2O8OA

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
110
Chain Sequence
KLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Induction of stable beta-sheet by Ca2+ in Clostridial collagen binding domain
rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
molecule keywords Collagenase
total genus 30
structure length 110
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2006-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o8oA00
3JQXA 3JQWA 4HPKB 2XVGA 5FAXA 5FBZA 1KFXL 4DY5A 4DZGA 4DY3A 1KFUL 2XVLA 2XVKA 1U5IA 2QFEA 3DF0A 1QXPA 4I3GA 1DF0A 1NQDA 2O8OA 1NQJA 1WMDA 3BOWA 5SV5A 4DXZA 1WMFA 4G9SB 4HPKA 2LUWA 3AFGA 1WMEA
chains in the Genus database with same CATH superfamily
3RWNA 2WWSA 3CDZB 3T1LA 5F6LB 2IWGB 4EZ4A 1DYKA 1IQAA 5FYIA 4CE8A 2Z5WA 4S2DA 5JXJA 1LOAA 1WBFA 1ULPA 1HRV1 2X09A 4Q4Y3 2C0ZA 1SQ4A 2KA3A 4P08A 4PHZA 1KJLA 2P37A 1S55A 2HWB1 1D4M3 5JI7A 1SBEA 4K1YA 4IE4A 4JTOA 4OI0A 3MBWA 1LOFA 1UD1A 3OSDA 4ATEA 4EV0A 1QXJA 3IN9A 5CFCC 1G7YA 5ABJB 3C7EA 2Q5TA 1CAUB 3A22A 4H55A 2Q8EA 4CDXA 5JI9A 1QJX1 1DZRA 1GQPA 1HRI2 3BOWA 5IVFA 5SV5A 1COV3 1UU4A 1ENQA 1W8NA 3ITQA 5EPAA 4XHBA 3FBYA 3WG1A 3ZIXA 4LO7A 1YLLA 1LRHA 4BISA 4AOCA 3BKZA 3UL2A 3FJSA 1ZBA3 3G6JB 1UMIA 1K5MB 4YARA 3VKLA 3MW4A 2ZGUA 5JCTA 1UY1A 2FMDA 2QQMA 2VNGA 2GMEA 1OPMA 3S5QA 5K0UC 1A78A 5F9TA 2WFF1 1UXZA 3U10A 1UYYA 5CAZA 5F7UA 4R4XA 2B46X 5HCFA 5A7WB 4AAPA 1W9TA 1D2SA 2TBVA 3GBGA 1FYUA 5FZAA 4LO5B 4YG0A 3IAPA 4CCMA 3OEBA 5H9SA 1RUF2 3C7HA 3F2ZA 1Y7BA 3OPTA 2B7YA 5LATA 4JHTA 2ZHLA 1YFWA 3MV11 2DUOA 3DYPA 1FPN3 1X36A 4E8CA 4LOSA 4LNVA 2GH2A 1T6GC 1RMU1 2WAAA 1DGRN 1S2EA 4TSVA 2FDFA 3HNYM 1WD3A 2BZDA 1C8M2 2ZHKA 5CKNA 2Q1FA 5HCBA 4XABA 3ZMOA 2WLPA 3P3NA 3HQRA 1ASJ2 5CA6A 3L2YA 5C3PA 4Q29A 5FZEA 4AK3A 3NKGA 2VZQA 3VZKA 3NSTA 3HWJA 3KGLA 2K9ZA 4P14A 3GCXA 4OHZA 1LULA 4ZONA 1UW8A 1GZWA 1Y9MA 1IGOA 3VBOA 4Q4W1 1HB4A 1OOPC 1HQWA 3POBA 4Q0PA 5A6QA 5DN2A 5EWSA 4A2UA 4FT8A 1FV3A 3S7IA 2XVGA 5FJHA 2MEV1 1Q3EA 1SLBA 2ARXA 3KCYA 4HBNA 4M0NA 3T0DA 2VZ3A 1UOBA 1L3JA 4AVCA 4KQ7A 2VZ1A 1XPWA 2R1DA 5JZGA 2A71A 3KT4A 4XF0A 4JKKA 3WSOA 1W0PA 1LHWA 4QXCA 4CEWC 1CZVA 5I0TA 2QFEA 1AZDA 4ZXKA 4RGGA 5CFDA 3PTRB 3BOPA 4FXGB 4C8DA 1VMJA 1BHGA 4PBOA 1W99A 5IVYA 5BNPC 2D6NA 4DNYA 2W91A 4NHLA 3WF0A 5KXCA 4RGAA 1OKOA 4BA6A 3DKWA 2XB6C 3I49A 2FBEA 2HWF3 5AVAA 4MG2A 1A8DA 4WVMA 3D0SA 2BYVE 1HKDA 4LHKA 3DV8A 3JZVA 1RHI3 2QE3A 4JAAA 3TN92 2FDHA 3OD4A 3SCGA 2DVAA 2P3KA 3IDAA 1X33A 2DU1A 2BJSA 1C57A 3PTYA 4EN0A 3FUQA 4RHV1 3H50A 1AYN1 2D3RA 4CXYA 1WZXA 1PIV3 2FDGA 2QBXA 2ZA9A 3HD8B 1MQTC 2QQKA 5F32A 2ZGQA 3RRDA 5T5LA 1QXRA 2WA3A 4B4QA 4CUBA 1TEIA 4B8EA 2KD7A 3ZFGC 1WMEA 3JB4C 3JQXA 3HN3A 1VRBA 2BBAA 5F5QA 3ZXLA 1S0FA 1XOYA 2HWE3 2PLV1 1RGSA 3LFMA 1EPWA 3LDKA 3MICA 2JE8A 3N9QA 4JV4A 1CAVB 1GP5A 1OQEA 5K0UB 1HB2A 4NAMA 5FP7A 4P00B 4AZZA 1DU3D 1C8M1 3WD5A 1RUG2 1VBB3 2LTNA 5F1RA 4NVPA 2I74A 4NRPA 1C8NA 2BEOA 5C3QA 2D6MA 2VAUA 1V9U2 4BLIA 4YW5A 4HKOA 2B9UA 2PHFA 2GC2A 4RS5B 5FP9A 3WQ1A 5ABJC 5KXEA 3ACFA 4NPLA 4AVTA 1P8JA 3EHKA 4D3WA 3MPPG 4E2GA 3KVBA 4OI4A 1H6XA 4AW7A 1DIWA 3SMHA 4RHV3 4DS0A 1JZ3A 2PAMA 2IXLA 4FTBA 2LS6A 5JPNB 4CP2A 3QCWA 4JGYC 4YW2A 4HSJA 5GZGA 4QQHA 3K3OA 3C2UA 1MS8A 1Q8VA 4HMZA 2B45X 4OYUA 4UBGA 3ATGA 4Y1YA 1RMU2 2VNRA 4ZU4A 4AEMA 4I0BA 3QACA 4NIIA 1AHSA 2CNAA 1DQ6A 2JG9C 4Z82A 3M8LA 3OBTA 3VZJA 4W6WA 1CQ9A 4M01A 4P5HA 1UIJA 3VD9A 3OUIA 4OQ9A 1JODA 3VN4A 2FZ1A 4Q1RA 1IZ3A 2IXCA 4BQXA 3JD73 1A8MA 4RQPA 5T5PA 3M4FA 4LO8A 5FY7A 2WN2A 2O14A 4MXWA 1UYXA 1ENXA 1SHWB 3ORJA 4LBNA 4AXOA 4QGLA 1LR5A 3VD3A 5DAPA 2VE1A 3E6BA 3WDWA 1HN1A 3K46A 2JG9B 2RDNA 2XHNA 4B1MA 2OUJA 3WLUA 4RR3C 1PGL1 1GBGA 2D43A 1VP6A 2VQUA 3KZ4C 2MEV2 4FP2A 2ZCWA 3SH3A 4ZS2A 4PDWB 1AR83 1XNAA 2BW8A 4G3YC 4CTEA 2D6OX 3WF3A 4NWWA 1ND2B 2Y34A 1ZYBA 2VCMA 2XJRA 1GMMA 4YM2A 1UN1A 4XFCA 3SQOA 4XMAA 5LY1A 2WSUA 1BMV2 3PVBB 2QQVA 4WZCA 4QGNA 3U11A 3RI8A 3VLBB 1G86A 2UWCA 3H8RA 5AC92 2JD9A 3SEPA 5FPUA 2E51A 4UAPA 4XFFA 4DOUA 2AEYA 1CAXB 4OULA 2PA7A 1O4TA 1SCRA 4FQZA 3HPNA 3PURA 3OY8A 1DQ4A 5GKAC 3MO4A 4ITCA 2RE9A 2Y6HA 5GLUA 4RS5C 3H1MA 4GA9A 2FQPA 1QWRA 1KJRA 1VBE2 1RUG3 3PIJA 1H6YA 4YW6A 4D6QA 1W8UA 2CDPA 4JX0A 3MDPA 3RGBA 1Z0HA 1W8HA 2FHRA 2HWC2 4AFAA 2CY6A 4AE2A 4BQ1A 1GWMA 4FCAA 5F3IA 2D98A 5F3GA 4AHYA 5LA1A 5LRSA 2YU1A 4P9YA 5LWBA 3LQCA 3T08A 4V1PA 1YQCA 1QNYA 5BNNA 2GNTA 4AI2A 2R49A 1QGLA 4B1LA 2HH9A 1J3PA 3I59A 3IT8A 1MS1A 4UF0B 5IW0A 2DWRA 3FFZA 3AVRA 4IV1A 4LK6A 1MS4A 4UT5A 1H0BA 4BHPA 3CJXA 1O91A 1O59A 2IFWA 1CONA 4AI9A 3ZFGB 1DF0A 3LCPA 1X9PA 4BE3A 3BTZA 4QPGC 3LF7A 4LHSA 4MGYE 1EYBA 2YZ4A 3HN1A 1MQTB 1RUC2 3KHCA 4IL7A 1CZSA 3MLJA 3O7OA 4IEPA 5FMCA 4YZ1A 1NE4A 2OQ6A 1NAEA 5FZ3A 3C7OA 3VKMA 2Y6LA 3AL5A 1W9SA 2B4KA 1H1AA 5FBJA 4GWMA 3I97A 4RGKA 1DDLA 4CP9B 1PX3A 4HKLA 3VD4A 5F8PA 4QD2A 4QXHA 5F5CA 5FZ6A 5JXGA 5T5OA 2I45A 2N7GA 5SV8A 3WVJA 2E32A 2W52A 4ZZ5A 1F4HA 2JE9A 4MLOA 1HRV3 4W4ZA 3ZVXA 1O5LA 2NYYA 1YHFA 4UFHA 3ZN4A 3O1SA 2A1XA 1W2UA 3KCXA 1JTZX 3B02A 3WW4A 2NLRA 1WA6X 2PHWA 5FXXA 5KXBA 3WEZA 4YFZA 2VC9A 2IFRA 