 3N7JA 5FZEA 1LHVA 5HV4A 1RXFA 2AR6A 4MXWA 3VDDA 2P34A 4I0WB 1HV1A 3NJVA 4OUEA 4P14A 4QGLA 3EB7A 2ET1A 4HVOA 1ULFA 3TEZA 2D3PA 4PCRA 4Q4X3 3MW3A 2JKXA 5KC6A 4MYEA 4YGDA 2RS13 2R1DA 5IWFA 4Z1VA 4HN1A 2B39A 2C9AA 4IV1A 3L2YA 4KU7A 2RMU1 3KCCA 3OPWA 2W9XA 2DU0A 1QNWA 4BZ4A 3ZR6A 3ZMNA 1SHWB 2O8OA 2DBIA 1PZ9A 4DXSA 2E32A 4XDPA 5FZGA 3AM2A 3U37A 1CAVA 4URAA 1NUKA 3AJZA 1HLCA 4LUKA 4MGIE 1XNKA 1C8NA 1Y3TA 1LOCA 3S7IA 2WYFA 2TNFA 2W52A 3H8XA 4YM1A 5FMBA 3ACHA 4N7UA 1QJZA 1YI9A 3KQ4B 3USUB 2A75A 5GKAC 5AC91 5EIYB 1AR71 1JZ2A 4MVTA 4WVVA 2DCYA 1ZBE3 2VE1A 2VZ3A 3IBMA 5CIRA 4IDZA 3K2OA 4CDXB 5JZGC 5E16A 3ZMOA 3O0WA 5IVJA 2XKPA 5L36A 4YGEA 1GUIA 2AUYA 2E33A 3OOXA 1SCSA 4HMZA 2ZACA 4A4AA 5CFCB 1R1ZA 1LU1A 1TZOA 2VCMA 4RR3C 1W6OB 2OYZA 4NPMA 3WQBA 2K9ZA 4EROA 2ZEXA 4AI3A 4CEYB 1F8VA 2X5IA 2XWJB 3E5QA 3KCXA 1K12A 3KV5A 5FKCA 3VKNA 4BQ3A 3O1OA 4IEYA 4JTNA 4Y1YA 1ND2A 1PK6A 5HCAA 1LHWA 4I30A 1IPJA 1DYOA 1RUC2 2WDBA 2WLQA 4RHV3 4XZUG 5BV6A 5KHKA 1JOPA 2P5BA 4PIXA 2B7YA 5F2WA 4CCLA 5FQ0B 2WQ4A 4IE6A 4ASMB 2BTVC 2XQRA 2Y6FA 4CU8A 3HNYM 3VN4A 1LTEA 2OX0A 2ZOEB 4E4SA 4F7ZA 2O1QA 3AZXA 4QPIA 5GLZA 1V70A 1CAUB 2GDFA 4Y26A 4LOTA 4RL7A 2ZGOA 1VBB3 1ONAA 3JD72 2XDVA 4UF0A 4WVMA 3T0BA 4EN8B 3ZXDA 2IFRA 2ZEYA 4OULA 2HWE2 3OGRA 4UWDA 1F4AA 3OF1A 2WFPA 5H9PA 1UY3A 2J7MA 2R073 3KF3A 5I93A 2D97A 3RGBA 4MV2A 1MS5A 4AOCA 5FBJA 4EWAA 1VE0A 3J8F1 4OCTA 3AYEA 4I02A 2CU5A 2ORZA 3SNMA 3VB9A 4Z8BA 4K8RB 4ATEA 5FTTC 1VMHA 1ULDA 4CE8A 4TYSA 4DUWA 4PF1A 4F3JA 2JG8B 3ZFEB 2JDUA 1JZ3A 1NLQA 1VBC1 1SBEA 4EZHA 3UNPA 3RFRA 2ZX2A 4QGMA 2CYFA 5BUVA 2A6WA 5I91A 2YBKA 1OLME 2Y6JA 3BVCA 2MEV1 1W6NB 4RS5A 5H9SA 3ZXKA 4R9BA 2WS91 3I54A 3OD0A 3R4UA 1PO21 2ZGUA 4CCDA 2W1SA 4E27A 1BJQA 1XRUA 4M01A 1EYBA 2JDHA 4RGKA 3MGUA 1UMHA 2BUKA 1XNDA 3DYPA 1QJY3 2JDNA 3V0BA 3M3IA 3VHOA 2DDUA 3K3NA 4L2NA 4LBQA 1FPN3 2WT0A 5LY2A 3LDKA 5IHRA 5IK7A 3BOWA 1MEC3 3U07A 1GP5A 2PHDA 3P1IA 1C57A 5HBAA 3ZIWA 4CDUB 1ZNPA 3WF2A 3WY6A 4DEVA 1OI6A 1MS9A 1GICA 4Z2AA 5LA9A 2A73B 4CCOA 1ZRFA 3FBYA 2Z4FA 3M8LA 1XSRA 1JMUB 4XBQA 1W8TA 2J1VA 2D6KA 2XJPA 3GZUC 4IERA 5DUUA 1WW4A 2JDZA 3O1TA 2JECA 4ZKTB 3VDBA 1D0HA 2ZGSA 5LBBA 1QJX3 4BIFA 2X10A 1UPIA 3VUOA 1HXS1 1RB8G 2IXJA 3ZSEA 3INAA 4RHV2 2W68A 3AB0A 5EHDA 4QPGB 1WMFA 3LDBA 1FX5A 3OTFA 4YPJA 3FC0A 4RD7A 4AQ2A 3H9AA 2B42B 4INDA 2OQ7A 2YROA 5FP3A 1RUI1 3ZKUA 5FOBB 1FMD1 2ILMA 2VOTA 3AZZA 3FHQA 4N53B 2OPKA 4AFCA 4QXCA 2WN2A 1GMMA 3C7GA 1VBB2 3AYAA 2OPWA 4YW5A 3VHPA 1JZ6A 2VNVA 1ZVFA 4FPJA 5DQ0A 3H8OA 4YG0A 5C4WA 1U5YA 2PHFA 2BBVA 5LBCA 2ZX0A 5A7WA 1O4YA 4Q4V3 3GALA 1J59A 2XBO1 2WKKA 1CIWA 1HRI2 5J3UA 1K5MC 1NCQA 2W2IA 1U12A 3MV11 3LE0A 1OA4A 4NMIA 3N9MA 2XVLA 2R062 3JZVA 1BBT3 5LRRA 2CTVA 5FZFA 