2O8OA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
110
Chain Sequence
KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
publication title Induction of stable beta-sheet by Ca2+ in Clostridial collagen binding domain
rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 30
structure length 110
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2006-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8oA00
1KFUL 1DF0A 1WMEA 3BOWA 4I3GA 4DY3A 1U5IA 4G9SB 2LUWA 1WMFA 1KFXL 2QFEA 4HPKA 3DF0A 4DY5A 4DZGA 2O8OA 5FBZA 2XVLA 4HPKB 2XVGA 1NQDA 3JQWA 2XVKA 1NQJA 1QXPA 3JQXA 5SV5A 1WMDA 4DXZA 5FAXA 3AFGA
chains in the Genus database with same CATH superfamily
3WR0A 3BTAA 2RDNA 2Q1FA 4RQPA 3ZYRA 4PDWA 4KG0A 1GLHA 2ZGTA 2DTWA 2HWF1 3JD72 1U5YA 1CESA 4AQSA 4BQ4A 1BJQA 2V5YA 1RMU3 1SFPA 5C8CA 1WMFA 1VMFA 2XUMA 1FMD3 4C0HA 3WOGA 3DF0A 5ACA2 1CAXB 3GCXA 5FYIA 4Q26A 3ZFFB 5A3PA 4AEDB 5FZ1A 3OEBA 1LJ7A 1MS1A 1EUUA 2JDPA 4RS5C 4Q4Y1 2ET7A 2HWF3 1HN1A 1VBA2 4RD7A 1H2NA 1DHKB 3GJBA 1ZBE2 2CWSA 4M0NA 1OVPA 2WWSA 4B29A 2GC2A 1RUG2 2VC9A 1YQ6A 3NKGA 3VBOC 2D6MA 1YJLA 1D4VB 1JOPA 4QMAA 4AL9A 2W94A 4C90A 4Y5Z0 2VMDA 5FP4A 4GXLA 4JHTA 5F39A 4NWWA 4ET7A 4XFAA 3TAYA 1W6MA 1KDKA 1FT9A 2XKPA 3LSDA 2R071 4Q4Y3 1ZZ9A 4CP2A 1TME1 2GC3A 5IATA 3PL0A 1UY3A 4L0PA 5CNAA 1ONAA 1ENRA 3OPTA 4XZUG 3O0WA 4WM8A 5L7OC 5FTTC 2FCUA 2W1QA 1BBT2 4AWDA 2NMOA 4BK5A 2YBPA 5SV5A 2P17A 2RMU2 4FP2A 5DDJ1 1S1AA 1BXHA 4DFSA 2R073 5FQ0B 4OFGA 3WQ1A 4LKDA 1TME3 4Q1RA 3ZX7A 1O6UA 2WSUA 4XBQA 3ROUA 3RZGA 1SHWB 1TEIA 2IZWA 2WQ4A 5FZDA 2JDMA 4ZU7A 1VB4A 1Y3TA 3ES1A 4QQOA 3DECA 2WABA 3BPZA 4UFHA 1CAXA 3ZFFA 3ZYHA 5A7QA 4FSJA 1R1ZA 1NA1A 2RDRA 1FOD1 4PI0A 2NZ9A 4E2SA 3ZPOA 2KD7A 5DDJ3 1JZ5A 3HNBM 3AKSA 1PMHX 2PHFA 4LKSA 1I3HA 5HCAA 2NM1A 3B02A 3GCWA 4MX3A 4QXHA 3WP3A 3KV9A 4YZ3A 1WCUA 1BZWA 5ISLA 4IV1B 4EN0A 3VDBA 3WUCA 1PGW1 2VY0A 1VBB2 1QXPA 2K0GA 4XJAA 5A3NA 3RFRA 3QCWA 5B4XA 1S0DA 1BVVA 3GZUC 1OKOA 1C1FA 2XWJB 4MADA 4QPIC 1FOD3 5AFEA 4Q1PA 2JG9B 1RJ7A 1RUE2 2LROA 1GSLA 3QBQA 3OPWA 4CXYA 4CCEA 1DYOA 1V6LA 4E4DX 4M3CA 3KT1A 2VZQA 4UFKA 5FWJA 3T4HB 3RG0A 4FAGA 3LD8A 1RTVA 2RM22 1US3A 4YW3A 3AZVA 5BY5A 2J1TA 3DGTA 4FOVA 4AFDA 5JXHA 4GIQA 2FHRA 5FXWA 5I0TA 3SQOA 1OC1A 5A33B 4BZ4A 1HRI2 1RL3A 5FQ0A 3J8F1 1Q56A 4QB1A 3KCYA 4AF9A 1Y9GA 1H30A 1TMF2 5CAZA 3H42B 4ZS3A 2CAUA 4W65A 1NLQA 1CVNA 4QPGC 4Q0QA 3W21A 1CAWA 3T1LA 2X10A 3EHKA 2AH2A 2ZGOA 1V6OA 4YW6A 4JKKA 4BDVB 1GP4A 3T2OA 4P5YA 1X8MA 3WW3A 2E26A 4QDRA 5GLVA 3NNFA 4DEQA 3ZYIB 5F8PA 2KXLA 3GHMA 3J8F3 3LPGA 4IESA 2QFEA 3MBWA 4IV1A 5FYCA 4AFBA 3PUAA 1Q5OA 1JUIA 2OQ6A 5FWEA 3NAPA 3U37A 1QJU1 2QJVA 3OGRA 2TNFA 3OSDA 2FDKA 2P5BA 4WZCA 4I01A 2JG9A 5DXDA 3R6SA 2DFBA 1UPSA 2QUOA 3EO6A 3POYA 3MPBA 2FQPA 2VCMA 3B9CA 1CZTA 3WG3A 4IV3C 2QNKA 2LRPA 3WF0A 1OLRA 2ATFA 1COV1 3T1MA 3FHAA 4XJZA 4CCNA 4XDQA 1WUVA 3CMGA 3TWIA 3C7HA 1AXZA 1QJU3 2PLV2 5A33A 2CU5A 3OBAA 1WA6X 4NPLA 2BW8A 3ZPYA 4COWA 1YI9A 3IMMA 1AR71 2DURA 4QX1A 1XYPA 1CR7A 1CX4A 1X33A 1PIV1 5H9PA 4R52A 1K5JA 3IAQA 5DQ0A 3KT4A 4FPOB 1XU2A 4M4RA 4OULA 1COV3 1OLME 2D6KA 3X29B 1FPN2 5A3MA 2DVFA 3VBRA 2ILMA 5CFCB 4B1MA 1XNBA 3NJZA 3ZN4A 2PA7A 2VPVA 3JQXA 4D6QA 1W39A 3AC0A 4RS5B 2B46X 3V0AB 2EA7A 1AR73 1K5MB 4XJUA 3BODA 1PMJX 2YV8A 5I8SA 5FK7A 2D93A 3FZ3A 5A3TA 2ZAAA 1PIV3 3AYCA 3VBOB 4OYUA 3OGVA 3C7EA 4M4PA 4DO0A 4Q5OA 5BUVA 5HCFA 4GB31 4TTGA 2CGPA 3F95A 4WVMB 3E5UA 4Q0UA 5EJ3A 3WG4A 1Q3EA 2YMZA 4D0QA 4W8JA 5FUIA 5LA2A 1KEXA 2EXHA 3RMXA 1ZBA2 3DEMA 1HLCA 2O8QA 2QQIA 2RS52 4ZPIA 3RWKX 1NOVA 3WNPA 2EIGA 5EIYB 5JSOA 5L7OB 2XHNA 5J98B 3OJBA 4IDZA 3BN6A 4O9GA 4GB33 4YW2A 5F7UA 1O7FA 3H1MA 2WNVC 4XUNA 1H1IA 1IHMA 2JENA 2W1WA 3ME2A 2ZX3A 4RGAA 2K46A 2PFWA 3NJXA 3B5LB 3E6CC 4BISA 3ZSJA 3U11A 1KRIA 2A3XA 3IT8A 2DYCA 1PO11 4GH4C 1W8OA 2QKDA 3WXPA 3I2OA 3T0AA 2D6OX 3MYXA 1RHI1 4N8MA 4CRQA 2FDGA 4LBMA 1J83A 4FFFA 4RS5A 3ABZA 1QNWA 1V6IA 4LULA 4TSVA 3VBSC 3OEAA 3LCPA 3VBOA 4CDWC 4MOAA 3GALA 4KGGA 3MZHA 3C8XA 1PO13 5KHJA 1UPIA 1WW6A 3MW2A 4GA9A 3IDAA 2V09A 2HEVF 4NWVA 1RHI3 2ZX4A 1NAEA 3L2HA 4HKWA 4QDQA 3T2QA 5JUVA 3MLLA 4QPIB 5EJZB 1IS4A 2BNMA 2GAUA 3QH6A 4JDOA 4WVMA 5L9RA 1J59A 2UWCA 1OFSA 1E5SA 2YG0A 1GQGA 1YFXA 1IZ3A 2FZ2A 4MYEA 2ZHKA 4DXRA 3GZTB 4DNYA 3U75A 4F7ZA 3AKQA 3O1VA 5FZEA 5L7OA 1JODA 2VD7A 1N3OA 3JUUA 3WCSA 1YCIA 4YNIA 4UBHA 1QQP2 5KXCA 1ZRIA 3VDDC 1RUF2 3W5MA 4OLLA 3TNPB 2PAEA 1F5FA 2XKOA 4IEVA 2OIIA 2A6VA 3RYRA 2B7YA 4RL7A 2TEPA 4QGNA 4QPGB 4YVSC 3U78A 4PF5A 3N7KA 4XF4A 5EP9A 4DUVA 3ES4A 3IDCB 1QJZA 3FC0A 3FUOA 1BYHA 4LBQA 2IXIA 2ZHLA 4CUAA 5FYVA 1WW7A 4LO8A 1EYBA 2W0XA 4NAMA 1PGL2 1QMJA 4JX0A 2Q0AA 3D3AA 5FMCA 1S0IA 3KLSA 1RIRA 5EPAA 3DKQA 2XH6A 1W9YA 2GMEA 5FY1A 2QQWA 2YDEA 5JIUA 1AUYA 1E5RA 4CCJA 1S0FA 2BRTA 2OT7A 4MLOA 2BNOA 3ZMNA 5EXOA 5A7WA 1IS6A 3H50A 5CFDB 1O3TA 4QPIA 4LE4A 1DCSA 3H8UA 1QJX2 1I9RA 2EF6A 4P00B 3TOJA 1JH5A 2AACA 1W8NA 1W6PA 4GULA 3ZDSA 3ZN6A 3CIHA 1DZRA 1UZ0A 3MF6A 4Q4V1 4MGSA 4GWNA 3WDVA 5FYSA 1UY2A 5JOWA 1NY71 1XU1A 1CJDA 1CWPA 3Q8CA 4LK6A 4CYDA 4L2NA 1UX6A 4NPMA 1WD3A 