2O8VB

Paps reductase in a covalent complex with thioredoxin c35a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoadenosine phosphosulfate reductase
publication title 3'-Phosphoadenosine-5'-phosphosulfate Reductase in Complex with Thioredoxin: A Structural Snapshot in the Catalytic Cycle.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 30
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o8vB00
4OO5A 4MDCA 2BJXA 1X9MB 2ZCTA 4E8HA 4CHSA 3L9SA 1ERVA 3DD3A 5J4UA 3FEUA 4ZL9A 1BQ7A 1G6YA 3RBTA 3J7Yk 2VUPA 4V1Ag 1SD9A 4KW6A 3LORA 4TN8A 4ZL8A 1X5CA 1GL8A 1Y25A 3FK8A 4YQMA 1SL1B 3G7YA 3TJJA 6GSUA 4TR1B 4OWYA 3CRTA 3VI7A 2TRXA 2F3MA 4IW9A 2XPEA 3APQA 3TKRA 1IYIA 2L5OA 5IMAA 5G30A 4KX4A 2FHEA 2LJAA 4IVFA 2H73A 3EMXA 4ZBAA 3E0UA 3IE3A 3FR9A 4AJ6A 3FZAA 3KH7A 4TXOB 5IMZA 2VD1A 5EPFA 3KGKA 1GLPA 2OACA 1HNCA 3GL5A 3H79A 1JLVA 2E2MA 1R5PA 1T00A 1YEXA 5A4WA 1R26A 1TRWA 4PURA 2H1AA 1GULA 4PQHA 1XOAA 3IRAA 2VM1A 1SJ6A 2YZUA 2HZEA 3A2WA 3IV4A 3W8JA 4Q5NA 3UEMA 3G7JA 3WGDA 3VWVA 1K0DA 4BVXA 3L78A 3GA4A 4O32A 1BX9A 1BYEA 17GSA 3DVWA 2F8FA 4V1Ap 3BCKA 1TXXA 1Z3EA 1NHYA 2HRFA 2IFQB 4RI7A 1RW1A 4HZ4A 2FWHA 7GSSA 2GDRA 2E2GA 2M72A 3UVTA 5INYA 2C0GA 3I43A 1XWKA 1M0UA 5G5FA 3MDKA 1AQWA 3ERGA 3F6FA 4KB3A 4GQFA 1GH2A 4ULXA 3I9V2 3H1NA 3FRCA 1EGOA 4HU7A 1EGRA 2EIOA 2FNOA 4ML1A 4WEYA 5HFIA 1EV4A 3PH9A 4OO4A 2DJKA 1U88A 2YV7A 1BAYA 4HQZA 2J23A 2FWEA 1XW5A 4WKWA 2GS3A 4OFTA 4DVCA 1SKRB 2H1GA 3F4RA 3KD0A 2P5QA 4MJCA 2OE1A 2F51A 2RM5A 1MDIA 6GSWA 5GZZB 2R2JA 3GIXA 1O81A 3MSZA 1QMVA 2IPAA 4DSQA 2X8CA 3TGZA 2LS5A 2TIRA 2ON7A 3HDCA 4GCIA 2HXKA 1T7PB 4HDEA 1FB0A 2C8UA 1K0MA 5C00A 4ILFA 1YZXA 3DMLA 10GSA 3GTUA 5CAXA 3MWHA 2C0FA 4MA9A 4J2FA 5D73A 3CBUA 3MNGA 1Z6NA 1A8YA 4FYCA 1O73A 2HSHA 1XWAA 2H0GA 3GKXA 1GUMA 1S3AA 4JBBA 4YAPA 1XZOA 4LMVA 3F4SA 1PGTA 1XWGA 2FY6A 3IHQA 3HCZA 4NMUA 2YV9A 4XS6A 1PL1A 2BMXA 4X0XA 2L59A 4TR3A 4I5QA 1XIYA 3W8SA 4EE0A 3F63A 3EVIA 3TKPA 1B4QA 3WT1A 4OMVA 3KH9A 2YWOA 2CA8A 2H74A 3HYPA 3LEFA 3WD6A 1GSEA 1G7EA 1FAAA 4IKHA 1XXUA 3LYKA 4E8EA 4NWYA 5ECMB 2AUVA 3BJ5A 1YJ6A 4BWQA 4KCEA 1NSWA 4MCUA 3C71A 4PUAA 5EVOA 1TRUA 2MYGA 2H30A 3IBHA 9GSSA 1AAZA 5ID2B 2LQQA 1GNWA 2VOCA 1YKCA 3US3A 3IAS2 2CV4A 6GSVA 3EE2A 3GHAA 3D22A 2GTUA 2VCVA 1GP1A 1OKTA 5ECRB 4BPYA 3HJPA 2IN3A 4HI7A 2YWIA 5DCGA 4ID0A 1SL0B 4ZBDA 1O85A 1DUGA 2B7JA 2V6KA 2H0IA 3QAWA 3C7MA 2RIIA 2NTOA 1T4YA 5A4UA 2WZ9A 4F03A 1JZRA 2NDOA 1OE8A 3GKKA 4EDZA 2IJYA 1SENA 3GN3A 3O6TA 1M9BA 5J9BA 2GSRA 3ZL5A 3FKFA 4IJ3A 2X8GA 2O8VB 1GUKA 5F8BA 1QXHA 5JCUA 2LRCA 1G0TA 3DEXA 3M9KA 5ELGA 1FW1A 3GH9A 3QD9A 1XWCA 4H86A 2B6MA 3I69A 1M2DA 4RQRA 5LCZA 3TUEA 3D21A 3FY7A 11GSA 2I4AA 5B6NA 3EU4A 4MZCA 4ZB9A 2CZ2A 2L4CA 1GSUA 2FWGA 3V1WA 5E59A 2WULA 5FT3A 4F9ZA 5KN0A 4KUNA 5HR0A 2DJ3A 3RDWA 4RUVA 4OCFA 1HQOA 1BJXA 5CYYA 3QFBC 1A24A 1ON4A 4AJ8A 3WGXA 4HU9A 3C8EA 2G0FA 1K0OA 4ISDA 1OC8A 1E6BA 1X0RA 1UC7A 2OE0A 1EZKA 1OC9A 3DRNA 4RQXA 2KP1A 3F3RA 5ECSA 3LSZA 22GSA 2PBJA 2K8SA 3KZQA 2VL9A 2R4VA 4JU5A 3VFIA 5DDLA 5IM9A 4KSOA 3DYRA 3E9JB 1W4VA 1BG5A 3TDGA 2NPBA 2V41A 6GSYA 2K6VA 2GT6A 4N30A 1KBNA 3TRPA 4EO3A 4MJBA 5ECNB 1Z9HA 3KMOA 1SK2A 1A2LA 3L4NA 4WETA 4Q5FA 5HQPA 2HLSA 4KA0A 5DQYA 2V32A 4EUYA 2VL2C 4LLRA 4L0UA 1B4PA 1H4OA 4FYUA 1GRXA 5AIXA 2ON5A 4GSTA 3ZVJA 1EV9A 8GSSA 1NHOA 3GSSA 1ZOFA 3KTBA 1PN9A 2H0HA 4N0ZA 4KDUA 2IL3A 1K0AA 3N9JA 1EOHA 1UVZA 1T1VA 1V57A 3QDNA 5ECIB 2H6ZA 2CAIA 3EINA 2OBIA 4QL9A 1SK0A 2L4QA 4LA1A 5IMVA 1A23A 5DQSA 4ECJA 2VL2A 4KSMA 3A2XA 3GYKA 2OADA 3EYTA 2FCHA 5AN1A 4GSSA 3LFLA 1O7UA 4I2UA 2L5LA 1WIKA 1USBA 1QK8A 2DJ0A 4KCAA 4L0WA 3HVSA 3EMPA 4YQUA 1C72A 4TVEA 3LWAA 1A0RP 3ZIJA 2GGTA 3GL3A 4IHUA 4X1UA 4FH8A 2B5YA 2XHFA 4MK3A 1GTUA 3KMNA 1GSSA 5D96A 2WGRA 2C3NA 4POKA 4MH3A 5H5QA 4KDYA 2PU9C 4EF0A 3APOA 5FWGA 5C04A 1PKZA 3IK7A 2CVBA 3HJMA 2B1KA 2PVOC 4IN0A 4OFNA 2MZCA 4IGJA 3GRXA 2I81A 2Z9SA 1TK8B 3ISOA 4KE3A 2MMZA 3P2AA 3HKRA 3S9FA 2LEGA 1ILOA 2WDUA 4MMMA 2H6YA 2JADA 3D6IA 3L0HA 5DAKA 2R6KA 1EWXA 1X5EA 1X5DA 4IJIA 4J56E 1M2AA 1SKSB 2I9HA 3FZ4A 5EY6A 2C80A 2X64A 4G2EA 3FR6A 3FZ9A 2M80A 4MPFA 2PWJA 5DBQA 1TJDA 4XS4B 1EP7A 3N5OA 5ECHB 5JWQB 4WR4A 3GNJA 3VWXA 2VLVA 5FHIA 1F6MC 3LQ7A 2AHEA 4V2NA 3P8WA 2B5XA 2P31A 3FHKA 2MMNA 4V2MA 2JSYA 2A2SA 3GFKA 4MLYA 2YANA 4V2LA 2QGVA 1K0BA 2C3TA 4N0VA 3DKSA 5DALB 1O6JA 1PX6A 1WPIA 5CRWA 3D5JA 3M3MA 3F4TA 1WMJA 3UIWA 4BVYA 1ERWA 2H1DA 2CZ3A 2HNLA 4NAXA 2WCIA 5AGYA 1OYJA 2R3XA 5CO3A 3ZZXA 5J41A 2PPTA 2EIQA 3ZTLA 1GTBA 2B7KA 2C0EA 3ZMKA 5IPGA 3WT2A 5G31A 1ZYEA 2BTOT 3VI5A 1E2YA 4HJMA 1Z6MA 5ECPB 4YAVA 2VAFA 1THOA 2FA4A 3UARA 3O76A 4MF5A 1F9MA 4O7HA 1K0CA 2PVQA 5DCHA 2VIMA 2L6DA 3TKSC 4ECIA 2H01A 1SKWB 1GSFA 3F3QA 2WRTA 1T8EB 2OA7A 5DJLA 4PQIA 2GLRA 3H93A 2WB9A 5ECOB 1FOVA 1G6WA 2JZRA 4TR1A 4IQAA 1TI3A 2VO4A 2YWMA 1UN2A 1DE1A 2GZZA 4WXTA 4FO5A 1I5GA 3EWLA 3IPZA 4WF4A 4GLTA 6GSXA 3HD5A 4DSRA 4K7OA 1PD21 2K9FA 4TXOA 3GH6A 5ELAA 3CRUA 3TKSE 3TOTA 4LMWA 1TI1A 3UAPA 1X9SB 2MMAA 2FUG2 3TKSA 5COHA 2H19A 3VWWA 3UOMA 1R5AA 4HJ2A 2GT5A 3P90A 1FG4A 1ERUA 1ZMAA 3AY8A 4IP1A 4PUFC 5L71A 5JWOB 2LNTA 2IWTA 3KP9A 3Q18A 2GSSA 4K0GA 2WJUA 2YJ7A 1M9AA 2X99A 2C1YA 4NV2A 5IQYA 5CRHA 2DJ2A 3UJ1A 1TRVA 3UBLA 1SD8A 4ZBBA 1SYXA 2IFQA 3TJKA 4KAEA 1JLWA 2AV4A 1LBKA 4JRRA 2YN1A 3SWLA 1QFNA 3VPQA 3QAVA 5IOWA 2YOIA 1IYHA 3WYWA 4EC0A 3EC3A 4FYBA 4IP6A 4ZIJA 3GMFA 3KM6A 4K8MA 3BCIA 3ERWA 1U3IA 1ZZYA 1GUHA 5F06A 2GSTA 4IELA 1SJIA 4FIWA 3DIEA 2CT6A 5ECQB 3G9BA 3LG6A 2VCQA 5A4VA 3GX8A 2AYTA 2OE3A 4IBPA 1B9XC 1XW6A 4WBRD 1TP9A 4GSNA 4O92A 3RPNA 4K9ZA 5AISA 3TJFA 3KTLA 2VLTA 3GKMA 1WRYA 1LJRA 2CVDA 2R5GA 3F0IA 1YQ1A 2X8HA 1UA5A 4HUAA 2AB6A 3TRXA 2CX3A 4PXOA 4DEJA 4NHZA 5F05A 5D9VA 1ZL9A 2F8AA 3EURA 1EEJA 1AW9A 1SJZA 4MJAA 5IMCA 3LXZA 1U6TA 1R7HA 4K1FA 3ZFLA 3NZNA 4BWSA 2TRCP 2KOKA 1SK1A 1MD4A 4WBJA 4HOJA 2FD3A 4MZWA 2N5BA 2CQ9A 3Q19A 2OBKA 2MBTA 5ECKB 2HT9A 3RHBA 4TR0A 5HR2A 4D73A 3GKNA 4TRXA 1XOBA 4Z7XA 16GSA 2D2ZA 3LJRA 4EKZA 1OAZA 2XPDA 3HZ8A 3VWUA 6GSSA 3HVXA 1HNBA 1MTCA 1TRSA 2VCXA 2H76A 3C1RA 1ML6A 4OCEA 5ID2A 4EDYA 4OD7A 4IS0A 3GV1A 5KEJA 4F2IA 3CSJA 4G10A 3MAKA 4MJEA 1N8JA 5D9XA 4XRDA 1RQMA 4XIHA 1TU7A 5GSSA 3ZYWA 1MDJA 1O8XA 4POBA 4ZILA 1S3CA 3APSA 3CYNA 3GUSA 1A2JA 2QKEA 1Z7RA 3FR3A 4ML6A 3LGCA 1WJKA 4XRAA 4K0NA 2IMFA 2V6OA 5EL8A 5IMFA 4K2DA 2CX4A 3DXBA 3ME8A 3C73A 4RI6A 2DMMA 2FGXA 2YWNA 5B6MA 4TKYA 4EVMA 2PMTA 3K8NA 2VD0A 5JCWA 2HZEB 4Q5QA 3M1GA 1A2MA 4KDXA 3A3TA 4JZQA 1AQVA 1OVNA 1F2EA 2DJ1A 1VF3A 5CP1A 3KXOA 2ALBA 3KP8A 2LUSA 1JZOA 1M99A 3OR5A 1A0FA 2DSAA 2LRNA 4MZBA 2OJLA 1FB6A 1JHBA 5F0GA 2HI7A 1Z7PA 3SBCA 3KCMA 2PGTA 13GSA 2VCWA 4EL1A 5G2ZA 1Q98A 3HY2A 2FWFA 4GRFA 3ZRDA 2NBSA 4GXZA 1PMTA 2RUFA 1TKDB 4ECCA 1K3LA 3ZFBA 2H75A 2IMIA 3KEBA 4I8BA 2VCTA 2B5EA 2L57A 3GSTA 2XBIA 1GTIA 3QPMA 2GVPA 5KN3A 2LRTA 1GWCA 4MH2A 2VL3A 5G5EA 2GQMA 5CRDA 3JCML 2JZTA 1MDKA 4POLA 2P0GA 3ZLPA 1B48A 1TW9A 2N5FA 3H8QA 5A5KA 4PQ1A 1K0NA 3TRQA 2H71A 3ME7A 1A8LA 1GNEA 2PERA 2LJRA 3BD2A 2ZUPA 1I9DA 4F82A 3RAZA 4L5OA 2AAWA 2IMDA 3R2QA 3A5WA 4MPGA 4ZXGA 2YP6A 3GTUB 2R37A 1HNAA 1T3BA 3IOSA 1YDKA 2YCDA 2GZPA 4N11A 2EIRA 1Z5YE 2LKUA 3J7Yb 4MF7A 2KUCA 1Q4JA 2A2RA 4GQCA 1AIUA 1O8WA 3W6GA 5GAPD 3HVVA 5D93A 2QSIA 3QCPA 1GSQA 1PSQA 5IOXA 3HHVA 20GSA 5J5NA 3CTFA 4XS1A 5F07A 1HD2A 3ERFA 2RUEA 2V1MA 1BEDA 3CTGA 5GSTA 4X43A 3ZMLA 5CRGA 5J3RA 1EOGA 4CW9A 4O5RA 3UL3A 2FA8A 2KP2A 18GSA 1VF1A 3HZ4A 4OFMA 5H5SA 4F0BA 1QQ2A 2C3QA 1OC3A 3IC4A 3LXTA 4ZB6A 2I3YA 4K7IA 6GSTA 5AIVA 4BL7A 2LNSA 4DSSA 1J0FA 3TKQA 1DE2A 3HXSA 2YZHA 3KIJA 2E7PA 2QC7A 4HEA2 1EEMA 4ACSA 2B3SA 1V2AA 3DVXA 4L8EA 4PNGA 3O3TA 1FHEA 2K8VA 2O89A 4TXVA 5ECLB 3FW2A 2O85A 1FVJA 3BOAA 3TJGA 2MMOA 3D4TA 5KN1A 4YH2A 4I2TA 2IMEA 4TR4A 2L6CA 4XCSA 1ABAA 3PGTA 2XBQA 4EXJA 1XVWA 3CSIA 5IO0A 4YQVA 1AC1A 1XCCA 3ZREA 3D4MA 2DBCA 1VGLA 2VCZA 4CDOA 2DIYA 2GSQA 3GX0A 4ECBA 2FLSA 2YPMA 3QR6A 19GSA 3IDVA 1ZYQB 1JZDA 3UBKA 1AQXA 2C4JA 