4A45A 1OXCA 4FP2A 3VBOA 4LHSA 3VKOA 4QHZA 1AR92 4N90A 3CMGA 4BU2A 5I8YA 4MHRA 1UYPA 3OD4A 5FY8A 1GANA 2Y6GA 4MO3M 1R64A 4O65A 4CA9A 2RS31 3O1UA 1W9YA 2A6ZA 1QOTA 2RS51 1YHFA 3BPSA 2PXJA 3OGJA 3WDYA 1Y7BA 1XOYA 5FO8B 2HWC1 3E6DA 4LOSA 1NZCA 2VBDA 4OLLA 4KI5M 5AVAA 2P3YA 2I07B 2HYKA 4XFHA 2ZX1A 4AVTA 4AWDA 4JHTA 3KT4A 3MF9A 3VBHC 2BYVE 2JIJA 1V00A 3FZ3A 3ECQA 4FO9A 5A3UA 1SFYA 5FUIA 4FSJA 1QJY2 5FLIA 1REEA 1Q5OA 3EBRA 2VZSA 3H7YA 2GNTA 4NHXA 5FBZA 4N8MA 4FBFA 1T6BX 4XF9A 4B3NA 1D4VB 1OF3A 4AHZA 3I2JA 1AR73 1T2XA 5DUVA 2EAKA 1K5JA 1W3XA 3SH5A 3I3EA 3GGLA 4WM7B 4XJ9A 1NY71 5BNPB 1QH7A 4E4ZA 5IVEA 2WR9A 3AK0A 2C4XA 5FCCA 3T30A 1CAXA 2P4EA 2JG9B 4HL0A 2OKXA 3LEGA 1UOGA 3VBSB 3MHZA 4Q1RA 3TBDA 2DUOA 4RQPA 5D8AA 1KDMA 5FYYA 1IZ3A 1NA1B 1VPHA 2E31A 2G9GA 2PAMA 4BLIA 3ACGA 4LBQD 2UURA 5FWEA 1QJX2 3M2MA 5BXXA 4XTMA 3OB8A 3PUAA 1W6QA 3DPRA 1FOD2 4ARXA 5CADA 4AI2A 4LHLA 4W4ZA 1GQGA 1I9RA 1DGWX 1KJRA 1UNBA 4UFJA 3PNAA 5E8AA 2BU9A 3I2DA 2WZR1 4ZZ8A 1JYVA 5F1RA 4K40A 2ZKLA 1OMIA 1QXRA 3C3VA 3J9SA 3VBFB 1WUVA 3I59A 1MQTC 5F3GA 1EUUA 4Y3OA 3TAYA 2VNOA 1N1YA 3T3YA 5D2AA 3OY8A 2VQUA 3AFKA 2QJVA 2ZHNA 4MXWB 2D3SA 4AHYA 3VDDB 2XKOA 3KV4A 2DFCA 1UO9A 4DNYA 4XUPA 4Q4V2 3CBNA 4BM8A 4Q8KA 1RUD2 1LHUA 2Q1FA 2E51A 3D6EA 2FDKA 4PI0A 1J1TA 5JI9A 3LA3A 5IVBA 4RSUA 4KBBA 4WZFA 1NKGA 4IV3C 4MADA 2RM22 4C90A 1HN1A 3B69A 4IV1B 5EXOA 2IVIB 1RUF2 3MIEA 4YM2A 3PVOA 1LCLA 4ES8A 3WG1A 1VBC3 5A6XA 1M06G 1AYN3 3Q8CA 5DDJ1 2WAOA 4Q4W2 2VTFA 1Q56A 2FHRA 2WT1A 4D7TA 1Z7S3 5LBEA 1DQ0A 3T4VA 1WW6A 3VL9A 4QM8A 3H1YA 1HB2A 1AX0A 2NN8A 4CTEA 4CP9A 3A21A 2YYOA 3O1PA 3MFAA 4XPVA 4CCKA 5HXMA 3A0KA 4QX7A 2E63A 2P37A 4XFAA 1U5IA 4MGTA 3ABZA 4QHBA 3DKQA 2HYXA 3FL7A 4BQ4A 1ULCA 1W2UA 2ZGPA 1BHGA 5IUQA 3WP6A 2V09A 1PIV3 1ZBA3 5JXIA 2FD8A 1DLLA 1WCKA 4TSVA 4NPLA 3ZSKA 3TN91 4Y1VA 3KF5A 3ZN6B 4P9GA 5M0TA 2VMEA 3VKMA 4QQOA 1QNYA 4OHZA 2XJUA 4YVSA 1HN0A 2X5IB 4IEZA 4DS0A 4KNCA 1JBCA 1BVVA 3WW1A 4N9HA 1PK6B 3OGGA 5FYMA 4CPBA 3GM8A 1C5IA 2NZ9A 2Y8KA 3WNKA 4PJYA 4RGGA 1GOFA 1R093 2ZCWA 5IVCA 4AF9A 1YYNA 1PX3A 3UGHA 2NMNA 2V4AA 5FPLA 2H0VA 3NAPA 4XIKA 1RGSA 3WW3A 1XPWA 3FHIB 3IDCB 4HVRA 4LKFA 5ANQA 5AC92 2RR12 1RUI3 1JYXA 5FMOL 3DYMA 4FQ4A 3VZKA 4JGZA 3D82A 2GMPA 2GN3A 1NG0A 4X8PA 3WNLA 3PVEA 1W8ZA 4Q0SA 3MLJA 1Y9MA 1QMJA 4WVMB 5J7MA 2QQNA 4TLFA 4P9YA 4DY5A 3CJIB 1GZCA 4HONA 1XC6A 1WMXA 3MLLA 1LULA 2ZEWA 1SDDB 1XSQA 3F2ZA 3NV4A 4CDWB 2CGPA 3T4HB 2K46A 2Z69A 2XBO3 3GXUA 5IAXA 2IXLA 3WD5A 3EJKA 5JDBA 1BYHA 4AVCA 4C1WA 1A3KA 4FOVA 1SG3A 2HBUA 1ENRA 2AENA 3NW4A 3QH7A 4XILA 1OC1A 5FXZA 3WVJA 2WWJA 4PIYA 2JB4A 2WIIB 3OGSA 3V0AA 4NIIA 2PAEA 3UT0A 5FMCA 1YFXA 2BGPA 2CHHA 1QDCA 4Y22A 2D6MA 3J26N 4CU7A 2ARCA 4JC1A 2HWF3 3PURA 