1NCRA 1O6UA 2PHTA 3NAPA 2GALA 5DAQA 5LY2A 5DQ0A 1AR82 3ZXAC 2RHPA 1H8TA 4CEWB 2QQUA 3LPFA 5KC5A 4BQWA 1MQTA 5FYUA 4FPGA 4TWTA 4CCNA 1RUOA 2YPDA 5A70A 2XVLA 3GDBA 4BJ0A 1RITA 1CIYA 4UW3A 1YXWA 2CWSA 1POV1 3MIEA 4AQ6A 3D6EA 4B4RA 5IHRA 1S0BA 2Q4SA 1NY71 3AP7A 5FPLA 5IFTA 2ZGNA 2VZTA 2BNMA 3GHNA 3WG2A 3POIA 4IV3B 1TME2 4OZXA 1C1FA 1DQ2A 4NPRA 4FOQA 3MHZA 3OUHA 2WS91 1AL22 3B94A 4KH9A 4UFIA 1VPHA 1JYIA 2EIDA 3OBRA 3O12A 4FXKB 1AYM2 1EV13 3JB8A 4XEZA 3FN9A 1OI6A 2D5FA 4EYUA 2VBPA 2VULA 2ZJCA 1AL23 4FTEA 1NA1B 4W6YA 1U5XA 1A3KA 1BZWA 1Z78A 3VDDA 5C5UA 1CIWA 5F37A 5CEHA 4OHXA 3WINE 2BRTA 1OLMA 2Q8OA 4ES8A 1PGL2 3Q8CA 3EQEA 1BXHA 1TMF1 3AMMA 4ONUA 1JH5A 1OUXA 5KXDA 1RMU3 3N36A 4MZUA 4LBQB 3SCFA 1NLSA 4QX1A 3DXUA 3K51A 4DUXA 2R0FA 3HBZA 2C4XA 3S6PA 1HQNA 1US2A 1IPSA 1I5PA 1S0EA 5HV4A 5BNOA 1XNCA 4ES9A 2XLFA 4QPGA 3N4MA 3WDTA 4UFKA 1UZZA 2JIJA 1ZRDA 1NCRC 2WT1A 1YEWA 1OKQA 1YI9A 1W0NA 1XU2A 2R062 3DPRA 4JDOA 4PLOA 3J26N 1QJX3 4XFHA 4ZU5A 3CO2A 1W06A 3ZXKA 2DVFA 5IVCA 5L19A 4OZOA 2R073 1NZCA 5FYCA 2RMU3 4KI5M 4P9GA 2W92A 4FPJA 4HG6B 1VBE1 4PIXA 2FDIA 1GOFA 1TQ5A 2NMOA 1ZBA1 2EICA 3AKPA 2XGXA 1FXZA 2J1SA 2E33A 2W5FA 3TEWA 5EJ3A 3POGA 1DGRA 1V6NA 4XDPA 1Z7S2 1W05A 4N7UA 1BK1A 3ZDVA 1RJ8A 5CFCB 4Y1UA 5ACA1 3BU7A 5K8SA 2RJ2A 3J9SA 3BTAA 1VRH1 5FAXA 1JZ8A 5I0RA 1PO11 2EVXA 4DRVA 2HEVF 1N1SA 2Y8KA 1GU3A 4FPFA 4JVAA 1PVC2 3RJ2X 4R52A 4D7TA 2J42A 4EQVA 1UY2A 1W90A 3KV6A 1DFQA 4GZ9A 3OGSA 5IVVA 5GALA 1RUF1 3JUUA 4PBPA 3TYJA 3ZXDA 5FY4A 4WM7B 2PAEA 1JYWA 1BLZA 2ZEZA 2WZPP 2ZGLA 4M4RA 3WNLA 3ZSLA 4FAGA 2VUJA 2XBO3 1JOJA 3PL0A 4RA0A 2IXIA 4WVVA 3GZTB 1SLLA 3ZYHA 5JOWA 2C9AA 2Q8CA 3WCRA 1WCSA 4QXKA 3ZYBA 5LEJA 1UWWA 1YUDA 4CXXA 3NV3A 2D97A 5FUPA 4Y1ZA 3ZYRA 4DQAA 1KS4A 4CCKA 1JHJA 3GJAA 4WVZA 3ZSKA 1KFXL 1JOPA 3WG4A 3DPRC 2VECA 4N53A 4DZGA 4H7MA 1ND2A 4EN7B 4KBBA 2CYFA 3I3QA 3WP3A 5J1XA 4YW7A 1WCQA 4B3NA 2YB7A 5LCWL 3HOBA 4DUWA 1B35C 2G9FA 3KT1A 3WP6A 1QQP2 5FZGA 4XILA 2W08A 5GZDA 4FPKA 2MPFA 4ASMB 5FREA 1QH7A 3ACLA 4Q4V1 2NMNA 5CBLA 4LEJA 5D21A 4XDQA 2XLAA 2BVVA 3ZIWA 5M0TA 4L11A 2VGDA 4DEQA 5FFOC 2EF6A 1PX4A 2R0HA 2WO3A 1QIQA 3ENRA 4MGKE 1FNYA 5KHKA 2Y26A 3AYCA 4QAWA 1R092 1HV0A 3C3VA 1XNTA 1LECA 1VBB2 4LKSA 2H6CA 4WM8C 4E27A 3RMXA 1ZVFA 5GLZA 2YGMA 4PLNA 2FCVA 4MV2A 5HXVA 3S57A 4Q0QA 2OQ7A 4IEXA 3OGGA 3DYOA 2RV9A 4QPWA 3RWKX 4E4ZA 4QKBA 5FO9B 1YQ5A 5BY5A 1JYTA 3WHTA 1OVPA 4AEDB 1O4ZA 2WS92 1ENRA 1XE7A 1G9CA 1QJEA 2Z69A 3TEZA 2W39A 4EE2A 3E5XA 1RUG1 3OGRA 3ZFGA 2NQYA 5IATA 1DQ0A 4Q4X3 1CAWA 1CR7A 2PELA 3JD72 5E16A 1RUE1 2W1QA 3WNKA 2JDPA 3RDIA 5DPNA 4YW3A 3KQRA 4BB3A 4O65A 2VTFA 2P34A 2DU0A 3M3OA 4R9AA 5C9AB 1OT5A 3MUY1 4CCOA 4UW5A 3T2PA 2WKKA 4BK4A 5I0SA 4XIKA 2IXKA 1EAH3 2AGSA 1VBD2 4KGQA 1WW4A 4YNIA 1RUI3 3OY8B 5JDBA 3GHMA 4CDWB 5J7MA 1R081 1N3PA 4BYYA 2FD8A 2J1TA 5CG8A 2WNOA 2OZ6A 3VDDC 3K4DA 1HDKA 4I01A 1OBNA 2JX9A 3LEMA 3R6SA 1VBA2 3T1MA 1VBC3 2UYBA 2XJPA 4L97A 4UXAA 4D6SA 3AYDA 3C8XA 3VGIA 4XDOA 2A6XA 2P3YA 2WNUA 4MOAA 3N9PA 4M00A 4HPKB 3ST7A 1JZ4A 2HLEA 1D2QA 4LMFA 2WQ4A 1REEA 4IE5A 2CV6A 2OPKA 5D1IA 2Y38A 3ZKUA 3O1RA 3I59B 4SBVA 4UF0A 5DZGA 3RS6A 1DG6A 3WF1A 4CDXB 1VAKA 3KGZA 1ZBA2 1LOBA 3PVEA 5JZGC 1NT0A 1G9FA 2JG8B 5F3EA 5FP3A 1J1TA 5JWPA 2OVUA 4QM8A 4QM9A 3ZYFA 3O1PA 2V4VA 1GQGA 1OA4A 4MHRA 5ACA2 2JDYA 2DURA 2HYXA 1D7PM 1U5IA 4P5YA 3NL1A 5G04L 2ET7A 4PT6A 1OF3A 2P5BA 3T2OA 1S0CA 1QY4A 4GQ7A 1QNWA 1SFPA 4ORFA 1UCXA 1RUH3 1UZ0A 2IUWA 2OT7A 4NIGA 2WIIB 2A3WA 1COV1 1QJY2 2W94A 1EUTA 5A3NA 1G9AA 1LAJA 3MYXA 4P9LA 2B5HA 1VIWB 3NNLA 3DKQA 4XC9A 1K45A 2DUPA 3K75B 3KWVA 3N3HA 3TNQA 1QXPA 3LKJA 5FY5A 1ODNA 3T09A 4KWKA 4N53C 4A42A 3NNJA 1Q8OA 3N7LA 1BBT3 2XMLA 4IEZA 4EN6B 4QQPA 5G05L 5LZ6A 1VBE3 1RVF2 1VB4A 2BGOA 1IKPA 3OJBA 1W2NA 3TAYA 4YZ5A 3NW4A 2V73A 2B9VA 3OBZA 1AJKA 4RQPB 2QZ2A 4XJ9A 5C8CB 3AMNA 4Q4V2 2HWF1 1FPN1 5IVJA 1RXGA 4GB32 4CZSA 5AC93 5FWJA 2VW2A 2A6YA 1SACA 1VRH3 2DVGA 2E7TA 4Q26A 4ARXA 2QQPA 4XZPA 3E5QA 2WZR1 4N43C 4YW1A 3VBFA 5JMOA 5FYBA 5JR7B 4LHLA 3M3IA 5BNNB 2AC1A 3CKHA 1HRV2 4AFBA 5D8AC 5A7PA 1RUE3 2WWJA 3TEXA 1TVGA 1VBA1 1LOEA 2Z42A 4IV1B 2WZ8A 1T6BX 4UI9L 2KXLA 3D5OA 4L92A 4XUNA 1HQLA 2OKXA 5IJRA 5CFCA 1CAVA 3WNPA 1RUI2 5FZ1A 3RG0A 3OOXA 2VD7A 2D6LX 1FV2A 1H2LA 3W9AA 3WXPA 3EJKA 1S4CA 1W6MA 3WDUA 3WZ1A 1BEV1 2CL2A 3OTFA 1UOJA 4BCUA 1F31A 2Q1ZB 1RUD2 1ND3C 1VAMA 3HT2A 3OG2A 4WVMB 3AVSA 4GALA 3T0BA 3V56A 5C9AC 1POV3 5A7QA 1GFF2 2P2KA 4GIQA 5FIXA 2VMFA 5IK4A 1ASJ1 4I3GA 3I3BA 5JAXA 3ZSEA 4RS5A 2TUNA 1IPJA 3IZOA 2YBPA 1S0JA 1W8FA 4F8AA 4F83A 3MZHA 1C8M3 4KMQA 4WM7A 2ZGKA 1PNGA 5L9VA 3LAGA 1H8VA 3RNSA 2E31A 2OIIA 1W6OA 3BN6A 4PIZA 4RD7A 2VTXA 1B35A 3BIWE 3CJIB 4Y5Z0 5FBZA 5F3CA 4HSLA 2BOJA 2WQZC 2XXZA 5FZDA 1RINA 2X29A 1R082 3HNMA 4FP3A 2FZ2A 2VCCA 2ZKNA 2WS93 3VBUA 2EIGA 2WNVB 5I0DA 1XE8A 3EXUA 1MVQA 3PIGA 1H2NA 4JGZB 5EQUA 1LGCA 4Y4YA 3M70A 1W6PA 2C9KA 3AKTA 1W6MB 3KHBA 3I3MA 3MFCA 4QX2A 4YGDA 2X8KA 2WZR3 2D93A 2QQLA 5FY1A 1GWKA 3VL8A 1JW6A 3VBFC 4NPMA 5IK5A 4KL1A 1X82A 3H7JA 2J22A 3PU8A 2CAUA 4XPVA 5DABA 1DLCA 1LHNA 1AYN3 1J1LA 3PUSA 