2WYFA 4Q2FA 4I0AA 1TNFA 3PUHA 2BVVA 5D1IA 4ES9A 4NN0A 5GJ6A 2WS92 3K77A 1Q8SA 1LKNA 4Q4V3 1UZZA 4QQLA 4LO4B 4AAXA 3ON7A 3CF6E 4QPGA 4UBGA 4NPRA 4XFGA 4YZ4A 5EHDA 2WQZC 3POJA 1A6CA 4MG2A 1JYVA 4RN5A 5FY8A 2B8MA 5B4NA 2ZGUA 3DV8A 5J09A 2DUPA 2OZJA 5C4WC 2P3IA 2E53A 4XTMA 1OUSA 3Q8BA 4Y22A 1DQ0A 4OZXA 3T2TA 5IK5A 1X50A 2FDHA 1XC6A 4COZA 2JD4A 1B35B 2QZ2A 2C9AA 1H4GA 5FKBA 4HXCA 3TNQA 4KG8A 5LB6A 1PZ7A 4E27A 4YARA 3C7GA 4E9KA 4Q4W2 4JDMA 4QU1A 3DYMA 3LFIA 4XTPA 3QACA 5A6QA 3NNMA 3HT1A 1KDMA 5LASA 1JYCA 4B3NA 3WVJA 4IV3A 1W99A 4QDSA 4QKBA 3BVCA 1W03A 5E8AA 1LHNA 2D6LX 3PVOA 4PHZA 2WRAA 2VOVA 3M4FA 2SLIA 2DCJA 4KWKA 4Y26A 2XG3A 1US2A 4UW4A 5J96B 1NKGA 1W0PA 4A3ZA 1GQHA 1XSQA 3ACFA 1POV0 3DCQA 3K3OA 2WNVB 5C3QA 5C9AB 2ZGQA 3PVEA 2JG8B 2FD8A 2VNGA 4XAAA 5E6HA 5E16A 1PZ9A 4QHOA 1ENQA 1GFF2 4ZU5A 3W9AA 2BBVA 4CCMA 1URXA 5JPNB 3LWCA 2GN3A 4IW3A 1I6XA 3RI8A 4EZ4A 3VD4A 4J1XA 4CDUB 1SCSA 2UY8A 2EIDA 2ZHMA 3VL8A 5JR2A 3M3EA 1HQLA 1MS4A 3LDBA 3VBSB 4AFMA 4NVPA 4EN6B 3O0XA 4NIIA 4D7YA 2IWGB 2RDSA 3RWNA 1U5IA 2WKKA 2JDYA 4RR3B 3AK0A 4CEYB 2RS12 1AR91 4QXCA 3GJAA 4SLIA 2XBO1 4FVVA 1OUXA 2ZBJA 1JXNA 2RR11 1RVF1 3KD4A 5LBFA 3WDTA 5I0DA 2BBAA 3TBDA 3RS6A 3L2YA 4P02B 3ITQA 4QX3A 3UKVA 4Z92B 3OOXA 4JKMA 3AVRA 4JZRA 1LGNA 3B94A 4UT5A 4QPWA 3JQWA 4LBOA 3DYOA 1OVSA 2WLQA 2A7AA 3LEGA 4HETA 4AI1A 5FRAA 4G3YC 4MGIE 1AR93 4RHV1 3KHCA 4GD4A 2WFPA 2WNVA 2XBO3 2Y6FA 2RR13 5IAVA 1RVF3 5DAVA 3UKNA 1DF0A 4BJ0A 1ZVFA 4K7JA 1J1LA 1UY0A 3C7OA 5ABJB 1GNHA 3POEA 3DN7A 2ADEA 1F4HA 1DGWA 2DBIA 4GH4A 5FZBA 4OHYA 5FZGA 5LA0A 4CCOA 2A6XA 5JI9A 1GICA 4RHV3 3O12A 4BA6A 3MICA 1GOFA 1LNSA 2ENRA 4Y1YA 4PF1A 1AYN2 4IGPA 3KZ4C 3VBSA 2BFUL 3GZAA 4W6WA 4CDQC 3OGJA 4WV8A 4HKOA 2ZPXA 2EXIA 4CDWA 5D8AC 4C8DA 3CL1A 1BEV2 4AHWA 1Q43A 2PHUA 5LRRA 1DFQA 3J26N 4PLNA 4RR3A 3R05A 5HCBA 4AI3A 1MS9A 5IHRA 3POWA 4CDXC 4Q4X1 3HMYA 2YZ4A 4G9SB 1GZWB 1WW4A 2OUJA 3KVBA 2W87A 3T3YA 3N9LA 3MI8A 1ZREA 1HKDA 3CQOA 4UFMA 3CLPA 4TYSA 1XE7A 1UZVA 4K1ZA 3VD3A 1ODNA 4OVEA 2R0FA 2RV9A 1I5ZA 2TBVA 4A42A 4EN7B 4A7KA 4BH9A 1U0AA 2XJUA 4Q4X3 1VIWB 4MZUA 1AX0A 4Z82A 3RZKA 5CYYA 2VZPA 3AKPA 4YVWC 4JKLA 4PLOA 4XUOA 2QDNA 1ZRFA 2DCKA 5FMOL 3E5QA 3SH4A 5IK7A 4OUEA 1W2NA 4FT8A 3THTA 2VZ3A 4MV2A 4YVSA 3MO4A 3SHRA 5I93A 2JJ6A 1CQ9A 3IKWA 3M1HA 1VBD1 4OHVA 3S6PA 4B7KA 5HV0A 2E33A 1O3RA 2Z42A 5CU1A 4B4QA 4LBLA 5C4WB 2WNUB 2X5IB 4QX2A 3ILNA 4MGTA 3AVSA 2C26A 3AP4A 4LLOA 1EV12 3IPVB 1SLBA 2BGOA 4AEDC 4N53B 2CNAA 4FTEA 1S0JA 1KQRA 4I30A 4KWJA 4LBNA 4C1XA 2OVUA 2J22A 5AC91 4YG6A 5GZFA 3FHQA 1VBD3 2Z5WA 5LA1A 5JOXA 1AYM2 2VUJA 3AZYA 5FPVA 1EAH2 1V6JA 3PMSA 1GZWA 3CNAA 1HJGA 1YQCA 2D5FA 2HWE1 4EN8B 4LLFA 3IBMA 1YQ8A 1RUD2 3NNGA 1ZRDA 1J3RA 3O14A 5FZ0A 5AC93 4K21A 4OCTA 2ETEA 4EYUA 1LRHA 4CPBD 3VBHC 4AHYA 4LJHA 4FTSA 1DZTA 1PM7A 2JB8A 2WAAA 1Z78A 2X09A 2HWE3 3J9SA 4NE9A 5IVYA 1CX1A 4Z2AA 3WD5A 1JZ2A 5J7MA 5FUPA 4PLMA 5FJHA 5KHHA 4BXSV 2ZEYA 1O91A 1VBC1 2DVBA 2YPDA 4ZU4A 1W2OA 3HT2A 1KS4A 2PHXA 5C4WA 4BM8A 3INAA 2B9VA 1RUI2 1V9U2 2E9QA 4FXGB 1LTEA 1W6NB 4GWJA 4UF0B 4E2GA 2BOJA 2QCSB 4LITA 4HN0A 2VECA 1LHUA 3AZZA 5DZGA 5A3WA 3SC7X 2LS6A 2JKXA 1UX7A 5G05L 3AL5A 3ZR5A 5C3PA 2AREA 2EIEA 1OOPB 4LO5B 5HBAA 5DAPA 2P3YA 3WEZA 1VBC3 3ATGA 2X05A 3VZMA 1G8WA 4TZDA 4LOSA 1LR5A 2B42B 1UNBA 5FZ6A 4C91A 2QQVA 4HL0A 1UOBA 5BXXA 4E4SA 2A71A 5GALA 1LCLA 4FAHA 1VRH1 3HN1A 3U4XA 5LZ6A 3VD7A 1GP5A 1VMHA 2XJQA 4BYYA 1ZX5A 4RSUA 5JLVA 3BU0A 3WNXA 1JZ3A 3CZUA 4P9GA 1WGPA 1UY1A 3Q8EA 2P6CA 3OF1A 2VH9A 3H8XA 3PDQA 4Y20A 2JXAA 4XCBA 1H0BA 2ARCA 3J7MA 3I3QA 4TWTA 5FLHA 1VRH3 3FN9A 2ZEXA 4A7YA 2VMGA 2V4AA 1AL21 4HVQA 4KBZA 4AXOA 2HWC1 1Q8PA 1WLDA 4WM7C 5FP9A 2WT2A 4RFT0 4L97A 4CE8A 3WP5A 3KV4A 1UKRA 2Q1MA 4XPVA 3ZFEB 5T50A 4GMP1 3PIJA 2RHPA 2YFUA 1VBE2 4INDA 2J1VA 2VQAA 1LOEA 1PVC2 5F6LB 2X53S 3BU7A 1OHFA 4QKNA 1HB4A 2J1UA 4HMZA 5JR7B 2WWUA 5DMYA 1AL23 4QKFA 5DPNA 4QAWA 2R6QA 2HWC3 4LHNA 3DUIA 3WQBA 4QGLA 1X36A 4OUMA 4BE3A 2YU2A 3AKRA 3A23A 2PQSA 2Y6KA 5E89A 3LOIA 4LEJA 4AEMA 5K8SA 1SLTA 4HZFA 4RGGA 4GMP3 5IUQA 2ZGSA 1UF2C 4WZFA 4YWAA 2C6SA 5APAA 1C8M2 3SITA 2PYTA 3GBFA 3UGGA 3UYJA 3ZSLA 2C24A 2OPWA 1OA3A 1JZ4A 2D6PA 5M0TA 2J1AA 2ZMLA 1IKPA 4ASKA 3I4IA 5IFTA 3A21A 3SCGA 1BLZA 1VMJA 3UL2A 2FMYA 1FYUA 3URFA 3MF9A 1ULDA 2QTWB 1N3QA 2XL9A 4URTA 4MGYE 3RRDA 2AEZA 4A2UA 4CEWC 1W6QA 2PAKA 2WFF1 5CB7A 3U07A 2WJSA 4DUXA 1MQTB 3RZJA 4BPZA 2LUWA 3NJVA 4XBLA 4I3PA 4MH0E 1H1MA 1QJFA 2C9KA 1AR62 4JGYB 4CU6A 1DGRA 2IVJA 3ZYPA 1MACA 1SDWA 1OQEA 2Q8DA 5A70A 4N7IA 3T4VA 3FLPA 5FP8A 2QDRA 2ZOEB 1S2KA 1HJFA 3SEEA 2H6BA 5FYTA 3WNLA 4AHZA 4CDQA 5CFCC 4RA0A 5JPMB 2WFF3 1QDOA 2FDJA 2YYOA 3EQEA 5D8AA 3GXUA 3ACIA 4COUA 4MVTA 2YBKA 1K5MC 1GKBA 1Q8OA 4CDXA 1DLCA 2QQPA 5L36A 3ACGA 3WSOA 1SLLA 3TYJA 1DP0A 4Y24A 1Q8QA 4Z2WA 3UNPA 4R9CA 4ZHNA 2IFRA 3EB7A 1ZNPA 2GSYA 3WY6A 5JSPA 1ZZ7A 3D8CA 3MIEA 5T54A 1SFNA 2XB6C 5FMBA 3N3HA 2Q30A 5F2SA 3I2DA 5HXVA 1Z7S1 3MPPG 3SH5A 2XJRA 2N7GA 5HI0A 1C3HA 5ANQA 1RUG1 3WCRA 4XQDA 3AZWA 4HK8A 1U12A 1Y9QA 1DQ1A 3VBHB 2P37A 1IS3A 1NG0A 2R30A 3ELNA 3I8TA 4YVWA 2DCZA 