2J9HA 2C0DA 4KGIA 2DJJA 2GQKA 1V40A 1KTEA 1GTAA 12GSA 4NXIA 1N2AA 3TCOA 4HZ2A 1HYUA 2I1UA 1WOUA 2O7KA 4ZL7A 3E3EA 2H1BA 3VLNA 4AF2A 2JL4A 4NPBA 2HRNA 2H66A 1VRSD 2K18A 3QAGA 4F0CA 4N10A 2DC5A 5DVBA 2NVLA 1XWBA 1ERTA 4G19A 3PINA 5IMDA 1TK0B 4XS4A 4TW5A 4MP4A 2CAQA 3F8UA 2AJQB 4MABA 1PA3A 3FYGA 4QQ7A 3IR4A 1OC9B 1K3YA 1AUCA 4LL1B 1EP8A 4AJ7A 3ZIVA 1THXA 2YJHA 1J08A 5HR1A 2H6XA 4D73B 4WF5A 2MBSA 1VF2A 2EC4A 1TK5B 5DALA 1DSBA 3VPTA 2REMA 4MF6A 1OE7A 4I97A 3CXGA 1FO5A 1W89A 3QFAC 3F9UA 3I6AA 1F37A 3ED3A 1JZWA 2HSYA 4NV5A 1NW2A 1KEBA 1M2BA 3NIVA 5CREA 2DLXA 3CSHA 1B9YC 5E4WA 2H8LA 3QOUA 1S3DA 2B1LA 1TU8A 1XPVA 2N5AA 1X9WB 5B8AA 5J9CA 4I6XA 2H70A 1G7OA 1R4WA 1XW9A 4JR6A 5LNKe 1NM3A 2HFDA 5D8IA 3UMAA 2YNXA 1F3BA 1TOFA 5ENUA 1AXDA 2OKAA 1H75A 2WFCA 1GSYA 2JACA 2WS2A 1FVKA 5JWRB 1WE0A 2VM2A 3P7XA 2HYXA 5JCGA 4K6XA 5IIZA 2JZSA 3NOFA 1Y6EA 1V98A 1CQHA 5GAND 1J9BA 4Q5RA 3UVHA 5HR3A 1PRXA 1YF0A 1TDIA 3TB2A 4PX1A 1QUWA 3U5RE 5B8BA 1GSDA 3IA1A 1B8XA 2M46A 4J57E 2KHPA 2XC2A 2H72A 1ACVA 3LYPA 3C1SA 1XFLA 5B7CA 4QL7A 3RHCA 5IPHA 4AGSA 4GTUA 1YEPA 4PGTA 2CVKA 2LV3A 1PX7A 5IO2A 1KNGA 1VF4A 3TJBA 1PL2A 4LL4B 2G2QA 14GSA 3ZITA 1YF1A 4GF0A 1MD3A 1ZGNA 1CQGA 3U6VA 4BA7A 2LTKA 2RM6A 3G7IA 5D9TA 1M7TA 1YKAA 3M8NA 3WGEA 1RK4A 4HQSA 2PN8A 3M9JA 4GWRA 2PUKC 4G9HA 5LD0A 1V9WA 3F6DA 4PNFA 2E0QA 3L9UA 3Q6OA 4WR5A 2A4VA 2JSZA 1SYRA 1PKWA 3IXRA 5DAKB 2LJKA 1LU4A 4P3YB 1XBSA 4TOPA 2ES7A 4JEDA 2LQOA 4HS1A 5ABRA 1YY7A 3A2VA 3IAM2 3Q74A 1DBYA 5H5RA 1U3AA 3CMIA 4POMA 2IIYA 3DWVA 3HJOA 3M0FA 5KN2A 2GZYA 5DJMA 3QMXA 3VURA 1JFUA 1GLQA 4JR4A 1XVQA 2GQLA 3H4KA 5CNWA 3PR8A 4K7NA 1F3AA 1WP0A 1QGVA 2HE3A 4KNDA 4L5LA 1OKDA 1ZCPA 5G1LA 1T4ZA 2ZNMA 3D0ZA 5HFKA 5D9WA 3RPPA 2JU5A 3KJYA 3TOUA 1TTZA 1ST9A 2VLUA 3DGQA 2DIZA 2P5RA 4ZB8A 2HZFA 1SL2B 4KH7A 4DSSB 2DMLA 1WWJA 2V2GA 4XHMA 1K3OA 2F9SA 2RLIA 2LSTA 4NHWA 2IMKA 3IK9A 1MEKA 1SU9A 2O87A 3ZVJD 3GURA 1U87A 2KLXA 5HFGA 4IQ1A 1PQNA 4XTSA 3FZ5A 3EU3A 1URMA 3L9VA 3HA9A 3BBYA 5G1KA 3VK9A 4JE1A 1V58A
chains in the Genus database with same CATH superfamily
4OO5A 4MDCA 2BJXA 1X9MB 2ZCTA 4E8HA 4CHSA 3L9SA 1ERVA 3DD3A 5J4UA 3FEUA 4ZL9A 1BQ7A 1G6YA 3RBTA 3J7Yk 2VUPA 4V1Ag 1SD9A 4KW6A 3LORA 4TN8A 4ZL8A 1X5CA 1GL8A 1Y25A 3FK8A 4YQMA 1SL1B 3G7YA 3TJJA 6GSUA 4TR1B 4OWYA 3CRTA 3VI7A 2TRXA 2F3MA 4IW9A 2XPEA 3APQA 3TKRA 1IYIA 2L5OA 5IMAA 5G30A 4KX4A 2FHEA 2LJAA 4IVFA 2H73A 3EMXA 4ZBAA 3E0UA 3IE3A 3FR9A 4AJ6A 3FZAA 3KH7A 4TXOB 5IMZA 2VD1A 5EPFA 3KGKA 1GLPA 2OACA 1HNCA 3GL5A 3H79A 1JLVA 2E2MA 4EIPA 1R5PA 1T00A 1YEXA 5A4WA 1R26A 1TRWA 4PURA 2H1AA 1GULA 4PQHA 1XOAA 3IRAA 2VM1A 1SJ6A 2YZUA 2HZEA 3A2WA 3IV4A 3W8JA 4Q5NA 3UEMA 3G7JA 4G0IA 3WGDA 3VWVA 1K0DA 4BVXA 3L78A 3GA4A 4O32A 1BX9A 1BYEA 17GSA 3DVWA 2F8FA 4V1Ap 3BCKA 1TXXA 1Z3EA 1NHYA 2HRFA 2IFQB 4RI7A 1RW1A 4HZ4A 2FWHA 7GSSA 2GDRA 2E2GA 2M72A 3UVTA 5INYA 2C0GA 3I43A 1XWKA 1M0UA 5G5FA 3MDKA 1AQWA 3ERGA 4O5UA 3F6FA 4KB3A 4GQFA 3A5IA 1GH2A 4ULXA 3I9V2 3H1NA 3FRCA 1EGOA 4HU7A 1EGRA 2EIOA 2FNOA 4ML1A 4WEYA 5HFIA 1EV4A 3PH9A 4OO4A 2DJKA 1U88A 2YV7A 1BAYA 4HQZA 2J23A 2FWEA 1XW5A 4WKWA 2GS3A 4OFTA 4DVCA 1SKRB 2H1GA 3F4RA 3KD0A 2P5QA 4MJCA 2OE1A 2F51A 2RM5A 1MDIA 6GSWA 5GZZB 2R2JA 3GIXA 1O81A 1PFOA 3MSZA 1QMVA 2IPAA 1ZYNA 4DSQA 2X8CA 3TGZA 2LS5A 2TIRA 2ON7A 3HDCA 4GCIA 2HXKA 1T7PB 4HDEA 1FB0A 2C8UA 1K0MA 5C00A 4ILFA 1YZXA 3DMLA 10GSA 3GTUA 5CAXA 4O5QA 3MWHA 2C0FA 4MA9A 4J2FA 5D73A 3CBUA 3MNGA 1Z6NA 1A8YA 4FYCA 1O73A 2HSHA 1XWAA 2H0GA 3GKXA 1GUMA 1S3AA 4JBBA 4YAPA 1XZOA 4LMVA 3F4SA 1PGTA 1XWGA 2FY6A 3IHQA 3HCZA 4NMUA 2YV9A 4XS6A 1PL1A 2BMXA 4X0XA 2L59A 2HRAA 4TR3A 4I5QA 1XIYA 3W8SA 4EE0A 3F63A 3EVIA 3TKPA 1B4QA 3WT1A 4OMVA 3KH9A 2YWOA 2CA8A 2H74A 3HYPA 3LEFA 3WD6A 1GSEA 1G7EA 1FAAA 4IKHA 1XXUA 3IC8A 3LYKA 3EPTA 4E8EA 4NWYA 5ECMB 2AUVA 3BJ5A 1YJ6A 1M3JA 4KCEA 4BWQA 1NSWA 4MCUA 3C71A 4PUAA 5EVOA 1TRUA 2MYGA 2H30A 3IBHA 9GSSA 1AAZA 5ID2B 2LQQA 1GNWA 2VOCA 1YKCA 3US3A 3IAS2 2CV4A 6GSVA 3EE2A 3GHAA 3D22A 2GTUA 2VCVA 1GP1A 1OKTA 5ECRB 4BPYA 3HJPA 2IN3A 4HI7A 2YWIA 5DCGA 4ID0A 1SL0B 4ZBDA 1O85A 2A2PA 1DUGA 2B7JA 2V6KA 2H0IA 3QAWA 3C7MA 2RIIA 2NTOA 1T4YA 5A4UA 2WZ9A 4F03A 1JZRA 2NDOA 1OE8A 3GKKA 4EDZA 2IJYA 1SENA 3GN3A 3O6TA 1M9BA 5J9BA 2GSRA 3ZL5A 3FKFA 1FOHA 4IJ3A 2X8GA 2O8VB 1GUKA 5F8BA 1QXHA 5JCUA 2LRCA 1G0TA 3DEXA 3M9KA 5ELGA 1FW1A 3GH9A 3QD9A 1XWCA 4H86A 2B6MA 3I69A 1M2DA 4RQRA 5LCZA 3TUEA 3D21A 3FY7A 11GSA 2I4AA 5B6NA 3EU4A 4MZCA 4ZB9A 2CZ2A 2L4CA 1GSUA 2FWGA 3V1WA 5E59A 2WULA 5FT3A 4F9ZA 5KN0A 4KUNA 5HR0A 2DJ3A 3RDWA 4RUVA 4OCFA 1HQOA 1BJXA 5CYYA 3QFBC 1A24A 1ON4A 4AJ8A 3WGXA 4HU9A 3C8EA 2G0FA 1K0OA 4ISDA 1OC8A 1E6BA 1X0RA 1UC7A 2OE0A 1EZKA 1OC9A 3DRNA 4RQXA 2KP1A 3F3RA 5ECSA 3LSZA 22GSA 2PBJA 2K8SA 3KZQA 4YKFA 2VL9A 2R4VA 4JU5A 3VFIA 5DDLA 5IM9A 4KSOA 3DYRA 3E9JB 1W4VA 1BG5A 3TDGA 2NPBA 2V41A 6GSYA 2K6VA 2GT6A 4N30A 1KBNA 3TRPA 4EO3A 4MJBA 5ECNB 1Z9HA 3KMOA 1SK2A 1A2LA 3L4NA 4WETA 4Q5FA 5HQPA 2HLSA 4KA0A 5DQYA 2V32A 4EUYA 2VL2C 4LLRA 4L0UA 1B4PA 3HVNA 1H4OA 4FYUA 1GRXA 5AIXA 2ON5A 4GSTA 3ZVJA 1EV9A 8GSSA 1NHOA 3GSSA 1ZOFA 3KTBA 1PN9A 2H0HA 2DKHA 4N0ZA 4KDUA 2IL3A 1K0AA 3N9JA 1EOHA 1UVZA 1T1VA 1ZYPA 1V57A 3QDNA 5ECIB 2H6ZA 2R0GA 2CAIA 3EINA 2OBIA 4QL9A 1SK0A 2L4QA 4LA1A 5IMVA 1A23A 5DQSA 4ECJA 2VL2A 4KSMA 3A2XA 3GYKA 2OADA 3EYTA 4KF9A 2FCHA 5AN1A 4GSSA 3LFLA 1O7UA 4I2UA 5KOWA 2L5LA 1WIKA 1USBA 1QK8A 2DJ0A 4KCAA 4L0WA 3PPUA 3HVSA 3EMPA 4YQUA 1C72A 4TVEA 4BL7B 3LWAA 1A0RP 3ZIJA 2GGTA 3GL3A 4IHUA 4X1UA 4FH8A 2B5YA 2XHFA 4MK3A 1GTUA 3KMNA 1GSSA 5D96A 2WGRA 2C3NA 4POKA 4MH3A 5H5QA 4KDYA 2PU9C 4EF0A 3APOA 5FWGA 5C04A 1PKZA 3IK7A 2CVBA 3HJMA 2B1KA 2PVOC 4IN0A 4OFNA 2MZCA 4IGJA 3GRXA 2I81A 2Z9SA 1TK8B 4K5SA 3ISOA 4KE3A 2MMZA 3P2AA 3HKRA 3S9FA 2LEGA 1ILOA 2WDUA 4MMMA 2H6YA 2JADA 3D6IA 3L0HA 3LW9A 5DAKA 2R6KA 1EWXA 1X5EA 1X5DA 2HRKA 4IJIA 4J56E 1M2AA 1SKSB 2I9HA 3FZ4A 5EY6A 2C80A 2X64A 4G2EA 3FR6A 3FZ9A 2M80A 4MPFA 2PWJA 5DBQA 1TJDA 4XS4B 1EP7A 3N5OA 5ECHB 5JWQB 4WR4A 3GNJA 3VWXA 2VLVA 4Z2UA 5FHIA 1F6MC 3LQ7A 2AHEA 4V2NA 3P8WA 2B5XA 2P31A 3FHKA 2MMNA 4V2MA 2JSYA 2A2SA 3GFKA 4MLYA 2YANA 4V2LA 2QGVA 1K0BA 2C3TA 4N0VA 3DKSA 5DALB 1O6JA 1PX6A 1WPIA 5CRWA 3D5JA 3M3MA 3F4TA 1WMJA 3UIWA 4BVYA 1ERWA 2H1DA 2CZ3A 2HNLA 4NAXA 2WCIA 5AGYA 1OYJA 2R3XA 5CO3A 3ZZXA 5J41A 2PPTA 2EIQA 3ZTLA 1GTBA 2B7KA 2C0EA 3ZMKA 5IPGA 3WT2A 5G31A 1ZYEA 2BTOT 3VI5A 1E2YA 4HJMA 1Z6MA 5ECPB 4YAVA 2VAFA 1THOA 2FA4A 3UARA 3O76A 4MF5A 1F9MA 4O7HA 1K0CA 2PVQA 5DCHA 2VIMA 2L6DA 3TKSC 4ECIA 2H01A 1SKWB 1GSFA 3F3QA 2WRTA 1T8EB 2OA7A 5DJLA 4PQIA 2GLRA 3H93A 2WB9A 5ECOB 1FOVA 1G6WA 2JZRA 4TR1A 4IQAA 2HSMA 1TI3A 2VO4A 2YWMA 1UN2A 1DE1A 2GZZA 4WXTA 4FO5A 1I5GA 3EWLA 3IPZA 4WF4A 4GLTA 6GSXA 3HD5A 4DSRA 4K7OA 1PD21 2K9FA 4TXOA 3GH6A 5ELAA 3CRUA 3TKSE 3TOTA 4LMWA 1TI1A 3UAPA 1X9SB 2MMAA 2FUG2 3TKSA 5COHA 2H19A 3VWWA 3UOMA 1R5AA 4A5PA 4HJ2A 2GT5A 3P90A 1FG4A 1ERUA 1ZMAA 3AY8A 4IP1A 4PUFC 5L71A 5JWOB 2LNTA 2IWTA 3KP9A 3Q18A 2GSSA 4K0GA 2WJUA 2YJ7A 1M9AA 2X99A 2C1YA 4NV2A 5IQYA 5CRHA 2DJ2A 3UJ1A 1TRVA 3UBLA 1SD8A 4ZBBA 1SYXA 2IFQA 3TJKA 4KAEA 1JLWA 2AV4A 1LBKA 4JRRA 2YN1A 3SWLA 1QFNA 3VPQA 3QAVA 5IOWA 2YOIA 1IYHA 3WYWA 4EC0A 3EC3A 4FYBA 4IP6A 4ZIJA 3GMFA 3KM6A 4K8MA 3BCIA 3ERWA 1U3IA 1ZZYA 1GUHA 5F06A 2GSTA 4IELA 1SJIA 4FIWA 3DIEA 2CT6A 5ECQB 3G9BA 3LG6A 2VCQA 5A4VA 3GX8A 2AYTA 2OE3A 4IBPA 1B9XC 1XW6A 4WBRD 1TP9A 4GSNA 4O92A 3RPNA 3MIXA 4K9ZA 5AISA 3TJFA 1XG8A 3KTLA 2VLTA 3GKMA 1WRYA 1LJRA 2CVDA 2R5GA 3F0IA 1YQ1A 2X8HA 1UA5A 4HUAA 2AB6A 3TRXA 2CX3A 4PXOA 4DEJA 4NHZA 5F05A 5D9VA 1ZL9A 2R0CA 2F8AA 3EURA 1EEJA 1AW9A 1SJZA 4FQUA 4MJAA 5IMCA 3LXZA 1U6TA 1R7HA 4K1FA 3ZFLA 3NZNA 4BWSA 2TRCP 2KOKA 1SK1A 1MD4A 4WBJA 4HOJA 2R0PA 2FD3A 4MZWA 2N5BA 2CQ9A 3Q19A 2OBKA 2MBTA 5ECKB 2HT9A 3RHBA 4TR0A 5HR2A 4D73A 3GKNA 4TRXA 1XOBA 4Z7XA 16GSA 2D2ZA 3LJRA 4EKZA 1OAZA 2XPDA 3HZ8A 3VWUA 5BMUA 6GSSA 3HVXA 1HNBA 1MTCA 1TRSA 2VCXA 2H76A 3C1RA 1ML6A 4OCEA 