2RS32 3LWCA 4QB1A 1H2KA 3DL3A 4UYBA 4AQ2A 4GKYA 1OXCA 1S1AA 3ACIA 1W8ZA 3B9CA 4QT6A 1BEV3 1TG7A 2R071 2YGLA 5FWEA 3RYPA 2G1MA 2HEYF 1CD3G 3I2DA 4IEWA 4NIDA 1ZRIA 1ND3A 3POEA 4K7JA 3I2OA 2A75A 2YDEA 2WFPA 4CVUA 3WHUA 1ZRFA 4JRAA 1YJKA 4N7IA 3VBFB 4DINB 2ZGMA 4FOWA 4LBJA 4DMIA 2CTVA 1AL0G 4XFGA 4YVSB 1DBNA 2JENA 4MGSA 2ILMA 3ZN5A 1NKGA 3WP5A 4WM7C 1X8MA 5FYMA 4BLJA 1ZNPA 2PXJA 4BIOA 2BNOA 3N9NA 5CFDC 2GC3A 2J1AA 2WNVC 4FAHA 5DZEA 4EWAA 1UNBA 3MF6A 3DN7A 1BVVA 3OEAA 4LUMA 4HLTA 1LHUA 1AR62 1IS3A 1DZQA 1GZ9A 1C1LA 1NXMA 3LEGA 2JKXA 3OYWB 5A7SA 2ZBJA 3RZHA 2QCSB 3ELNA 1SCSA 4NRMA 4ET7A 1J3QA 4NMIA 3LPGA 1YJLA 3AJZA 5ANQA 2D44A 4ZXEA 3H8UA 1MS3A 5JVVA 3ZXEA 1CZTA 4P02B 4IV3A 5IYYA 5I8TA 2BDRA 2RS51 1QDOA 5A7WA 2VQTA 1VMHA 3A7QA 1W6OB 3FWEA 4HN1A 1FI2A 1GANA 4NO4A 2FCUA 4JDMA 4FPYA 2HEWF 3FZ3A 5A3WA 4M3CA 2AENA 5L36A 1CJPA 1YQ8A 4ZHNA 3MIDA 2BFUS 1JZ7A 4XUTA 2RR11 2VUAA 1ZRCA 2BWAA 2HWB3 4GWIA 4I3PA 1VRH2 3A23A 3CIHA 4RFT0 1F2NA 3EMRA 1OLRA 1QDCA 1PVC1 2A5ZA 2X5IB 3DYMA 4FQ4A 4HXCA 4RSUA 5K4LA 2ET1A 5BNNC 1AR93 2DTYA 2WYFA 1IG0A 4PF5A 5F39A 4DFSA 4Q2FA 2VW1A 1SLIA 4Y24A 2X53S 1YRZA 2RMU1 2R063 3V0AB 4MX3A 3AP9A 4BMEA 3AZWA 5FZHA 3T4HB 3TNPB 1ULDA 5KHGA 5LA0A 4NIHA 3LIHA 5KWRA 2E53A 4IEYA 3ZO0B 3T30A 2CWMA 4KU7A 2ARBA 1GICA 3KVAA 2XQRA 1POV0 3PDQA 3T0AA 4N90A 3WG3A 1R1ZA 1I1EA 1NA1C 3I3DA 3NWKA 1SFNA 2G9GA 4LO4B 5BUVA 1V9U1 3ZFEA 1SDWA 3BPSA 3KT7A 1NE6A 5KHHA 1Q8SA 1HXS1 3J7NA 3WUCA 4XBQA 1O7FA 2OPWA 3USUB 4CUGA 4EN9B 4HK8A 4YSFA 3M3QA 1KDKA 5H9PA 1IS4A 5BPXA 2WO2A 3H7YA 4K21A 3GGLA 4XXAA 5CKQA 5BV6A 1AVBA 4IV3C 4HPKA 4XJUA 2WUHA 3AFGA 4N53B 1K3IA 2VUCA 3UGFA 4ZKTB 3OGJA 3VBRA 1XBFA 1RUF3 1UOFA 1G8WA 3UESA 4N9IA 2XHKA 2XJUA 5A1LA 3V0AA 4Q4X1 3J7MA 4AFDA 1AR71 1E5HA 4FFGA 1DYPA 1YNAA 1UO9A 4QQOA 1AUYA 2JG8A 5EP9A 4EROA 5HI0A 3HIFA 2ZAAA 4NE9A 1WGPA 4XE9A 4D6RA 1AF9A 1OH3A 3KM5A 5DDJ2 4UOJA 2DCTA 4Q0UA 3AXEA 4QHOA 3SEEA 1NUKA 5HBAA 2JB4A 5DAXA 2FMYA 4Z2AA 1UZWA 2UYAA 5C8CA 4FVVA 2J1RA 5LBFA 2ZX0A 5A3TA 3THDA 3SHRA 1GLHA 2QUOA 4GH4C 4M3CB 3USUA 5FPAA 4MGTA 2ZKLA 1YO8A 2RS52 5I8YA 1W3XA 2A6WA 2DUQA 5J3UA 4GJYA 4LBLA 4AYUA 4BQ3A 1OD5A 2H6BA 2JDHA 1D4VB 3THTA 3VBSB 3ZDSA 4DY3A 4IDZA 3B3QE 2WL1A 1F5JA 2JIGA 5E1RA 3ES4A 2VMGA 4F3JA 1GOGA 1XC6A 5TSWA 2XWJB 3GALA 2XWBB 1WA4A 4I09A 3ZX7A 1GWLA 3AMQA 1D0GA 3E6DA 5FV3A 2DDUA 5CADA 3AC0A 4HONA 4LK7A 1GQHA 4QPGB 4TLFA 5JLVA 2OS2A 1QOOA 3AZYA 3FBMA 2HJIA 2WABA 2UY9A 4XJWA 5DUVA 4CCJA 2EIEA 1OQDA 3BODA 1NLRA 1BBT2 4K1ZA 4FSJA 1PIV1 3ZFFB 3ILNA 4CDWA 4YRDA 4HVQA 5A33B 4BQ5A 3NRUA 2DVBA 3ZLIA 1UZVA 2RR13 1BCXA 4QX7A 4S2GA 2MNGA 2OX0A 1NLQA 4D7SA 5JR2A 3I2GA 2VCAA 2WNVA 3R0RA 4QQLA 5T55A 3BVCA 4YG6A 1NCQA 3I8TA 2QVSB 5LA9A 4X8NA 2PHLA 3VBSA 4JZRA 2DCYA 3D3AA 4P9WA 5FYSA 2W1SA 3LSDA 3H8OA 2WFF3 1RUJ1 3VBRB 5GLWA 4L99A 4E9KA 1G9BA 5CZKA 4S2HA 4W65A 4FPHA 3AJYA 5I93A 4PI0A 3ALQA 3K77A 4LLOA 4GULA 5IT6A 2PQQA 1KFUL 2XVKA 4WM8A 1FT9A 2IC1A 2VMEA 5JUVA 4QWNA 1V6JA 2ZACA 2FDJA 3HQXA 5FZOB 1ND2C 3KB5A 1PZ7A 3GF6A 2WZEA 2DCJA 2O8OA 4XZUG 1EUUA 3H3LA 4PI2A 4HKWA 2YPJA 5L9RA 2RVAA 1APNA 1LOFC 4RR3B 3P5BA 3M3EA 1AJOA 5JMCA 4LR4A 2YMZA 3NNMA 3ROUA 5ABJA 1RL3A 1B35B 3KCCA 3FLRA 4NN0A 3N35A 2GSYA 3LD8A 5KHIA 1IKQA 5FMOL 4CU7A 2GP3A 4Q27A 3U4XA 2ENRA 5FZFA 4PDWA 2VQAA 3G7DA 2ZX4A 3ACHA 2X05A 1PK6C 1W8WA 3AYEA 2VG9A 4H7LA 4AVAA 1YIPA 2DTWA 2L9LA 4XBNA 3VHRA 2ZZQA 4K3UA 4MGIE 2F4LA 4YW4A 3UKNA 4AF9A 1R1A3 4QX3A 2OXBA 3GNEA 1X8EA 4JDNA 1OH4A 2W2IA 3KS7A 4KWUA 3LOIA 4YFWA 2RDSA 4OLLA 1BKZA 5D2AA 2VMDA 1MZFA 1U5ZA 1H30A 2BFUL 5HPOA 3QLQA 1UY4A 1GNYA 4JGYB 4LKFA 1TME3 2HBTA 3GM8A 5T3NA 5APAA 2F6BA 1DGWX 5FXWA 4P9XA 3VZLA 4E2SA 5GZFA 1PO22 1HW5A 1BBT1 1XE0A 2BV4A 2QDNA 1LESA 1JU3A 1HLCA 1VE0A 2R061 3UJOA 4DO0A 5FPBA 2YHJA 2GNBA 2QNKA 1NCQB 2JECA 3C7FA 5CU1A 3GBFA 1JHNA 1BEV2 1LKNA 3KF3A 4CPBA 2VMCA 1PGW2 1C28A 1W2TA 1ST8A 1NQDA 3PJQA 4QHZA 5FLJA 3T2TA 2C1FA 5C6CA 4DIQA 1AYM1 2ZEWA 4Y3OA 2B39A 2ZEYA 1LCLA 2LM3A 2RS53 3RSJA 4XOGA 2RS12 3TRSB 1V9U3 5FY8A 1KITA 1OHFA 3K4AA 3IMNA 4LJHA 5IAVA 3GCWA 3WF2A 5J36A 1EPZA 1OLME 3LZZA 4XACA 2Y6GA 3B00A 2RM21 1UU6A 5C4WB 4Z1VA 1ULFA 2SBAA 4LXLA 5FYVA 5FTTC 3U14A 1UU5A 4XYXA 1W03A 5J37A 3O1VA 4LA3A 3ETQA 1OSGA 4MO3M 4CDUC 3F95A 2R6QA 4IETA 3SISA 1IS5A 2XJTA 2CGNA 3UKVA 2XUMA 4BU2A 1N1YA 4XUPA 4OVEA 5FJKA 5DG1A 2XUEA 2YC4A 4U2AA 2DVDA 1RUJ3 4EZHA 1RUI1 3LA3A 4D8MA 1J58A 4GD4A 3VHNA 3JBG1 2ADEA 3RZKA 1ZZBA 1R083 2VZPA 1K12A 5A3PA 3ZR6A 4DXRA 3RZGA 4IQPA 5GZCA 4RFRB 3N7JA 4MH0E 3URFA 1RJ7A 4QKNA 1OURA 2GC0A 4A3XA 1NG0A 2Y6FA 3LIGA 4FPEA 1PHMA 2VOWA 4Y22B 4AI1A 1W2AX 1EP0A 2ZMKA 4MHUA 3FE5A 4CA9A 3PVOA 2GN7A 4AL9A 1WW6A 5C9AA 1CAXA 2E9QA 1N1VA 1RUJ2 1Z7S1 3POFA 4QX0A 3OGVA 1DZTA 5L73A 1Q5OA 3SH5A 3VL9A 3ZM8A 3H42B 5BNPB 1W04A 5FYHA 3EB7A 2VXRA 2RJLA 1H4GA 1ZZ7A 2ZPXA 3H3ZA 3SKVA 5F2SA 1ZZ6A 4BDVB 1LODA 4AQTA 3OCPA 1L7RA 2JICA 4CU8A 4R9DA 4NHXA 5KBFA 4Q0VA 2IXHA 4QB6A 3H0OA 3BCWA 3I54A 5IUQA 3J8F2 2DCZA 3T4VA 1PO21 1SLAA 1GZCA 2WNUB 3DXTA 3LB9A 1F35A 3WQ0A 2HWB2 1UYZA 2NZ9A 3KLSA 1AR91 1NQJA 2DYCA 1OOPB 2V5DA 