5F32A 2VE1A 1JZ8A 1U5ZA 1H8VA 2R072 4XEZA 3M7AA 5BPXA 1UOGA 4AAPA 1TME2 1Z7S3 3JU9A 3UESA 4NAOA 2GNDA 4LBKA 3VHOA 1RUG3 2Z2SB 3RQ0A 5FPUA 5KHKA 4AVVA 2DCTA 1DYKA 2WUHA 1DQ6A 1XYNA 2MEV1 5FPZA 1OQ1A 1OPMA 2OS2A 2WAOA 2RMU1 5DDJ2 4AEDA 1RITA 3KVAA 5EYXA 5CBLA 2A6WA 4AR2A 3PIGA 5A7OA 1A78A 4XQWA 2RVAA 1LENA 4OMCA 4YFZA 1JMUB 3ZIWA 1KJLA 5FREA 2JKBA 5FPBA 2MEV3 3KGZA 4ONUA 3OUIA 1QOTA 1H9WA 1QNYA 3N9MA 4LXLA 3GHNA 2RMU3 3VZJA 4H2AA 1UD1A 4JDNA 2ZZJA 4BLIA 3U10A 5I8YA 1H2MA 1MS0A 2Y0IA 3N35A 3IMNA 1RXGA 1NCQB 3I59B 4UFLA 4CA9A 1O4ZA 1PGW2 5KHIA 3VZOA 4AI8A 1NX9A 3MIHA 1YJKA 3VBHA 5LY1A 3ILRA 1QF3A 2G9FA 5IVFA 2BDRA 2ZEZA 1O8PA 4YPJA 5CG8A 3LEIA 1XNDA 4NO4A 2DU0A 4WM7B 1JYXA 3OD0A 5CKQA 1RUC2 3RYKA 2QQKA 4O65A 2EVXA 3IDEA 3BI3A 2O1QA 3E97A 2XQRA 1CIWA 4PI2A 4EWAA 3HNMA 1W06A 1H2LA 4N90A 2PELA 4IXLA 2MHFA 2YU1A 5FP7A 1NT0A 1C4RA 4AQ6A 3RJ2X 2KR2A 1HRI1 1OD5A 2ZS6B 4XUPA 3ZXAC 1D2QA 2WWJA 5J48A 2GZWA 1MS5A 5JXJA 2JDNA 4M3CF 1IQAA 3LA2A 1SLAA 1BHGA 2CGNA 2OXBA 1X7NA 2P34A 4UWDA 3U0ZA 2HJIA 2JD9A 1NZCA 3UV9A 5CFDC 2XJPA 3KCCA 1HRI3 1FATA 5A7NA 1F35A 4YM2A 4ZS2A 3OBRA 2A70A 5GKAC 1N3PA 1FV3A 1CIYA 4NR1A 3I59A 2XONA 3K4DA 4IE5A 1PO21 2ZGNA 3K48A 2XLGA 4L99A 5DUXA 1WLCA 4AG4A 2AEYA 4TN7A 5FO7B 4AW7A 3FWEA 1M4WA 3OCPA 1IGOA 4FPYA 4LHLA 4E8CA 2FDIA 3CZJA 3AMHA 1TE1B 1WCQA 2I74A 4QX5A 4FBFA 3LDKA 4FPFA 4EV0A 4CEWB 3JBG1 1IS5A 1YIFA 4QXBA 5HPOA 1SBDA 4WM7A 1OF3A 4WVWA 4HT1T 2ARAA 2L9LA 1ZZBA 1PO23 4IGOA 1XOYA 1COV2 4R4XA 2PHWA 4LO6B 5IVJA 1CONA 3VUOA 1BMV1 4JHZA 5HCHA 1A8MA 2PLV1 3WLUA 1G9FA 1SLIA 3HQRA 4I09A 4XOGA 4GJZA 4XHBA 4NOTA 3JBG3 4QM9A 4R4ZA 4BIOA 4K3UA 1LB2A 1PIV2 2WSVA 3UT0A 2RS32 2W91A 2WNEA 2Y6GA 5DG1A 1V0AA 1CGPA 4EZHA 3RPQA 5FZMA 1FPN1 2WDBA 1SDDB 3T0BA 1B35C 1ASJ1 2PLV3 1ULGA 3KGLA 2P1BA 3BYWA 4Q8LA 3VBFB 3IAPA 1C1LA 3JXSA 3M3OA 3PUQA 3WDYA 5C33A 1ZZ8A 4K8RB 3HQUA 5IFPA 1MZFA 3KWVA 3WW4A 2A75A 4OHWA 5DAWA 5DZEA 3AZXA 5K4LA 4XETA 3B3QE 3WNOA 2G19A 1FPN3 3CO2A 3MV11 3NV3A 4LOTA 3FHIB 2R7EB 3CDZB 3F2ZA 1ASJ3 3KQRA 4CP0A 1UKGA 2LTNA 2PHRA 4CEWA 4HLTA 3VBFC 2VO5A 3LKJA 4GALA 2AENA 4TLFA 2PXJA 1UU4A 4PIYA 1E57A 1QIQA 5C9AC 5GZCA 2JG8C 3LSEA 5F3GA 5CIRA 3VKOA 2RS51 4S2GA 3H1WA 5BNOB 3D0SA 1Y7BA 4LUKA 4YG3A 1AX1A 5J1XA 1DGWX 4IGQA 3H3UA 3PTYA 4AEKA 3BKZA 5CFCA 1A3KA 4CP1A 3J7NA 1APNA 1UU6A 4CDUC 2Y6LA 2XVGA 2HBUA 3V0AA 5T3NA 2QBXA 2DVDA 1K5MA 1R081 2WBKA 1JUHA 2VQ0A 2RS53 4PBOA 4A44A 1A8DA 2JE9A 5A7PA 1NXD1 1NLRA 5DAQA 3P3NA 3PVNA 3KHBA 1PNGA 3USSA 4CEYC 2UY9A 5LK5A 4AVBA 3VBFA 4D7SA 5J36A 2OQ7A 3WT3A 5LW9A 4DUWA 4LHKA 2P3KA 2E7QA 4LPLA 1UWWA 1R083 4EROA 5C3RA 4AVTA 2R061 2HWB2 3O1TA 2D5HA 3SKJE 2JECA 1A34A 1FXZA 3NKTA 2HEYF 4O7XA 4J1WA 4EWDA 1SBEA 1MVEA 1EUTA 5LATA 1FI2A 1LGBA 1MEC1 3HIFA 3RZZA 1QY4A 4XURA 5T5JA 2GMPA 3DXUA 2DVAA 3PURA 1LEMA 4FI9A 1NLSA 1K12A 4HG6B 2R063 5A6XA 1WW5A 5ABJC 4N43C 3AMMA 1RUH2 2JDHA 4XIOA 5A1LA 1P8JA 1UW8A 3ZYBA 2WN3A 4FPHA 5IW0A 3WDWA 1JHNA 4ASLA 2XOMA 3CU7A 3B69A 1MEC3 4NHLA 4NRQA 1CD3G 1VR3A 3HD8B 4ARYA 1UAIA 1Y9MA 2DWRA 4RR3C 5F5IA 1R1A1 3BOPA 3VZLA 3NJYA 1JZ7A 2VULA 2BVBA 4JTNA 4QM8A 5BV6A 5KC6A 2J1EA 2XVKA 4L92A 1G9DA 3NNJA 1PGL1 2WYSA 3L9JT 4N9HA 1FAYA 1JHJA 1HB3A 1IQDC 1XNKA 2IXCA 2Y34A 3FX3A 3BOWA 1J3QA 5I0RA 4LR4A 1W90A 3AXDA 4PIXA 2A3YA 5F6KA 1R1A3 4BMBA 4K9SA 5T5LA 4V2VA 1R091 4SBVA 5H9SA 4BLJA 3KM5A 4HANA 2UWBA 3SISA 1QJX1 1V6NA 3N9OA 1GV9A 5A6ZA 1W9WA 2Y33A 4M0HA 5F5AA 3ZM8A 2WL1A 4Q0PA 3WHUA 2ZJCA 3PU8A 5LEJA 1E5HA 3WP6A 1JS9A 5FZKA 1UYZA 3LB9A 2YHJA 1GMMA 2YC0A 2QQLA 2GNMA 3HJRA 5LBBA 4BCUA 4NIDA 2LM3A 1YNAA 3TB0A 5FDBA 3DPRB 2IC1A 2YXSA 1FX5A 1O4TA 1NY72 3VBUB 1R093 3NWKA 2ZACA 2CV6A 2PHTA 1HXS1 2VW2A 2WN2A 4GKYA 4DXZA 1QJX3 2Q8EA 3V64A 5JXIA 4I3GA 2XGXA 2DFCA 4QHZA 3ETPA 1O3QA 2WT1A 2WNUC 2X5IC 3FMGA 5A32B 5JMCA 5FLIA 1YRZA 5KHGA 3SEPA 2JX9A 3ALQA 1RC6A 1HV0A 4N53C 5KR7A 2VMFA 3ECQA 3B9IA 1HXS3 2CDOA 1RUNA 2O0OA 1HRV1 3HBKA 5CFDA 2JB4A 5I8TA 3OB8A 3TEYA 3OY8B 1T6GC 4HPKB 4D94A 2ZKNA 3TRSB 3I7DA 3WG1A 4X6RB 2D43A 4WBBA 1XSRA 4XE9A 2R041 4NIGA 4FP3A 4XABA 2ORXA 4Y4RA 4JGZC 4ZKTB 5JMOA 1YFUA 5CKMA 5JIAA 4LIVA 1GWLA 4GJYA 4B7EA 5GLZA 2XHKA 1V6MA 4Q4W1 1W9SA 1HRV3 4KWUA 3OPZA 1G9CA 4P9IA 1QGLA 1RJ8A 2FCTA 5FKCA 4IEXA 4OHZA 2W1UA 4ES8A 5FLJA 5J37A 2R043 5GLUA 1S4CA 1D0GA 3APBA 1FNYA 3N9NA 3J7LA 1CN1A 3ETQA 1QHDA 4DOUA 4IQPA 3POBA 3ZYGA 4FFIA 4Q4W3 3IIIA 3CBNA 1MZEA 4KU7A 5F3IA 2VMCA 1S2EA 2P6HA 2VBDA 3IB3A 1Z0HA 4YYOA 3SMHA 4AI0A 4XBNA 4CPBA 3MUZ1 3WV6A 4CCDA 4LKEA 2DU1A 1H8TB 2VNOA 3R4DB 3P6BA 5FY0A 4CP9B 1REFA 4UYBA 1WCKA 1QKQA 3O1UA 1B35A 1G9AA 3H8RA 1QXJA 5IK4A 1OOPC 1IPSA 1YO8A 1NCRC 2A6YA 2MPFA 3AFKA 3KB5A 3MDPA 4LT5A 3MIFA 1F4AA 3H1YA 4AVSA 3W58A 1LOGA 1QJY1 1GU3A 4IEYA 3A4UA 2A73B 2E31A 2EXJA 2RS11 2G9ZA 3AB0A 3HAGA 5T55A 4Z8BA 5FZIA 3QH7A 4U2AA 1VALA 4HVRA 4Y4YA 3R4SA 2XBO2 2W2IA 4AQ2A 3WDUA 1RVF2 1ZRCA 1H6XA 1LOFC 5GLWA 2VQUA 4FQ4A 5CZKA 2EAKA 2V5DA 5C9AA 2JG8A 5F37A 4OI4A 3CKHA 1QJY3 5FPXA 5FP3A 4UXAA 5FY4A 2WINB 2YBSA 2VZVA 1LOBA 1G7YA 2MNGA 2RS13 2VUDA 3K4AA 1JBCA 4N43B 4S2HA 3RNSA 