5ID2A 4EDYA 4OD7A 4IS0A 3GV1A 5KEJA 4F2IA 3CSJA 4G10A 3MAKA 4MJEA 1N8JA 5D9XA 4XRDA 1RQMA 4XIHA 1TU7A 5GSSA 3ZYWA 1MDJA 1O8XA 4POBA 4ZILA 1S3CA 3APSA 3CYNA 3GUSA 1A2JA 2QKEA 1Z7RA 3FR3A 4ML6A 3LGCA 1WJKA 4USSA 4K0NA 4XRAA 2IMFA 2V6OA 5EL8A 5IMFA 4K2DA 2CX4A 3DXBA 3ME8A 3C73A 4RI6A 2DMMA 2FGXA 2YWNA 5B6MA 4TKYA 4EVMA 2PMTA 3K8NA 2VD0A 5JCWA 2HZEB 4Q5QA 4YKGA 3M1GA 1A2MA 4KDXA 3A3TA 4JZQA 1AQVA 1OVNA 1F2EA 2DJ1A 1VF3A 4BVXB 4PTSA 4K2XA 5CP1A 3KXOA 2ALBA 3KP8A 2LUSA 1JZOA 1M99A 3OR5A 3CQFA 1A0FA 2DSAA 2LRNA 4K5RA 4MZBA 2OJLA 1FB6A 1JHBA 5F0GA 2HI7A 1Z7PA 4Z2RA 3SBCA 3KCMA 2PGTA 13GSA 2VCWA 4EL1A 5G2ZA 1Q98A 3HY2A 2FWFA 4GRFA 3ZRDA 2NBSA 4GXZA 1PMTA 2RUFA 1TKDB 4ECCA 1K3LA 3ZFBA 2H75A 2IMIA 3KEBA 4I8BA 2VCTA 2A4HA 2B5EA 2L57A 3GSTA 2XBIA 1GTIA 3QPMA 2GVPA 5KN3A 2LRTA 1GWCA 4MH2A 2VL3A 5G5EA 2GQMA 5CRDA 3JCML 2JZTA 1MDKA 3R3EA 4POLA 2P0GA 3ZLPA 1B48A 1TW9A 2N5FA 3H8QA 5A5KA 4PQ1A 1K0NA 3TRQA 2H71A 3ME7A 1A8LA 1GNEA 1S3RA 2PERA 2LJRA 3BD2A 4G0KA 2ZUPA 1I9DA 4F82A 3RAZA 4L5OA 2AAWA 2IMDA 3R2QA 3A5WA 4MPGA 4ZXGA 2YP6A 3GTUB 2R37A 1HNAA 1T3BA 3IOSA 1YDKA 2YCDA 2GZPA 4N11A 2EIRA 1Z5YE 2LKUA 3J7Yb 4MF7A 2KUCA 1Q4JA 2A2RA 4GQCA 1AIUA 1O8WA 3W6GA 5GAPD 3HVVA 2X4AA 5D93A 2QSIA 3QCPA 1GSQA 1PSQA 5IOXA 1PN0A 3HHVA 20GSA 5J5NA 3CTFA 4XS1A 5F07A 1HD2A 3ERFA 2RUEA 2V1MA 1BEDA 3CTGA 5GSTA 4X43A 3ZMLA 5CRGA 5J3RA 1EOGA 4CW9A 4O5RA 3UL3A 2FA8A 2KP2A 18GSA 1VF1A 3HZ4A 4OFMA 5H5SA 4F0BA 1QQ2A 2C3QA 1OC3A 3IC4A 3LXTA 4ZB6A 2I3YA 4K7IA 6GSTA 5AIVA 4BL7A 2LNSA 4DSSA 5BRTA 1J0FA 3TKQA 1DE2A 3HXSA 2YZHA 3KIJA 2E7PA 2QC7A 4HEA2 1EEMA 4ACSA 2B3SA 4G0LA 2QA2A 1V2AA 3DVXA 4L8EA 4PNGA 3O3TA 1FHEA 2K8VA 2O89A 4TXVA 5ECLB 3FW2A 2O85A 1FVJA 3BOAA 3TJGA 2MMOA 3D4TA 4ICYA 5KN1A 4X4JA 4YH2A 4I2TA 2IMEA 2QA1A 4TR4A 4CY8A 2L6CA 4XCSA 1ABAA 3PGTA 2XBQA 4EXJA 1XVWA 3CSIA 5IO0A 4YQVA 1AC1A 1XCCA 3ZREA 3D4MA 2DBCA 1VGLA 2VCZA 4CDOA 2DIYA 2GSQA 3GX0A 4ECBA 2FLSA 2UZ8A 2YPMA 3QR6A 19GSA 3IDVA 1ZYQB 1JZDA 3UBKA 1AQXA 2C4JA 2J9HA 2C0DA 4KGIA 4Z2TA 2DJJA 2GQKA 1M3IA 1V40A 1KTEA 1GTAA 12GSA 4NXIA 1N2AA 3TCOA 4HZ2A 1HYUA 2I1UA 1WOUA 2O7KA 4ZL7A 3E3EA 2H1BA 3VLNA 4AF2A 2JL4A 4NPBA 2HRNA 2H66A 1VRSD 2K18A 5KOXA 3QAGA 4F0CA 4N10A 2DC5A 5DVBA 2NVLA 1XWBA 1ERTA 4G19A 3PINA 5IMDA 1TK0B 4XS4A 4TW5A 4MP4A 2CAQA 3F8UA 2AJQB 4MABA 1PA3A 3FYGA 4QQ7A 3IR4A 1OC9B 1K3YA 1AUCA 4LL1B 1EP8A 4AJ7A 3ZIVA 1THXA 2YJHA 1J08A 5HR1A 2H6XA 4D73B 4WF5A 2MBSA 1VF2A 2EC4A 1TK5B 5DALA 1DSBA 3VPTA 2REMA 4MF6A 1OE7A 4I97A 3MYDA 3CXGA 1FO5A 1W89A 3QFAC 3F9UA 4HSCX 3I6AA 1F37A 3ED3A 1JZWA 2HSYA 4NV5A 1NW2A 1KEBA 1M2BA 3NIVA 5CREA 2DLXA 3CSHA 1B9YC 5E4WA 2H8LA 3QOUA 1S3DA 2B1LA 3IHGA 1TU8A 1XPVA 2N5AA 1X9WB 5B8AA 4CY6A 5J9CA 3FMWA 4I6XA 2H70A 1G7OA 1R4WA 1XW9A 4JR6A 5LNKe 1NM3A 2HFDA 5D8IA 3UMAA 2YNXA 1F3BA 1TOFA 5ENUA 1AXDA 2OKAA 1H75A 2WFCA 1GSYA 2JACA 2WS2A 1FVKA 5JWRB 1WE0A 2DKIA 2VM2A 3P7XA 2HYXA 5JCGA 4K6XA 5IIZA 2JZSA 3NOFA 1Y6EA 1V98A 1CQHA 5GAND 1J9BA 4Q5RA 3UVHA 5HR3A 1PRXA 1YF0A 1TDIA 3TB2A 4PX1A 1QUWA 3U5RE 5B8BA 1GSDA 3IA1A 1B8XA 2M46A 4J57E 2KHPA 2XC2A 2H72A 1ACVA 3LYPA 3C1SA 1XFLA 5B7CA 4QL7A 3RHCA 5IPHA 4AGSA 4GTUA 1YEPA 4PGTA 2CVKA 2LV3A 1PX7A 5IO2A 1KNGA 1VF4A 3TJBA 1PL2A 4LL4B 2G2QA 14GSA 3ZITA 1YF1A 4GF0A 1MD3A 1ZGNA 1CQGA 3U6VA 4BA7A 2LTKA 2RM6A 3G7IA 5D9TA 1M7TA 1YKAA 3M8NA 3WGEA 1RK4A 4HQSA 2PN8A 3M9JA 4GWRA 2PUKC 4G9HA 5LD0A 1V9WA 3F6DA 4PNFA 2E0QA 3L9UA 3Q6OA 4WR5A 2A4VA 2JSZA 1SYRA 1PKWA 3IXRA 5DAKB 2LJKA 1LU4A 4P3YB 1XBSA 4BIKA 4TOPA 2ES7A 4JEDA 2LQOA 4HS1A 5ABRA 1YY7A 3A2VA 3IAM2 3Q74A 1DBYA 5H5RA 2X49A 1U3AA 3CMIA 4POMA 2IIYA 3DWVA 3HJOA 3M0FA 5KN2A 2GZYA 5DJMA 3QMXA 3VURA 1JFUA 1GLQA 4JR4A 1XVQA 5CNWA 2GQLA 3H4KA 3PR8A 4K7NA 1F3AA 1WP0A 1QGVA 2HE3A 4KNDA 4L5LA 1OKDA 1ZCPA 5G1LA 1T4ZA 2ZNMA 3D0ZA 5HFKA 5D9WA 3RPPA 2JU5A 3KJYA 3TOUA 1TTZA 1ST9A 2VLUA 3DGQA 2DIZA 2P5RA 4ZB8A 4BVYB 2HZFA 1SL2B 4KH7A 4DSSB 2DMLA 1WWJA 2V2GA 4XHMA 1K3OA 2F9SA 2RLIA 2LSTA 4NHWA 2IMKA 3IK9A 1MEKA 1SU9A 2O87A 3ZVJD 3GURA 1U87A 2KLXA 5HFGA 4IQ1A 1PQNA 4XTSA 3FZ5A 4EIQA 3EU3A 1URMA 3L9VA 3HA9A 3BBYA 4MNNA 5G1KA 3VK9A 4JE1A 1V58A
chains in the Genus database with same CATH topology
4OO5A 4MDCA 2BJXA 1X9MB 2ZCTA 4E8HA 4CHSA 3L9SA 1ERVA 3DD3A 5J4UA 3FEUA 4ZL9A 1BQ7A 1G6YA 3RBTA 3J7Yk 2VUPA 4V1Ag 1SD9A 4KW6A 3LORA 4TN8A 4ZL8A 1X5CA 1GL8A 1Y25A 3FK8A 4YQMA 1SL1B 3G7YA 3TJJA 6GSUA 4TR1B 4OWYA 3CRTA 3VI7A 2TRXA 2F3MA 4IW9A 2XPEA 3APQA 3TKRA 1IYIA 2L5OA 5IMAA 5G30A 4KX4A 2FHEA 2LJAA 4IVFA 2H73A 3EMXA 4ZBAA 3E0UA 3IE3A 3FR9A 4AJ6A 3FZAA 3KH7A 4TXOB 5IMZA 2VD1A 5EPFA 3KGKA 1GLPA 2OACA 1HNCA 3GL5A 3H79A 1JLVA 2E2MA 4EIPA 1R5PA 1T00A 1YEXA 5A4WA 1R26A 1TRWA 4PURA 2H1AA 1GULA 4PQHA 1XOAA 3IRAA 2VM1A 1SJ6A 2YZUA 2HZEA 3A2WA 3IV4A 3W8JA 4Q5NA 3UEMA 3G7JA 4G0IA 3WGDA 3VWVA 1K0DA 4BVXA 3L78A 3GA4A 4O32A 1BX9A 1BYEA 17GSA 3DVWA 2F8FA 4V1Ap 3BCKA 1TXXA 1Z3EA 1NHYA 2HRFA 2IFQB 4RI7A 1RW1A 4HZ4A 2FWHA 7GSSA 2GDRA 2E2GA 2M72A 3UVTA 5INYA 2C0GA 3I43A 1XWKA 1M0UA 5G5FA 3MDKA 1AQWA 3ERGA 4O5UA 3F6FA 4KB3A 4GQFA 3A5IA 1GH2A 4ULXA 3I9V2 3H1NA 3FRCA 1EGOA 4HU7A 1EGRA 2EIOA 2FNOA 4ML1A 4WEYA 5HFIA 1EV4A 3PH9A 4OO4A 2DJKA 1U88A 2YV7A 1BAYA 4HQZA 2J23A 2FWEA 1XW5A 4WKWA 2GS3A 4OFTA 4DVCA 1SKRB 2H1GA 3F4RA 3KD0A 2P5QA 4MJCA 2OE1A 2F51A 2RM5A 1MDIA 6GSWA 5GZZB 2R2JA 3GIXA 1O81A 3MSZA 1QMVA 2IPAA 1ZYNA 4DSQA 2X8CA 3TGZA 2LS5A 2TIRA 2ON7A 3HDCA 4GCIA 2HXKA 1T7PB 4HDEA 1FB0A 2C8UA 1K0MA 5C00A 4ILFA 1YZXA 3DMLA 10GSA 3GTUA 5CAXA 4O5QA 3MWHA 2C0FA 4MA9A 4J2FA 5D73A 3CBUA 3MNGA 1Z6NA 1A8YA 4FYCA 1O73A 2HSHA 1XWAA 2H0GA 3GKXA 1GUMA 1S3AA 4JBBA 4YAPA 1XZOA 4LMVA 3F4SA 1PGTA 1XWGA 2FY6A 3IHQA 3HCZA 4NMUA 2YV9A 4XS6A 1PL1A 2BMXA 4X0XA 2L59A 2HRAA 4TR3A 4I5QA 1XIYA 3W8SA 4EE0A 3F63A 3EVIA 3TKPA 1B4QA 3WT1A 4OMVA 3KH9A 2YWOA 2CA8A 2H74A 3HYPA 3LEFA 3WD6A 1GSEA 1G7EA 1FAAA 4IKHA 1XXUA 3IC8A 3LYKA 3EPTA 4E8EA 4NWYA 5ECMB 2AUVA 3BJ5A 1YJ6A 4BWQA 4KCEA 1NSWA 4MCUA 3C71A 4PUAA 5EVOA 1TRUA 2MYGA 2H30A 3IBHA 9GSSA 1AAZA 5ID2B 2LQQA 1GNWA 2VOCA 1YKCA 3US3A 3IAS2 2CV4A 6GSVA 3EE2A 3GHAA 3D22A 2GTUA 2VCVA 1GP1A 1OKTA 5ECRB 4BPYA 3HJPA 2IN3A 4HI7A 2YWIA 5DCGA 4ID0A 1SL0B 4ZBDA 1O85A 2A2PA 1DUGA 2B7JA 2V6KA 2H0IA 3QAWA 3C7MA 2RIIA 2NTOA 1T4YA 5A4UA 2WZ9A 4F03A 1JZRA 2NDOA 1OE8A 3GKKA 4EDZA 2IJYA 1SENA 3GN3A 3O6TA 1M9BA 5J9BA 2GSRA 3ZL5A 3FKFA 1FOHA 4IJ3A 2X8GA 2O8VB 1GUKA 5F8BA 1QXHA 5JCUA 2LRCA 1G0TA 3DEXA 3M9KA 5ELGA 1FW1A 3GH9A 3QD9A 1XWCA 4H86A 2B6MA 3I69A 1M2DA 4RQRA 5LCZA 3TUEA 3D21A 3FY7A 11GSA 2I4AA 5B6NA 3EU4A 4MZCA 4ZB9A 2CZ2A 2L4CA 1GSUA 2FWGA 3V1WA 5E59A 2WULA 5FT3A 4F9ZA 5KN0A 4KUNA 5HR0A 2DJ3A 3RDWA 4RUVA 4OCFA 1HQOA 1BJXA 5CYYA 3QFBC 1A24A 1ON4A 4AJ8A 3WGXA 4HU9A 3C8EA 2G0FA 1K0OA 4ISDA 1OC8A 1E6BA 1X0RA 1UC7A 2OE0A 1EZKA 1OC9A 3DRNA 4RQXA 2KP1A 3F3RA 5ECSA 3LSZA 22GSA 2PBJA 2K8SA 3KZQA 4YKFA 2VL9A 2R4VA 4JU5A 3VFIA 5DDLA 5IM9A 4KSOA 3DYRA 3E9JB 1W4VA 1BG5A 3TDGA 2NPBA 2V41A 6GSYA 2K6VA 2GT6A 4N30A 1KBNA 3TRPA 4EO3A 4MJBA 5ECNB 1Z9HA 3KMOA 1SK2A 1A2LA 3L4NA 4WETA 4Q5FA 5HQPA 2HLSA 4KA0A 5DQYA 2V32A 4EUYA 2VL2C 4LLRA 4L0UA 1B4PA 1H4OA 4FYUA 1GRXA 5AIXA 2ON5A 4GSTA 3ZVJA 1EV9A 8GSSA 1NHOA 3GSSA 1ZOFA 3KTBA 1PN9A 2H0HA 2DKHA 4N0ZA 4KDUA 2IL3A 1K0AA 3N9JA 1EOHA 1UVZA 1T1VA 1ZYPA 1V57A 3QDNA 5ECIB 2H6ZA 2R0GA 2CAIA 3EINA 2OBIA 4QL9A 1SK0A 2L4QA 4LA1A 5IMVA 1A23A 5DQSA 4ECJA 2VL2A 4KSMA 3A2XA 3GYKA 2OADA 3EYTA 4KF9A 2FCHA 5AN1A 4GSSA 3LFLA 1O7UA 4I2UA 5KOWA 2L5LA 1WIKA 1USBA 1QK8A 2DJ0A 4KCAA 4L0WA 3PPUA 3HVSA 3EMPA 4YQUA 1C72A 4TVEA 4BL7B 3LWAA 1A0RP 3ZIJA 2GGTA 3GL3A 4IHUA 4X1UA 4FH8A 2B5YA 2XHFA 4MK3A 1GTUA 3KMNA 1GSSA 5D96A 2WGRA 2C3NA 4POKA 4MH3A 5H5QA 4KDYA 2PU9C 4EF0A 3APOA 5FWGA 5C04A 1PKZA 3IK7A 2CVBA 3HJMA 2B1KA 2PVOC 4IN0A 4OFNA 2MZCA 4IGJA 3GRXA 2I81A 2Z9SA 1TK8B 4K5SA 3ISOA 4KE3A 2MMZA 3P2AA 3HKRA 3S9FA 2LEGA 1ILOA 2WDUA 4MMMA 2H6YA 2JADA 3D6IA 3L0HA 3LW9A 5DAKA 2R6KA 1EWXA 1X5EA 1X5DA 2HRKA 4IJIA 4J56E 1M2AA 