4P9IA 1W6PB 4PCRA 2A70A 3A0KA 4NAOA 2GNMA 2ADDA 5LA2A 4IXLA 2YFUA 1K5JA 3JBG3 3NJXA 4QKFA 3UETA 2ZAHA 1O3QA 4YVWA 1OA3A 4BXSV 4AGVA 3KD4A 3C7GA 1ENSA 2GMPA 4K6BA 2YG0A 3MIGA 2NM1A 1OLQA 4IEQA 4CDQA 5BNPA 2XPJA 2YY1A 3SLIA 1WW7A 1I9RA 5A33A 4OI2A 2VOKA 1GNHA 5EJZB 5L7OA 1N3OA 1QJZA 1ULGA 3ZOIA 2IVIB 4IERA 3WX5A 4QDQA 1HXS3 1RUC3 2EIBA 4NOTA 2JDZA 1I6XA 3MIBA 5ERLA 4IE0A 4MVTA 3N9OA 1O3RA 2W0XA 3AKRA 1WMFA 3K3NA 3W58A 1R1A2 5CG9A 2HWD2 3WT3A 5IFPA 5BNQA 1WW5A 2VR4A 4COZA 5AC91 1TMF3 4BIFA 1AR61 4K8FA 1UYPA 1WCKA 4ARYA 1ACCA 3NAPB 4DXSA 3JBG2 1XNBA 4UFJA 5I91A 1JBCA 2XBO1 3WNNA 1W28A 1BK0A 1XYNA 2BERA 1FOD3 3QD6A 5CB7A 3KSCA 1Y4WA 4O7XA 2GAUA 4YM3A 3LA7A 2HWC3 2NPIA 1TE1B 4I0WB 4C90A 5J98B 2D6PA 3U0ZA 2G9ZA 1RUE2 2R041 1RYYA 2ZS6B 3J8F3 5JSPA 3I2FA 2ZABA 3FFQA 2D6KA 4PIYA 4DRRA 2C26A 5FZOA 3AFKA 4META 3VB9A 4BXFA 3L9JT 4RR3A 2OA2A 3LGRA 1VBD1 4XQWA 1VBC2 5FLHA 3ZFEB 1YI7A 5FYZA 2CGOA 2D3PA 3P3PA 4IGOA 1V6MA 1UX6A 1VMFA 3QH7A 4Q4V3 2ETEA 5KHJA 1FMD3 2XOMA 4E4HA 2SLIA 2BGPA 4OMCA 2G4IA 2ZGSA 5FPZA 1JXNA 1XNKA 4C0BA 2VOVA 1S2KA 4AVBA 5A1AA 1AR72 3NMBA 2VU9A 4YGCA 5FZ9A 2GP5A 5E89A 1VJ2A 2QZ3A 3VBUC 2JKBA 1E5IA 1VLNA 2XH6A 2Q0AA 4TZDA 4A7ZA 1GR3A 4EWDA 5FYTA 4AHXA 4R4ZA 1ZA4A 4ZY9A 5JXHA 3VUOA 1RUNA 3D0JA 3S30A 4ASKA 1AR63 4XFIA 4OHYA 1QJU3 3ON7A 4JGYA 5BYNA 5F5IA 3NV2A 5FOBB 2Y0IA 2VZSA 4A44A 2WQ8A 1LGNA 1POQA 1W0OA 1HXS2 3OF1A 3VKOA 2W1UA 1W6NB 3IPVB 4Y20A 5GM0A 3E97A 2JG9A 3UV9A 1CX1A 5FLIA 2K2SA 1XQNA 4CU6A 2GZWA 2A7AA 4FPLA 4CP1A 3I7DA 3SKJE 1J84A 2VCBA 3POWA 4RHV2 2R043 2GMMA 1O8PA 3W20A 2ZGTA 2HWF2 3KF5A 4I2OA 1KRIA 3IDEA 3VBUB 1ZBE1 4COWA 1IPKA 1R093 2O0OA 5JIUA 2DCKA 1KD7A 3FLTA 4XJZA 3WDYA 4GXLA 2VOTA 4LITA 2I07B 2LALA 2YC2A 4I0AA 5JOXA 3ACGA 5KR7A 5C33A 1X7NA 1ULCA 2HYKA 4GMP1 3MIHA 3ZPYA 3R4DB 1AXKA 2XJVA 4AGRA 4TTGA 5CYYA 4PQQA 1XYOA 3INAA 1QQP3 1YFXA 2A3YA 4QX8A 4E2QA 5FYYA 5FZ8A 3RZLA 4CEYC 3ILRA 4I02A 2ERFA 3O5SA 3DF0A 4HVRA 1UAIA 1EY2A 1VAVA 2XDVA 3CF6E 3ZFEC 4E8DA 3HEIA 1SLCA 4QGMA 2F4PA 4LUKA 5EJ1B 1V6LA 4CP9A 1KQRA 1RUD1 4LBQD 3VHPA 5AFBA 4C0HA 1S2BA 4OI1A 1H1IA 2VMIA 3JCIA 5FRAA 3KV9A 1W6NA 3IPVA 4Y20B 4HFSA 5C3RA 5HCHA 1SBDA 2V09A 3I2JA 4W50A 3PUIA 3CQOA 3MLLA 1IHMA 2O8QA 2R042 5LW9A 1LEMA 1WLDA 1MEC1 2OZJA 2QQNA 3BUCA 4NHYA 4X6RB 3O1UA 1K42A 5A3LA 1PMJX 4TYSA 2RG4A 4URAA 3J4UH 2A3XA 2XKPA 2EAAA 3WDXA 2CGPA 3VKNA 3V65A 3I2HA 5FY0A 2PQSA 3NAPC 2R30A 5GZEA 3B01A 4A4AA 3SITA 4CCEA 5FQ0A 3VV1A 5IAXA 3H8XA 1IS6A 5T5JA 3LEKA 1STMA 2JD4A 3DCQA 3GBWA 4NRQA 4A7KA 3N9MA 3BU0A 4Y22A 3WV6A 3IAQA 1S0GA 3WUDA 2BPA2 2WBKA 3WDVA 1ZBE3 2XQXA 2JXAA 4Q4W3 1CGPA 2BBVA 4G9SB 1LNSA 1PIV2 3H1YA 1SEFA 1Q43A 2DBIA 3JQWA 3KQ4B 4YLZA 4W8JA 3MF9A 1KEXA 4Q5OA 1PVC3 4M0HA 4AVVA 5FP8A 3IIIA 5H9RA 2PLV3 3IBMA 1MR5A 1N3QA 1UOGA 4BOWA 4AAXA 1V6OA 1DHKB 2YFZA 4NJ4A 5CNAA 3WP4A 1HX6A 1UIKA 2FDKA 3TEYA 3FL7A 2EALA 4QPIC 4A7YA 5FMBA 5FCCA 2P6CA 5E88A 2UURA 4UFLA 3TWIA 3WW3A 4EWEA 5IK8A 3RZZA 4GH4B 2R072 5FK7A 4AHZA 4YM1A 4MSVA 5C71A 2JJ6A 1V00A 4JKLA 2OW4A 3PUHA 1W9YA 2H0BA 1HJFA 3CBNA 2ORZA 2X5IA 3DECA 2VH9A 4MXVA 2WNUC 4QMAA 1HRI3 3LE0A 2ZHNA 4J1XA 4NUBA 5IWFA 5BXXA 4QDRA 1JZ2A 3AK0A 2QQIA 5DUUA 1H9PA 1QHDA 2KM2A 1URXA 2GH8A 4LLFA 1UY0A 2QJVA 3AL6A 4XCBA 3RJRA 1UL9A 2YUEA 3MFAA 4FOVA 4URTA 4KU8A 1N47A 2QKDA 3BPZA 3S5AA 1AXYA 2W9XA 2CHHA 2GN3A 5LASA 2P4EA 1QKQA 3ZMNA 2WLQA 4FFHA 2XONA 3TB0A 3THPA 4H2AA 4J1WA 1ULEA 1HB1A 2C5DA 2E7QA 4XBLA 3VHOA 5A3UA 2PHDA 2ZGOA 1OA2A 5A3OA 4R8HA 1YYNA 4YWAA 3NV4A 4CRQA 3CJIA 1QJY3 3UGGA 1PZ8A 4W6XA 1ASJ3 2DFBA 2Q30A 1V0AA 2HWC1 2WYSA 3JD71 4QU1A 4PQ9A 5K9YA 2P17A 3FX3A 5EHDA 1QQP1 2ZOEB 1PK6A 1WWYA 4QPIA 3WQ7A 4ATFA 1BVP1 2A6ZA 2VPVA 2RM22 3D4KA 1O8SA 1ZX5A 3SC7X 4KWJA 2UU8A 2WDBA 3LFIA 2P3JA 3MW2A 5FUNA 1SPPB 1M06G 4E4SA 3X29B 4LBKA 5B4NA 1QMJA 1RUD3 4QXBA 3O0WA 5FZ4A 3M7AA 3PHMA 3VDCA 4CEYA 3OPWA 5FMOS 1UPSA 2PHRA 3IDBB 3HAGA 4YVWB 4XF9A 3RYKA 1E5RA 3CHXA 5A6XA 1MZ6A 2X5IC 3RZJA 1O3TA 3JXSA 1MPXA 3ZFFA 1CN1A 1ZA7A 1X9TA 2V5YA 4CDUB 3GYDA 3PLQA 1VALA 4XQDA 1PO13 3OUJA 4Q8LA 5B4XA 3LA2A 5EV7A 3RI9A 3AM2A 2VQ0A 2AH2A 5C4WC 4AQSA 3U07A 4ZS3A 3E6CC 5HCAA 1K5MC 4XIOA 5EZWA 4SLIA 1FOD2 3HR9A 2PTMA 4KNCA 2UY8A 3GZEA 4QPYA 1L7QA 2JDMA 3R4SA 3ZN6A 1REDA 3DGTA 4L2NA 4QB2A 1NZIA 4HZFA 3HBKA 3VKFC 1S0DA 1RIRA 1REFA 1IQDC 1S0IA 2R32A 1OQ1A 4QQ2A 3HMYA 2YC0A 3O0XA 3VDAA 3BB6A 1U5YA 3GXUA 5D8AA 1MACA 1PO23 1NCQC 1VBD3 2ZXQA 3QOPA 2WFF2 1Y9QA 3I3EA 1OFSA 3PU3A 3PMSA 4TN7A 1E5SA 2MHFA 1Y9GA 3VBHB 5LK7B 4XHXA 3PUAA 4OHWA 1F8VA 2E63A 4OMDA 5LK5A 1LJ7A 1JN2P 4Q4X2 3POJA 3UT0A 3TOJA 1UKGA 3BTYA 4HK9A 2GU9A 4BH9A 4B7KA 4NHMA 3WW1A 3NJYA 4YVSC 2ZX3A 3BI3A 5C5TA 1W2OA 1SBFA 4GWNA 3CZUA 4UW6A 5FZ0A 1JOBA 3K2OA 5T52A 4F7ZA 1SZBA 5FK8A 2Y6KA 1E57A 1MS5A 3MLKA 4O9GA 2ZX2A 3P1IA 2KR2A 1GUIA 4XFAA 3NJZA 4XF4A 1W6QA 2VZUA 3L2HA 2XL9A 3I2KA 5JSRA 1Z7S3 5DUWA 3J7LA 4LHNA 1PK6B 1QH6A 1ZZ9A 2Z79A 5FO8B 4OUEA 4MGZE 4YG3A 2WN3A 3WY6A 4R9CA 5H9QA 3SNMA 1U0AA 2OYZA 2ZMLA 4GKXA 4G4FA 1K5MA 5DG2A 4DEVA 1SLTA 1OC1A 1OFNA 1GOHA 3PVNA 3ZYIB 3GZUC 1GP4A 4S2FA 1L7LA 