1O59A 1HB2A 3NL1A 3O1SA 1JTZX 5IJRA 1DQ5A 1S0EA 2FMDA 3ILFA 1RUJ1 2W46A 3I54A 4XF3A 4CDUA 3ZFEC 4CSWA 2XJSA 3WDXA 4LBQD 1TVGA 1OH4A 3HQXA 1V70A 4IEQA 5IVBA 2VM9A 5CADA 1ZA7A 1G6NA 1GBGA 4AVAA 4CP9A 4YZ5A 4NROA 5FPLA 4CEYA 3THPA 3PHMA 2P3JA 4FPJA 1AYN1 4C1WA 1RUJ3 1WKYA 1BVP1 2GN7A 3GNEA 1H9PA 4GZ9A 1UCXA 4YM0A 1BEV1 2GDFA 3FFZA 5H9RA 1UN1A 3B7MA 4Q4X2 2D6NA 4QPYA 5JXGA 2O14A 1OA4A 5IVVA 3R0RA 3BTXA 1AYN3 5JOYA 5FY5A 4N9IA 2D3PA 3P3PA 4MGZE 5GZGA 2JDZA 1QU0A 3LAGA 4JV4A 4NMIA 5L73A 5T5OA 4CU7A 4AYUA 1E5IA 1BEV3 3OUHA 5LA9A 2J42A 4O61A 5ABJA 1EY2A 3N9QA 4N43A 3LZZA 5EZWA 1MQTC 1GR3A 4FQZA 4JVAA 2FZ1A 2XQXA 1T2XA 4FFGA 1EPWA 3BALA 4JGYC 2IXHA 4MGQA 5FR3A 2B39A 5LBEA 2QQMA 4LHSA 1QH7A 3OTFA 1QWRA 4K1YA 2C5DA 4LQRA 4OHXA 4BHPA 2XLFA 2BUKA 4K20A 2WA3A 1DDLA 3WNMA 3W5NA 1VBD2 5LBCA 5LCWL 4QGMA 1CZVA 4LUMA 2ARBA 1GNZA 1WLTA 4QX7A 1IPKA 1WMDA 1EV11 3CJIC 3EJKA 4IEWA 4LO7A 3MHZA 1W3VA 4QXKA 4DRVA 5IK8A 3WX5A 5FYBA 3WF1A 2AR6A 3AJZA 1SMVA 1ODMA 4ZXKA 5AC92 3OYWB 4ZY9A 4JGZB 3T09A 1OH3A 5C5TA 3D5OA 2ZKLA 3K75B 4X6QB 2JICA 5LK7B 1N47A 3ZYJB 1UXXX 2AUYA 4MXWB 5GZEA 4F3JA 3UJQA 1AF9A 4DXTA 3AP7A 1UYXA 2HWE2 1YFWA 1EV13 2OA2A 2VTXA 3MV01 3VV1A 3NSTA 5JAXA 5FK8A 3ZLIA 1UXZA 2WO3A 4P9WA 3U4SA 2HWD1 4COYA 2XJTA 4AEJA 4D6RA 1D2SA 4URAA 1OI6A 3VKFC 4AE2A 4OI1A 4NHXA 2LW8A 3WHTA 3N36A 5A7SA 2WNUA 1DG6A 2X5IA 3AL6A 3J4UH 4IEPA 2BEOA 3N7MA 5K9YA 2CL2A 3IPVA 4FPKA 4K6BA 2IUWA 2HWD3 2QQOA 4M00A 3AP6A 1YXWA 4N53A 3QLQA 2OKXA 4DRRA 1VBC2 2DTYA 4UAPA 5DZFA 2YROA 1L7LA 4WVVA 4V2WA 3NVCA 1NCRB 4UI9L 1RUI1 4HN1A 3UGFA 3T2PA 2GP3A 1LHOA 2YGMA 3Q9OA 1W6OB 2WZR1 4R9AA 2HLEA 2OUHA 2XXZA 1ZZCA 4NHMA 4XMAA 3NQHA 3WQ7A 3OYWA 4NUBA 4JGZA 4E4HA 5DABA 2YPJA 3ZXEA 4D69A 4XIKA 2XMLA 1NCQC 5FZ8A 1F9KA 4GWIA 1RUI3 3SNMA 2EAAA 1VRH2 1NYWA 1GANA 2WZR3 3LEKA 3IDBB 4FCAA 1W8HA 3RVHA 4YZ2A 3HWJA 3I3DA 4BWOA 1L7RA 3SCHA 2P4EA 4ITCA 5IT6A 3NNLA 2X8KA 4TLGA 4HOOA 3OD4A 5JZGC 1YHFA 1O8SA 2RE9A 3TN92 2OYZA 3FLTA 1D4M2 2WC2A 5FXVA 2YY1A 1U5XA 3M3QA 1TG7A 1AL22 2VW0A 3ZXDA 1W6NA 4UF0A 4YLZA 3O1PA 2HWC2 3GDBA 4ATFA 2JIJA 4JQTA 4P9JA 4Y33A 2E63A 4YZ1A 2WO1A 5A1FA 2GC0A 1HDKA 1QJEA 2OZ6A 2ARXA 2ES3A 3VHNA 2XLAA 1O3SA 1OOPA 1LGCA 4LA3A 1VBE1 1NCRA 4KMQA 5FFOC 2WZPP 5JSRA 1AR81 2VW1A 1W6OA 1W9TA 4PBPA 4PDWB 4RQPB 2E7TA 5C8CB 4XJWA 1UY4A 2ZHNA 4XC9A 5ANNA 4P08A 3SXWA 2D7FA 2Q5TA 3AP5A 1W04A 3RGBA 4OQ8A 4BB3A 2AC1A 4J25A 2RJKA 5FV3A 3H7YA 2WLPA 4OQ9A 5J3UA 4XACA 1X9TA 4AQTA 4ZZ8A 4E4ZA 1IKQA 1LOFA 2QE3A 3KF5A 4GAZA 1VBE3 2F4LA 5BNPC 1AR83 1LESA 4FO9A 4RGKA 3FLRA 3I2GA 4JQRA 4XVHA 1W0OA 1HX6A 4B1LA 2A5ZA 3AP9A 1RMU2 1OFNA 4KBBA 2P2KA 1FMD2 3BIWE 5FZ3A 2W9XA 3TEXA 4BIFA 3A22A 5SV8A 3ZFEA 1W6MB 2XL7A 1LU2A 3RYPA 2Y8KA 1XJAA 4EWEA 4HFSA 1REDA 1K3IA 3ZSKA 3JD71 5LRSA 2HWF2 2WO2A 2XR4A 3WP4A 2J1SA 1AR61 1ZA4A 2VG9A 2VCBA 4WM8B 4H14A 3I49A 2VZRA 3I2JA 1VAMA 4GQ7A 5KXEA 3VB9A 1POQA 4Z1VA 2PMWB 3CJIB 3WW1A 1UU5A 4O9EA 1VAKA 5ACA1 3VLBB 1ULFA 1KS5A 1UL9A 4JRAA 4XUTA 4D7TA 3AX4A 2DCYA 2XWBB 4Q4Y2 4U36A 3JD73 1WCDJ 2BERA 3VDCA 1EPZA 1AR63 1VBA1 1PK6C 3GF6A 4HSJA 1ZBE1 3K46A 4XHXA 5IWFA 1BQPA 2BGCA 3I2HA 1H6YA 5A3OA 3THDA 3WNKA 1SZBA 1F31A 3ENRA 1SACA 1XE8A 1NA1B 5ACA3 5A6YA 1XYOA 3M3CA 5H9QA 4HBNA 5DN2A 1NQJA 4LBJA 3AMNA 2ZEWA 1Z7S2 1ND3C 5FPAA 1JYIA 2CSGA 3ASIA 4LKFA 4CCLA 3RI9A 3VHPA 5C3SA 1KD7A 1MQTA 1GQPA 1VBA3 4XFHA 4CU9A 4P14A 1SPPB 1ZBE3 3NW4A 2OX0A 1HQWA 4QHBA 2HKXA 3MEPA 4JGYA 5BNOC 2J7MA 1OBNA 4NRPA 1BBT1 1GOHA 2VCAA 4CUCA 2JDUA 1O5UA 1UIJA 4M3CB 5FUNA 3O1OA 3MIBA 1QH6A 1AVBA 4KWLA 4XQ4A 1WBFA 2O8OA 2DVGA 4I0WB 2VNRA 4W6XA 2G1MA 2Z4FA 1IG0A 3USUB 4FOYA 2CGOA 1GWMA 2JIGA 2MEV2 4MHUA 4BU2A 5I0SA 3CJIA 3IWZA 3AMQA 3VL9A 4BK4A 1PHMA 3LGRA 1BBT3 2VZ1A 2ZA9A 5AVAA 3C2UA 5K7PA 3VZKA 1JYNA 1FOD2 2D97A 2VQTA 4UFIA 2Q8CA 1JZ6A 1ND2C 1OSGA 1WMEA 3ZXJA 1XBFA 2BOIA 2DV9A 1GZTA 3B00A 4GMP0 1I5PA 2V73A 2ZGPA 4YSFA 4AFAA 1CAWB 3R4UA 3MFCA 1VBB1 3AXEA 5KC5A 1VPHA 1MPXA 1GZ9A 3KS7A 2ZGKA 3K51A 2WQ8A 1RGSA 2ZAHA 5JWPA 1RUE1 2CAVA 2VVEA 2EXKA 4BQYA 4NHYA 4CCKA 1XNAA 4XF9A 1SPPA 3NAPB 2UU8A 3PTRB 4XFCA 5JZGB 1OKQA 2OPKA 3HOBA 4IETA 2W95A 1DIWA 1J58A 1DGRN 1VBB3 2RDQA 2RM21 4XCAA 5JVVA 5EV7A 3HNYM 1EP0A 3ACHA 4FXKB 3ZR6A 2K9ZA 2BWAA 5A3UA 5LY2A 3NMBA 1RUE3 4YGBA 3M2MA 1NXMA 1RUC1 2BQPA 3ZXFA 1PMIA 2DDUA 3J8F2 2E32A 1TMF1 1ULEA 1W8ZA 3AYAA 1WA4A 2QVSB 2RM23 1I1EA 3DYPA 4XFBA 4DY5A 4GWMA 5JCTA 4UW3A 1L3JA 3ORJA 1UMHA 1RXFA 5EWSA 2C0ZA 4ATEA 1NQDA 1VP6A 3E5XA 1RUC3 4META 1PNFA 2QQNA 3I2FA 4FOQA 1CZSA 3FUQA 4NIAA 1TMF3 1NCQA 3VBRB 1XB9A 3OGGA 4AGVA 5A1AA 5HXMA 5BNPB 3UK9A 3LA3A 3POFA 3RMYA 1X82A 2Q1ZB 3LFMA 1QJU2 2CWMA 3PU3A 3FE5A 2VOXA 4S2FA 2D40A 3N7LA 2E6VA 2Z69A 2NP0A 1DYPA 4QX8A 1PO22 2VMEA 2Y6HA 5D21A 3O1MA 3HPNA 2FBEA 5JZGA 4NHKA 3AYDA 1V6KA 3FFQA 2AZ5A 3LDRA 3DPRC 3J7HA 2VZUA 2I45A 4Y1VA 1ACCA 2C1FA 3VBUC 3KSCA 3JBG2 4YW5A 4FPEA 2WR9A 3I3EA 3QOPA 1AR72 2XUEA 2ZX0A 3AFGA 5EQUA 1CAUB 4YG0A 4L11A 4RYDA 1BMV2 1DBNA 2GC1A 2BV4A 5KXBA 3OGSA 4Y3OA 4AK3A 2WO7A 3WINE 1ULCA 2WZEA 3LEMA 2G9GA 1BK1A 1XE0A 3PUSA 4FTBA 1OQDA 2VZSA 