4XQWA 4LLOA 1OFSA 4QHOA 2W46A 1LODA 5LASA 4M3CE 1HW5A 5CFCC 4RS5B 4NVPA 1NAEA 4DRVA 2W1UA 3ZSLA 5KXBA 4MSVA 1WLTA 4PT6A 2GAUA 3KHCA 1RUNA 4OI4A 1ZM1A 5JMOA 1WLWA 1EV13 3DYOA 5DG1A 3MIDA 4FPOB 3SQOA 3V0BB 3GZTB 4LBQB 3SKVA 3WNPA 3ZXEA 1CZSA 1SPPB 5K9YA 1PIV2 3PLQA 3ZPOA 4IE0A 2EIGA 1UU5A 1AVBA 3OYWB 3NMBA 4C91A 3O12A 4P02B 3LAGA 5FAXA 3AKRA 5F5QA 1A34A 4XFBA 5A32A 4IEVA 3HNMA 1QJU3 2BOIA 5A3MA 1LU2A 1PVC3 1WD3A 2VQ0A 1IS3A 1BVP1 4WVWA 3ZPYA 2ID4A 5DAVA 2H6CA 2NQYA 5FYSA 4UFHA 2XJSA 2VTXA 2O14A 3POFA 4GWNA 4QB2A 3N9LA 3RMXA 4UW4A 1VRH3 4U2AA 1VAMA 1WBLA 2CDOA 2ET7A 5CG8A 1C1FA 2R6QA 2WZR3 3ETQA 4EN7B 3ZFEC 2VUDA 5DXDA 5C3QA 5FPBA 2VL4A 3W58A 4S2GA 2XLFA 1OPMA 4EWEA 3LSDA 4DUXA 5J96B 3I4IA 4CPBD 2XLAA 4OMDA 2Q1MA 1J3QA 1UZWA 3OBAA 4DUVA 5F32A 3O1VA 5A7WB 2Q0AA 3GBFA 4EZ4A 3C7OA 2R0FA 2ARAA 1CWPA 5FZDA 4BPZA 2VOXA 5FO9B 5I8TA 1G7YA 4XFIA 5H9QA 1LGNA 4Q4Y3 3SEEA 2WBKA 2ZHKA 3THDA 4B4PA 4FPCA 1W9FA 2D6PA 3HEIA 5DMYA 2C26A 3WG4A 1OVSA 2Y38A 1QQP2 2GC0A 1F15A 4CDUC 2W0XA 3D3AA 5T5JA 2VZPA 2HWF2 4D6RA 2CAVA 1E57A 1PMIA 4O9EA 2PHUA 4XDOA 2OIIA 4W6WA 5FZ6A 4EN0A 1UKGA 1XNTA 1LOEA 2A6YA 1W3VA 5FOJB 4AR2A 4HANA 2W87A 2K0GA 3CZUA 1SDWA 3J4UH 3CJXA 3O7OA 2ZJCA 4M0NA 1LESA 1SBDA 2W08A 3VBUA 3ZXGA 1HRV3 5C5UA 1EV12 1FV2A 1MZEA 2XXZA 2XGXA 2ZS6B 3LOIA 5FZOA 1RHI3 4COUA 1IS5A 1F4HA 3THPA 4IE5A 4QPGC 1NCRA 3IPVA 5IATA 4IXLA 2Y6KA 1W9WA 3AYDA 3MPPG 5JOWA 3ZVXA 3CKHA 2VZ1A 1UZVA 1UY0A 4Q5OA 4URTA 3TN93 4TTGA 2HKXA 4WZCA 5A3PA 2ZGKA 1CAXB 3ORJA 5J36A 4DIQA 2YGLA 3ON7A 3OBTA 4RQPB 3WQ7A 5D8AB 1A8DA 1OH4A 3I97A 1YFUA 1GYKA 1YLLA 2YDEA 2YU2A 3Q9OA 1X50A 1WCDJ 5K0UB 1W6QB 3DPRB 1IKPA 5CZKA 1AR61 2AC1A 4AW7A 1D2QA 5EP9A 1H8TA 5CVRA 1Q8PA 1H9WA 3MICA 1ND3A 1OUSA 2WZEA 4JHZA 4JKMA 4KU8A 4X8NA 4GKYA 3WLUA 3WP4A 2XONA 3I59B 1JZ5A 1UN1A 2BPA2 4F83A 3LIGA 2ZEZA 3WF1A 4LO7A 1VBE1 3OY8B 3T08A 4JV4A 4QDQA 4DXZA 5GZFA 3ALQA 5F3IA 2WO2A 4PBOA 3ZYHA 2DTYA 4E8CA 1S0CA 1BEV2 4RYDA 5F6LB 5FZAA 3BKZA 3G6JB 1WKYA 1W8FA 2BNOA 2RHPA 2YU1A 4JX0A 3SISA 1CJDA 4LIUA 1Q8SA 4Q4Y2 5KR7A 4CXXA 1HKDA 3C8XA 4CP2A 5JI7A 2GP3A 2UYAA 3NNMA 4K20A 3ZR5A 1D4M2 2I74A 4LT5A 4ZPIA 1V0AA 4E4DX 2BFUL 3PVBB 4I2OA 1V6JA 2ZABA 4WM7C 4BYYA 4BQYA 4D8MA 2YFZA 4NRQA 5BNPC 1HDKA 4QXHA 3PJQA 2GU9A 5ACA3 2RDNA 4NRPA 3OUJA 4D94A 4AL9A 2JG9C 5JOYA 3B9CA 2Y26A 3ES1A 3VBSC 1K42A 2FBEA 2JJ6A 3MUZ1 4LK6A 4R9AA 4CP9B 5JXGA 3N36A 3WINE 3ZYBA 3NNLA 4PLNA 2BJSA 5LA2A 5A7SA 4EV0A 1UIKA 4G3YC 2HWD3 4QT6A 1WZXA 2PA7A 2UYBA 2L9LA 2D7FA 2QQLA 3OUHA 1RHI2 2WO1A 3WDUA 5A6YA 5K8SA 3GBWA 2YPDA 1AR91 5JMCA 3ENRA 1PMHX 2YUEA 2WWUA 2CL2A 1WA6X
chains in the Genus database with same CATH topology