1CPNA 3CU7A 4K20A 4UBHA 3PMEA 2JEMA 3AP5A 4GB31 1AYN2 2PHXA 3POYA 3UJQA 2AYHA 3EBRA 1XXNA 4NR1A 2VY0A 4Y5SA 3UK9A 2ZZJA 4D0QA 5IK7A 1OUSA 2W3JA 2WZR2 1COV2 1QJY1 4V2WA 5LBCA 4KG0A 1CVNA 2VBDA 1GYKA 2WA4A 2HWD1 3J8F1 3ZXJA 1ZZCA 1AX2A 5FY9A 3RVHA 2JE7A 4ISQA 1V6KA 3QBQA 3ZYJB 1C3HA 1UX7A 5AFEA 2PLV2 2VW0A 2QTWB 1G6NA 3CJIC 1N1TA 1QEXA 1CWPA 1TME1 4I30A 1DQ1A 4AEDA 2MEV3 2XBO2 4LKDA 5DZFA 2BU9A 3N7KA 1YQ6A 2ID4A 2FCTA 2CU5A 1W8OA 3THCA 3VBRC 3ZN6B 1PNFA 3O14A 4JRLA 4XFBA 2Q8DA 5C70A 5KC6A 4Y1XA 4N8MA 3NO8A 3PJYA 1BQPA 4DB5A 1RVF1 4HOOA 4K9SA 5EIYB 1B09A 5FUIA 5JSOA 1X50A 1NXD1 2HBUA 3AMHA 3TN91 1KDMA 4DUVA 4CCLA 4ZU7A 3UNPA 2WSVA 4K8RB 4DPNA 2YXSA 4XVHA 4LA2A 3VBOB 2YV8A 1LHVA 5F6KA 1FPN2 5AVPA 1XB9A 3MPBA 4COVA 2GC1A 2PFWA 2ZEXA 5FP4A 1V6IA 3MIFA 3ZFFC 4NHKA 4H14A 2E26A 3U78A 1WCUA 4CYDA 2VNOA 2XJSA 4IV1C 1JU4A 1PGSA 1YCIA 1ZRRA 4LQRA 4MUVA 5B2GB 2ATFA 2W46A 2W68A 4HL0A 4GH4A 2YROA 2DV9A 2VVDA 4QKDA 3DUIA 4N43B 4ZZ8A 4AR2A 5FPVA 4BQ2A 5FZBA 4JCKA 3Q8FA 4YVSA 5GLTA 2JDKA 3GJBA 3OB8A 1ZZ8A 2ES3A 2CAVA 1OD3A 2PHUA 5LRRA 4IGPA 3B93A 5CVRA 4JQTA 1GNZA 3VDBA 2VXJA 3VBSC 5GLVA 4JHZA 3UKTA 1EAH1 1TNRA 1IOAA 3D82A 1WLCA 3CMGA 1SMVA 1XSRA 2P6HA 4IEVA 4YYOA 1CAWB 2EXJA 4NIAA 4C1XA 2D7FA 2WRAA 4LO6B 4LIVA 4GMP3 5A1FA 5L9BA 4EN8B 5BNOB 4HN0A 1RVF3 1WKYA 1PZ9A 5C3SA 1VBC1 4CU9A 5A6ZA 3S0MA 2P1BA 2W1WA 2VL4A 1PVXA 4YZ4A 3FHIB 1ZBE2 1I3HA 4AI0A 4Y4RA 1H2MA 1C4RA 4N43A 3SCHA 1LU1A 1AXZA 3MI8A 2RDRA 4QX5A 1D0HA 3I4IA 4X8PA 4XURA 3ZKYA 1UXXX 4L8QA 1AYM3 3RPQA 2F17A 1BMV1 1RXFA 1J3RA 3MW3A 4QHBA 2ARCA 2Y0OA 2ZTNA 4Y33A 4J6GA 1DGLA 2WC2A 1BJQA 4IUGA 3D8CA 1OOPA 2WO7A 1Y43B 3IMMA 3U75A 3ZYPA 2V72A 3KMHA 4XXPA 1H8TB 5BNOC 4FFIA 4FI9A 1OF4A 1AR73 2VZVA 2RS31 5EFUA 1AX0A 3B5LB 2B8MA 4LOTA 2ORXA 4A3ZA 3EYPA 3R05A 4KGGA 2XLGA 4UFMA 2H0VA 3I2IA 3WCSA 2RS11 3NJVA 4CSWA 3SH4A 3AP4A 1OPOA 3WW2A 3E5UA 1I5ZA 2Q1MA 1F15A 3BGAA 3S7EA 2ZGPA 5L7OB 3Q8BA 4ZPIA 4Z2WA 5J09A 2QQJA 1JUIA 3UYJA 3WF4A 5C8WA 2JDNA 1FAYA 2PYTA 2R7EB 1JMUB 2YBKA 2ZGRA 2YU2A 1TZOA 2X10A 5FZ7A 3WQBA 2A6VA 1KS5A 5EYYA 3VDDB 3AXDA 2ZHMA 2CSGA 1RTVA 4CDWC 4Z92B 1VB2A 2WR9A 2RJKA 1D4M2 3R4UA 4C91A 2J1VA 2XJQA 1DP0A 3HVDA 3APBA 3FC0A 2BQPA 4GJZA 4BQ4A 4XJAA 1XNDA 4CEWA 1YWKA 3N9LA 2BNNA 4XTPA 4XW3A 5K0UA 4FOYA 1SG3A 1HRI1 4QDSA 2VBBA 5EXOA 1EAH2 2BOIA 1J83A 2TEPA 3UGHA 2AREA 5A80A 1IG3A 4FFFA 1HJGA 1JUHA 4Q4Y1 3BALA 3W59A 5LEKA 1Y3TA 1MZEA 2QQOA 3CLPA 3OPZA 5LBBA 3U37A 5CKMA 2BP6A 2EA7A 4LPLA 1GSLA 4XMIA 5DAVA 4CDQB 2WWUA 5DMYA 4AEDC 1CX4A 3M1HA 4IEUA 4CDUA 4WZFA 2VJXA 1ZM1A 3ES1A 4K40A 3POSA 2RR12 3H3UA 3U1XA 2DBNA 3J7HA 2YYOA 1ZREA 1U12A 3IWZA 1YQ2A 4DXTA 4IGQA 1H1MA 1OMIA 3B7MA 4OFGA 2EXIA 2W47A 1DYOA 2VZRA 2E7AA 3NVCA 3O0VA 5CFDB 2NN8A 4AI3A 4BWOA 4CCCA 1FMD2 3AZXA 4LBOA 1HB3A 3WR0A 4INDA 2Y64A 4Y5TA 1ULOA 1J59A 1LTEA 4YZ3A 4H3WA 4FTSA 4D7YA 1C5IA 1NY72 2CDOA 1C5HA 4B7EA 3V0BA 3HNBM 1WD4A 2LUWA 5A3MA 5A6YA 2VNVA 1AR92 1NX9A 3AB0A 2WINB 4LE3A 2BTVC 4AG4A 1AL21 3Q9OA 2PMWB 4CUAA 5FXZA 4JQRA 3RFRA 1GZTA 3LSEA 2BUKA 5HV0A 3DPRB 5A7OA 1JYCA 1UMZA 1WCDJ 2WJSA 4CXWA 3U4SA 2W87A 4OHVA 1VR3A 5HXMA 1QJU1 3AMPA 4XETA 1WMXA 2VMHA 3IB3A 1TMF2 2UWBA 1SFYA 1HIXA 3VZMA 3USSA 1PM4A 2XKOA 3JU9A 3CZJA 1WUVA 3H9AA 4JGZC 4MYEA 4R9BA 3WOGA 5FZKA 3ILFA 4FBFA 2XG3A 1R1A1 2J1UA 2BGCA 2PAKA 1YIFA 2VOXA 3VBHC 3V0BB 1SPPA 5JIAA 1F4AA 1UQXA 3OBAA 3V64A 4XAAA 5FZMA 4A6SA 3ETPA 5DDJ1 1HN0A 4QU2A 2B42B 4COYA 4IW3A 3FMGA 1JI6A 3OD0A 1DQ5A 2EXHA 5IVEA 5LBEA 4Z07A 3GZAA 2D40A 4XAEA 1O5UA 2XL7A 2IZWA 4CDQC 1WMDA 3VD5A 4B4PA 2C24A 4NROA 5JOYA 1UMHA 2J7MA 4C1WA 3IDCB 1NYWA 1RHI2 4CPBD 3BTXA 1PMHX 4FPCA 2AR6A 2Y60A 5ANNA 1XU1A 4COUA 3PUQA 4XCAA 3O1MA 5FOJB 1ND3B 3K48A 1PMIA 3MV01 1BYHA 2AACA 1UF2C 5F5AA 2XR4A 4NWVA 4UWDA 4AFMA 4BQYA 4PJYA 3DEMA 3H1WA 5JXIA 1HV1A 3QH6A 3Q8EA 4X6QB 5FO7B 4JC1A 1XJAA 1AX1A 1NCRB 1GP6A 1PO12 4GAZA 1ODMA 2QDRA 4RYDA 3RYRA 2EXKA 4XF3A 2TNFA 3AZVA 2QQWA 3KV5A 1FNZA 1Q8PA 4IEOA 5D8AB 3ABZA 1UPIA 4YVWC 1XSQA 2C6SA 1W9FA 4IE6A 1PM7A 3MEPA 4Y1VA 4AHWA 4GB33 4AWDA 4BK5A 4KWLA 5JOZA 3AYAA 4AGGA 2JWPA 1A6CA 1D4M1 1O4YA 1OVSA 3LEIA 5C3OA 1QOTA 4AEJA 2LROA 2VVEA 2WNEA 2YBSA 1YC61 2AEZA 4UW4A 4L9BA 1WBLA 1R64A 3MUZ1 4BZ4A 5FXVA 1F9KA 5C8CC 3B69A 2RM23 5LB6A 5L7OC 4MXWB 1LENA 1RUH1 4RQPC 5DUXA 5FDBA 1RB8G 3FHAA 2JDAA 5DXDA 4TXWA 1FOD1 1GV9A 3RZMA 2LRPA 4YPJA 3VZOA 3LOBA 1MS9A 4Q4Y2 4KBZA 1Q56A 3TBDA 3BYWA 3RMYA 2HWE1 1QOSA 3NKTA 1ALYA 2HWD3 3AKQA 5EYXA 5I8SA 1XYPA 1W6QB 5FR3A 3T2QA 4A45A 1H8TC 2K46A 1EV12 3IM0A 4MGQA 1JS9A 1QJU2 1W39A 3IKWA 1NA1A 4GMP0 4M4PA 4J25A 4LIUA 5ISLA 1XRUA 5A32A 4LBQA 4B29A 4D69A 3Q8AA 4LKEA 1LHOA 5C7GA 5FQ0B 5J48A 2V4AA 4XTMA 3AZZA 3FUOA 4L0PA 4LULA 5JPMB 4CUCA 3ZSMA 5T50A 2GNDA 3VD7A 1FMD1 2VO5A 1JZ5A 2VZOA 4XQ4A 1JYNA 5C4WA 3WNOA 1GZWB 4ASLA 3A4UA 4OUMA 1JYVA 3HT1A 3VBHA 5FKCA 2O1QA 1VBB1 1LOGA 4LORA 4XUQA 5FKBA 2WO1A 5ACA3 4JKMA 1MEC3 1WLWA 4WV8A 5DAWA 3W21A 2G19A 3BIEA 3A21A 1LU2A 5FZLA 2VVFA 2RS33 1LOCA 4WBBA 1LB2A 1GKBA 2ZX1A 1M4WA 1MS0A 1QJX2 2WT0A 2JG8C 1KXGA 1UKRA 3CNAA 4HVOA 4JTNA 4O9EA 4P9JA 