3EMRA 1LU1A 1SFYA 4DZGA 2RS31 2PHDA 1PK6B 5DUWA 2ZTNA 2JWPA 1AX2A 4KH9A 3N4MA 5JI7A 3DXTA 4QX0A 5GLTA 5B2GB 1DZQA 3KCXA 4XXPA 2DUQA 1G9BA 5I0UA 5TSWA 1ASJ2 5BNPA 2VOWA 2ZGLA 4MGKE 4UFJA 2OW4A 3LIHA 4GB32 2BJSA 2TUNA 2ZXQA 3JZVA 4NJ4A 5CKNA 1ND3B 1NUKA 4YGCA 4R8HA 4MO3M 2GNTA 2ZGMA 2VL4A 3A0NA 4A6OA 4DY3A 2RS33 1UYPA 5KXDA 3I2IA 3PMEA 3HBZA 4DQAA 4ARXA 1TNRA 1ZBA1 2NQYA 3POIA 5DG2A 4KQ7A 4N7UA 2DBNA 4HONA 1JOBA 4QWNA 4LMFA 3ZO0B 2Y0OA 5FXZA 4IE0A 4FFHA 3GGLA 3ZKUA 3FL7A 3S7EA 4OUSA 4W4ZA 3BTZA 1W2AX 3P5BA 3ZSEA 1CAUA 4Y1XA 2VBPA 1ZBA3 3WZ1A 1YEWA 1PO12 1LODA 2R1DA 1H8TC 1RHI2 2R32A 4ZZ5A 1RYYA 4K40A 4BXFA 3K3NA 2Y64A 5FYHA 3PLQA 3A0KA 1JU4A 4UW6A 1ND2B 4YM3A 2GH8A 3DL3A 4YW7A 3WW2A 5JDBA 3WG2A 1R082 2WT0A 3JCIA 1PK6A 5BNQA 2BGPA 2R49A 3IIAA 4FPCA 3RZHA 1NZIA 4OI0A 2WA4A 4LBQB 1OPOA 4Q8KA 1DU3D 2VXJA 1DQ4A 5F9TA 2BP6A 4X8PA 1DQ2A 1XPWA 2Y26A 4QD2A 1VAVA 3IM0A 2VXRA 3MLJA 1ND3A 3N9PA 3RZMA 2VBBA 4B4PA 1AJOA 1OXCA 3CEWA 1POV1 2GALA 1JN2P 3H8OA 4QB2A 1PZ8A 2HWB1 2R062 3AM2A 3VKMA 4IEZA 1G86A 1MS3A 5A7WB 3N7JA 4LE3A 4QKDA 4XXAA 5BNOA 3A7QA 2GP5A 1LULA 5K0UC 3CHXA 2HH9A 4Q0VA 4X8NA 1MEC2 1QQP1 4PT6A 3POGA 1V00A 4BQ1A 1W6PB 1RUF1 2ZX2A 3G7DA 1JYWA 3ZXKA 4Q27A 2VUCA 3ZN6B 1W8FA 4ASMB 3VD5A 1POV3 2VUAA 2CY6A 4A7ZA 2B5HA 2EIBA 3NV4A 2R1BA 1GOGA 2VJXA 2HWB3 5BNNC 1RUH1 4NRMA 4PQQA 3T08A 1BKZA 1ZRRA 3W20A 4EE2A 4GKXA 2QQJA 3C7FA 5E1RA 2XPJA 3HEIA 2Z79A 1QQP3 4MSVA 1RUF3 1ND2A 2VR4A 2H0BA 5CG9A 1REEA 1KFUL 1QOOA 1R1A2 2YFZA 3D4KA 4FPGA 1SG3A 2XJVA 4XF1A 5L9BA 1VJ2A 3W59A 2QZ3A 3OG2A 5FXXA 1RUH3 3RSJA 3D82A 2H0VA 3THCA 4YW4A 1CAVB 4AHXA 1XNCA 1K42A 2UYAA 4MXVA 2A1XA 4QT6A 5CEHA 3HR9A 1XXNA 4Y22B 4DEVA 2VCCA 2VVDA 3ST7A 3UGHA 5FZHA 2GU9A 1F8VA 5CA6A 1TZOA 1OMIA 4Q4V2 2EICA 3E6DA 1R092 2HYKA 4CXXA 5EFUA 4AFCA 3U14A 4Q0SA 4QQ2A 1W9FA 3E6BA 5DUUA 5FZ9A 4LTAA 2ZMNA 4YRDA 5FAXA 3ZFGC 4B4RA 5KWRA 4DPNA 2EALA 1HV1A 2BFUS 5C7GA 3NV1A 1MS8A 3EXUA 4IV3B 5CVRA 2WS91 5FOJB 4JAAA 3WNNA 3KF3A 5F1RA 1TQ5A 2VTFA 5IYYA 1LAJA 1O4YA 1XQNA 3PUIA 3BTYA 4M01A 4MUVA 5GZDA 3K4ZA 3WF3A 1HXS2 1J84A 4IERA 3O7OA 1W8UA 1GNYA 2ADDA 4Y5TA 3ZXLA 2Y60A 2XVLA 2YGLA 1UOFA 1PX3A 1WCSA 2WS93 4CTEA 3VHRA 1UZYA 3MGUA 1C28A 3H7JA 4IEOA 2PAMA 1J1TA 3ZSMA 3H9AA 2NPIA 4V1PA 1RUOA 3DKWA 4BQ5A 1W8TA 4XFIA 4CUGA 2R16A 1HRV2 3OUJA 5GM0A 1CAVA 1GWKA 2ZABA 1UZWA 5FZ7A 1WMXA 4XYXA 1JI6A 4AOCA 1NE6A 4JRLA 5FMOS 5FYZA 2YB7A 1QOSA 2E7AA 4H7LA 2R042 3IN9A 4YFWA 3T30A 5A80A 1N1SA 5KBFA 1OURA 1SBFA 4CU8A 2ERFA 4L8QA 1D0HA 2KM2A 1W2TA 4IE4A 1N1TA 2VTXJ 3LA7A 4W6YA 5FMDA 3DPRA 3D6EA 4IL7A 2D44A 3VBUA 3AJYA 2B4KA 4LIUA 5IAXA 1DLLA 1UO9A 2D98A 1YLLA 5C3OA 2V4VA 4HKLA 4H7MA 1HQNA 4JTOA 5A32A 1Q8VA 3SH3A 1HIXA 2H6CA 4QQHA 2WIIB 4D3WA 1GZCA 1F5JA 4Y5SA 2F4PA 4AI2A 3PJYA 4WVZA 4YW1A 4G4FA 5FZCA 2Q4SA 1OA2A 3OY8A 2J1RA 2YUEA 4HPKA 3ZVXA 1DGLA 1R64A 4UOJA 4GH4B 5F2WA 3BCWA 2IVIB 4DIQA 3MIGA 1Y43B 1IOAA 5FBZA 3UETA 2BZDA 2UWAA 3BGAA 4IEUA 5JOZA 3NO8A 1GUIA 4Z07A 1AR92 1OT5A 1MVQA 3E1F1 2BNNA 4AVCA 3GZEA 1WBLA 1WWYA 2RR12 3KV5A 4YGEA 5C70A 4XILA 4QU2A 2ID4A 4CDWB 3JB4C 1QJY2 3T0DA 1OLQA 3Q8FA 3H0OA 1FV2A 3MLKA 5C5UA 1C57A 1OF4A 1X8EA 3WUDA 3LIGA 3ZN5A 5A3LA 4LORA 5FOBB 5K0UB 1T6BX 1S0GA 3ZOIA 4RHV2 3WQ0A 3S30A 4XW3A 1KGYA 2HBTA 4AGRA 3LE0A 1AZDA 4OI2A 2SBAA 4AGGA 3MW3A 3UKTA 2IFWA 2FDFA 1GP6A 1VRBA 1SEFA 4IUGA 2W52A 4JCKA 4JC1A 5BNNB 3HN3A 1H2KA 2NLRA 3M70A 3MW4A 1YC61 3U1XA 3VDDB 1O5LA 1H8TA 1W0NA 4D6SA 1RUJ2 1YWKA 1D7PM 2Y6JA 2FCVA 4P9XA 2ZX1A 2VZOA 3MFAA 4NIHA 4EJRA 4XMIA 4CUBA 1ZYBA 2W68A 2WZ8A 4YVSB 1B09A 2KA3A 1LEDA 4RQPC 1UOJA 3LF7A 4PDWC 4KL1A 5IVCA 4MHRA 3RDIA 2UURA 5C8CC 5F3CA 5L9VA 1MZ6A 4R9DA 4BQ2A 2PHLA 1LECA 5AVPA 4EN9B 1C5HA 1N1VA 4XF0A 4C0BA 1LHWA 4Y1ZA 1PM4A 4CCCA 1YI7A 1W05A 4KI5M 2G4IA 1C5IA 2PTMA 5HV4A 4LK7A 1OLMA 4M3CE 5FO8B 3BB6A 2GH2A 4LA2A 1YIPA 1AXKA 5FZFA 3S57A 5ERLA 5FYMA 5K0UA 3TEZA 2UYBA 3P1IA 1AJKA 2VOTA 5FBJA 3ZFGB 3M3IA 3VN4A 2K2SA 2WNOA 4B8EA 4COVA 2F6BA 4OMDA 3H3LA 1FNZA 3H3ZA 2A3WA 2CHHA 4XDOA 2VGDA 5BNNA 1UQXA 4IE6A 3VD9A 1UMIA 1CPMA 2AYHA 3PVBB 2A6ZA 2F17A 2QQUA 3I3BA 3ACLA 3VDDA 2GMMA 4OZOA 1QDCA 2PQQA 5F5QA 3WF4A 1CPNA 2NMNA 1WZXA 4WM8C 2VMIA 5C71A 4RFRB 4A4AA 2E51A 1M06G 2DUOA 1ULOA 4S2DA 3B01A 4AZZA 1SQ4A 3TEWA 2Q8OA 2HEWF 1N1YA 3ZXGA 1WD4A 4DXSA 4FOWA 2VAUA 5FJKA 3I3MA 3PJQA 4TXWA 3UJOA 1AYM1 1GYKA 3EYPA 4ISRA 4L9BA 3SKVA 3ZFFC 3ZMOA 1EAH1 4XJ8A 1MZ5A 4IE7A 1MR5A 2VU9A 3OBZA 3LPFA 1NA1C 3MIDA 4I0BA 4YGDA 5EYYA 4XFFA 4A6SA 4CVUA 2W3JA 5FZ4A 2W5FA 1RUD1 1YFYA 1LOCA 3V65A 2RJ2A 1ULPA 4A45A 2C4XA 1KJRA 1S55A 4BQ3A 1HW5A 4HK9A 2D3SA 4HSLA 3FBMA 5FCCA 5FYUA 3LOBA 1AYM3 3ZFGA 3ZYFA 1EAH3 3B93A 4LNVA 4P9YA 3BPSA 5D2AA 4KU8A 2YC4A 3BUCA 3GYDA 4A41A 2HWD2 3MUY1 1S0CA 5FZOB 3ZIXA 1RUD3 2BU9A 2PN5A 1LOAA 4P9LA 5I91A 2X29A 1PVXA 4YM1A 2B45X 2DF7A 5FZLA 2VMHA 4Y20B 1JOJA 2JDAA 2CDPA 3JB8A 4F8AA 3O1RA 1V9U1 5EJ1B 5F5CA 5C6CA 1KITA 1K45A 3IZOA 4UW5A 3V56A 1PX4A 4A3XA 4CZSA 1IPJA 2V72A 4KGQA 3I97A 1Y4WA 1JW6A 5T52A 5FO9B 1YYNA 3VZNA 4XZPA 4DB5A 4F83A 2BTVC 2ORZA 5FY7A 3VGIA 4BQXA 3V0BB 4FPLA 