1YXWA 4BQ1A 2JICA 1TME3 1VIWB 3VBFC 5BNOC 4XJWA 2GNBA 2R1BA 2ZMNA 5C9AC 1S0GA 1Q8QA 5GZDA 3WDVA 4DPNA 4Q29A 4GB31 3VDDC 1F2NA 1PGL2 2VPVA 1ZYBA 2Q4SA 4KWKA 4AHXA 2CY6A 1DYKA 4XQDA 1PVXA 1S1AA 3WHUA 3NAPB 4WM8A 1G9DA 2F6BA 1REDA 3V56A 2WNVA 2WLPA 3WXPA 2VW2A 4JGZB 4I3PA 3HT2A 3MEPA 4META 1S0IA 1IKQA 1TNFA 1C8M2 4NO4A 1RUJ3 1RUH3 4TZDA 3AZWA 4Z92B 4E9KA 1H4GA 3HR9A 4JRAA 1JUHA 1EAH1 1FOD1 1KD7A 4GH4A 3B9IA 1RUG3 5KHIA 4L11A 4XMIA 2HWB2 3JQWA 3MIBA 1S0EA 1RMU3 5DUXA 3ZYPA 2WNUA 4XXPA 3THTA 5KBFA 3R05A 4MH0E 1OOPC 4BA6A 5I0TA 3RMYA 4WVZA 4QQ2A 1GZWA 5BNQA 3W59A 2WSVA 1CJPA 3V0AB 4JTOA 2ZX4A 4XJAA 4IETA 1SLAA 2DV9A 1RUE3 5ACA2 2JD4A 4BMBA 3HT1A 1OA2A 4FTBA 3WQ0A 1RUD1 1ENQA 2CV6A 3ELNA 2DCTA 2WWSA 4JGYA 1H1IA 2HWD2 3H8UA 4JDNA 2H0BA 1SACA 2RM21 2XJTA 3VZMA 1S0DA 1RVF3 4AVVA 3B00A 5GLVA 1DQ6A 4HSJA 1DF0A 5ABJA 4SBVA 4XJ8A 2EVXA 4IQPA 2PTMA 3VZOA 2P3KA 5D1IA 1R083 2AH2A 2EF6A 1AX1A 5A32B 1AL0G 2PLV3 4FPGA 3CJIC 3KCYA 1RJ7A 3WQ1A 5JOXA 3M3QA 5GZGA 2ATFA 2ZAHA 4FPFA 1H1MA 4CDWC 1CAWA 2WFF3 2ZKNA 2VQAA 3PVNA 4HZFA 4XHBA 5A33A 1VBA2 1DGLA 4Y5Z0 3IMNA 3QACA 1AF9A 1N3QA 4FOWA 3NVCA 4PQ9A 2ZZJA 4BIOA 5CFDB 1PM7A 4Q0PA 4K21A 4LO4B 4QGNA 4HSLA 4E2SA 1VALA 1WCSA 4N43A 2F4PA 2FMDA 2GSYA 1POV1 2X8KA 5JPMB 1IHMA 1SLCA 5GJ6A 2BVVA 1RUH2 4GMP1 1XU2A 1VBE3 4RS5C 3NV1A 4FPHA 1ZZBA 2IXKA 4ISQA 2WQZC 3RG0A 4AGVA 3KGLA 1NLRA 1S0JA 3ME2A 2DCJA 4AQ6A 1RMU2 4Q4X2 4D7SA 4W65A 2ZZQA 1ZRDA 2RR11 2RS12 3LWCA 5JZGA 4PLMA 1H30A 3ZXFA 1TMF1 2A5ZA 5L7OB 1DGWA 1PZ7A 1XYPA 4XE9A 5JSOA 3VZNA 5CNAA 4RR3A 1FI2A 3EQEA 1UAIA 5FLHA 1LOGA 3BALA 2D5FA 2XH6A 3AKSA 3LA7A 3VBUB 1V6NA 4KG8A 3UV9A 4CZSA 4FCAA 3ZXLA 3SLIA 3AKTA 4PBPA 1XXNA 1APNA 4IEOA 4I3GA 1RVF2 4OUSA 3JBG1 1NCRB 3IPVB 3ZYGA 1MR5A 3KT7A 1LOBA 4ASLA 4ZU7A 1ZBE2 3ILNA 5GLWA 3AMPA 3H7JA 1R1A1 3RPQA 3ZX7A 1MZFA 2TEPA 2Q1ZB 3C2UA 3MIFA 1COV1 2EXHA 3KT1A 5JR7B 3HN1A 3R4DB 4GWMA 2D44A 1NXMA 2H6BA 2ZPXA 3FLTA 5A3LA 1ALYA 1GLHA 1RC6A 2ARXA 2HEVF 4AYUA 3ZFFC 1UCXA 2OW4A 2ZGRA 3ZXJA 2ENRA 4GB33 1C4RA 4Y1UA 1AL23 1VAVA 1DHKB 3DKWA 2WFF2 4FXGB 1W39A 3BIWE 2D6NA 2RJLA 5IK8A 4YGBA 1GKBA 1UZYA 5EYXA 1DDLA 1ND3B 1DQ2A 1DU3D 2E7TA 3NL1A 1W0PA 4FAHA 1LGCA 2VY0A 1AR81 3AP6A 3HBZA 2VUAA 1QY4A 5L19A 1V6LA 1UKRA 4QX5A 1UL9A 1YRZA 1AJOA 3N7LA 5EZWA 3VBRB 4M00A 1CESA 4NWVA 3BTAA 3ZFGC 3CU7A 2R072 1Q3EA 5JIAA 1J58A 2IXHA 3FJSA 2D5HA 4NPRA 2R30A 2X29A 2DWRA 2ZMLA 3WHTA 3B7MA 3LCPA 3SCFA 2UY9A 1ZRRA 2RMU3 3MI8A 1OKQA 4HBNA 2DVGA 1XYNA 1WD4A 3X29B 4UBGA 2SLIA 2PHRA 4MZUA 4AEDC 1HX6A 4UXAA 1YIPA 1RL3A 3MW2A 3E5XA 4RQPC 5D8AC 3JB8A 4HK9A 2ZAAA 5DZFA 4KWJA 2P3JA 1CONA 1O3RA 1SCRA 1J3RA 5K0UC 1KRIA 1N1SA 3PHMA 2UWAA 1YNAA 1FPN2 4QXKA 1QQP1 5AC93 4PDWB 2OUHA 1MEC2 4B4RA 2D6OX 1W6PA 5DZGA 4DY3A 1KFXL 1OQ1A 4FPEA 3PTYA 4HFSA 