5F2WA 1ONAA 4A41A 4KG8A 1G9DA 5JZGB 2RDQA 4MADA 2Z4FA 1W3VA 1W8TA 4QPIB 4DY5A 4CDXC 1MZ5A 3NNGA 1MEC2 2ZMNA 5A32B 2UWAA 3ZSJA 4OQ8A 1QU0A 2AZ5A 4JGZA 4PF1A 2E6VA 1H9WA 4XUOA 5A7NA 1VBA3 4Q0SA 4CCDA 3ZYGA 3ASIA 4BM8A 3W5MA 2PN5A 5T54A 1CJDA 2Y6JA 4AEKA 1A34A 3HJRA 5K7PA 2IVJA 1R091 5FPXA 2JDUA 3O1TA 1F5FA 2ARAA 4FPOB 5FZIA 2WAOA 4LT5A 1FX5A 4HETA 4A6OA 4Q1PA 5CIRA 3FLPA 1RUC1 4IE7A 4RL7A 5I0UA 4YGBA 3IIAA 3O1OA 3WNMA 2NP0A 3EO6A 4Y26A 1US3A 1DGWA 1QJFA 4BPZA 3VBOC 1PGW1 1RUH2 1WLTA 4BMBA 3TN93 3NQHA 4GWJA 4YM0A 2VUDA 1O3SA 1RHI1 5IVBA 4HANA 3AKSA 1CPMA 4AI8A 2LW8A 1QF3A 1LGBA 1CAUA 1KGYA 1YFUA 2VTXJ 2W95A 4U36A 5GJ6A 4DXZA 2P3IA 3SXWA 3K4ZA 1YFYA 3HQUA 3N7MA 4M3CF 4XJ8A 1UZYA 1H4HA 5FMDA 3NNFA 1RC6A 5J96B 2Y33A 5E8AA 2Z2SB 3P6BA 4O61A 4RN5A 3ZXGA 4CEYB 4PLMA 4ISRA 3ME2A 4YZ2A 2OUHA 4WM8B 4YGEA 2JB8A 3OYWA 2AUYA 2IXJA 4AVSA 4M3CE 3ZPOA 4XF1A 2BWCA 4OCTA 2BVBA 2R1BA 3E1F1 2RMU2 4Z8BA 1MVEA 4TLGA 2RS13 4AFCA 2D5HA 3RQ0A 1UY3A 4PDWC 4LTAA 4Q8KA 3M3CA 5DDJ3 3NV1A 3VZNA 1W9WA 1TNFA 3LDRA 1FATA 2HKXA 1Q8QA 1JZ6A 2GDFA 3WNXA 2DF7A 3AP6A 3LDBA 3PNAA 4OUSA 1DCSA 3CL1A 3AX4A 4HT1T 4LE4A 4EJRA 4IESA 5FZCA 5E6HA 1V70A 2I2SA 2HWE2 3MGUA 3T3YA 3ZXFA 1CESA 2WT2A 4LBMA 1JYXA 4D94A 3W5NA 3A0NA 2D3SA 1SDDB 1EV11 2VM9A 2EAKA 2J1EA 2DFCA 3CEWA 4Q4W2 4WVWA 1LEDA 3FHQA 4E4DX 3KV4A 1NOVA 2K0GA 2A73B 1T2XA 5CISA 3ECQA 2R16A 4N9HA 4V2VA 4FO9A 4CP0A 3M2MA 1AR81 3B9IA 1DLLA 3ZR5A
chains in the Genus database with same CATH topology
3RWNA 2WWSA 3T1LA 5F6LB 2IWGB 1DYKA 1IQAA 2Z5WA 4S2DA 1LOAA 1WBFA 1HRV1 4Q4Y3 2C0ZA 1SQ4A 2KA3A 1KJLA 2P37A 1S55A 2HWB1 1D4M3 5JI7A 1SBEA 4K1YA 4JTOA 4OI0A 1LOFA 1UD1A 4ATEA 4EV0A 5CFCC 1QXJA 3IN9A 5ABJB 1G7YA 2Q5TA 1CAUB 4H55A 4CDXA 5JI9A 1QJX1 1DZRA 1HRI2 3BOWA 5SV5A 1COV3 1UU4A 1ENQA 3ZIXA 4XHBA 3FBYA 3WG1A 4LO7A 1YLLA 1LRHA 3UL2A 3FJSA 1ZBA3 3G6JB 1K5MB 4YARA 3VKLA 3MW4A 2ZGUA 5JCTA 2FMDA 2VNGA 2GMEA 1OPMA 5K0UC 1A78A 5F9TA 2WFF1 3U10A 5CAZA 4R4XA 2B46X 5HCFA 1D2SA 2TBVA 3GBGA 1FYUA 4LO5B 4YG0A 5H9SA 1RUF2 1Y7BA 2B7YA 2ZHLA 1YFWA 2DUOA 1FPN3 1X36A 4LNVA 2GH2A 1T6GC 1RMU1 4TSVA 1DGRN 1WD3A 1C8M2 2ZHKA 5HCBA 3ZMOA 2WLPA 3P3NA 1ASJ2 5CA6A 3L2YA 4Q29A 4AK3A 3NKGA 3VZKA 3NSTA 3HWJA 3KGLA 2K9ZA 4P14A 4OHZA 1LULA 1UW8A 1GZWA 1IGOA 3VBOA 4Q4W1 1OOPC 1HQWA 4Q0PA 4A2UA 5EWSA 4FT8A 1FV3A 3S7IA 2XVGA 2MEV1 1Q3EA 1SLBA 2ARXA 3KCYA 4HBNA 4M0NA 4AVCA 1L3JA 4KQ7A 2R1DA 5JZGA 2A71A 3KT4A 4XF0A 1W0PA 1LHWA 4CEWC 5I0TA 2QFEA 1AZDA 4ZXKA 4RGGA 5CFDA 3BOPA 4FXGB 4PBOA 5BNPC 2D6NA 4DNYA 4NHLA 5KXCA 4RGAA 4BA6A 3DKWA 2XB6C 2FBEA 2HWF3 5AVAA 1A8DA 4WVMA 3D0SA 2BYVE 1HKDA 4LHKA 3DV8A 3JZVA 1RHI3 2QE3A 4JAAA 3TN92 3OD4A 3SCGA 2DVAA 2P3KA 1X33A 2DU1A 1C57A 3PTYA 4EN0A 3FUQA 4RHV1 3H50A 1AYN1 2D3RA 1PIV3 3HD8B 2ZA9A 1MQTC 2ZGQA 3RRDA 5T5LA 1QXRA 2WA3A 4B4QA 1TEIA 4B8EA 3ZFGC 1WMEA 3JB4C 3JQXA 5F5QA 3ZXLA 1S0FA 2HWE3 2PLV1 1RGSA 1EPWA 3MICA 4JV4A 1CAVB 5K0UB 1OQEA 1DU3D 1C8M1 3WD5A 1RUG2 1VBB3 2LTNA 5F1RA 4NVPA 2I74A 1C8NA 2BEOA 2D6MA 1V9U2 4BLIA 4YW5A 4HKOA 2B9UA 2PHFA 2GC2A 4RS5B 3WQ1A 5ABJC 5KXEA 4AVTA 3EHKA 4D3WA 3MPPG 4E2GA 4OI4A 4AW7A 1DIWA 3SMHA 4RHV3 4DS0A 2PAMA 2IXLA 4FTBA 5JPNB 4CP2A 3QCWA 4JGYC 4YW2A 4HSJA 5GZGA 4QQHA 3C2UA 1MS8A 1Q8VA 4HMZA 2B45X 4UBGA 3ATGA 4Y1YA 1RMU2 2VNRA 4ZU4A 4AEMA 4I0BA 3QACA 1AHSA 2CNAA 1DQ6A 2JG9C 4Z82A 3M8LA 3OBTA 3VZJA 4W6WA 1CQ9A 4M01A 4P5HA 1UIJA 3VN4A 2FZ1A 4Q1RA 1IZ3A 2IXCA 3JD73 1A8MA 4RQPA 5T5PA 3M4FA 4LO8A 4MXWA 1ENXA 4LBNA 4AXOA 4QGLA 1LR5A 3WDWA 3E6BA 2JG9B 2OUJA 3WLUA 4RR3C 1PGL1 1GBGA 2D43A 1VP6A 3KZ4C 2MEV2 4FP2A 2ZCWA 3SH3A 4PDWB 1AR83 2BW8A 4G3YC 4CTEA 2D6OX 4NWWA 1ND2B 1ZYBA 2XJRA 4YM2A 1UN1A 4XFCA 4XMAA 1BMV2 2WSUA 3PVBB 4WZCA 4QGNA 3U11A 3RI8A 3VLBB 1G86A 2UWCA 5AC92 2E51A 4XFFA 4DOUA 1CAXB 4OULA 2PA7A 1O4TA 1SCRA 4FQZA 3OY8A 1DQ4A 5GKAC 4ITCA 2RE9A 5GLUA 4RS5C 3H1MA 4GA9A 2FQPA 1QWRA 1KJRA 1VBE2 1RUG3 3MDPA 4AFAA 1Z0HA 2FHRA 4AE2A 2HWC2 2CY6A 4BQ1A 4FCAA 2D98A 4AHYA 5LRSA 4P9YA 4V1PA 1QNYA 5BNNA 2GNTA 4AI2A 2R49A 1QGLA 1J3PA 3I59A 3IT8A 1MS1A 2DWRA 3FFZA 4IV1A 1MS4A 4BHPA 1H0BA 3CJXA 1O91A 2IFWA 1CONA 3ZFGB 1DF0A 3LCPA 4BE3A 4QPGC 4MGYE 1EYBA 2YZ4A 3HN1A 1MQTB 1RUC2 4IL7A 3O7OA 3MLJA 4IEPA 1NE4A 3VKMA 1H1AA 4GWMA 1DDLA 4HKLA 4QD2A 5T5OA 2I45A 2N7GA 5SV8A 3WVJA 2W52A 2JE9A 4MLOA 1HRV3 3ZVXA 1O5LA 2NYYA 1YHFA 3ZN4A 1W2UA 3KCXA 1JTZX 3B02A 3WW4A 2NLRA 2PHWA 5KXBA 4YFZA 2IFRA 1NCRA 2PHTA 3NAPA 3ZXAC 2GALA 1AR82 2RHPA 1H8TA 4CEWB 5KC5A 1MQTA 4FPGA 4TWTA 1RUOA 2XVLA 1RITA 4UW3A 1YXWA 2CWSA 1POV1 3MIEA 4AQ6A 3D6EA 4B4RA 1S0BA 2Q4SA 1NY71 3AP7A 2ZGNA 2BNMA 3GHNA 3WG2A 4IV3B 1TME2 4OZXA 1C1FA 1DQ2A 4NPRA 4FOQA 4KH9A 2WS91 1AL22 3B94A 1JYIA 3OBRA 3O12A 4FXKB 1AYM2 1EV13 3JB8A 4XEZA 1OI6A 2D5FA 2VULA 2ZJCA 1AL23 4FTEA 1NA1B 4W6YA 1U5XA 1A3KA 1BZWA 1Z78A 3VDDA 1CIWA 4OHXA 3WINE 1PGL2 2Q8OA 4ES8A 3EQEA 1BXHA 1TMF1 3AMMA 4ONUA 1JH5A 5KXDA 1RMU3 3N36A 4MZUA 4LBQB 3SCFA 1NLSA 3K51A 2R0FA 3HBZA 3S6PA 1HQNA 1S0EA 5BNOA 1XNCA 4ES9A 2XLFA 4QPGA 3N4MA 3WDTA 1UZZA 1ZRDA 1NCRC 2WT1A 1OKQA 1YI9A 2R062 1XU2A 4PLOA 3DPRA 4JDOA 