2ZMKA 3GM8A 3KQ4B 1YQ5A 2VNVA 2YC2A 4MXWA 2W1SA 1XNTA 2WZR2 3D0JA 2Y38A 3M8LA 3EBRA 3POSA 1V9U3 1SCRA 3K2OA 4Q29A 3KMHA 5DUVA 3SLIA 3VKNA 4CXWA 1QXRA 1VLNA 3FBYA 4H55A 2HYXA 1UYYA 4BOWA 5BYNA 3S5QA 3AYEA 3RJRA 3SCFA 4KNCA 5AFBA 1ALYA 2XDVA 4IV1C 2RJLA 2BWCA 1W8WA 3O5SA 5CISA 4K8FA 1X9PA 3NAPC 4ZONA 3S7IA 1S0BA 4R9BA 3BIEA 2W39A 3C3VA 4XJ9A 5FZAA 1HB1A 4DMIA 1UIKA 2D3RA 2JG9C 3VDAA 2IXKA 1F2NA 2W47A 2JE7A 4ORFA 5FZOA 1BK0A 1SLCA 3NRUA 4EQVA 1JYTA 4BQWA 4XUQA 1STMA 3AKTA 5FY9A 2W08A 4PQ9A 4DS0A 2JE8A 3HVDA 1L7QA 1NE4A 2NYYA 1XRUA 1ENXA 1IG3A 5E88A 4PIZA 3TN91 2GNBA 1AHSA 1S2BA 1D4M1 1ST8A 2NN8A 1ZM1A 2VOKA 3KV6A 1F15A 3FJSA 2CYFA 3Q8AA 4PCRA 4PJYA 3VKLA 1W6QB 4BMEA 2W92A 4Y1UA 2I2SA 2ET1A 3ZDVA 1W28A 2ZCWA 5LEKA 3G6JB 1PVC1 2R0HA 2JEMA 1C8NA 2IXLA 2JDKA 4E2QA 5FIXA 2VVFA 3AMPA 3CJXA 4I2OA 2VZTA 4QB6A 4QQPA 2RG4A 3V0BA 5DAXA 1YUDA 3ZKYA 3TN93 1PGSA 1WLWA 4ISQA 1D4M3 2B9UA 4CDQB 1AR82 2LALA 4XAEA 3VBRC 3WF2A 4E8DA 3O0VA 4XDPA 3S0MA 5D8AB 4ZXEA 2ZZQA 4AI9A 1RINA 5C8WA 1PVC3 1C8M1 2CTVA 1YQ2A 1LHVA 1W2UA 3LQCA 1KXGA 5F3EA 4P5HA 5LWBA 4CDXB 3RZLA 1UMZA 1HN0A 1JU3A 3GBWA 2IXJA 3NV2A 4D8MA 1VB2A 1OD3A 1BCXA 1H1AA 1CJPA 2AGSA 4W50A 2BYVE 1KFXL 3GBGA 1J3PA 5FYYA 2BPA2 1AXYA 3S5AA 3KT7A 3PNAA 4H3WA 4HVOA 4I02A 4J6GA 3OBTA 1C8M3 1VE0A 2WFF2 1RMU1 1RB8G 1ENSA 4DINB 1QEXA 3QD6A 1H4HA 1FMD1 2ZGRA 1AL0G 3I2KA 5L19A 2I07B 3USUA 5IVEA 4YVWB 5T5PA 1ZZ6A 1W3XA 5G04L
chains in the Genus database with same CATH topology
3WR0A 3BTAA 4RQPA 3ZYRA 4PDWA 4KG0A 1GLHA 2ZGTA 2DTWA 2HWF1 3JD72 1U5YA 1CESA 4AQSA 5C8CA 1BJQA 2V5YA 1RMU3 1WMFA 2XUMA 1FMD3 4C0HA 3WOGA 3DF0A 5ACA2 1CAXB 3ZFFB 4Q26A 4AEDB 1LJ7A 1MS1A 4RS5C 4Q4Y1 2ET7A 2HWF3 1VBA2 4RD7A 1H2NA 1DHKB 1ZBE2 2CWSA 4M0NA 2WWSA 4B29A 2GC2A 1RUG2 3NKGA 3VBOC 2D6MA 1YJLA 1D4VB 4QMAA 4C90A 4Y5Z0 4GXLA 4NWWA 4XFAA 3TAYA 1W6MA 1KDKA 1FT9A 2XKPA 3LSDA 2R071 4Q4Y3 1ZZ9A 4CP2A 1TME1 2GC3A 5CNAA 1ONAA 1ENRA 3O0WA 4WM8A 5L7OC 5FTTC 4AWDA 1BBT2 2NMOA 5SV5A 2P17A 2RMU2 4FP2A 5DDJ1 1S1AA 1BXHA 4DFSA 2R073 5FQ0B 4OFGA 3WQ1A 1TME3 4Q1RA 3ZX7A 2WSUA 4XBQA 3ROUA 1TEIA 2IZWA 2WQ4A 4ZU7A 1VB4A 1Y3TA 3ES1A 4QQOA 3BPZA 1CAXA 3ZFFA 4FSJA 1R1ZA 1NA1A 1FOD1 2NZ9A 4E2SA 5DDJ3 3AKSA 2PHFA 5HCAA 1I3HA 2NM1A 3B02A 4MX3A 3WP3A 4YZ3A 1BZWA 4IV1B 4EN0A 3WUCA 1PGW1 2VY0A 1VBB2 1QXPA 2K0GA 4XJAA 3QCWA 1S0DA 1BVVA 3GZUC 1C1FA 2XWJB 4QPIC 1FOD3 5AFEA 4Q1PA 2JG9B 1RJ7A 1RUE2 3QBQA 1GSLA 1V6LA 4E4DX 4M3CA 3KT1A 3RG0A 4FAGA 1RTVA 2RM22 4YW3A 3AZVA 5BY5A 3DGTA 4FOVA 4AFDA 4GIQA 2FHRA 5I0TA 5A33B 4BZ4A 1HRI2 1RL3A 5FQ0A 3J8F1 1Q56A 4AF9A 3KCYA 1H30A 1TMF2 5CAZA 2CAUA 4W65A 1CVNA 4QPGC 4Q0QA 1CAWA 3T1LA 3EHKA 2AH2A 2ZGOA 1V6OA 1X8MA 3WW3A 5GLVA 3ZYIB 2KXLA 3GHMA 3J8F3 4IESA 4IV1A 2QFEA 4AFBA 1Q5OA 1JUIA 3NAPA 1QJU1 2QJVA 2TNFA 4WZCA 4I01A 2JG9A 5DXDA 3R6SA 2DFBA 1UPSA 2QUOA 3EO6A 3POYA 3MPBA 2FQPA 3B9CA 3WG3A 4IV3C 2QNKA 1OLRA 2ATFA 1COV1 3T1MA 4XJZA 4XDQA 1WUVA 3TWIA 1AXZA 1QJU3 2PLV2 5A33A 3ZPYA 2BW8A 4COWA 1YI9A 1AR71 2DURA 1XYPA 1CR7A 1CX4A 1X33A 1PIV1 5H9PA 4R52A 3KT4A 4FPOB 1XU2A 4OULA 1COV3 2D6KA 3X29B 1FPN2 5A3MA 2DVFA 3VBRA 2ILMA 5CFCB 1XNBA 3NJZA 3ZN4A 2PA7A 2VPVA 3JQXA 1W39A 4RS5B 2B46X 3V0AB 2EA7A 1AR73 1K5MB 4XJUA 3BODA 2YV8A 5I8SA 2D93A 3FZ3A 2ZAAA 1PIV3 3AYCA 3VBOB 5BUVA 5HCFA 4GB31 2CGPA 4WVMB 3E5UA 4Q0UA 5EJ3A 3WG4A 1Q3EA 2YMZA 3RMXA 2EXHA 1ZBA2 1HLCA 2O8QA 2RS52 1NOVA 5JSOA 2EIGA 5L7OB 5J98B 3OJBA 4O9GA 4GB33 4YW2A 1O7FA 3H1MA 2WNVC 1H1IA 1IHMA 2JENA 3ME2A 2ZX3A 4RGAA 2PFWA 3B5LB 3E6CC 3ZSJA 3U11A 1KRIA 2A3XA 3IT8A 2DYCA 1PO11 4GH4C 2QKDA 3WXPA 2D6OX 3MYXA 1RHI1 4CRQA 4LBMA 4RS5A 1QNWA 1V6IA 4LULA 4TSVA 3VBSC 3LCPA 3VBOA 4CDWC 3GALA 4KGGA 3MZHA 1PO13 5KHJA 1UPIA 1WW6A 3MW2A 4GA9A 4NWVA 2V09A 2HEVF 4RR3C 1RHI3 2ZX4A 3L2HA 4HKWA 3MLLA 4QPIB 1IS4A 2BNMA 2GAUA 3QH6A 4JDOA 4WVMA 1J59A 2UWCA 1OFSA 1GQGA 1YFXA 1IZ3A 2FZ2A 4MYEA 2ZHKA 3GZTB 4DNYA 4F7ZA 3AKQA 5L7OA 1N3OA 3JUUA 3WCSA 1YCIA 4YNIA 4UBHA 1QQP2 5KXCA 3VDDC 1RUF2 4OLLA 3TNPB 2PAEA 1F5FA 2XKOA 4IEVA 2OIIA 2A6VA 3RYRA 2B7YA 4RL7A 2TEPA 4QGNA 4QPGB 4YVSC 4PF5A 3N7KA 4XF4A 3ES4A 3IDCB 1QJZA 3FC0A 3FUOA 1BYHA 4LBQA 2IXIA 2ZHLA 1WW7A 4LO8A 1EYBA 2W0XA 1PGL2 1QMJA 2Q0AA 1S0IA 3KLSA 1RIRA 2XH6A 2GMEA 2YDEA 5JIUA 1AUYA 1S0FA 4MLOA 3ZMNA 2BNOA 5CFDB 5EXOA 1IS6A 3H50A 1O3TA 4QPIA 4LE4A 3H8UA 1QJX2 1I9RA 2EF6A 3TOJA 1JH5A 1W6PA 4GULA 3ZDSA 3ZN6A 1DZRA 3MF6A 4Q4V1 4GWNA 3WDVA 5JOWA 1NY71 1XU1A 1CJDA 4CYDA 4L2NA 1UX6A 1WD3A 4Q2FA 4I0AA 1TNFA 5D1IA 2BVVA 4ES9A 4NN0A 5GJ6A 2WS92 1Q8SA 1LKNA 4Q4V3 1UZZA 4QQLA 4LO4B 3CF6E 4QPGA 4UBGA 4NPRA 4XFGA 4YZ4A 2WQZC 1A6CA 2B8MA 2ZGUA 3DV8A 5J09A 2DUPA 2OZJA 5C4WC 2P3IA 2E53A 4XTMA 4Y22A 1DQ0A 4OZXA 3T2TA 5IK5A 1X50A 4COZA 2JD4A 1B35B 2QZ2A 2C9AA 1H4GA 3TNQA 4KG8A 1PZ7A 4E27A 4YARA 4E9KA 4Q4W2 4JDMA 4XTPA 3QACA 3HT1A 1KDMA 1JYCA 4B3NA 3WVJA 4IV3A 5E8AA 1LHNA 2D6LX 3PVOA 4LT5A 2VOVA 3M4FA 2SLIA 2DCJA 4KWKA 4Y26A 2XG3A 4UW4A 5J96B 1W0PA 1GQHA 1POV0 2WNVB 5C9AB 2ZGQA 3PVEA 2JG8B 2VNGA 5E16A 1PZ9A 1ENQA 1GFF2 4ZU5A 3W9AA 2BBVA 1URXA 5JPNB 3LWCA 2GN3A 1I6XA 3RI8A 