2VOVA 3RSJA 1C3HA 3IIAA 5LK5A 2GN7A 5IK5A 3I7DA 3TYJA 3E6BA 2YC0A 2BW8A 2DU1A 2EAAA 1O3SA 1SLIA 3U0ZA 1MS3A 1AL22 1JTZX 2OZ6A 4P9LA 2R041 1REFA 1G9FA 4YW1A 1Q43A 5CBLA 3MPBA 1IS4A 4WM8B 3B94A 4FTSA 3IWZA 4M3CA 3ZYJB 4C1XA 1RITA 1NYWA 2B8MA 2DUQA 3ILFA 3OPZA 2ERFA 4OUMA 5AVPA 4A2UA 3VBHA 4GMP3 4IEWA 2Q5TA 4YRDA 4D3WA 2G9FA 2ZBJA 1ASJ1 4GH4B 3SCHA 1WGPA 1DZQA 1AYM1 4GMP0 3DN7A 3VL8A 4ATFA 2XVKA 3J8F3 4UW3A 1LOAA 3ZYIB 4NWWA 4HKWA 4KH9A 1BBT2 2JEMA 4YG3A 2PHXA 3SXWA 1OLRA 1TMF3 2RMU2 2HJIA 1HV0A 4CDQC 2DVAA 3AMQA 4AFAA 4LEJA 4B4QA 3E6CC 2GC1A 4EN9B 4YZ5A 4P9WA 2VOKA 1CAVB 2MEV3 3NJZA 1BEV1 3MFCA 4LLFA 2WS93 4AQSA 1ZRCA 1PO23 4ES9A 4CEWC 5AFEA 3ZN5A 5IK4A 1O4ZA 5GALA 1XQNA 1A6CA 3FLRA 4V1PA 3P3NA 4XF4A 2A3YA 1LGBA 1VBD1 4OHWA 1D4M1 1MS0A 4XBLA 4DZGA 4D69A 2A6VA 4EN6B 5AC92 4XYXA 1MQTA 3H0OA 4XFGA 3NAPC 1AR72 1N3PA 3ZN4A 1OA3A 3M3EA 3MZHA 2XPJA 2D98A 4EWDA 2AREA 1B35C 1COV3 2EXKA 3A0NA 3H1WA 4JQRA 4RGAA 5HI0A 1O5UA 2SBAA 4OHVA 4JAAA 2B45X 1NXD1 2Y0OA 1PHMA 3HWJA 4JVAA 4KG0A 2WA4A 3D0JA 1JXNA 1ND2B 4DB5A 3GZAA 2QZ2A 2A7AA 3DUIA 5KHHA 4OFGA 4AG4A 1GSLA 1HXS3 1TE1B 5A33B 1YCIA 3WDWA 5IT6A 3VKLA 2CAUA 3AMMA 1U5XA 3MIHA 1FMD3 3AMHA 1EPZA 4N43B 4QPIB 4XEZA 1PO11 4QQLA 1AR83 2ARBA 1H2MA 4I09A 1LB2A 1SLTA 2ZX3A 3H50A 4YW2A 1V9U1 5DUWA 3VHNA 2LALA 1XE7A 3D4KA 3NKTA 1QOOA 1T6GC 3ASIA 1BMV1 4K6BA 2D43A 2VOWA 3AJYA 3J8F2 4ZU5A 1J3PA 1LECA 4AXOA 1GZ9A 5JAXA 3AP9A 2VH9A 2LUWA 1C8M1 2QQPA 4A7KA 2B46X 4CDXC 4DQAA 2KA3A 5LRSA 1VBC2 1PGW2 2QFEA 1AYN2 1VB2A 2RS33 5DG2A 2D3RA 1VLNA 1Z7S2 2RS53 5J37A 5F6KA 1Z0HA 3M1HA 4BE3A 4NN0A 2HWC3 2MEV2 3TOJA 4AGGA 3LGRA 3IT8A 1PO22 4CEYC 3B02A 3QOPA 4LA2A 2VW0A 1H2LA 1VR3A 2NLRA 2YXSA 5KXCA 1DZRA 4LR4A 4AHWA 1SFNA 1ZBA2 3NV3A 4FOYA 1XNCA 4AQTA 1PZ8A 3WCRA 5CFDC 4YM0A 3HQXA 1ZZ9A 1OFNA 3ZO0B 4LBLA 1DIWA 3TNPB 1RJ8A 3NO8A 5C8WA 1WW5A 2A6XA 1LOFC 1YJLA 3U10A 3AKQA 3USUA 1HXS2 1R092 3RRDA 2VNGA 3RDIA 5JLVA 3LB9A 4L92A 2R043 4XF3A 3I8TA 2GH2A 1WMDA 2PYTA 1F5FA 3N7KA 3D0SA 1AX2A 1RUI2 2ZGQA 3RWNA 5BNNA 5L7OC 2JG8C 5B2GB 3N35A 2JENA 3HAGA 5CFCA 3L9JT 1AXYA 1YI7A 1W6OA 4FPLA 1AJKA 5C4WB 1RUC1 2ZTNA 3QCWA 1ULGA 1ASJ3 1VBA1 1N1TA 2XBO2 3WW4A 1NCQB 2QZ3A 3AKPA 1IGOA 3LZZA 5SV8A 2IFWA 4XBNA 4FPYA 4TWTA 1EPWA 3VBOB 4DFSA 2V73A 4OZXA 2NM1A 5KXDA 1FYUA 3JD71 1KDKA 3ES4A 1UZZA 3M70A 3PMSA 1XU1A 4LO8A 4M3CF 2E7AA 2HWE1 4M0HA 1NLSA 1QH6A 2RS52 3M4FA 3BU7A 4IEUA 5DDJ3 1F5JA 2UWCA 2YV8A 4IESA 1DG6A 3GYDA 4G4FA 4IEQA 4Q4X1 1S2KA 3QD6A 5L73A 4GIQA 3VGIA 4IEXA 2RS11 3ZXAC 4A3XA 3GBGA 2PQQA 1VBD3 1DGRA 3ZFEA 3CEWA 4GA9A 1BKZA 2IXCA 1H9PA 1W6PB 1CQ9A 3FMGA 2UY8A 3WZ1A 2UWBA 4N53C 2A70A 1NY72 3RI8A 4PIZA 4CP0A 5JIUA 1VAKA 3WCSA 2ZGTA 1QJU2 3VBRC 2GZWA 1L3JA 1PVC2 1LENA 