1SKSB 2I9HA 3FZ4A 5EY6A 2C80A 2X64A 4G2EA 3FR6A 3FZ9A 2M80A 4MPFA 2PWJA 5DBQA 1TJDA 4XS4B 1EP7A 3N5OA 5ECHB 5JWQB 4WR4A 3GNJA 3VWXA 2VLVA 4Z2UA 5FHIA 1F6MC 3LQ7A 2AHEA 4V2NA 3P8WA 2B5XA 2P31A 3FHKA 2MMNA 4V2MA 2JSYA 2A2SA 3GFKA 4MLYA 2YANA 4V2LA 2QGVA 1K0BA 2C3TA 4N0VA 3DKSA 5DALB 1O6JA 1PX6A 1WPIA 5CRWA 3D5JA 3M3MA 3F4TA 1WMJA 3UIWA 4BVYA 1ERWA 2H1DA 2CZ3A 2HNLA 4NAXA 2WCIA 5AGYA 1OYJA 2R3XA 5CO3A 3ZZXA 5J41A 2PPTA 2EIQA 3ZTLA 1GTBA 2B7KA 2C0EA 3ZMKA 5IPGA 3WT2A 5G31A 1ZYEA 2BTOT 3VI5A 1E2YA 4HJMA 1Z6MA 5ECPB 4YAVA 2VAFA 1THOA 2FA4A 3UARA 3O76A 4MF5A 1F9MA 4O7HA 1K0CA 2PVQA 5DCHA 2VIMA 2L6DA 3TKSC 4ECIA 2H01A 1SKWB 1GSFA 3F3QA 2WRTA 1T8EB 2OA7A 5DJLA 4PQIA 2GLRA 3H93A 2WB9A 5ECOB 1FOVA 1G6WA 2JZRA 4TR1A 4IQAA 2HSMA 1TI3A 2VO4A 2YWMA 1UN2A 1DE1A 2GZZA 4WXTA 4FO5A 1I5GA 3EWLA 3IPZA 4WF4A 4GLTA 6GSXA 3HD5A 4DSRA 4K7OA 1PD21 2K9FA 4TXOA 3GH6A 5ELAA 3CRUA 3TKSE 3TOTA 4LMWA 1TI1A 3UAPA 1X9SB 2MMAA 2FUG2 3TKSA 5COHA 2H19A 3VWWA 3UOMA 1R5AA 4A5PA 4HJ2A 2GT5A 3P90A 1FG4A 1ERUA 1ZMAA 3AY8A 4IP1A 4PUFC 5L71A 5JWOB 2LNTA 2IWTA 3KP9A 3Q18A 2GSSA 4K0GA 2WJUA 2YJ7A 1M9AA 2X99A 2C1YA 4NV2A 5IQYA 5CRHA 2DJ2A 3UJ1A 1TRVA 3UBLA 1SD8A 4ZBBA 1SYXA 2IFQA 3TJKA 4KAEA 1JLWA 2AV4A 1LBKA 4JRRA 2YN1A 3SWLA 1QFNA 3VPQA 3QAVA 5IOWA 2YOIA 1IYHA 3WYWA 4EC0A 3EC3A 4FYBA 4IP6A 4ZIJA 3GMFA 3KM6A 4K8MA 3BCIA 3ERWA 1U3IA 1ZZYA 1GUHA 5F06A 2GSTA 4IELA 1SJIA 4FIWA 3DIEA 2CT6A 5ECQB 3G9BA 3LG6A 2VCQA 5A4VA 3GX8A 2AYTA 2OE3A 4IBPA 1B9XC 1XW6A 4WBRD 1TP9A 4GSNA 4O92A 3RPNA 3MIXA 4K9ZA 5AISA 3TJFA 3KTLA 2VLTA 3GKMA 1WRYA 1LJRA 2CVDA 2R5GA 3F0IA 1YQ1A 2X8HA 1UA5A 4HUAA 2AB6A 3TRXA 2CX3A 4PXOA 4DEJA 4NHZA 5F05A 5D9VA 1ZL9A 2R0CA 2F8AA 3EURA 1EEJA 1AW9A 1SJZA 4FQUA 4MJAA 5IMCA 3LXZA 1U6TA 1R7HA 4K1FA 3ZFLA 3NZNA 4BWSA 2TRCP 2KOKA 1SK1A 1MD4A 4WBJA 4HOJA 2R0PA 2FD3A 4MZWA 2N5BA 2CQ9A 3Q19A 2OBKA 2MBTA 5ECKB 2HT9A 3RHBA 4TR0A 5HR2A 4D73A 3GKNA 4TRXA 1XOBA 4Z7XA 16GSA 2D2ZA 3LJRA 4EKZA 1OAZA 2XPDA 3HZ8A 3VWUA 5BMUA 6GSSA 3HVXA 1HNBA 1MTCA 1TRSA 2VCXA 2H76A 3C1RA 1ML6A 4OCEA 5ID2A 4EDYA 4OD7A 4IS0A 3GV1A 5KEJA 4F2IA 3CSJA 4G10A 3MAKA 4MJEA 1N8JA 5D9XA 4XRDA 1RQMA 4XIHA 1TU7A 5GSSA 3ZYWA 1MDJA 1O8XA 4POBA 4ZILA 1S3CA 3APSA 3CYNA 3GUSA 1A2JA 2QKEA 1Z7RA 3FR3A 4ML6A 3LGCA 1WJKA 4USSA 4K0NA 4XRAA 2IMFA 2V6OA 5EL8A 5IMFA 4K2DA 2CX4A 3DXBA 3ME8A 3C73A 4RI6A 2DMMA 2FGXA 2YWNA 5B6MA 4TKYA 4EVMA 2PMTA 3K8NA 2VD0A 5JCWA 2HZEB 4Q5QA 4YKGA 3M1GA 1A2MA 4KDXA 3A3TA 4JZQA 1AQVA 1OVNA 1F2EA 2DJ1A 1VF3A 4BVXB 4PTSA 4K2XA 5CP1A 3KXOA 2ALBA 3KP8A 2LUSA 1JZOA 1M99A 3OR5A 1A0FA 2DSAA 2LRNA 4K5RA 4MZBA 2OJLA 1FB6A 1JHBA 5F0GA 2HI7A 1Z7PA 4Z2RA 3SBCA 3KCMA 2PGTA 13GSA 2VCWA 4EL1A 5G2ZA 1Q98A 3HY2A 2FWFA 4GRFA 3ZRDA 2NBSA 4GXZA 1PMTA 2RUFA 1TKDB 4ECCA 1K3LA 3ZFBA 2H75A 2IMIA 3KEBA 4I8BA 2VCTA 2A4HA 2B5EA 2L57A 3GSTA 2XBIA 1GTIA 3QPMA 2GVPA 5KN3A 2LRTA 1GWCA 4MH2A 2VL3A 5G5EA 2GQMA 5CRDA 3JCML 2JZTA 1MDKA 3R3EA 4POLA 2P0GA 3ZLPA 1B48A 1TW9A 2N5FA 3H8QA 5A5KA 4PQ1A 1K0NA 3TRQA 2H71A 3ME7A 1A8LA 1GNEA 2PERA 2LJRA 3BD2A 4G0KA 2ZUPA 1I9DA 4F82A 3RAZA 4L5OA 2AAWA 2IMDA 3R2QA 3A5WA 4MPGA 4ZXGA 2YP6A 3GTUB 2R37A 1HNAA 1T3BA 3IOSA 1YDKA 2YCDA 2GZPA 4N11A 2EIRA 1Z5YE 2LKUA 3J7Yb 4MF7A 2KUCA 1Q4JA 2A2RA 4GQCA 1AIUA 1O8WA 3W6GA 5GAPD 3HVVA 2X4AA 5D93A 2QSIA 3QCPA 1GSQA 1PSQA 5IOXA 1PN0A 3HHVA 20GSA 5J5NA 3CTFA 4XS1A 5F07A 1HD2A 3ERFA 2RUEA 2V1MA 1BEDA 3CTGA 5GSTA 4X43A 3ZMLA 5CRGA 5J3RA 1EOGA 4CW9A 4O5RA 3UL3A 2FA8A 2KP2A 18GSA 1VF1A 3HZ4A 4OFMA 5H5SA 4F0BA 1QQ2A 2C3QA 1OC3A 3IC4A 3LXTA 4ZB6A 2I3YA 4K7IA 6GSTA 5AIVA 4BL7A 2LNSA 4DSSA 5BRTA 1J0FA 3TKQA 1DE2A 3HXSA 2YZHA 3KIJA 2E7PA 2QC7A 4HEA2 1EEMA 4ACSA 2B3SA 4G0LA 2QA2A 1V2AA 3DVXA 4L8EA 4PNGA 3O3TA 1FHEA 2K8VA 2O89A 4TXVA 5ECLB 3FW2A 2O85A 1FVJA 3BOAA 3TJGA 2MMOA 3D4TA 4ICYA 5KN1A 4X4JA 4YH2A 4I2TA 2IMEA 2QA1A 4TR4A 4CY8A 2L6CA 4XCSA 1ABAA 3PGTA 2XBQA 4EXJA 1XVWA 3CSIA 5IO0A 4YQVA 1AC1A 1XCCA 3ZREA 3D4MA 2DBCA 1VGLA 2VCZA 4CDOA 2DIYA 2GSQA 3GX0A 4ECBA 2FLSA 2UZ8A 2YPMA 3QR6A 19GSA 3IDVA 1ZYQB 1JZDA 3UBKA 1AQXA 2C4JA 2J9HA 2C0DA 4KGIA 4Z2TA 2DJJA 2GQKA 1V40A 1KTEA 1GTAA 12GSA 4NXIA 1N2AA 3TCOA 4HZ2A 1HYUA 2I1UA 1WOUA 2O7KA 4ZL7A 3E3EA 2H1BA 3VLNA 4AF2A 2JL4A 4NPBA 2HRNA 2H66A 1VRSD 2K18A 5KOXA 3QAGA 4F0CA 4N10A 2DC5A 5DVBA 2NVLA 1XWBA 1ERTA 4G19A 3PINA 5IMDA 1TK0B 4XS4A 4TW5A 4MP4A 2CAQA 3F8UA 2AJQB 4MABA 1PA3A 3FYGA 4QQ7A 3IR4A 1OC9B 1K3YA 1AUCA 4LL1B 1EP8A 4AJ7A 3ZIVA 1THXA 2YJHA 1J08A 5HR1A 2H6XA 4D73B 4WF5A 2MBSA 1VF2A 2EC4A 1TK5B 5DALA 1DSBA 3VPTA 2REMA 4MF6A 1OE7A 4I97A 3MYDA 3CXGA 1FO5A 1W89A 3QFAC 3F9UA 3I6AA 1F37A 3ED3A 1JZWA 2HSYA 4NV5A 1NW2A 1KEBA 1M2BA 3NIVA 5CREA 2DLXA 3CSHA 1B9YC 5E4WA 2H8LA 3QOUA 1S3DA 2B1LA 3IHGA 1TU8A 1XPVA 2N5AA 1X9WB 5B8AA 4CY6A 5J9CA 3FMWA 4I6XA 2H70A 1G7OA 1R4WA 1XW9A 4JR6A 5LNKe 1NM3A 2HFDA 5D8IA 3UMAA 2YNXA 1F3BA 1TOFA 5ENUA 1AXDA 2OKAA 1H75A 2WFCA 1GSYA 2JACA 2WS2A 1FVKA 5JWRB 1WE0A 2DKIA 2VM2A 3P7XA 2HYXA 5JCGA 4K6XA 5IIZA 2JZSA 3NOFA 1Y6EA 1V98A 1CQHA 5GAND 1J9BA 4Q5RA 3UVHA 5HR3A 1PRXA 1YF0A 1TDIA 3TB2A 4PX1A 1QUWA 3U5RE 5B8BA 1GSDA 3IA1A 1B8XA 2M46A 4J57E 2KHPA 2XC2A 2H72A 1ACVA 3LYPA 3C1SA 1XFLA 5B7CA 4QL7A 3RHCA 5IPHA 4AGSA 4GTUA 1YEPA 4PGTA 2CVKA 2LV3A 1PX7A 5IO2A 1KNGA 1VF4A 3TJBA 1PL2A 4LL4B 2G2QA 14GSA 3ZITA 1YF1A 4GF0A 1MD3A 1ZGNA 1CQGA 3U6VA 4BA7A 2LTKA 2RM6A 3G7IA 5D9TA 1M7TA 1YKAA 3M8NA 3WGEA 1RK4A 4HQSA 2PN8A 3M9JA 4GWRA 2PUKC 4G9HA 5LD0A 1V9WA 3F6DA 4PNFA 2E0QA 3L9UA 3Q6OA 4WR5A 2A4VA 2JSZA 1SYRA 1PKWA 3IXRA 5DAKB 2LJKA 1LU4A 4P3YB 1XBSA 4TOPA 2ES7A 4JEDA 2LQOA 4HS1A 5ABRA 1YY7A 3A2VA 3IAM2 3Q74A 1DBYA 5H5RA 2X49A 1U3AA 3CMIA 4POMA 2IIYA 3DWVA 3HJOA 3M0FA 5KN2A 2GZYA 5DJMA 3QMXA 3VURA 1JFUA 1GLQA 4JR4A 1XVQA 5CNWA 2GQLA 3H4KA 3PR8A 4K7NA 1F3AA 1WP0A 1QGVA 2HE3A 4KNDA 4L5LA 1OKDA 1ZCPA 5G1LA 1T4ZA 2ZNMA 3D0ZA 5HFKA 5D9WA 3RPPA 2JU5A 3KJYA 3TOUA 1TTZA 1ST9A 2VLUA 3DGQA 2DIZA 2P5RA 4ZB8A 4BVYB 2HZFA 1SL2B 4KH7A 4DSSB 2DMLA 1WWJA 2V2GA 4XHMA 1K3OA 2F9SA 2RLIA 2LSTA 4NHWA 2IMKA 3IK9A 1MEKA 1SU9A 2O87A 3ZVJD 3GURA 1U87A 2KLXA 5HFGA 4IQ1A 1PQNA 4XTSA 3FZ5A 4EIQA 3EU3A 1URMA 3L9VA 3HA9A 3BBYA 4MNNA 5G1KA 3VK9A 4JE1A 1V58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO5 A;  4MDC A;  2BJX A;  1X9M B;  2ZCT A;  4E8H A;  4CHS A;  3L9S A;  1ERV A;  3DD3 A;  5J4U A;  3FEU A;  4ZL9 A;  1BQ7 A;  1G6Y A;  3RBT A;  3J7Y k;  2VUP A;  4V1A g;  1SD9 A;  4KW6 A;  3LOR A;  4TN8 A;  4ZL8 A;  1X5C A;  1GL8 A;  1Y25 A;  3FK8 A;  4YQM A;  1SL1 B;  3G7Y A;  3TJJ A;  6GSU A;  4TR1 B;  4OWY A;  3CRT A;  3VI7 A;  2TRX A;  2F3M A;  4IW9 A;  2XPE A;  3APQ A;  3TKR A;  1IYI A;  2L5O A;  5IMA A;  5G30 A;  4KX4 A;  2FHE A;  2LJA A;  4IVF A;  2H73 A;  3EMX A;  4ZBA A;  3E0U A;  3IE3 A;  3FR9 A;  4AJ6 A;  3FZA A;  3KH7 A;  4TXO B;  5IMZ A;  2VD1 A;  5EPF A;  3KGK A;  1GLP A;  2OAC A;  1HNC A;  3GL5 A;  3H79 A;  1JLV A;  2E2M A;  1R5P A;  1T00 A;  1YEX A;  5A4W A;  1R26 A;  1TRW A;  4PUR A;  2H1A A;  1GUL A;  4PQH A;  1XOA A;  3IRA A;  2VM1 A;  1SJ6 A;  2YZU A;  2HZE A;  3A2W A;  3IV4 A;  3W8J A;  4Q5N A;  3UEM A;  3G7J A;  3WGD A;  3VWV A;  1K0D A;  4BVX A;  3L78 A;  3GA4 A;  4O32 A;  1BX9 A;  1BYE A;  17GS A;  3DVW A;  2F8F A;  4V1A p;  3BCK A;  1TXX A;  1Z3E A;  1NHY A;  2HRF A;  2IFQ B;  4RI7 A;  1RW1 A;  4HZ4 A;  2FWH A;  7GSS A;  2GDR A;  2E2G A;  2M72 A;  3UVT A;  5INY A;  2C0G A;  3I43 A;  1XWK A;  1M0U A;  5G5F A;  3MDK A;  1AQW A;  3ERG A;  3F6F A;  4KB3 A;  4GQF A;  1GH2 A;  4ULX A;  3I9V 2;  3H1N A;  3FRC A;  1EGO A;  4HU7 A;  1EGR A;  2EIO A;  2FNO A;  4ML1 A;  4WEY A;  5HFI A;  1EV4 A;  3PH9 A;  4OO4 A;  2DJK A;  1U88 A;  2YV7 A;  1BAY A;  4HQZ A;  2J23 A;  2FWE A;  1XW5 A;  4WKW A;  2GS3 A;  4OFT A;  4DVC A;  1SKR B;  2H1G A;  3F4R A;  3KD0 A;  2P5Q A;  4MJC A;  2OE1 A;  2F51 A;  2RM5 A;  1MDI A;  6GSW A;  5GZZ B;  2R2J A;  3GIX A;  1O81 A;  3MSZ A;  1QMV A;  2IPA A;  4DSQ A;  2X8C A;  