4J1XA 4CDUB 1SCSA 2UY8A 2ZHMA 3VL8A 3M3EA 1HQLA 1MS4A 3VBSB 4AFMA 4NVPA 4EN6B 3O0XA 4D7YA 2IWGB 3RWNA 1U5IA 2WKKA 4RR3B 3AK0A 4CEYB 2RS12 1AR91 4SLIA 2XBO1 4FVVA 2ZBJA 3KD4A 1JXNA 2RR11 1RVF1 3WDTA 3TBDA 3RS6A 3L2YA 3UKVA 4Z92B 1LGNA 3B94A 3JQWA 4LBOA 2WLQA 2A7AA 4AI1A 4HETA 5FRAA 4G3YC 4MGIE 1AR93 4RHV1 2WFPA 2WNVA 2XBO3 2RR13 1RVF3 3UKNA 1DF0A 1ZVFA 4K7JA 1J1LA 5ABJB 1GNHA 3DN7A 1DGWA 4GH4A 4OHYA 2A6XA 5JI9A 1GICA 4RHV3 3O12A 4BA6A 3MICA 2ENRA 4Y1YA 1AYN2 3KZ4C 3VBSA 2BFUL 3GZAA 4W6WA 4CDQC 3OGJA 4WV8A 4HKOA 2ZPXA 2EXIA 4CDWA 5D8AC 3CL1A 1BEV2 4AHWA 1Q43A 2PHUA 5LRRA 1DFQA 3J26N 4PLNA 4RR3A 3R05A 5HCBA 4AI3A 1MS9A 3POWA 4CDXC 4Q4X1 3HMYA 2YZ4A 4G9SB 1GZWB 1WW4A 2OUJA 3MI8A 1ZREA 1HKDA 3CLPA 4TYSA 1XE7A 4K1ZA 4OVEA 2R0FA 2TBVA 1I5ZA 4EN7B 4A7KA 4BH9A 1U0AA 2XJUA 4Q4X3 1VIWB 4MZUA 1AX0A 4Z82A 3AKPA 4YVWC 4PLOA 1ZRFA 2QDNA 2DCKA 5FMOL 3E5QA 3SH4A 5IK7A 4FT8A 3THTA 4MV2A 4YVSA 3SHRA 5I93A 2JJ6A 1CQ9A 3IKWA 3M1HA 1VBD1 4OHVA 3S6PA 4B7KA 1O3RA 2Z42A 5CU1A 4B4QA 4LBLA 5C4WB 2WNUB 2X5IB 3ILNA 4LLOA 3AP4A 1EV12 3IPVB 1SLBA 4AEDC 4N53B 2CNAA 4FTEA 1S0JA 1KQRA 4I30A 4KWJA 4LBNA 4C1XA 2OVUA 5AC91 4YG6A 5GZFA 1VBD3 2Z5WA 5JOXA 1AYM2 2VUJA 3AZYA 1EAH2 1V6JA 3PMSA 1GZWA 3CNAA 2HWE1 2D5FA 4EN8B 4LLFA 3IBMA 1RUD2 1ZRDA 1J3RA 3O14A 5AC93 4K21A 2ETEA 1LRHA 3VBHC 4AHYA 4FTSA 1DZTA 1PM7A 1Z78A 3J9SA 2HWE3 3WD5A 5J7MA 4PLMA 5KHHA 1O91A 1VBC1 2DVBA 4ZU4A 3HT2A 1KS4A 2PHXA 5C4WA 4BM8A 3INAA 4FXGB 1RUI2 1V9U2 2E9QA 1LTEA 1W6NB 4E2GA 2QCSB 4HN0A 2VECA 1LHUA 3AZZA 5DZGA 2AREA 4LO5B 1OOPB 5HBAA 4TZDA 1VBC3 3ATGA 3VZMA 1G8WA 1LR5A 2B42B 4C91A 4HL0A 4E4SA 5BXXA 4FAHA 2A71A 5GALA 1LCLA 3U4XA 1VRH1 3HN1A 4BYYA 2XJQA 1ZX5A 4RSUA 5JLVA 3WNXA 4P9GA 1WGPA 3OF1A 2VH9A 4Y20A 2JXAA 1H0BA 4TWTA 5FLHA 1VRH3 4A7YA 2VMGA 1AL21 4HVQA 4AXOA 2HWC1 1Q8PA 1WLDA 4WM7C 2WT2A 4RFT0 4L97A 3WP5A 1UKRA 4XPVA 3ZFEB 5T50A 4GMP1 2RHPA 1VBE2 4INDA 2VQAA 1LOEA 1PVC2 5F6LB 2X53S 3BU7A 1OHFA 4HMZA 5JR7B 1AL23 2R6QA 2HWC3 4LHNA 3DUIA 4QGLA 1X36A 4OUMA 4BE3A 3AKRA 5E89A 3LOIA 4LEJA 4AEMA 5K8SA 1SLTA 4HZFA 4RGGA 4GMP3 5IUQA 2ZGSA 1UF2C 4WZFA 1C8M2 3SITA 2PYTA 3GBFA 3ZSLA 1OA3A 2D6PA 2ZMLA 1IKPA 3I4IA 3SCGA 3UL2A 2FMYA 1FYUA 3URFA 3MF9A 1ULDA 4URTA 1N3QA 2XL9A 4A2UA 4MGYE 3RRDA 4CEWC 1W6QA 2PAKA 2WFF1 5CB7A 3U07A 2WJSA 1MQTB 4BPZA 2LUWA 4XBLA 4I3PA 4MH0E 1H1MA 1AR62 4JGYB 1DGRA 3ZYPA 1MACA 1SDWA 1OQEA 4N7IA 3FLPA 2QDRA 2ZOEB 1S2KA 4CDQA 2H6BA 4AHZA 5CFCC 4RA0A 5JPMB 2WFF3 1QDOA 2YYOA 3EQEA 5D8AA 4COUA 4MVTA 1K5MC 1GKBA 1Q8OA 4CDXA 2QQPA 5L36A 1SLLA 3TYJA 4Y24A 1Q8QA 4Z2WA 4R9CA 2IFRA 1ZNPA 2GSYA 3WY6A 5JSPA 1ZZ7A 3D8CA 3MIEA 5T54A 1SFNA 2XB6C 3VBFC 3N3HA 2Q30A 5HXVA 3I2DA 1Z7S1 3MPPG 3SH5A 2XJRA 2N7GA 5HI0A 1C3HA 1RUG1 3WCRA 4XQDA 3AZWA 4HK8A 1U12A 1Y9QA 1DQ1A 3VBHB 2P37A 1IS3A 1NG0A 2R30A 3ELNA 3I8TA 4YVWA 2DCZA 1U5ZA 1H8VA 2R072 4XEZA 3M7AA 5BPXA 1TME2 1Z7S3 3JU9A 2GNDA 4LBKA 3VHOA 1RUG3 2Z2SB 3RQ0A 5KHKA 4AVVA 2DCTA 1DYKA 1DQ6A 1XYNA 2MEV1 5FPZA 1OQ1A 1OPMA 2RMU1 5DDJ2 4AEDA 1RITA 5EYXA 5CBLA 2A6WA 1A78A 4XQWA 1LENA 4YFZA 3ZIWA 1KJLA 5FREA 2JKBA 2MEV3 3KGZA 4ONUA 1QOTA 1H9WA 1QNYA 3GHNA 2RMU3 1UD1A 4JDNA 2ZZJA 4BLIA 3U10A 5I8YA 1H2MA 1MS0A 2Y0IA 3N35A 3IMNA 1NCQB 3I59B 1O4ZA 1PGW2 5KHIA 3VZOA 4AI8A 3MIHA 1YJKA 3VBHA 3ILRA 1QF3A 2G9FA 5CG8A 1XNDA 4NO4A 2DU0A 4WM7B 3OD0A 1RUC2 3RYKA 2EVXA 3IDEA 2O1QA 3E97A 1CIWA 4EWAA 1H2LA 4N90A 2PELA 4IXLA 2MHFA 1C4RA 4AQ6A 3RJ2X 1HRI1 1OD5A 2ZS6B 3ZXAC 1D2QA 5J48A 2GZWA 1MS5A 4M3CF 1IQAA 3LA2A 1SLAA 2CGNA 1X7NA 2P34A 3U0ZA 2HJIA 1NZCA 3UV9A 5CFDC 2XJPA 3KCCA 1HRI3 1FATA 4YM2A 3OBRA 2A70A 5GKAC 1N3PA 1FV3A 4NR1A 3I59A 4AG4A 1PO21 2ZGNA 3K48A 2XLGA 4L99A 5DUXA 1WLCA 4AW7A 5FO7B 3FWEA 1M4WA 3OCPA 1IGOA 4FPYA 4LHLA 3AMHA 1TE1B 2I74A 4QX5A 4FBFA 4FPFA 4EV0A 4CEWB 3JBG1 1IS5A 1YIFA 1SBDA 4WM7A 4WVWA 4HT1T 1ZZBA 1PO23 4R4XA 1COV2 2PHWA 4LO6B 1CONA 3VUOA 1BMV1 1A8MA 2PLV1 3WLUA 1G9FA 1SLIA 4I09A 4XOGA 4XHBA 4NOTA 3JBG3 4QM9A 4R4ZA 4BIOA 4K3UA 1LB2A 1PIV2 2WSVA 2RS32 2WNEA 5DG1A 1CGPA 3RPQA 1FPN1 1B35C 1ASJ1 2PLV3 1ULGA 3KGLA 4Q8LA 3VBFB 1C1LA 3M3OA 3WDYA 5C33A 1ZZ8A 1MZFA 3WW4A 2A75A 4OHWA 5DZEA 3AZXA 4XETA 3B3QE 1FPN3 3CO2A 3NV3A 3FHIB 3KQRA 1ASJ3 4CP0A 1UKGA 2LTNA 2PHRA 4CEWA 4HLTA 3LKJA 4GALA 2AENA 4TLFA 1UU4A 4PIYA 1E57A 5C9AC 5GZCA 2JG8C 3LSEA 5CIRA 3VKOA 2RS51 4S2GA 3H1WA 5BNOB 3D0SA 1Y7BA 4LUKA 4YG3A 1AX1A 1DGWX 3H3UA 3PTYA 4AEKA 5CFCA 1A3KA 4CP1A 1APNA 1UU6A 4CDUC 2XVGA 3V0AA 5T3NA 2DVDA 1K5MA 1R081 1JUHA 2VQ0A 2RS53 4PBOA 1A8DA 2JE9A 1NXD1 1NLRA 3P3NA 3PVNA 1PNGA 3USSA 4CEYC 2UY9A 5LK5A 4AVBA 3VBFA 4D7SA 5J36A 3WT3A 4LHKA 2P3KA 2E7QA 1R083 4EROA 4AVTA 2R061 2HWB2 2D5HA 2JECA 1FXZA 3NKTA 2HEYF 4J1WA 4EWDA 1SBEA 1MVEA 1FI2A 1LGBA 1MEC1 3HIFA 3RZZA 1QY4A 5T5JA 2GMPA 2DVAA 1LEMA 1NLSA 2R063 1WW5A 5ABJC 4N43C 3AMMA 1RUH2 4XIOA 1UW8A 3WDWA 4FPHA 4ASLA 1JHNA 3CU7A 3B69A 1MEC3 4NHLA 1CD3G 1VR3A 3HD8B 1UAIA 2DWRA 1R1A1 3BOPA 3VZLA 2VULA 2BVBA 4JTNA 4QM8A 5BV6A 5KC6A 2XVKA 4L92A 1G9DA 1PGL1 3L9JT 4N9HA 1FAYA 1XNKA 2IXCA 3FX3A 3VZJA 5I0RA 3BOWA 1J3QA 4LR4A 3AXDA 4PIXA 