3POSA 2YY1A 2R0HA 4R9CA 5GM0A 1V6IA 2Z79A 4EJRA 2JX9A 3DL3A 3FE5A 4QQPA 4Q0QA 1U5ZA 2PN5A 1SBFA 1TEIA 2TUNA 1VRH2 2VMGA 3CO2A 2FQPA 4RA0A 2R32A 3NSTA 4CDUA 2YMZA 3AZYA 1KXGA 4OI2A 4M3CB 2WZR2 3BB6A 4LBMA 3BCWA 5SV5A 4LNVA 1PO13 3RYPA 3GNEA 5CB7A 3UKTA 2PAKA 3T2TA 1Y9QA 1V9U3 2DTWA 4RHV1 5CU1A 1DQ5A 4GXLA 4OI1A 2LTNA 4X6RB 4QPGA 1DFQA 2P17A 3JU9A 4NOTA 1ZZ8A 5C8CA 1N3OA 3S7EA 4PDWC 4YW3A 2XL9A 1QXPA 5HXVA 1VBB1 4ITCA 1I3HA 5BY5A 5GLTA 1QOSA 3PMEA 2R071 4FVVA 2V5YA 2JE7A 1RTVA 4HN0A 3SMHA 4YVWA 3SH4A 1HRI1 4GULA 1YFWA 1NA1C 1I1EA 1JH5A 3H1MA 3WOGA 3QBQA 1HRV2 2R061 5JSRA 5FFOC 5I0UA 4IEPA 5FREA 4OI0A 1WW7A 5FPXA 1MQTB 2GNMA 2FZ2A 4QU2A 4HETA 1H4HA 4YZ1A 4AI0A 1G9CA 1QF3A 3CNAA 5I0SA 1HQWA 1DGRN 3TN92 3FUOA 1UW8A 4Y1XA 5DZEA 4YG6A 4KGQA 4XIOA 1W0OA 4YVSB 4BWOA 3N4MA 1QJY1 4QPYA 3FLPA 1VJ2A 3B01A 1FPN1 2QKDA 2PELA 1MEC1 2QVSB 2P3IA 4DRRA 3N7MA 1DYPA 4P9XA 1GR3A 3TB0A 1JYIA 2ZGNA 5BNPA 1B09A 4IV1C 1UU6A 1MZ5A 4XJZA 3SH3A 4Y1ZA 2NYYA 4BOWA 5KC5A 1MVQA 4NHKA 1PNGA 3VBSA 1QKQA 3FFZA 1G86A 4NHLA 4COVA 4QD2A 4GKXA 1QJX1 4MXVA 1RUC3 3VZLA 1MZ6A 1JN2P 5FPZA 1SEFA 3ZSJA 3URFA 1LJ7A 2XJVA 4RFT0 3ILRA 2E7QA 2HEWF 1FNZA 3VBFA 3ACLA 5BNOA 5GZCA 4AE2A 2DVDA 5C9AA 1G8WA 4COZA 1OD5A 4Y22B 2ZA9A 4LHNA 4W6YA 3WX5A 2HWE3 1EY2A 2DUPA 1N47A 2EXIA 5CG9A 2K2SA 4Q4V1 1OLQA 1D2SA 4Q27A 3UL2A 2X5IC 4H7MA 3WR0A 5J48A 2IWGB 1ND2C 1PK6C 1UPSA 1BBT1 1JHNA 3KGZA 4B7KA 1F9KA 1RUF1 1V6OA 5JSPA 4E2GA 1H1AA 5J09A 4Q4W1 1DZTA 1KQRA 1TME2 1IQAA 3JCIA 5J98B 3WDTA 2Z2SB 2D93A 1LR5A 3GF6A 4N43C 4QPIC 3GHMA 2VW1A 3H3ZA 2VMHA 1G6NA 2WC2A 2OA2A 4XTPA 5FLJA 4MX3A 4YSFA 2E53A 4YZ2A 2OZJA 3ST7A 4XHXA 1IS6A 2IZWA 1OOPA 4HVQA 2KXLA 2A71A 3WG2A 4CYDA 1UF2C 1AR63 4HKOA 1I5ZA 1Q8OA 2NP0A 2DCZA 3ZN6A 5BNNB 3DF0A 4LO6B 2VXRA 3B93A 3B5LB 3E5UA 2CGOA 2WA3A 1BXHA 1RUJ2 5T50A 2NPIA 1OQDA 1ZREA 2I45A 1RUG2 2A3WA 1CGPA 1H0BA 2ZHMA 3VV1A 5KHJA 3WUDA 3AYCA 4HPKA 4HK8A 4AEKA 4R4ZA 3M3OA 1KFUL 4X6QB 2XJRA 2P2KA 3AXEA 1RUE2 5H9RA 4GALA 5T3NA 3W9AA 1QGLA 3CJIA 3OCPA 4S2FA 4DMIA 3L2HA 4I0BA 4B29A 1KITA 1YJKA 4CDWA 4XF0A 1HRI3 2AYHA 3FBMA 3VLBB 1UIJA 2D40A 2WNEA 4IL7A 2R063 1AXKA 2X53S 4KL1A 3R0RA 2DVBA 5E88A 4BLJA 4B8EA 1UMZA 1AR93 5HCFA 1SLLA 1GBGA 1FAYA 1PGW1 2GALA 3OJBA 1AYN1 4KQ7A 4E2QA 2OVUA 1DBNA 4FT8A 1Z7S1 4Z2WA 3SITA 4JCKA 4HLTA 3T1MA 1R082 4J1XA 4FPKA 4S2DA 1GNZA 2PLV2 4XQ4A 3HMYA 5C4WC 3JB4C 1NE6A 3V65A 2MHFA 4K8FA 1MS4A 4LA3A 1PIV1 4ONUA 4QMAA 1NCQC 1S55A 1ZBA1 4GQ7A 1FV3A 1AR62 1V6KA 4LE4A 2BNNA 3OBRA 2EALA 1H8TB 1HIXA 3RZZA 3OYWA 4L8QA 5AFBA 3TWIA 3VBOC 1BCXA 4AVAA 4COYA 1MVEA 3AP7A 4FOQA 3K48A 4Q8LA 4YYOA 1S2BA 4LHKA 1VBE2 1VP6A 3WT3A 1V6MA 4Y24A 1H8VA 1R091 2DYCA 1EAH3 4JRLA 2Y0IA 4XFFA 1FOD3 3EO6A 4XETA 