3TGZ A;  2LS5 A;  2TIR A;  2ON7 A;  3HDC A;  4GCI A;  2HXK A;  1T7P B;  4HDE A;  1FB0 A;  2C8U A;  1K0M A;  5C00 A;  4ILF A;  1YZX A;  3DML A;  10GS A;  3GTU A;  5CAX A;  3MWH A;  2C0F A;  4MA9 A;  4J2F A;  5D73 A;  3CBU A;  3MNG A;  1Z6N A;  1A8Y A;  4FYC A;  1O73 A;  2HSH A;  1XWA A;  2H0G A;  3GKX A;  1GUM A;  1S3A A;  4JBB A;  4YAP A;  1XZO A;  4LMV A;  3F4S A;  1PGT A;  1XWG A;  2FY6 A;  3IHQ A;  3HCZ A;  4NMU A;  2YV9 A;  4XS6 A;  1PL1 A;  2BMX A;  4X0X A;  2L59 A;  4TR3 A;  4I5Q A;  1XIY A;  3W8S A;  4EE0 A;  3F63 A;  3EVI A;  3TKP A;  1B4Q A;  3WT1 A;  4OMV A;  3KH9 A;  2YWO A;  2CA8 A;  2H74 A;  3HYP A;  3LEF A;  3WD6 A;  1GSE A;  1G7E A;  1FAA A;  4IKH A;  1XXU A;  3LYK A;  4E8E A;  4NWY A;  5ECM B;  2AUV A;  3BJ5 A;  1YJ6 A;  4BWQ A;  4KCE A;  1NSW A;  4MCU A;  3C71 A;  4PUA A;  5EVO A;  1TRU A;  2MYG A;  2H30 A;  3IBH A;  9GSS A;  1AAZ A;  5ID2 B;  2LQQ A;  1GNW A;  2VOC A;  1YKC A;  3US3 A;  3IAS 2;  2CV4 A;  6GSV A;  3EE2 A;  3GHA A;  3D22 A;  2GTU A;  2VCV A;  1GP1 A;  1OKT A;  5ECR B;  4BPY A;  3HJP A;  2IN3 A;  4HI7 A;  2YWI A;  5DCG A;  4ID0 A;  1SL0 B;  4ZBD A;  1O85 A;  1DUG A;  2B7J A;  2V6K A;  2H0I A;  3QAW A;  3C7M A;  2RII A;  2NTO A;  1T4Y A;  5A4U A;  2WZ9 A;  4F03 A;  1JZR A;  2NDO A;  1OE8 A;  3GKK A;  4EDZ A;  2IJY A;  1SEN A;  3GN3 A;  3O6T A;  1M9B A;  5J9B A;  2GSR A;  3ZL5 A;  3FKF A;  4IJ3 A;  2X8G A;  2O8V B;  1GUK A;  5F8B A;  1QXH A;  5JCU A;  2LRC A;  1G0T A;  3DEX A;  3M9K A;  5ELG A;  1FW1 A;  3GH9 A;  3QD9 A;  1XWC A;  4H86 A;  2B6M A;  3I69 A;  1M2D A;  4RQR A;  5LCZ A;  3TUE A;  3D21 A;  3FY7 A;  11GS A;  2I4A A;  5B6N A;  3EU4 A;  4MZC A;  4ZB9 A;  2CZ2 A;  2L4C A;  1GSU A;  2FWG A;  3V1W A;  5E59 A;  2WUL A;  5FT3 A;  4F9Z A;  5KN0 A;  4KUN A;  5HR0 A;  2DJ3 A;  3RDW A;  4RUV A;  4OCF A;  1HQO A;  1BJX A;  5CYY A;  3QFB C;  1A24 A;  1ON4 A;  4AJ8 A;  3WGX A;  4HU9 A;  3C8E A;  2G0F A;  1K0O A;  4ISD A;  1OC8 A;  1E6B A;  1X0R A;  1UC7 A;  2OE0 A;  1EZK A;  1OC9 A;  3DRN A;  4RQX A;  2KP1 A;  3F3R A;  5ECS A;  3LSZ A;  22GS A;  2PBJ A;  2K8S A;  3KZQ A;  2VL9 A;  2R4V A;  4JU5 A;  3VFI A;  5DDL A;  5IM9 A;  4KSO A;  3DYR A;  3E9J B;  1W4V A;  1BG5 A;  3TDG A;  2NPB A;  2V41 A;  6GSY A;  2K6V A;  2GT6 A;  4N30 A;  1KBN A;  3TRP A;  4EO3 A;  4MJB A;  5ECN B;  1Z9H A;  3KMO A;  1SK2 A;  1A2L A;  3L4N A;  4WET A;  4Q5F A;  5HQP A;  2HLS A;  4KA0 A;  5DQY A;  2V32 A;  4EUY A;  2VL2 C;  4LLR A;  4L0U A;  1B4P A;  1H4O A;  4FYU A;  1GRX A;  5AIX A;  2ON5 A;  4GST A;  3ZVJ A;  1EV9 A;  8GSS A;  1NHO A;  3GSS A;  1ZOF A;  3KTB A;  1PN9 A;  2H0H A;  4N0Z A;  4KDU A;  2IL3 A;  1K0A A;  3N9J A;  1EOH A;  1UVZ A;  1T1V A;  1V57 A;  3QDN A;  5ECI B;  2H6Z A;  2CAI A;  3EIN A;  2OBI A;  4QL9 A;  1SK0 A;  2L4Q A;  4LA1 A;  5IMV A;  1A23 A;  5DQS A;  4ECJ A;  2VL2 A;  4KSM A;  3A2X A;  3GYK A;  2OAD A;  3EYT A;  2FCH A;  5AN1 A;  4GSS A;  3LFL A;  1O7U A;  4I2U A;  2L5L A;  1WIK A;  1USB A;  1QK8 A;  2DJ0 A;  4KCA A;  4L0W A;  3HVS A;  3EMP A;  4YQU A;  1C72 A;  4TVE A;  3LWA A;  1A0R P;  3ZIJ A;  2GGT A;  3GL3 A;  4IHU A;  4X1U A;  4FH8 A;  2B5Y A;  2XHF A;  4MK3 A;  1GTU A;  3KMN A;  1GSS A;  5D96 A;  2WGR A;  2C3N A;  4POK A;  4MH3 A;  5H5Q A;  4KDY A;  2PU9 C;  4EF0 A;  3APO A;  5FWG A;  5C04 A;  1PKZ A;  3IK7 A;  2CVB A;  3HJM A;  2B1K A;  2PVO C;  4IN0 A;  4OFN A;  2MZC A;  4IGJ A;  3GRX A;  2I81 A;  2Z9S A;  1TK8 B;  3ISO A;  4KE3 A;  2MMZ A;  3P2A A;  3HKR A;  3S9F A;  2LEG A;  1ILO A;  2WDU A;  4MMM A;  2H6Y A;  2JAD A;  3D6I A;  3L0H A;  5DAK A;  2R6K A;  1EWX A;  1X5E A;  1X5D A;  4IJI A;  4J56 E;  1M2A A;  1SKS B;  2I9H A;  3FZ4 A;  5EY6 A;  2C80 A;  2X64 A;  4G2E A;  3FR6 A;  3FZ9 A;  2M80 A;  4MPF A;  2PWJ A;  5DBQ A;  1TJD A;  4XS4 B;  1EP7 A;  3N5O A;  5ECH B;  5JWQ B;  4WR4 A;  3GNJ A;  3VWX A;  2VLV A;  5FHI A;  1F6M C;  3LQ7 A;  2AHE A;  4V2N A;  3P8W A;  2B5X A;  2P31 A;  3FHK A;  2MMN A;  4V2M A;  2JSY A;  2A2S A;  3GFK A;  4MLY A;  2YAN A;  4V2L A;  2QGV A;  1K0B A;  2C3T A;  4N0V A;  3DKS A;  5DAL B;  1O6J A;  1PX6 A;  1WPI A;  5CRW A;  3D5J A;  3M3M A;  3F4T A;  1WMJ A;  3UIW A;  4BVY A;  1ERW A;  2H1D A;  2CZ3 A;  2HNL A;  4NAX A;  2WCI A;  5AGY A;  1OYJ A;  2R3X A;  5CO3 A;  3ZZX A;  5J41 A;  2PPT A;  2EIQ A;  3ZTL A;  1GTB A;  2B7K A;  2C0E A;  3ZMK A;  5IPG A;  3WT2 A;  5G31 A;  1ZYE A;  2BTO T;  3VI5 A;  1E2Y A;  4HJM A;  1Z6M A;  5ECP B;  4YAV A;  2VAF A;  1THO A;  2FA4 A;  3UAR A;  3O76 A;  4MF5 A;  1F9M A;  4O7H A;  1K0C A;  2PVQ A;  5DCH A;  2VIM A;  2L6D A;  3TKS C;  4ECI A;  2H01 A;  1SKW B;  1GSF A;  3F3Q A;  2WRT A;  1T8E B;  2OA7 A;  5DJL A;  4PQI A;  2GLR A;  3H93 A;  2WB9 A;  5ECO B;  1FOV A;  1G6W A;  2JZR A;  4TR1 A;  4IQA A;  1TI3 A;  2VO4 A;  2YWM A;  1UN2 A;  1DE1 A;  2GZZ A;  4WXT A;  4FO5 A;  1I5G A;  3EWL A;  3IPZ A;  4WF4 A;  4GLT A;  6GSX A;  3HD5 A;  4DSR A;  4K7O A;  1PD2 1;  2K9F A;  4TXO A;  3GH6 A;  5ELA A;  3CRU A;  3TKS E;  3TOT A;  4LMW A;  1TI1 A;  3UAP A;  1X9S B;  2MMA A;  2FUG 2;  3TKS A;  5COH A;  2H19 A;  3VWW A;  3UOM A;  1R5A A;  4HJ2 A;  2GT5 A;  3P90 A;  1FG4 A;  1ERU A;  1ZMA A;  3AY8 A;  4IP1 A;  4PUF C;  5L71 A;  5JWO B;  2LNT A;  2IWT A;  3KP9 A;  3Q18 A;  2GSS A;  4K0G A;  2WJU A;  2YJ7 A;  1M9A A;  2X99 A;  2C1Y A;  4NV2 A;  5IQY A;  5CRH A;  2DJ2 A;  3UJ1 A;  1TRV A;  3UBL A;  1SD8 A;  4ZBB A;  1SYX A;  2IFQ A;  3TJK A;  4KAE A;  1JLW A;  2AV4 A;  1LBK A;  4JRR A;  2YN1 A;  3SWL A;  1QFN A;  3VPQ A;  3QAV A;  5IOW A;  2YOI A;  1IYH A;  3WYW A;  4EC0 A;  3EC3 A;  4FYB A;  4IP6 A;  4ZIJ A;  3GMF A;  3KM6 A;  4K8M A;  3BCI A;  3ERW A;  1U3I A;  1ZZY A;  1GUH A;  5F06 A;  2GST A;  4IEL A;  1SJI A;  4FIW A;  3DIE A;  2CT6 A;  5ECQ B;  3G9B A;  3LG6 A;  2VCQ A;  5A4V A;  3GX8 A;  2AYT A;  2OE3 A;  4IBP A;  1B9X C;  1XW6 A;  4WBR D;  1TP9 A;  4GSN A;  4O92 A;  3RPN A;  4K9Z A;  5AIS A;  3TJF A;  3KTL A;  2VLT A;  3GKM A;  1WRY A;  1LJR A;  2CVD A;  2R5G A;  3F0I A;  1YQ1 A;  2X8H A;  1UA5 A;  4HUA A;  2AB6 A;  3TRX A;  2CX3 A;  4PXO A;  4DEJ A;  4NHZ A;  5F05 A;  5D9V A;  1ZL9 A;  2F8A A;  3EUR A;  1EEJ A;  1AW9 A;  1SJZ A;  4MJA A;  5IMC A;  3LXZ A;  1U6T A;  1R7H A;  4K1F A;  3ZFL A;  3NZN A;  4BWS A;  2TRC P;  2KOK A;  1SK1 A;  1MD4 A;  4WBJ A;  4HOJ A;  2FD3 A;  4MZW A;  2N5B A;  2CQ9 A;  3Q19 A;  2OBK A;  2MBT A;  5ECK B;  2HT9 A;  3RHB A;  4TR0 A;  5HR2 A;  4D73 A;  3GKN A;  4TRX A;  1XOB A;  4Z7X A;  16GS A;  2D2Z A;  3LJR A;  4EKZ A;  1OAZ A;  2XPD A;  3HZ8 A;  3VWU A;  6GSS A;  3HVX A;  1HNB A;  1MTC A;  1TRS A;  2VCX A;  2H76 A;  3C1R A;  1ML6 A;  4OCE A;  5ID2 A;  4EDY A;  4OD7 A;  4IS0 A;  3GV1 A;  5KEJ A;  4F2I A;  3CSJ A;  4G10 A;  3MAK A;  4MJE A;  1N8J A;  5D9X A;  4XRD A;  1RQM A;  4XIH A;  1TU7 A;  5GSS A;  3ZYW A;  1MDJ A;  1O8X A;  4POB A;  4ZIL A;  1S3C A;  3APS A;  3CYN A;  3GUS A;  1A2J A;  2QKE A;  1Z7R A;  3FR3 A;  4ML6 A;  3LGC A;  1WJK A;  4XRA A;  4K0N A;  2IMF A;  2V6O A;  5EL8 A;  5IMF A;  4K2D A;  2CX4 A;  3DXB A;  3ME8 A;  3C73 A;  4RI6 A;  2DMM A;  2FGX A;  2YWN A;  5B6M A;  4TKY A;  4EVM A;  2PMT A;  3K8N A;  2VD0 A;  5JCW A;  2HZE B;  4Q5Q A;  3M1G A;  1A2M A;  4KDX A;  3A3T A;  4JZQ A;  1AQV A;  1OVN A;  1F2E A;  2DJ1 A;  1VF3 A;  5CP1 A;  3KXO A;  2ALB A;  3KP8 A;  2LUS A;  1JZO A;  1M99 A;  3OR5 A;  1A0F A;  2DSA A;  2LRN A;  4MZB A;  2OJL A;  1FB6 A;  1JHB A;  5F0G A;  2HI7 A;  1Z7P A;  3SBC A;  3KCM A;  2PGT A;  13GS A;  2VCW A;  4EL1 A;  5G2Z A;  1Q98 A;  3HY2 A;  2FWF A;  4GRF A;  3ZRD A;  2NBS A;  4GXZ A;  1PMT A;  2RUF A;  1TKD B;  4ECC A;  1K3L A;  3ZFB A;  2H75 A;  2IMI A;  3KEB A;  4I8B A;  2VCT A;  2B5E A;  2L57 A;  3GST A;  2XBI A;  1GTI A;  3QPM A;  2GVP A;  5KN3 A;  2LRT A;  1GWC A;  4MH2 A;  2VL3 A;  5G5E A;  2GQM A;  5CRD A;  3JCM L;  2JZT A;  