4ZU5A 3J26N 1QJX3 4XFHA 3ZXKA 3CO2A 5L19A 2DVFA 2R073 1NZCA 2RMU3 4P9GA 4FPJA 1VBE1 4PIXA 1TQ5A 2NMOA 1ZBA1 3AKPA 2XGXA 1FXZA 5EJ3A 1DGRA 1V6NA 1Z7S2 4N7UA 1BK1A 1RJ8A 5CFCB 4Y1UA 5ACA1 3BU7A 5K8SA 3J9SA 3BTAA 1VRH1 5FAXA 5I0RA 1PO11 2EVXA 4DRVA 2HEVF 1N1SA 4FPFA 4JVAA 1PVC2 3RJ2X 4R52A 4D7TA 1DFQA 5GALA 1RUF1 3JUUA 4PBPA 3TYJA 3ZXDA 4WM7B 2PAEA 2WZPP 2ZGLA 3ZSLA 4FAGA 2VUJA 2XBO3 1JOJA 4RA0A 2IXIA 4WVVA 3GZTB 1SLLA 5JOWA 2C9AA 3WCRA 1WCSA 4QXKA 5LEJA 1YUDA 3NV3A 2D97A 4Y1ZA 3ZYRA 4DQAA 1KS4A 3ZSKA 4WVZA 1KFXL 3WG4A 3DPRC 2VECA 4N53A 4DZGA 4H7MA 1ND2A 4EN7B 4KBBA 2CYFA 3WP3A 4B3NA 1B35C 2G9FA 3KT1A 3WP6A 1QQP2 4XILA 2W08A 5GZDA 4FPKA 2MPFA 4ASMB 5FREA 1QH7A 3ACLA 4Q4V1 2NMNA 5CBLA 4LEJA 4XDQA 2XLAA 2BVVA 3ZIWA 4L11A 2VGDA 5FFOC 2EF6A 2R0HA 3ENRA 4MGKE 1FNYA 5KHKA 2Y26A 3AYCA 1R092 1HV0A 3C3VA 1LECA 1VBB2 2H6CA 4WM8C 4E27A 3RMXA 1ZVFA 5GLZA 2YGMA 4PLNA 4MV2A 5HXVA 4Q0QA 4IEXA 3OGGA 5FO9B 4E4ZA 5BY5A 3WHTA 4AEDB 1O4ZA 2WS92 1ENRA 1XE7A 1G9CA 2Z69A 2W39A 3E5XA 1RUG1 3ZFGA 2NQYA 1DQ0A 4Q4X3 1CAWA 1CR7A 2PELA 3JD72 5E16A 1RUE1 3RDIA 4YW3A 3KQRA 2P34A 2DU0A 3M3OA 4R9AA 5C9AB 4UW5A 2WKKA 5I0SA 4XIKA 2IXKA 1EAH3 2AGSA 1VBD2 4KGQA 1WW4A 4YNIA 1RUI3 3OY8B 5JDBA 3GHMA 4CDWB 5J7MA 1R081 1N3PA 4BYYA 5CG8A 2OZ6A 3VDDC 1HDKA 4I01A 2JX9A 3R6SA 1VBA2 3T1MA 1VBC3 2UYBA 2XJPA 4L97A 4UXAA 3AYDA 3VGIA 2A6XA 2WNUA 4M00A 4HPKB 3ST7A 1D2QA 2WQ4A 1REEA 5D1IA 2CV6A 2OPKA 2Y38A 3I59B 4SBVA 5DZGA 3RS6A 1DG6A 4CDXB 1VAKA 3KGZA 1ZBA2 1LOBA 3PVEA 5JZGC 1G9FA 2JG8B 1J1TA 5JWPA 2OVUA 4QM8A 4QM9A 1GQGA 1OA4A 5ACA2 2DURA 1U5IA 3NL1A 2ET7A 1S0CA 1QY4A 4GQ7A 1QNWA 4ORFA 1UCXA 1RUH3 2WIIB 2A3WA 1COV1 1QJY2 1G9AA 3MYXA 4P9LA 2B5HA 1VIWB 2DUPA 3N3HA 3TNQA 1QXPA 3LKJA 4KWKA 4N53C 1Q8OA 3N7LA 1BBT3 4IEZA 4EN6B 4QQPA 1VBE3 1RVF2 1VB4A 1IKPA 3OJBA 3TAYA 4YZ5A 3NW4A 2V73A 1AJKA 4RQPB 2QZ2A 4XJ9A 5C8CB 3AMNA 4Q4V2 2HWF1 1FPN1 4GB32 4CZSA 5AC93 2VW2A 2A6YA 1SACA 1VRH3 2DVGA 2E7TA 4Q26A 2QQPA 4XZPA 3E5QA 2WZR1 4N43C 4YW1A 3VBFA 5JR7B 4LHLA 3M3IA 5BNNB 1HRV2 4AFBA 5D8AC 1RUE3 4IV1B 1VBA1 1LOEA 2Z42A 5K9YA 2KXLA 3D5OA 4L92A 5CFCA 1HQLA 1CAVA 1RUI2 3RG0A 2D6LX 1FV2A 1H2LA 3W9AA 3WXPA 3EJKA 1W6MA 3WDUA 3WZ1A 1BEV1 2CL2A 3OTFA 4BCUA 1F31A 2Q1ZB 1RUD2 1ND3C 1VAMA 3HT2A 4WVMB 3V56A 4GALA 5C9AC 5J3UA 1POV3 1GFF2 2P2KA 4GIQA 5IK4A 1ASJ1 4I3GA 5JAXA 3ZSEA 4RS5A 2TUNA 1IPJA 1S0JA 4F8AA 4F83A 3MZHA 1C8M3 4WM7A 2ZGKA 1PNGA 3LAGA 1H8VA 3RNSA 2OIIA 1W6OA 4PIZA 4RD7A 4Y5Z0 3BIWE 1B35A 3CJIB 5FBZA 4HSLA 2WQZC 1RINA 2X29A 1R082 4FP3A 2FZ2A 2ZKNA 2WS93 3VBUA 2EIGA 2WNVB 1XE8A 3EXUA 1MVQA 1H2NA 4JGZB 1LGCA 4Y4YA 3M70A 1W6PA 3AKTA 1W6MB 3MFCA 4YGDA 2X8KA 2WZR3 2D93A 3VL8A 1JW6A 3VBFC 5IK5A 4KL1A 1X82A 3H7JA 2CAUA 4XPVA 1LHNA 1AYN3 1J1LA 2RS32 3LWCA 1H2KA 3DL3A 4AQ2A 4GKYA 1S1AA 4QT6A 3B9CA 1BEV3 2YGLA 2R071 3RYPA 2HEYF 1CD3G 3I2DA 4IEWA 1ND3A 4K7JA 2A75A 2YDEA 2WFPA 3WHUA 1ZRFA 4JRAA 1YJKA 4N7IA 3VBFB 4DINB 2ZGMA 4FOWA 4LBJA 4DMIA 2CTVA 1AL0G 4XFGA 4YVSB 1DBNA 2JENA 2ILMA 3ZN5A 3WP5A 4WM7C 1X8MA 4BLJA 1ZNPA 4BIOA 2BNOA 5CFDC 2GC3A 2WNVC 4FAHA 5DZEA 4EWAA 3MF6A 3DN7A 1BVVA 4LUMA 4HLTA 1LHUA 1AR62 1IS3A 1DZQA 1GZ9A 1C1LA 1NXMA 3OYWB 2ZBJA 2QCSB 3ELNA 1SCSA 1J3QA 1YJLA 3AJZA 2D44A 3H8UA 1MS3A 5JVVA 3ZXEA 4IV3A 5I8TA 2RS51 1QDOA 3FWEA 4HN1A 1W6OB 1FI2A 1GANA 4NO4A 4JDMA 4FPYA 2HEWF 3FZ3A 4M3CA 2AENA 5L36A 1CJPA 3MIDA 2BFUS 2RR11 2VUAA 1ZRCA 2BWAA 2HWB3 4I3PA 1VRH2 4RFT0 1F2NA 1OLRA 1QDCA 1PVC1 2A5ZA 2X5IB 4FQ4A 4RSUA 2ET1A 5BNNC 1AR93 2DTYA 4PF5A 4DFSA 4Q2FA 2VW1A 1SLIA 4Y24A 2X53S 1YRZA 2RMU1 2R063 3V0AB 4MX3A 3AP9A 4BMEA 3AZWA 3TNPB 1ULDA 5KHGA 5KWRA 2E53A 4IEYA 3ZO0B 2CWMA 4KU7A 2ARBA 1GICA 1POV0 4N90A 3WG3A 1R1ZA 1I1EA 1NA1C 3NWKA 4LO4B 1SFNA 2G9GA 5BUVA 1V9U1 3ZFEA 1SDWA 3KT7A 1NE6A 5KHHA 1Q8SA 1HXS1 3WUCA 4XBQA 1O7FA 4EN9B 3USUB 4HK8A 4YSFA 3M3QA 1KDKA 5H9PA 1IS4A 5BPXA 3H7YA 4K21A 4XXAA 5BV6A 1AVBA 4IV3C 4HPKA 4XJUA 4N53B 3AFGA 4ZKTB 3OGJA 3VBRA 1RUF3 1G8WA 4N9IA 2XHKA 2XJUA 3V0AA 4Q4X1 4AFDA 1AR71 1DYPA 1YNAA 4QQOA 1AUYA 2JG8A 5HI0A 4EROA 3HIFA 2ZAAA 1WGPA 4XE9A 1AF9A 3KM5A 5DDJ2 2DCTA 4Q0UA 3AXEA 5HBAA 2FMYA 2UYAA 5C8CA 4FVVA 2ZX0A 3SHRA 1GLHA 2QUOA 4GH4C 4M3CB 3USUA 2ZKLA 1YO8A 2RS52 5I8YA 2A6WA 2DUQA 4LBLA 4AYUA 1OD5A 2H6BA 3THTA 1D4VB 3VBSB 3ZDSA 4DY3A 3B3QE 2WL1A 1F5JA 5E1RA 3ES4A 2VMGA 4F3JA 5TSWA 2XWJB 3GALA 2XWBB 1WA4A 4I09A 3ZX7A 3AMQA 1D0GA 3E6DA 5CADA 4QPGB 1GQHA 4TLFA 5JLVA 1QOOA 3AZYA 3FBMA 2HJIA 4XJWA 2UY9A 5DUVA 1OQDA 3BODA 1NLRA 1BBT2 4K1ZA 4FSJA 1PIV1 3ZFFB 3ILNA 4CDWA 4YRDA 4HVQA 5A33B 2DVBA 2RR13 1BCXA 4S2GA 2MNGA 4D7SA 2WNVA 3R0RA 4QQLA 5T55A 4YG6A 1NCQA 3I8TA 2QVSB 4X8NA 2PHLA 3VBSA 2DCYA 4P9WA 3LSDA 2WFF3 1RUJ1 3VBRB 5GLWA 4L99A 4E9KA 1G9BA 4S2HA 4W65A 4FPHA 3AJYA 5I93A 3ALQA 4LLOA 4GULA 5IT6A 2PQQA 1KFUL 2XVKA 4WM8A 1FT9A 2IC1A 1V6JA 2ZACA 3HQXA 1ND2C 3KB5A 1PZ7A 3GF6A 2DCJA 2O8OA 4HKWA 2YPJA 1APNA 1LOFC 4RR3B 5JMCA 3M3EA 1AJOA 4LR4A 2YMZA 3ROUA 5ABJA 1RL3A 1B35B 3KCCA 3FLRA 4NN0A 3N35A 2GSYA 5KHIA 1IKQA 5FMOL 4Q27A 3U4XA 2ENRA 4PDWA 2VQAA 3G7DA 2ZX4A 1PK6C 3AYEA 2VG9A 4H7LA 4AVAA 