3CL1A 1X7NA 3O5SA 2QUOA 5I8SA 4AEMA 1RIRA 4R52A 2C0ZA 1SLBA 5C8CB 4K7JA 1S0BA 3MF6A 5FDBA 5T5LA 1WLDA 5JWPA 1O3QA 4LUMA 1YIFA 3QLQA 3SCGA 1O3TA 3ZFFA 3U11A 2FMYA 2FZ1A 2WSUA 3WV6A 2DFBA 3K51A 2XG3A 4YVWB 4L99A 4NR1A 1RUD3 1XE8A 3AMNA 2QCSB 3U4XA 1CR7A 4HKLA 3UKNA 1CPMA 1FXZA 3DPRC 3UKVA 3GHNA 5FO7B 2RM23 5EYYA 1RUF3 2WINB 4J1WA 1TNRA 3EHKA 3IM0A 4H14A 4L97A 2HWF1 2A3XA 2IXIA 2TBVA 4Q4W3 4MLOA 4ZXKA 1PGSA 1O7FA 4AI8A 1X8MA 2MNGA 4P9JA 3ZFGA 2OUJA 4Q0VA 2N7GA 4XW3A 2JKBA 2QDNA 2VG9A 1DQ4A 1EV11 2VVFA 4GB32 1K5MA 4Q2FA 3CLPA 3KQRA 3S0MA 3FFQA 3NWKA 3LSEA 3CF6E 5FRAA 3MLKA 1H2NA 1WA4A 4LBKA 2XVGA 4AFMA 3H3UA 3WDXA 3IDEA 1LHOA 2WNVB 1I6XA 2AZ5A 4UW5A 4R4XA 1H2KA 4AEDA 1QJU1 1PVC1 3USSA 3V64A 1POV3 2XB6C 5E1RA 2VULA 1CX4A 1G9BA 3M7AA 5LK7B 5K0UA 1EAH2 5C6CA 1POV0 4R9DA 1VRH1 1NOVA 1PNFA 1KS4A 5KXEA 3DV8A 2WNUB 2PFWA 2RR13 3KSCA 2DVFA 1J1LA 1GZWB 2BGCA 3N3HA 2QDRA 1C28A 5BNOB 1CN1A 5C9AB 1KS5A 2YPJA 3RJ2X 3RQ0A 1JYCA 2VVEA 3UJQA 2B5HA 4LO5B 2XL7A 4WBBA 3MW4A 5BYNA 2VMIA 1LEMA 4Y20A 4YVSC 3KLSA 4JGYB 4A7YA 4Q4Y1 4XF1A 4AFBA 1CD3G 2HEYF 3R4SA 4Z07A 1IOAA 4CP1A 4I01A 1BZWA 2WL1A 3IDBB 2ZMKA 3JBG3 4N7IA 2CWSA 5ABJB 2R49A 1W6MA 1R1A3 1G9AA 4JGZC 2ETEA 2YGMA 4C0BA 4H3WA 3PJYA 1HQLA 2O0OA 4LBOA 3P3PA 1HRV1 4XDQA 2DURA 3WP5A 3FX3A 4PF5A 2DF7A 4XXAA 1RHI1 2PHLA 4OVEA 1OQEA 1OOPB 2WT2A 3MDPA 4K9SA 1CAWB 5FMOS 2ZHLA 5E89A 4IV3A 3ZYRA 1SQ4A 1Y43B 2GMMA 2E6VA 4YGCA 4YZ4A 4G9SB 4CDQA 3BPZA 4W6XA 1ZA4A 2ES3A 3B3QE 4R8HA 4U36A 4XFCA 4C91A 1QU0A 4BCUA 4Q1PA 1ULEA 1FT9A 4HT1T 2KM2A 1JW6A 1PGL1 1UX6A 4CEWA 1C5HA 3KZ4C 5GLUA 5T55A 3KM5A 1BQPA 1F31A 2DCKA 4F8AA 4YZ3A 3RI9A 3APBA 2Q30A 4L9BA 2JE9A 4YARA 4H7LA 4HPKB 5JZGB 3KD4A 2VU9A 1B35A 4ORFA 1TMF2 3NKGA 2AGSA 5T5PA 3O0XA 4C0HA 4SLIA 1JUIA 1O91A 1YUDA 4RR3B 4BMEA 4B7EA 3M3CA 3O0VA 2CNAA 4ISRA 1RINA 3R6SA 1DQ1A 4FP3A 3G7DA 5EV7A 4ZU4A 2HWB1 2WS92 4Z82A 1LEDA 5JVVA 3MYXA 3S6PA 4Y4YA 1X36A 4N9IA 2QE3A 3ROUA 3T1LA 4K3UA 1FATA 4J6GA 4WV8A 3JBG2 4PLOA 1QQP3 5ACA1 5BNNC 2W39A 4DOUA 2Z42A 1R1A2 2IC1A 1COV2 1CVNA 5LEJA 2BQPA 3RYKA 3POWA 2XLGA 2HWD1 1WBFA 4XZPA 2VGDA 2RE9A 4Q26A 1LRHA 2YHJA 1KJLA 2GC3A 2VECA 5BPXA 5T52A 3WUCA 1AXZA 4I0AA 1TME1 4NHMA 5F9TA 4CDXA 2BWAA 4O9GA 1UU4A 1FMD2 2XWBB 5EWSA 1N1VA 2BNMA 4BHPA 1UD1A 1GNHA 1LHNA 2I2SA 3JQXA 1AR82 2XUMA 3KS7A 1QDOA 4CEYA 5JCTA 1NQDA 4H55A 3KB5A 4FAGA 3BOPA 1WMEA 5T5OA 1WLCA 3QH6A 4D7YA 2Z5WA 3DGTA 4QQHA 1ENXA 3VBUC 1AYM3 3NV2A 5FQ0A 1QXJA 2O8QA 3D5OA 4XJUA 5CFDA 1SMVA 1NCRC 1ZZCA 3UJOA 1CAUA 1RUH1 1RUJ1 3ZDSA 3ATGA 5T54A 1X8EA 3KMHA 1LOFA 1FNYA 1JOJA 2RS32 3ZFFB 1AZDA 4XOGA 1RUG1 4A7ZA 2HWC2 5K7PA 3UK9A 3A4UA 5KWRA 2WJSA 1GQHA 1BEV3 1RMU1 1YWKA 3MIGA 4OHXA 2ZGLA 5TSWA 1Z78A 2BWCA 2D6LX 