1MDK A;  4POL A;  2P0G A;  3ZLP A;  1B48 A;  1TW9 A;  2N5F A;  3H8Q A;  5A5K A;  4PQ1 A;  1K0N A;  3TRQ A;  2H71 A;  3ME7 A;  1A8L A;  1GNE A;  2PER A;  2LJR A;  3BD2 A;  2ZUP A;  1I9D A;  4F82 A;  3RAZ A;  4L5O A;  2AAW A;  2IMD A;  3R2Q A;  3A5W A;  4MPG A;  4ZXG A;  2YP6 A;  3GTU B;  2R37 A;  1HNA A;  1T3B A;  3IOS A;  1YDK A;  2YCD A;  2GZP A;  4N11 A;  2EIR A;  1Z5Y E;  2LKU A;  3J7Y b;  4MF7 A;  2KUC A;  1Q4J A;  2A2R A;  4GQC A;  1AIU A;  1O8W A;  3W6G A;  5GAP D;  3HVV A;  5D93 A;  2QSI A;  3QCP A;  1GSQ A;  1PSQ A;  5IOX A;  3HHV A;  20GS A;  5J5N A;  3CTF A;  4XS1 A;  5F07 A;  1HD2 A;  3ERF A;  2RUE A;  2V1M A;  1BED A;  3CTG A;  5GST A;  4X43 A;  3ZML A;  5CRG A;  5J3R A;  1EOG A;  4CW9 A;  4O5R A;  3UL3 A;  2FA8 A;  2KP2 A;  18GS A;  1VF1 A;  3HZ4 A;  4OFM A;  5H5S A;  4F0B A;  1QQ2 A;  2C3Q A;  1OC3 A;  3IC4 A;  3LXT A;  4ZB6 A;  2I3Y A;  4K7I A;  6GST A;  5AIV A;  4BL7 A;  2LNS A;  4DSS A;  1J0F A;  3TKQ A;  1DE2 A;  3HXS A;  2YZH A;  3KIJ A;  2E7P A;  2QC7 A;  4HEA 2;  1EEM A;  4ACS A;  2B3S A;  1V2A A;  3DVX A;  4L8E A;  4PNG A;  3O3T A;  1FHE A;  2K8V A;  2O89 A;  4TXV A;  5ECL B;  3FW2 A;  2O85 A;  1FVJ A;  3BOA A;  3TJG A;  2MMO A;  3D4T A;  5KN1 A;  4YH2 A;  4I2T A;  2IME A;  4TR4 A;  2L6C A;  4XCS A;  1ABA A;  3PGT A;  2XBQ A;  4EXJ A;  1XVW A;  3CSI A;  5IO0 A;  4YQV A;  1AC1 A;  1XCC A;  3ZRE A;  3D4M A;  2DBC A;  1VGL A;  2VCZ A;  4CDO A;  2DIY A;  2GSQ A;  3GX0 A;  4ECB A;  2FLS A;  2YPM A;  3QR6 A;  19GS A;  3IDV A;  1ZYQ B;  1JZD A;  3UBK A;  1AQX A;  2C4J A;  2J9H A;  2C0D A;  4KGI A;  2DJJ A;  2GQK A;  1V40 A;  1KTE A;  1GTA A;  12GS A;  4NXI A;  1N2A A;  3TCO A;  4HZ2 A;  1HYU A;  2I1U A;  1WOU A;  2O7K A;  4ZL7 A;  3E3E A;  2H1B A;  3VLN A;  4AF2 A;  2JL4 A;  4NPB A;  2HRN A;  2H66 A;  1VRS D;  2K18 A;  3QAG A;  4F0C A;  4N10 A;  2DC5 A;  5DVB A;  2NVL A;  1XWB A;  1ERT A;  4G19 A;  3PIN A;  5IMD A;  1TK0 B;  4XS4 A;  4TW5 A;  4MP4 A;  2CAQ A;  3F8U A;  2AJQ B;  4MAB A;  1PA3 A;  3FYG A;  4QQ7 A;  3IR4 A;  1OC9 B;  1K3Y A;  1AUC A;  4LL1 B;  1EP8 A;  4AJ7 A;  3ZIV A;  1THX A;  2YJH A;  1J08 A;  5HR1 A;  2H6X A;  4D73 B;  4WF5 A;  2MBS A;  1VF2 A;  2EC4 A;  1TK5 B;  5DAL A;  1DSB A;  3VPT A;  2REM A;  4MF6 A;  1OE7 A;  4I97 A;  3CXG A;  1FO5 A;  1W89 A;  3QFA C;  3F9U A;  3I6A A;  1F37 A;  3ED3 A;  1JZW A;  2HSY A;  4NV5 A;  1NW2 A;  1KEB A;  1M2B A;  3NIV A;  5CRE A;  2DLX A;  3CSH A;  1B9Y C;  5E4W A;  2H8L A;  3QOU A;  1S3D A;  2B1L A;  1TU8 A;  1XPV A;  2N5A A;  1X9W B;  5B8A A;  5J9C A;  4I6X A;  2H70 A;  1G7O A;  1R4W A;  1XW9 A;  4JR6 A;  5LNK e;  1NM3 A;  2HFD A;  5D8I A;  3UMA A;  2YNX A;  1F3B A;  1TOF A;  5ENU A;  1AXD A;  2OKA A;  1H75 A;  2WFC A;  1GSY A;  2JAC A;  2WS2 A;  1FVK A;  5JWR B;  1WE0 A;  2VM2 A;  3P7X A;  2HYX A;  5JCG A;  4K6X A;  5IIZ A;  2JZS A;  3NOF A;  1Y6E A;  1V98 A;  1CQH A;  5GAN D;  1J9B A;  4Q5R A;  3UVH A;  5HR3 A;  1PRX A;  1YF0 A;  1TDI A;  3TB2 A;  4PX1 A;  1QUW A;  3U5R E;  5B8B A;  1GSD A;  3IA1 A;  1B8X A;  2M46 A;  4J57 E;  2KHP A;  2XC2 A;  2H72 A;  1ACV A;  3LYP A;  3C1S A;  1XFL A;  5B7C A;  4QL7 A;  3RHC A;  5IPH A;  4AGS A;  4GTU A;  1YEP A;  4PGT A;  2CVK A;  2LV3 A;  1PX7 A;  5IO2 A;  1KNG A;  1VF4 A;  3TJB A;  1PL2 A;  4LL4 B;  2G2Q A;  14GS A;  3ZIT A;  1YF1 A;  4GF0 A;  1MD3 A;  1ZGN A;  1CQG A;  3U6V A;  4BA7 A;  2LTK A;  2RM6 A;  3G7I A;  5D9T A;  1M7T A;  1YKA A;  3M8N A;  3WGE A;  1RK4 A;  4HQS A;  2PN8 A;  3M9J A;  4GWR A;  2PUK C;  4G9H A;  5LD0 A;  1V9W A;  3F6D A;  4PNF A;  2E0Q A;  3L9U A;  3Q6O A;  4WR5 A;  2A4V A;  2JSZ A;  1SYR A;  1PKW A;  3IXR A;  5DAK B;  2LJK A;  1LU4 A;  4P3Y B;  1XBS A;  4TOP A;  2ES7 A;  4JED A;  2LQO A;  4HS1 A;  5ABR A;  1YY7 A;  3A2V A;  3IAM 2;  3Q74 A;  1DBY A;  5H5R A;  1U3A A;  3CMI A;  4POM A;  2IIY A;  3DWV A;  3HJO A;  3M0F A;  5KN2 A;  2GZY A;  5DJM A;  3QMX A;  3VUR A;  1JFU A;  1GLQ A;  4JR4 A;  1XVQ A;  2GQL A;  3H4K A;  5CNW A;  3PR8 A;  4K7N A;  1F3A A;  1WP0 A;  1QGV A;  2HE3 A;  4KND A;  4L5L A;  1OKD A;  1ZCP A;  5G1L A;  1T4Z A;  2ZNM A;  3D0Z A;  5HFK A;  5D9W A;  3RPP A;  2JU5 A;  3KJY A;  3TOU A;  1TTZ A;  1ST9 A;  2VLU A;  3DGQ A;  2DIZ A;  2P5R A;  4ZB8 A;  2HZF A;  1SL2 B;  4KH7 A;  4DSS B;  2DML A;  1WWJ A;  2V2G A;  4XHM A;  1K3O A;  2F9S A;  2RLI A;  2LST A;  4NHW A;  2IMK A;  3IK9 A;  1MEK A;  1SU9 A;  2O87 A;  3ZVJ D;  3GUR A;  1U87 A;  2KLX A;  5HFG A;  4IQ1 A;  1PQN A;  4XTS A;  3FZ5 A;  3EU3 A;  1URM A;  3L9V A;  3HA9 A;  3BBY A;  5G1K A;  3VK9 A;  4JE1 A;  1V58 A; 
#chains in the Genus database with same CATH topology
 4OO5 A;  4MDC A;  2BJX A;  1X9M B;  2ZCT A;  4E8H A;  4CHS A;  3L9S A;  1ERV A;  3DD3 A;  5J4U A;  3FEU A;  4ZL9 A;  1BQ7 A;  1G6Y A;  3RBT A;  3J7Y k;  2VUP A;  4V1A g;  1SD9 A;  4KW6 A;  3LOR A;  4TN8 A;  4ZL8 A;  1X5C A;  1GL8 A;  1Y25 A;  3FK8 A;  4YQM A;  1SL1 B;  3G7Y A;  3TJJ A;  6GSU A;  4TR1 B;  4OWY A;  3CRT A;  3VI7 A;  2TRX A;  2F3M A;  4IW9 A;  2XPE A;  3APQ A;  3TKR A;  1IYI A;  2L5O A;  5IMA A;  5G30 A;  4KX4 A;  2FHE A;  2LJA A;  4IVF A;  2H73 A;  3EMX A;  4ZBA A;  3E0U A;  3IE3 A;  3FR9 A;  4AJ6 A;  3FZA A;  3KH7 A;  4TXO B;  5IMZ A;  2VD1 A;  5EPF A;  3KGK A;  1GLP A;  2OAC A;  1HNC A;  3GL5 A;  3H79 A;  1JLV A;  2E2M A;  4EIP A;  1R5P A;  1T00 A;  1YEX A;  5A4W A;  1R26 A;  1TRW A;  4PUR A;  2H1A A;  1GUL A;  4PQH A;  1XOA A;  3IRA A;  2VM1 A;  1SJ6 A;  2YZU A;  2HZE A;  3A2W A;  3IV4 A;  3W8J A;  4Q5N A;  3UEM A;  3G7J A;  4G0I A;  3WGD A;  3VWV A;  1K0D A;  4BVX A;  3L78 A;  3GA4 A;  4O32 A;  1BX9 A;  1BYE A;  17GS A;  3DVW A;  2F8F A;  4V1A p;  3BCK A;  1TXX A;  1Z3E A;  1NHY A;  2HRF A;  2IFQ B;  4RI7 A;  1RW1 A;  4HZ4 A;  2FWH A;  7GSS A;  2GDR A;  2E2G A;  2M72 A;  3UVT A;  5INY A;  2C0G A;  3I43 A;  1XWK A;  1M0U A;  5G5F A;  3MDK A;  1AQW A;  3ERG A;  4O5U A;  3F6F A;  4KB3 A;  4GQF A;  3A5I A;  1GH2 A;  4ULX A;  3I9V 2;  3H1N A;  3FRC A;  1EGO A;  4HU7 A;  1EGR A;  2EIO A;  2FNO A;  4ML1 A;  4WEY A;  5HFI A;  1EV4 A;  3PH9 A;  4OO4 A;  2DJK A;  1U88 A;  2YV7 A;  1BAY A;  4HQZ A;  2J23 A;  2FWE A;  1XW5 A;  4WKW A;  2GS3 A;  4OFT A;  4DVC A;  1SKR B;  2H1G A;  3F4R A;  3KD0 A;  2P5Q A;  4MJC A;  2OE1 A;  2F51 A;  2RM5 A;  1MDI A;  6GSW A;  5GZZ B;  2R2J A;  3GIX A;  1O81 A;  1PFO A;  3MSZ A;  1QMV A;  2IPA A;  1ZYN A;  4DSQ A;  2X8C A;  3TGZ A;  2LS5 A;  2TIR A;  2ON7 A;  3HDC A;  4GCI A;  2HXK A;  1T7P B;  4HDE A;  1FB0 A;  2C8U A;  1K0M A;  5C00 A;  4ILF A;  1YZX A;  3DML A;  10GS A;  3GTU A;  5CAX A;  4O5Q A;  3MWH A;  2C0F A;  4MA9 A;  4J2F A;  5D73 A;  3CBU A;  3MNG A;  1Z6N A;  1A8Y A;  4FYC A;  1O73 A;  2HSH A;  1XWA A;  2H0G A;  3GKX A;  1GUM A;  1S3A A;  4JBB A;  4YAP A;  1XZO A;  4LMV A;  3F4S A;  1PGT A;  1XWG A;  2FY6 A;  3IHQ A;  3HCZ A;  4NMU A;  2YV9 A;  4XS6 A;  1PL1 A;  2BMX A;  4X0X A;  2L59 A;  2HRA A;  4TR3 A;  4I5Q A;  1XIY A;  3W8S A;  4EE0 A;  3F63 A;  3EVI A;  3TKP A;  1B4Q A;  3WT1 A;  4OMV A;  3KH9 A;  2YWO A;  2CA8 A;  2H74 A;  3HYP A;  3LEF A;  3WD6 A;  1GSE A;  1G7E A;  1FAA A;  4IKH A;  1XXU A;  3IC8 A;  3LYK A;  3EPT A;  4E8E A;  4NWY A;  5ECM B;  2AUV A;  3BJ5 A;  1YJ6 A;  1M3J A;  4KCE A;  4BWQ A;  1NSW A;  4MCU A;  3C71 A;  4PUA A;  5EVO A;  1TRU A;  2MYG A;  2H30 A;  3IBH A;  9GSS A;  1AAZ A;  5ID2 B;  2LQQ A;  1GNW A;  2VOC A;  1YKC A;  3US3 A;  3IAS 2;  2CV4 A;  6GSV A;  3EE2 A;  3GHA A;  3D22 A;  2GTU A;  2VCV A;  1GP1 A;  1OKT A;  5ECR B;  4BPY A;  3HJP A;  2IN3 A;  4HI7 A;  2YWI A;  5DCG A;  4ID0 A;  1SL0 B;  4ZBD A;  1O85 A;  2A2P A;  1DUG A;  2B7J A;  2V6K A;  2H0I A;  3QAW A;  3C7M A;  2RII A;  2NTO A;  1T4Y A;  5A4U A;  2WZ9 A;  4F03 A;  1JZR A;  2NDO A;  1OE8 A;  3GKK A;  4EDZ A;  2IJY A;  1SEN A;  3GN3 A;  3O6T A;  1M9B A;  5J9B A;  2GSR A;  3ZL5 A;  