1YIPA 2DTWA 4XBNA 3VHRA 2ZZQA 4K3UA 4MGIE 4YW4A 3UKNA 4AF9A 1R1A3 3GNEA 1X8EA 4JDNA 3KS7A 3LOIA 4YFWA 4OLLA 1BKZA 1MZFA 1U5ZA 1H30A 2BFUL 3QLQA 4JGYB 1TME3 5T3NA 2F6BA 1DGWX 4E2SA 4P9XA 3VZLA 5GZFA 1PO22 1HW5A 1BBT1 2QDNA 1LESA 1HLCA 2R061 3UJOA 2YHJA 2GNBA 2QNKA 1NCQB 2JECA 5CU1A 3GBFA 1JHNA 1BEV2 1LKNA 1PGW2 1C28A 1NQDA 3PJQA 5FLJA 3T2TA 2C1FA 5C6CA 1AYM1 2B39A 1LCLA 2LM3A 2RS53 3RSJA 4XOGA 2RS12 3TRSB 1V9U3 1KITA 1OHFA 3IMNA 5J36A 1EPZA 3LZZA 3B00A 2RM21 1UU6A 5C4WB 4Z1VA 1ULFA 2SBAA 5FTTC 1UU5A 4XYXA 5J37A 4LA3A 3ETQA 1OSGA 4CDUC 2R6QA 4IETA 3SISA 1IS5A 2XJTA 2CGNA 3UKVA 2XUMA 1N1YA 4OVEA 5DG1A 4U2AA 2DVDA 1RUJ3 1RUI1 3LA3A 1J58A 3VHNA 3JBG1 1ZZBA 1R083 4IQPA 5GZCA 3N7JA 4MH0E 3URFA 1RJ7A 2GC0A 4A3XA 1NG0A 4FPEA 1PHMA 2VOWA 4Y22B 4AI1A 1EP0A 2ZMKA 3FE5A 3PVOA 2GN7A 5C9AA 1WW6A 1CAXA 2E9QA 1N1VA 1RUJ2 1Z7S1 1DZTA 5L73A 1Q5OA 3SH5A 3VL9A 5BNPB 2VXRA 2RJLA 1H4GA 1ZZ7A 2ZPXA 3H3ZA 1ZZ6A 1LODA 4AQTA 3OCPA 2JICA 4R9DA 5KBFA 4Q0VA 2IXHA 3H0OA 3BCWA 3I54A 5IUQA 3J8F2 2DCZA 1PO21 1SLAA 1GZCA 2WNUB 3LB9A 3WQ0A 2HWB2 2NZ9A 3KLSA 1AR91 1NQJA 2DYCA 1OOPB 4P9IA 1W6PB 4PCRA 2A70A 3A0KA 2GNMA 4IXLA 3JBG3 2ZAHA 1O3QA 4YVWA 1OA3A 4AGVA 3KD4A 1ENSA 2GMPA 4K6BA 3MIGA 2NM1A 1OLQA 4IEQA 4CDQA 5BNPA 2XPJA 2YY1A 3SLIA 1WW7A 1I9RA 5A33A 4OI2A 2VOKA 1GNHA 5L7OA 1N3OA 1QJZA 1ULGA 4IERA 3WX5A 1HXS3 1RUC3 4NOTA 2JDZA 1I6XA 3MIBA 4MVTA 1O3RA 2W0XA 3AKRA 1WMFA 3W58A 1R1A2 5CG9A 2HWD2 3WT3A 5BNQA 1WW5A 4COZA 5AC91 1TMF3 4BIFA 1AR61 4K8FA 1WCKA 3NAPB 3JBG2 1XNBA 1JBCA 2XBO1 1XYNA 3QD6A 1FOD3 5CB7A 3KSCA 2GAUA 4YM3A 3LA7A 2HWC3 2NPIA 1TE1B 4I0WB 4C90A 5J98B 2D6PA 3U0ZA 1RUE2 2R041 2ZS6B 3J8F3 5JSPA 2ZABA 3FFQA 2D6KA 4PIYA 4DRRA 3AFKA 4META 3L9JT 4RR3A 2OA2A 3LGRA 1VBD1 4XQWA 1VBC2 5FLHA 3ZFEB 1YI7A 2CGOA 2D3PA 3P3PA 1V6MA 1UX6A 3QH7A 4Q4V3 2ETEA 5KHJA 1FMD3 2SLIA 2G4IA 2ZGSA 5FPZA 1JXNA 1XNKA 4C0BA 2VOVA 1S2KA 4AVBA 1AR72 4YGCA 2VU9A 5E89A 1VJ2A 2QZ3A 3VBUC 2JKBA 1VLNA 2XH6A 2Q0AA 4TZDA 4A7ZA 1GR3A 4EWDA 4AHXA 4R4ZA 1ZA4A 1RUNA 3D0JA 3S30A 1AR63 4XFIA 4OHYA 1QJU3 4JGYA 5BYNA 3NV2A 5FOBB 2Y0IA 1LGNA 1W0OA 1HXS2 3OF1A 3VKOA 1W6NB 3IPVB 4Y20A 5GM0A 3E97A 2JG9A 3UV9A 5FLIA 2K2SA 1XQNA 2GZWA 2A7AA 4FPLA 4CP1A 3I7DA 3POWA 4RHV2 2R043 2GMMA 1KRIA 2ZGTA 2HWF2 4I2OA 3IDEA 3VBUB 1ZBE1 4COWA 1IPKA 1R093 2O0OA 5JIUA 2DCKA 1KD7A 3FLTA 4XJZA 3WDYA 4GXLA 2I07B 2LALA 4I0AA 5JOXA 5C33A 1X7NA 1ULCA 2HYKA 4GMP1 3MIHA 3ZPYA 3R4DB 1AXKA 2XJVA 4AGRA 1XYOA 3INAA 1QQP3 1YFXA 2A3YA 4E2QA 4CEYC 3ILRA 4I02A 2ERFA 3O5SA 3DF0A 4HVRA 1UAIA 1EY2A 1VAVA 3CF6E 3ZFEC 1SLCA 4QGMA 2F4PA 4LUKA 1V6LA 1KQRA 1RUD1 4LBQD 3VHPA 5AFBA 4C0HA 1S2BA 4OI1A 1H1IA 2VMIA 3JCIA 5FRAA 1W6NA 3IPVA 4Y20B 4HFSA 1SBDA 2V09A 3MLLA 1IHMA 2O8QA 2R042 1LEMA 1WLDA 1MEC1 2OZJA 4X6RB 5A3LA 4TYSA 3J4UH 2A3XA 2XKPA 2EAAA 3WDXA 2CGPA 3VKNA 3V65A 3NAPC 2R30A 5GZEA 3B01A 5FQ0A 3SITA 3VV1A 1IS6A 5T5JA 2JD4A 3GBWA 4A7KA 2BPA2 4Y22A 3WV6A 1S0GA 3WUDA 3WDVA 1ZBE3 2JXAA 4Q4W3 1CGPA 2BBVA 4G9SB 1PIV2 3H1YA 1SEFA 1Q43A 3JQWA 4YLZA 3MF9A 1PVC3 4M0HA 4AVVA 5H9RA 2PLV3 3IBMA 1MR5A 1N3QA 4BOWA 1V6OA 1DHKB 5CNAA 3WP4A 1HX6A 1UIKA 2EALA 4QPIC 4A7YA 5FCCA 5E88A 2UURA 3TWIA 3WW3A 4EWEA 5IK8A 3RZZA 4GH4B 2R072 4AHZA 4YM1A 4MSVA 2JJ6A 1V00A 2OW4A 2H0BA 2X5IA 4MXVA 2VH9A 2WNUC 4QMAA 1HRI3 2ZHNA 4J1XA 5BXXA 3AK0A 5DUUA 1H9PA 1QHDA 2KM2A 1URXA 2GH8A 4LLFA 2QJVA 3RJRA 1UL9A 2YUEA 3MFAA 4FOVA 4URTA 4KU8A 1N47A 3BPZA 2QKDA 1AXYA 2GN3A 1QKQA 3ZMNA 2WLQA 3THPA 3TB0A 4J1WA 1ULEA 2C5DA 2E7QA 4XBLA 3VHOA 2PHDA 2ZGOA 1OA2A 4R8HA 1YYNA 3NV4A 4CRQA 3CJIA 1QJY3 1PZ8A 4W6XA 1ASJ3 2DFBA 2Q30A 2HWC1 3JD71 4PQ9A 2P17A 3FX3A 1QQP1 2ZOEB 1PK6A 4QPIA 3WQ7A 4ATFA 1BVP1 2A6ZA 2VPVA 3D4KA 2RM22 1ZX5A 4KWJA 2UU8A 2P3JA 3MW2A 1M06G 4E4SA 3X29B 4LBKA 1QMJA 1RUD3 3O0WA 3M7AA 3PHMA 4CEYA 5FMOS 1UPSA 2PHRA 3IDBB 3HAGA 4YVWB 4XF9A 3RYKA 1MZ6A 2X5IC 1O3TA 3ZFFA 1CN1A 2V5YA 4CDUB 3GYDA 3PLQA 1VALA 4XQDA 1PO13 4Q8LA 3LA2A 5EV7A 3RI9A 3AM2A 2VQ0A 2AH2A 5C4WC 4AQSA 3U07A 3E6CC 5HCAA 1K5MC 4XIOA 5EZWA 4SLIA 1FOD2 3HR9A 2PTMA 4KNCA 2UY8A 4QPYA 3R4SA 3ZN6A 1REDA 3DGTA 4L2NA 3VKFC 4HZFA 1S0DA 1RIRA 1REFA 1S0IA 2R32A 1OQ1A 4QQ2A 3HMYA 2YC0A 3O0XA 3BB6A 1U5YA 5D8AA 1MACA 1PO23 1NCQC 1VBD3 3QOPA 2WFF2 1Y9QA 1OFSA 3PMSA 2MHFA 3VBHB 5LK7B 4XHXA 4OHWA 1F8VA 2E63A 5LK5A 1LJ7A 1JN2P 4Q4X2 3TOJA 1UKGA 4HK9A 2GU9A 4BH9A 4B7KA 4NHMA 3WW1A 4YVSC 2ZX3A 4GWNA 1SBFA 4UW6A 5T52A 4F7ZA 1E57A 1MS5A 3MLKA 4O9GA 2ZX2A 4XFAA 4XF4A 3NJZA 1W6QA 3L2HA 2XL9A 5JSRA 1Z7S3 5DUWA 4LHNA 1PK6B 1QH6A 1ZZ9A 2Z79A 5FO8B 4MGZE 4YG3A 3WY6A 4R9CA 5H9QA 3SNMA 1U0AA 2OYZA 2ZMLA 4GKXA 4G4FA 1K5MA 5DG2A 1SLTA 1OFNA 3PVNA 3ZYIB 3GZUC 4S2FA 1CPNA 3CU7A 4K20A 4UBHA 3PMEA 2JEMA 3AP5A 4GB31 1AYN2 2PHXA 3POYA 3UJQA 2AYHA 3EBRA 1XXNA 4NR1A 2VY0A 3UK9A 2ZZJA 5IK7A 2WZR2 1COV2 1QJY1 4KG0A 1CVNA 1GYKA 2WA4A 2HWD1 3J8F1 3ZXJA 1ZZCA 1AX2A 2JE7A 4ISQA 1V6KA 3QBQA 3ZYJB 1C3HA 5AFEA 2PLV2 2VW0A 1G6NA 3CJIC 1N1TA 1TME1 4I30A 1DQ1A 4AEDA 2MEV3 2XBO2 5DZFA 3N7KA 3VUOA 3ZN6B 3VBRC 1PNFA 3O14A 4JRLA 4XFBA 5KC6A 4Y1XA 4DB5A 3NO8A 3PJYA 1BQPA 1RVF1 4K9