2A3YA 5F6KA 1R1A3 4BMBA 4K9SA 5T5LA 1R091 4SBVA 5H9SA 4BLJA 3KM5A 4HANA 2UWBA 3SISA 1QJX1 1V6NA 1GV9A 4M0HA 2WL1A 4Q0PA 3WHUA 2ZJCA 5LEJA 3WP6A 3LB9A 2YHJA 2YC0A 2GNMA 4BCUA 2LM3A 1YNAA 3TB0A 5FDBA 3DPRB 2IC1A 2YXSA 1FX5A 1O4TA 1NY72 3VBUB 1R093 3NWKA 2ZACA 2CV6A 2PHTA 1HXS1 2VW2A 4GKYA 4DXZA 1QJX3 3V64A 4I3GA 2XGXA 2DFCA 1O3QA 2WT1A 2WNUC 2X5IC 3FMGA 5A32B 5JMCA 5FLIA 1YRZA 5KHGA 2JX9A 3ALQA 1RC6A 1HV0A 4N53C 3ECQA 3B9IA 1HXS3 1RUNA 2O0OA 1HRV1 5CFDA 5I8TA 3OY8B 1T6GC 4HPKB 4D94A 2ZKNA 3TRSB 3I7DA 3WG1A 4X6RB 2D43A 4WBBA 4XE9A 2R041 4FP3A 4JGZC 4ZKTB 1YFUA 5JIAA 4B7EA 5GLZA 2XHKA 1V6MA 4Q4W1 1G9CA 1HRV3 3OPZA 4P9IA 1QGLA 1RJ8A 4OHZA 4IEXA 4ES8A 5FLJA 5J37A 2R043 5GLUA 1D0GA 3APBA 1FNYA 4DOUA 1CN1A 3ETQA 1QHDA 4IQPA 3ZYGA 4Q4W3 1MZEA 4KU7A 1Z0HA 4YYOA 3SMHA 4AI0A 4XBNA 3WV6A 2DU1A 1H8TB 2VNOA 3R4DB 1REFA 1WCKA 1QKQA 1B35A 1G9AA 1QXJA 5IK4A 1OOPC 1YO8A 1NCRC 2A6YA 2MPFA 3AFKA 3KB5A 3MDPA 3MIFA 3H1YA 4AVSA 3W58A 1LOGA 1QJY1 4IEYA 3A4UA 2A73B 2EXJA 4Z8BA 2RS11 3AB0A 3HAGA 5T55A 3QH7A 4U2AA 1VALA 4HVRA 4Y4YA 3R4SA 2XBO2 4AQ2A 3WDUA 1RVF2 1ZRCA 1LOFC 5GLWA 4FQ4A 2EAKA 5C9AA 2JG8A 4OI4A 1QJY3 5FPXA 4UXAA 2WINB 1LOBA 1G7YA 2MNGA 2RS13 4N43B 3RNSA 1JBCA 4S2HA 3NL1A 1JTZX 1DQ5A 1S0EA 2FMDA 3ILFA 1RUJ1 3I54A 4XF3A 4CDUA 3ZFEC 2XJSA 3WDXA 4LBQD 3HQXA 1V70A 4IEQA 5CADA 1G6NA 1GBGA 4AVAA 4YZ5A 4CEYA 3THPA 3PHMA 2P3JA 4FPJA 1AYN1 4C1WA 1RUJ3 1BVP1 2GN7A 3GNEA 1H9PA 1UCXA 4YM0A 1BEV1 2GDFA 3FFZA 5H9RA 1UN1A 3B7MA 4Q4X2 2D6NA 4QPYA 1OA4A 3R0RA 1AYN3 5JOYA 4N9IA 2D3PA 3P3PA 4MGZE 5GZGA 2JDZA 1QU0A 3LAGA 4JV4A 5L73A 5T5OA 4AYUA 1BEV3 5ABJA 1EY2A 4N43A 3LZZA 5EZWA 1MQTC 1GR3A 4FQZA 4JVAA 2FZ1A 1EPWA 3BALA 4JGYC 2IXHA 2B39A 1QH7A 3OTFA 1QWRA 4K1YA 2C5DA 4OHXA 4BHPA 2XLFA 2BUKA 4K20A 2WA3A 1DDLA 1VBD2 4QGMA 4LUMA 2ARBA 1GNZA 1WLTA 1IPKA 1WMDA 1EV11 3CJIC 3EJKA 4IEWA 4LO7A 4QXKA 4DRVA 5IK8A 3WX5A 2AR6A 3AJZA 1SMVA 4ZXKA 5AC92 3OYWB 4JGZB 3D5OA 2ZKLA 4X6QB 2JICA 5LK7B 1N47A 3ZYJB 4MXWB 2AUYA 5GZEA 4F3JA 3UJQA 1AF9A 3AP7A 2HWE2 2OA2A 1YFWA 1EV13 3VV1A 3NSTA 5JAXA 4P9WA 2HWD1 4COYA 2XJTA 4AEJA 1D2SA 1OI6A 3VKFC 4AE2A 4OI1A 3WHTA 3N36A 2WNUA 1DG6A 2X5IA 3J4UH 4IEPA 2BEOA 3N7MA 5K9YA 2CL2A 3IPVA 4FPKA 4K6BA 2HWD3 4M00A 3AP6A 1YXWA 4N53A 3QLQA 4DRRA 1VBC2 2DTYA 5DZFA 2YROA 4WVVA 3NVCA 1NCRB 1RUI1 4HN1A 1LHOA 2YGMA 3Q9OA 1W6OB 2WZR1 4R9AA 2OUHA 1ZZCA 4NHMA 4XMAA 3WQ7A 3OYWA 4JGZA 2YPJA 3ZXEA 4D69A 4XIKA 1NCQC 1F9KA 1RUI3 3SNMA 2EAAA 1VRH2 1NYWA 1GANA 2WZR3 3IDBB 4FCAA 4YZ2A 3HWJA 4BWOA 3SCHA 4ITCA 5IT6A 2X8KA 3OD4A 5JZGC 1YHFA 2RE9A 3TN92 2OYZA 3FLTA 1D4M2 2WC2A 2YY1A 1U5XA 3M3QA 1AL22 2VW0A 3ZXDA 1W6NA 4YLZA 2HWC2 4ATFA 4P9JA 2E63A 4YZ1A 2GC0A 1HDKA 2OZ6A 2ARXA 2ES3A 3VHNA 2XLAA 1O3SA 1OOPA 1LGCA 4LA3A 1VBE1 1NCRA 5FFOC 2WZPP 5JSRA 1AR81 2VW1A 1W6OA 4PBPA 4PDWB 4RQPB 2E7TA 5C8CB 4XJWA 2ZHNA 3SXWA 2D7FA 2Q5TA 3AP5A 2RJKA 3H7YA 2WLPA 5J3UA 4AQTA 4E4ZA 1IKQA 1LOFA 2QE3A 1VBE3 5BNPC 1AR83 1LESA 4FO9A 3FLRA 4JQRA 1W0OA 1HX6A 2A5ZA 3AP9A 1RMU2 1OFNA 4KBBA 2P2KA 1FMD2 3BIWE 4BIFA 5SV8A 3ZFEA 1W6MB 2XL7A 1LU2A 3RYPA 4EWEA 4HFSA 1REDA 3ZSKA 3JD71 5LRSA 2HWF2 3WP4A 1AR61 1ZA4A 2VG9A 4WM8B 4H14A 4GQ7A 1VAMA 5KXEA 4Z1VA 3CJIB 3WW1A 1UU5A 4O9EA 1VAKA 5ACA1 3VLBB 1ULFA 1KS5A 1UL9A 4JRAA 3AX4A 2DCYA 2XWBB 4Q4Y2 4U36A 3JD73 1WCDJ 1EPZA 1AR63 1VBA1 1PK6C 3GF6A 4HSJA 1ZBE1 4XHXA 1BQPA 2BGCA 3ENRA 1F31A 1SACA 1XE8A 1NA1B 5ACA3 1XYOA 3M3CA 5H9QA 4HBNA 1NQJA 4LBJA 3AMNA 1Z7S2 1ND3C 1JYIA 3ASIA 3RI9A 3VHPA 1KD7A 1MQTA 4XFHA 1VBA3 4P14A 1ZBE3 3NW4A 1HQWA 4QHBA 2HKXA 3MEPA 4JGYA 5BNOC 1BBT1 1O5UA 1UIJA 4M3CB 3MIBA 1QH6A 1AVBA 4KWLA 4XQ4A 1WBFA 2O8OA 2DVGA 4I0WB 2VNRA 4W6XA 4FOYA 2CGOA 2MEV2 5I0SA 3CJIA 3IWZA 3AMQA 3VL9A 1PHMA 3LGRA 1BBT3 5AVAA 2ZA9A 5K7PA 3C2UA 3VZKA 1FOD2 2D97A 1ND2C 1OSGA 1WMEA 3ZXJA 2DV9A 3B00A 4GMP0 2ZGPA 2V73A 4YSFA 4AFAA 1CAWB 3R4UA 3MFCA 1VBB1 3AXEA 5KC5A 1GZ9A 3KS7A 2ZGKA 3K51A 1RGSA 2ZAHA 5JWPA 1RUE1 2CAVA 2VVEA 2EXKA 4XF9A 4XFCA 3NAPB 2UU8A 5JZGB 1OKQA 2OPKA 4IETA 2RM21 1DIWA 1J58A 1DGRN 1VBB3 5JVVA 5EV7A 1EP0A 4FXKB 2K9ZA 2BWAA 1RUE3 4YGBA 3M2MA 1NXMA 1RUC1 2BQPA 3ZXFA 1PMIA 3J8F2 1TMF1 1ULEA 3AYAA 1WA4A 2QVSB 2RM23 1I1EA 4XFBA 4DY5A 4GWMA 5JCTA 4UW3A 1L3JA 5EWSA 2C0ZA 4ATEA 1NQDA 1VP6A 3E5XA 1RUC3 4META 1PNFA 4FOQA 3FUQA 1TMF3 1NCQA 3VBRB 3OGGA 4AGVA 5BNPB 3UK9A 3LA3A 3RMYA 1X82A 2Q1ZB 1QJU2 2CWMA 3FE5A 2VOXA 4S2FA 2D40A 3N7LA 2E6VA 2Z69A 2NP0A 1DYPA 1PO22 2FBEA 5JZGA 4NHKA 3AYDA 1V6KA 3FFQA 2AZ5A 3DPRC 4Y1VA 2I45A 2C1FA 3VBUC 3KSCA 3JBG2 4YW5A 4FPEA 3QOPA 1AR72 2ZX0A 3AFGA 1CAUB 4YG0A 4L11A 1BMV2 1DBNA 2GC1A 5KXBA 4AK3A 3WINE 1ULCA 2G9GA 1BK1A 4FTBA 1OQDA 1LU1A 1SFYA 4DZGA 2RS31 2PHDA 1PK6B 5DUWA 2ZTNA 1AX2A 4KH9A 3N4MA 5JI7A 5GLTA 5B2GB 1DZQA 3KCXA 4XXPA 2DUQA 1G9BA 5I0UA 5TSWA 1ASJ2 5BNPA 2VOWA 2ZGLA 4MGKE 2OW4A 4GB32 3JZVA 2TUNA 1ND3B 4YGCA 4R8HA 2GNTA 2ZGMA 3A0NA 4DY3A 2RS33 5KXDA 3PMEA 3HBZA 4DQAA 1TNRA 1ZBA1 2NQYA 5DG2A 4KQ7A 4N7UA 3ZO0B 2Y0OA 3S7EA 4OUSA 3ZSEA 1CAUA 4Y1XA 1ZBA3 3WZ1A 1PO12 1LODA 2R1DA 1H8TC 1RHI2 2R32A 4K40A 3PLQA 3A0KA 4YM3A 4UW6A