3FKF A;  1FOH A;  4IJ3 A;  2X8G A;  2O8V B;  1GUK A;  5F8B A;  1QXH A;  5JCU A;  2LRC A;  1G0T A;  3DEX A;  3M9K A;  5ELG A;  1FW1 A;  3GH9 A;  3QD9 A;  1XWC A;  4H86 A;  2B6M A;  3I69 A;  1M2D A;  4RQR A;  5LCZ A;  3TUE A;  3D21 A;  3FY7 A;  11GS A;  2I4A A;  5B6N A;  3EU4 A;  4MZC A;  4ZB9 A;  2CZ2 A;  2L4C A;  1GSU A;  2FWG A;  3V1W A;  5E59 A;  2WUL A;  5FT3 A;  4F9Z A;  5KN0 A;  4KUN A;  5HR0 A;  2DJ3 A;  3RDW A;  4RUV A;  4OCF A;  1HQO A;  1BJX A;  5CYY A;  3QFB C;  1A24 A;  1ON4 A;  4AJ8 A;  3WGX A;  4HU9 A;  3C8E A;  2G0F A;  1K0O A;  4ISD A;  1OC8 A;  1E6B A;  1X0R A;  1UC7 A;  2OE0 A;  1EZK A;  1OC9 A;  3DRN A;  4RQX A;  2KP1 A;  3F3R A;  5ECS A;  3LSZ A;  22GS A;  2PBJ A;  2K8S A;  3KZQ A;  4YKF A;  2VL9 A;  2R4V A;  4JU5 A;  3VFI A;  5DDL A;  5IM9 A;  4KSO A;  3DYR A;  3E9J B;  1W4V A;  1BG5 A;  3TDG A;  2NPB A;  2V41 A;  6GSY A;  2K6V A;  2GT6 A;  4N30 A;  1KBN A;  3TRP A;  4EO3 A;  4MJB A;  5ECN B;  1Z9H A;  3KMO A;  1SK2 A;  1A2L A;  3L4N A;  4WET A;  4Q5F A;  5HQP A;  2HLS A;  4KA0 A;  5DQY A;  2V32 A;  4EUY A;  2VL2 C;  4LLR A;  4L0U A;  1B4P A;  3HVN A;  1H4O A;  4FYU A;  1GRX A;  5AIX A;  2ON5 A;  4GST A;  3ZVJ A;  1EV9 A;  8GSS A;  1NHO A;  3GSS A;  1ZOF A;  3KTB A;  1PN9 A;  2H0H A;  2DKH A;  4N0Z A;  4KDU A;  2IL3 A;  1K0A A;  3N9J A;  1EOH A;  1UVZ A;  1T1V A;  1ZYP A;  1V57 A;  3QDN A;  5ECI B;  2H6Z A;  2R0G A;  2CAI A;  3EIN A;  2OBI A;  4QL9 A;  1SK0 A;  2L4Q A;  4LA1 A;  5IMV A;  1A23 A;  5DQS A;  4ECJ A;  2VL2 A;  4KSM A;  3A2X A;  3GYK A;  2OAD A;  3EYT A;  4KF9 A;  2FCH A;  5AN1 A;  4GSS A;  3LFL A;  1O7U A;  4I2U A;  5KOW A;  2L5L A;  1WIK A;  1USB A;  1QK8 A;  2DJ0 A;  4KCA A;  4L0W A;  3PPU A;  3HVS A;  3EMP A;  4YQU A;  1C72 A;  4TVE A;  4BL7 B;  3LWA A;  1A0R P;  3ZIJ A;  2GGT A;  3GL3 A;  4IHU A;  4X1U A;  4FH8 A;  2B5Y A;  2XHF A;  4MK3 A;  1GTU A;  3KMN A;  1GSS A;  5D96 A;  2WGR A;  2C3N A;  4POK A;  4MH3 A;  5H5Q A;  4KDY A;  2PU9 C;  4EF0 A;  3APO A;  5FWG A;  5C04 A;  1PKZ A;  3IK7 A;  2CVB A;  3HJM A;  2B1K A;  2PVO C;  4IN0 A;  4OFN A;  2MZC A;  4IGJ A;  3GRX A;  2I81 A;  2Z9S A;  1TK8 B;  4K5S A;  3ISO A;  4KE3 A;  2MMZ A;  3P2A A;  3HKR A;  3S9F A;  2LEG A;  1ILO A;  2WDU A;  4MMM A;  2H6Y A;  2JAD A;  3D6I A;  3L0H A;  3LW9 A;  5DAK A;  2R6K A;  1EWX A;  1X5E A;  1X5D A;  2HRK A;  4IJI A;  4J56 E;  1M2A A;  1SKS B;  2I9H A;  3FZ4 A;  5EY6 A;  2C80 A;  2X64 A;  4G2E A;  3FR6 A;  3FZ9 A;  2M80 A;  4MPF A;  2PWJ A;  5DBQ A;  1TJD A;  4XS4 B;  1EP7 A;  3N5O A;  5ECH B;  5JWQ B;  4WR4 A;  3GNJ A;  3VWX A;  2VLV A;  4Z2U A;  5FHI A;  1F6M C;  3LQ7 A;  2AHE A;  4V2N A;  3P8W A;  2B5X A;  2P31 A;  3FHK A;  2MMN A;  4V2M A;  2JSY A;  2A2S A;  3GFK A;  4MLY A;  2YAN A;  4V2L A;  2QGV A;  1K0B A;  2C3T A;  4N0V A;  3DKS A;  5DAL B;  1O6J A;  1PX6 A;  1WPI A;  5CRW A;  3D5J A;  3M3M A;  3F4T A;  1WMJ A;  3UIW A;  4BVY A;  1ERW A;  2H1D A;  2CZ3 A;  2HNL A;  4NAX A;  2WCI A;  5AGY A;  1OYJ A;  2R3X A;  5CO3 A;  3ZZX A;  5J41 A;  2PPT A;  2EIQ A;  3ZTL A;  1GTB A;  2B7K A;  2C0E A;  3ZMK A;  5IPG A;  3WT2 A;  5G31 A;  1ZYE A;  2BTO T;  3VI5 A;  1E2Y A;  4HJM A;  1Z6M A;  5ECP B;  4YAV A;  2VAF A;  1THO A;  2FA4 A;  3UAR A;  3O76 A;  4MF5 A;  1F9M A;  4O7H A;  1K0C A;  2PVQ A;  5DCH A;  2VIM A;  2L6D A;  3TKS C;  4ECI A;  2H01 A;  1SKW B;  1GSF A;  3F3Q A;  2WRT A;  1T8E B;  2OA7 A;  5DJL A;  4PQI A;  2GLR A;  3H93 A;  2WB9 A;  5ECO B;  1FOV A;  1G6W A;  2JZR A;  4TR1 A;  4IQA A;  2HSM A;  1TI3 A;  2VO4 A;  2YWM A;  1UN2 A;  1DE1 A;  2GZZ A;  4WXT A;  4FO5 A;  1I5G A;  3EWL A;  3IPZ A;  4WF4 A;  4GLT A;  6GSX A;  3HD5 A;  4DSR A;  4K7O A;  1PD2 1;  2K9F A;  4TXO A;  3GH6 A;  5ELA A;  3CRU A;  3TKS E;  3TOT A;  4LMW A;  1TI1 A;  3UAP A;  1X9S B;  2MMA A;  2FUG 2;  3TKS A;  5COH A;  2H19 A;  3VWW A;  3UOM A;  1R5A A;  4A5P A;  4HJ2 A;  2GT5 A;  3P90 A;  1FG4 A;  1ERU A;  1ZMA A;  3AY8 A;  4IP1 A;  4PUF C;  5L71 A;  5JWO B;  2LNT A;  2IWT A;  3KP9 A;  3Q18 A;  2GSS A;  4K0G A;  2WJU A;  2YJ7 A;  1M9A A;  2X99 A;  2C1Y A;  4NV2 A;  5IQY A;  5CRH A;  2DJ2 A;  3UJ1 A;  1TRV A;  3UBL A;  1SD8 A;  4ZBB A;  1SYX A;  2IFQ A;  3TJK A;  4KAE A;  1JLW A;  2AV4 A;  1LBK A;  4JRR A;  2YN1 A;  3SWL A;  1QFN A;  3VPQ A;  3QAV A;  5IOW A;  2YOI A;  1IYH A;  3WYW A;  4EC0 A;  3EC3 A;  4FYB A;  4IP6 A;  4ZIJ A;  3GMF A;  3KM6 A;  4K8M A;  3BCI A;  3ERW A;  1U3I A;  1ZZY A;  1GUH A;  5F06 A;  2GST A;  4IEL A;  1SJI A;  4FIW A;  3DIE A;  2CT6 A;  5ECQ B;  3G9B A;  3LG6 A;  2VCQ A;  5A4V A;  3GX8 A;  2AYT A;  2OE3 A;  4IBP A;  1B9X C;  1XW6 A;  4WBR D;  1TP9 A;  4GSN A;  4O92 A;  3RPN A;  3MIX A;  4K9Z A;  5AIS A;  3TJF A;  1XG8 A;  3KTL A;  2VLT A;  3GKM A;  1WRY A;  1LJR A;  2CVD A;  2R5G A;  3F0I A;  1YQ1 A;  2X8H A;  1UA5 A;  4HUA A;  2AB6 A;  3TRX A;  2CX3 A;  4PXO A;  4DEJ A;  4NHZ A;  5F05 A;  5D9V A;  1ZL9 A;  2R0C A;  2F8A A;  3EUR A;  1EEJ A;  1AW9 A;  1SJZ A;  4FQU A;  4MJA A;  5IMC A;  3LXZ A;  1U6T A;  1R7H A;  4K1F A;  3ZFL A;  3NZN A;  4BWS A;  2TRC P;  2KOK A;  1SK1 A;  1MD4 A;  4WBJ A;  4HOJ A;  2R0P A;  2FD3 A;  4MZW A;  2N5B A;  2CQ9 A;  3Q19 A;  2OBK A;  2MBT A;  5ECK B;  2HT9 A;  3RHB A;  4TR0 A;  5HR2 A;  4D73 A;  3GKN A;  4TRX A;  1XOB A;  4Z7X A;  16GS A;  2D2Z A;  3LJR A;  4EKZ A;  1OAZ A;  2XPD A;  3HZ8 A;  3VWU A;  5BMU A;  6GSS A;  3HVX A;  1HNB A;  1MTC A;  1TRS A;  2VCX A;  2H76 A;  3C1R A;  1ML6 A;  4OCE A;  5ID2 A;  4EDY A;  4OD7 A;  4IS0 A;  3GV1 A;  5KEJ A;  4F2I A;  3CSJ A;  4G10 A;  3MAK A;  4MJE A;  1N8J A;  5D9X A;  4XRD A;  1RQM A;  4XIH A;  1TU7 A;  5GSS A;  3ZYW A;  1MDJ A;  1O8X A;  4POB A;  4ZIL A;  1S3C A;  3APS A;  3CYN A;  3GUS A;  1A2J A;  2QKE A;  1Z7R A;  3FR3 A;  4ML6 A;  3LGC A;  1WJK A;  4USS A;  4K0N A;  4XRA A;  2IMF A;  2V6O A;  5EL8 A;  5IMF A;  4K2D A;  2CX4 A;  3DXB A;  3ME8 A;  3C73 A;  4RI6 A;  2DMM A;  2FGX A;  2YWN A;  5B6M A;  4TKY A;  4EVM A;  2PMT A;  3K8N A;  2VD0 A;  5JCW A;  2HZE B;  4Q5Q A;  4YKG A;  3M1G A;  1A2M A;  4KDX A;  3A3T A;  4JZQ A;  1AQV A;  1OVN A;  1F2E A;  2DJ1 A;  1VF3 A;  4BVX B;  4PTS A;  4K2X A;  5CP1 A;  3KXO A;  2ALB A;  3KP8 A;  2LUS A;  1JZO A;  1M99 A;  3OR5 A;  3CQF A;  1A0F A;  2DSA A;  2LRN A;  4K5R A;  4MZB A;  2OJL A;  1FB6 A;  1JHB A;  5F0G A;  2HI7 A;  1Z7P A;  4Z2R A;  3SBC A;  3KCM A;  2PGT A;  13GS A;  2VCW A;  4EL1 A;  5G2Z A;  1Q98 A;  3HY2 A;  2FWF A;  4GRF A;  3ZRD A;  2NBS A;  4GXZ A;  1PMT A;  2RUF A;  1TKD B;  4ECC A;  1K3L A;  3ZFB A;  2H75 A;  2IMI A;  3KEB A;  4I8B A;  2VCT A;  2A4H A;  2B5E A;  2L57 A;  3GST A;  2XBI A;  1GTI A;  3QPM A;  2GVP A;  5KN3 A;  2LRT A;  1GWC A;  4MH2 A;  2VL3 A;  5G5E A;  2GQM A;  5CRD A;  3JCM L;  2JZT A;  1MDK A;  3R3E A;  4POL A;  2P0G A;  3ZLP A;  1B48 A;  1TW9 A;  2N5F A;  3H8Q A;  5A5K A;  4PQ1 A;  1K0N A;  3TRQ A;  2H71 A;  3ME7 A;  1A8L A;  1GNE A;  1S3R A;  2PER A;  2LJR A;  3BD2 A;  4G0K A;  2ZUP A;  1I9D A;  4F82 A;  3RAZ A;  4L5O A;  2AAW A;  2IMD A;  3R2Q A;  3A5W A;  4MPG A;  4ZXG A;  2YP6 A;  3GTU B;  2R37 A;  1HNA A;  1T3B A;  3IOS A;  1YDK A;  2YCD A;  2GZP A;  4N11 A;  2EIR A;  1Z5Y E;  2LKU A;  3J7Y b;  4MF7 A;  2KUC A;  1Q4J A;  2A2R A;  4GQC A;  1AIU A;  1O8W A;  3W6G A;  5GAP D;  3HVV A;  2X4A A;  5D93 A;  2QSI A;  3QCP A;  1GSQ A;  1PSQ A;  5IOX A;  1PN0 A;  3HHV A;  20GS A;  5J5N A;  3CTF A;  4XS1 A;  5F07 A;  1HD2 A;  3ERF A;  2RUE A;  2V1M A;  1BED A;  3CTG A;  5GST A;  4X43 A;  3ZML A;  5CRG A;  5J3R A;  1EOG A;  4CW9 A;  4O5R A;  3UL3 A;  2FA8 A;  2KP2 A;  18GS A;  1VF1 A;  3HZ4 A;  4OFM A;  5H5S A;  4F0B A;  1QQ2 A;  2C3Q A;  1OC3 A;  3IC4 A;  3LXT A;  4ZB6 A;  2I3Y A;  4K7I A;  6GST A;  5AIV A;  4BL7 A;  2LNS A;  4DSS A;  5BRT A;  1J0F A;  3TKQ A;  1DE2 A;  3HXS A;  2YZH A;  3KIJ A;  2E7P A;  2QC7 A;  4HEA 2;  