5L7OA 3AX4A 1EP0A 1AUYA 1D4M3 2JG8A 1RUE1 4YNIA 4YM3A 1H8TC 2XHKA 5JOZA 4MGZE 3WG3A 1ND3C 1YO8A 1W6NA 4Q0UA 2JXAA 5CA6A 3ZFGB 3AP5A 2VUJA 4LTAA 2G4IA 3EXUA 2VVDA 4COWA 5C33A 3RYRA 1K5MB 1XYOA 5GZEA 4KWLA 1RVF1 2E9QA 2EXJA 4QM9A 3VZJA 1GFF2 3TNQA 1ZBE1 4AVSA 2R042 4YW4A 2QNKA 3BODA 5C8CC 4CRQA 2BEOA 2PHTA 1ZZ6A 1R081 5KHGA 4AEDB 4AVBA 5EJ3A 1VB4A 2PLV1 4FTEA 4LULA 1LKNA 4YFWA 2WZPP 3VBHB 3JUUA 3RS6A 3IN9A 3LOBA 2GH8A 4YVWC 1NE4A 2WFF1 2RJKA 1ASJ2 1AHSA 3FWEA 1X33A 1Q8VA 1AYM2 4LBNA 2BFUS 4UBHA 2YZ4A 1C1LA 1O5LA 3AFGA 4FQZA 4N53A 3AP4A 3LKJA 1M4WA 1C8M3 1OHFA 3HD8B 4BH9A 3VBRA 4XMAA 1A78A 5DDJ2 3WNXA 5EFUA 2NMOA 5I0RA 1QWRA 4Y20B 2UU8A 1BK1A 1RUOA 3D8CA 3E97A 4LE3A 2CWMA 1U0AA 4AK3A 2HWB3 2C5DA 4P5HA 1NQJA 1TQ5A 4AEJA 4JDMA 3RJRA 3ZIXA 3SHRA 1VBD2 3IKWA 4AI1A 4WM8C 3POYA 4S2HA 3RNSA 4MGKE 3FUQA 2WNVC 1ZZ7A 2XJQA 1W6MB 1QHDA 1ENSA 2GMEA 4MGYE 2R16A 2BVBA 1URXA 4KGGA 1S0FA 4DINB 1OSGA 5CAZA 2LM3A 3LA2A 4FXKB 4GH4C 4K1YA 2ZGMA 1GV9A 1OPOA 2GNDA 2B9UA 4IV3B 1MS1A 4PDWA 1CPNA 2WNUC 3VHRA 3WW2A 3O14A 1D0GA 4CDQB 4WM7A 1O4TA 4K1ZA 1MS8A 3ZSMA 2Q8OA 4UW6A 2JG9A 1HQNA 3AZVA 1PO12 4AFDA 2GC2A 4CEWB 1NA1A 1A8MA 4P9IA 5HCBA 3S30A 2CGNA 1AL21 2C1FA 1V9U2 4MUVA 1BMV2 1ZX5A 4JGYC 1VBA3 3AXDA 5LEKA 4JDOA 1XNBA 4LBJA 2EA7A 4YLZA 2VNRA 4AGRA 3HIFA 4OHYA 3WP3A 2MPFA 1B35B 3VKFC 5JPNB 1X82A 5ABJC 1MACA 3TRSB 4YFZA 1IPKA 1YFYA 3JD73 3N7JA 2PHWA 1LHVA 2AR6A 4MXWA 3VDDA 2P34A 4I0WB 1HV1A 4P14A 4QGLA 2ET1A 4HVOA 1ULFA 2D3PA 4PCRA 4Q4X3 3MW3A 5KC6A 4MYEA 4YGDA 2RS13 2R1DA 4Z1VA 4HN1A 2B39A 2C9AA 4IV1A 3L2YA 4KU7A 2RMU1 3KCCA 2DU0A 1QNWA 4BZ4A 3ZMNA 2O8OA 1PZ9A 3AM2A 1CAVA 3AJZA 1HLCA 4LUKA 4MGIE 1XNKA 1C8NA 1Y3TA 1LOCA 3S7IA 2TNFA 2W52A 4YM1A 4N7UA 1QJZA 1YI9A 3USUB 2A75A 5GKAC 5AC91 1AR71 4MVTA 4WVVA 1ZBE3 2DCYA 3IBMA 5CIRA 5JZGC 4CDXB 5E16A 3ZMOA 3O0WA 2XKPA 5L36A 4YGEA 2AUYA 4HMZA 1SCSA 2ZACA 5CFCB 1R1ZA 1LU1A 4RR3C 4EROA 2OYZA 1W6OB 2K9ZA 4AI3A 4CEYB 1F8VA 2X5IA 2XWJB 3E5QA 3KCXA 3VKNA 4IEYA 4JTNA 4Y1YA 1ND2A 1PK6A 5HCAA 1LHWA 4I30A 1IPJA 1RUC2 5BV6A 2WLQA 4RHV3 5KHKA 4PIXA 2B7YA 5FQ0B 2WQ4A 4ASMB 2BTVC 3VN4A 1LTEA 4E4SA 2ZOEB 4F7ZA 2O1QA 3AZXA 4QPIA 5GLZA 1V70A 1CAUB 2GDFA 4Y26A 4RL7A 2ZGOA 1VBB3 1ONAA 3JD72 4WVMA 4EN8B 3ZXDA 2IFRA 4OULA 2HWE2 3OF1A 2WFPA 5H9PA 2R073 5I93A 2D97A 4MV2A 1MS5A 4EWAA 3J8F1 3AYEA 4I02A 4Z8BA 3SNMA 4ATEA 5FTTC 1ULDA 4TYSA 4F3JA 2JG8B 3ZFEB 1VBC1 1SBEA 2ZX2A 4QGMA 2CYFA 5BUVA 2A6WA 5I91A 2MEV1 1W6NB 4RS5A 5H9SA 3ZXKA 4R9BA 2WS91 3I54A 3OD0A 3R4UA 1PO21 2ZGUA 4E27A 1BJQA 1XRUA 4M01A 1EYBA 3MGUA 2BUKA 1XNDA 1QJY3 3V0BA 3M3IA 3VHOA 4L2NA 4LBQA 1FPN3 2WT0A 5IK7A 3BOWA 1MEC3 3U07A 2PHDA 1C57A 5HBAA 3ZIWA 4CDUB 1ZNPA 3WY6A 1OI6A 1MS9A 1GICA 2A73B 1ZRFA