1EEM A;  4ACS A;  2B3S A;  4G0L A;  2QA2 A;  1V2A A;  3DVX A;  4L8E A;  4PNG A;  3O3T A;  1FHE A;  2K8V A;  2O89 A;  4TXV A;  5ECL B;  3FW2 A;  2O85 A;  1FVJ A;  3BOA A;  3TJG A;  2MMO A;  3D4T A;  4ICY A;  5KN1 A;  4X4J A;  4YH2 A;  4I2T A;  2IME A;  2QA1 A;  4TR4 A;  4CY8 A;  2L6C A;  4XCS A;  1ABA A;  3PGT A;  2XBQ A;  4EXJ A;  1XVW A;  3CSI A;  5IO0 A;  4YQV A;  1AC1 A;  1XCC A;  3ZRE A;  3D4M A;  2DBC A;  1VGL A;  2VCZ A;  4CDO A;  2DIY A;  2GSQ A;  3GX0 A;  4ECB A;  2FLS A;  2UZ8 A;  2YPM A;  3QR6 A;  19GS A;  3IDV A;  1ZYQ B;  1JZD A;  3UBK A;  1AQX A;  2C4J A;  2J9H A;  2C0D A;  4KGI A;  4Z2T A;  2DJJ A;  2GQK A;  1M3I A;  1V40 A;  1KTE A;  1GTA A;  12GS A;  4NXI A;  1N2A A;  3TCO A;  4HZ2 A;  1HYU A;  2I1U A;  1WOU A;  2O7K A;  4ZL7 A;  3E3E A;  2H1B A;  3VLN A;  4AF2 A;  2JL4 A;  4NPB A;  2HRN A;  2H66 A;  1VRS D;  2K18 A;  5KOX A;  3QAG A;  4F0C A;  4N10 A;  2DC5 A;  5DVB A;  2NVL A;  1XWB A;  1ERT A;  4G19 A;  3PIN A;  5IMD A;  1TK0 B;  4XS4 A;  4TW5 A;  4MP4 A;  2CAQ A;  3F8U A;  2AJQ B;  4MAB A;  1PA3 A;  3FYG A;  4QQ7 A;  3IR4 A;  1OC9 B;  1K3Y A;  1AUC A;  4LL1 B;  1EP8 A;  4AJ7 A;  3ZIV A;  1THX A;  2YJH A;  1J08 A;  5HR1 A;  2H6X A;  4D73 B;  4WF5 A;  2MBS A;  1VF2 A;  2EC4 A;  1TK5 B;  5DAL A;  1DSB A;  3VPT A;  2REM A;  4MF6 A;  1OE7 A;  4I97 A;  3MYD A;  3CXG A;  1FO5 A;  1W89 A;  3QFA C;  3F9U A;  4HSC X;  3I6A A;  1F37 A;  3ED3 A;  1JZW A;  2HSY A;  4NV5 A;  1NW2 A;  1KEB A;  1M2B A;  3NIV A;  5CRE A;  2DLX A;  3CSH A;  1B9Y C;  5E4W A;  2H8L A;  3QOU A;  1S3D A;  2B1L A;  3IHG A;  1TU8 A;  1XPV A;  2N5A A;  1X9W B;  5B8A A;  4CY6 A;  5J9C A;  3FMW A;  4I6X A;  2H70 A;  1G7O A;  1R4W A;  1XW9 A;  4JR6 A;  5LNK e;  1NM3 A;  2HFD A;  5D8I A;  3UMA A;  2YNX A;  1F3B A;  1TOF A;  5ENU A;  1AXD A;  2OKA A;  1H75 A;  2WFC A;  1GSY A;  2JAC A;  2WS2 A;  1FVK A;  5JWR B;  1WE0 A;  2DKI A;  2VM2 A;  3P7X A;  2HYX A;  5JCG A;  4K6X A;  5IIZ A;  2JZS A;  3NOF A;  1Y6E A;  1V98 A;  1CQH A;  5GAN D;  1J9B A;  4Q5R A;  3UVH A;  5HR3 A;  1PRX A;  1YF0 A;  1TDI A;  3TB2 A;  4PX1 A;  1QUW A;  3U5R E;  5B8B A;  1GSD A;  3IA1 A;  1B8X A;  2M46 A;  4J57 E;  2KHP A;  2XC2 A;  2H72 A;  1ACV A;  3LYP A;  3C1S A;  1XFL A;  5B7C A;  4QL7 A;  3RHC A;  5IPH A;  4AGS A;  4GTU A;  1YEP A;  4PGT A;  2CVK A;  2LV3 A;  1PX7 A;  5IO2 A;  1KNG A;  1VF4 A;  3TJB A;  1PL2 A;  4LL4 B;  2G2Q A;  14GS A;  3ZIT A;  1YF1 A;  4GF0 A;  1MD3 A;  1ZGN A;  1CQG A;  3U6V A;  4BA7 A;  2LTK A;  2RM6 A;  3G7I A;  5D9T A;  1M7T A;  1YKA A;  3M8N A;  3WGE A;  1RK4 A;  4HQS A;  2PN8 A;  3M9J A;  4GWR A;  2PUK C;  4G9H A;  5LD0 A;  1V9W A;  3F6D A;  4PNF A;  2E0Q A;  3L9U A;  3Q6O A;  4WR5 A;  2A4V A;  2JSZ A;  1SYR A;  1PKW A;  3IXR A;  5DAK B;  2LJK A;  1LU4 A;  4P3Y B;  1XBS A;  4BIK A;  4TOP A;  2ES7 A;  4JED A;  2LQO A;  4HS1 A;  5ABR A;  1YY7 A;  3A2V A;  3IAM 2;  3Q74 A;  1DBY A;  5H5R A;  2X49 A;  1U3A A;  3CMI A;  4POM A;  2IIY A;  3DWV A;  3HJO A;  3M0F A;  5KN2 A;  2GZY A;  5DJM A;  3QMX A;  3VUR A;  1JFU A;  1GLQ A;  4JR4 A;  1XVQ A;  5CNW A;  2GQL A;  3H4K A;  3PR8 A;  4K7N A;  1F3A A;  1WP0 A;  1QGV A;  2HE3 A;  4KND A;  4L5L A;  1OKD A;  1ZCP A;  5G1L A;  1T4Z A;  2ZNM A;  3D0Z A;  5HFK A;  5D9W A;  3RPP A;  2JU5 A;  3KJY A;  3TOU A;  1TTZ A;  1ST9 A;  2VLU A;  3DGQ A;  2DIZ A;  2P5R A;  4ZB8 A;  4BVY B;  2HZF A;  1SL2 B;  4KH7 A;  4DSS B;  2DML A;  1WWJ A;  2V2G A;  4XHM A;  1K3O A;  2F9S A;  2RLI A;  2LST A;  4NHW A;  2IMK A;  3IK9 A;  1MEK A;  1SU9 A;  2O87 A;  3ZVJ D;  3GUR A;  1U87 A;  2KLX A;  5HFG A;  4IQ1 A;  1PQN A;  4XTS A;  3FZ5 A;  4EIQ A;  3EU3 A;  1URM A;  3L9V A;  3HA9 A;  3BBY A;  4MNN A;  5G1K A;  3VK9 A;  4JE1 A;  1V58 A; 
#chains in the Genus database with same CATH homology
 4OO5 A;  4MDC A;  2BJX A;  1X9M B;  2ZCT A;  4E8H A;  4CHS A;  3L9S A;  1ERV A;  3DD3 A;  5J4U A;  3FEU A;  4ZL9 A;  1BQ7 A;  1G6Y A;  3RBT A;  3J7Y k;  2VUP A;  4V1A g;  1SD9 A;  4KW6 A;  3LOR A;  4TN8 A;  4ZL8 A;  1X5C A;  1GL8 A;  1Y25 A;  3FK8 A;  4YQM A;  1SL1 B;  3G7Y A;  3TJJ A;  6GSU A;  4TR1 B;  4OWY A;  3CRT A;  3VI7 A;  2TRX A;  2F3M A;  4IW9 A;  2XPE A;  3APQ A;  3TKR A;  1IYI A;  2L5O A;  5IMA A;  5G30 A;  4KX4 A;  2FHE A;  2LJA A;  4IVF A;  2H73 A;  3EMX A;  4ZBA A;  3E0U A;  3IE3 A;  3FR9 A;  4AJ6 A;  3FZA A;  3KH7 A;  4TXO B;  5IMZ A;  2VD1 A;  5EPF A;  3KGK A;  1GLP A;  2OAC A;  1HNC A;  3GL5 A;  3H79 A;  1JLV A;  2E2M A;  4EIP A;  1R5P A;  1T00 A;  1YEX A;  5A4W A;  1R26 A;  1TRW A;  4PUR A;  2H1A A;  1GUL A;  4PQH A;  1XOA A;  3IRA A;  2VM1 A;  1SJ6 A;  2YZU A;  2HZE A;  3A2W A;  3IV4 A;  3W8J A;  4Q5N A;  3UEM A;  3G7J A;  4G0I A;  3WGD A;  3VWV A;  1K0D A;  4BVX A;  3L78 A;  3GA4 A;  4O32 A;  1BX9 A;  1BYE A;  17GS A;  3DVW A;  2F8F A;  4V1A p;  3BCK A;  1TXX A;  1Z3E A;  1NHY A;  2HRF A;  2IFQ B;  4RI7 A;  1RW1 A;  4HZ4 A;  2FWH A;  7GSS A;  2GDR A;  2E2G A;  2M72 A;  3UVT A;  5INY A;  2C0G A;  3I43 A;  1XWK A;  1M0U A;  5G5F A;  3MDK A;  1AQW A;  3ERG A;  4O5U A;  3F6F A;  4KB3 A;  4GQF A;  3A5I A;  1GH2 A;  4ULX A;  3I9V 2;  3H1N A;  3FRC A;  1EGO A;  4HU7 A;  1EGR A;  2EIO A;  2FNO A;  4ML1 A;  4WEY A;  5HFI A;  1EV4 A;  3PH9 A;  4OO4 A;  2DJK A;  1U88 A;  2YV7 A;  1BAY A;  4HQZ A;  2J23 A;  2FWE A;  1XW5 A;  4WKW A;  2GS3 A;  4OFT A;  4DVC A;  1SKR B;  2H1G A;  3F4R A;  3KD0 A;  2P5Q A;  4MJC A;  2OE1 A;  2F51 A;  2RM5 A;  1MDI A;  6GSW A;  5GZZ B;  2R2J A;  3GIX A;  1O81 A;  3MSZ A;  1QMV A;  2IPA A;  1ZYN A;  4DSQ A;  2X8C A;  3TGZ A;  2LS5 A;  2TIR A;  2ON7 A;  3HDC A;  4GCI A;  2HXK A;  1T7P B;  4HDE A;  1FB0 A;  2C8U A;  1K0M A;  5C00 A;  4ILF A;  1YZX A;  3DML A;  10GS A;  3GTU A;  5CAX A;  4O5Q A;  3MWH A;  2C0F A;  4MA9 A;  4J2F A;  5D73 A;  3CBU A;  3MNG A;  1Z6N A;  1A8Y A;  4FYC A;  1O73 A;  2HSH A;  1XWA A;  2H0G A;  3GKX A;  1GUM A;  1S3A A;  4JBB A;  4YAP A;  1XZO A;  4LMV A;  3F4S A;  1PGT A;  1XWG A;  2FY6 A;  3IHQ A;  3HCZ A;  4NMU A;  2YV9 A;  4XS6 A;  1PL1 A;  2BMX A;  4X0X A;  2L59 A;  2HRA A;  4TR3 A;  4I5Q A;  1XIY A;  3W8S A;  4EE0 A;  3F63 A;  3EVI A;  3TKP A;  1B4Q A;  3WT1 A;  4OMV A;  3KH9 A;  2YWO A;  2CA8 A;  2H74 A;  3HYP A;  3LEF A;  3WD6 A;  1GSE A;  1G7E A;  1FAA A;  4IKH A;  1XXU A;  3IC8 A;  3LYK A;  3EPT A;  4E8E A;  4NWY A;  5ECM B;  2AUV A;  3BJ5 A;  1YJ6 A;  4BWQ A;  4KCE A;  1NSW A;  4MCU A;  3C71 A;  4PUA A;  5EVO A;  1TRU A;  2MYG A;  2H30 A;  3IBH A;  9GSS A;  1AAZ A;  5ID2 B;  2LQQ A;  1GNW A;  2VOC A;  1YKC A;  3US3 A;  3IAS 2;  2CV4 A;  6GSV A;  3EE2 A;  3GHA A;  3D22 A;  2GTU A;  2VCV A;  1GP1 A;  1OKT A;  5ECR B;  4BPY A;  3HJP A;  2IN3 A;  4HI7 A;  2YWI A;  5DCG A;  4ID0 A;  1SL0 B;  4ZBD A;  1O85 A;  2A2P A;  1DUG A;  2B7J A;  2V6K A;  2H0I A;  3QAW A;  3C7M A;  2RII A;  2NTO A;  1T4Y A;  5A4U A;  2WZ9 A;  4F03 A;  1JZR A;  2NDO A;  1OE8 A;  3GKK A;  4EDZ A;  2IJY A;  1SEN A;  3GN3 A;  3O6T A;  1M9B A;  5J9B A;  2GSR A;  3ZL5 A;  3FKF A;  1FOH A;  4IJ3 A;  2X8G A;  2O8V B;  1GUK A;  5F8B A;  1QXH A;  5JCU A;  2LRC A;  1G0T A;  3DEX A;  3M9K A;  5ELG A;  1FW1 A;  3GH9 A;  3QD9 A;  1XWC A;  4H86 A;  2B6M A;  3I69 A;  1M2D A;  4RQR A;  5LCZ A;  3TUE A;  3D21 A;  3FY7 A;  11GS A;  2I4A A;  5B6N A;  3EU4 A;  4MZC A;  4ZB9 A;  2CZ2 A;  2L4C A;  1GSU A;  2FWG A;  3V1W A;  5E59 A;  2WUL A;  5FT3 A;  4F9Z A;  5KN0 A;  4KUN A;  5HR0 A;  2DJ3 A;  3RDW A;  4RUV A;  4OCF A;  1HQO A;  1BJX A;  5CYY A;  3QFB C;  1A24 A;  1ON4 A;  4AJ8 A;  3WGX A;  4HU9 A;  3C8E A;  2G0F A;  1K0O A;  4ISD A;  1OC8 A;  1E6B A;  1X0R A;  1UC7 A;  2OE0 A;  1EZK A;  1OC9 A;  3DRN A;  4RQX A;  2KP1 A;  3F3R A;  5ECS A;  3LSZ A;  22GS A;  2PBJ A;  2K8S A;  3KZQ A;  4YKF A;  2VL9 A;  2R4V A;  4JU5 A;  3VFI A;  5DDL A;  5IM9 A;  4KSO A;  3DYR A;  3E9J B;  1W4V A;  1BG5 A;  3TDG A;  2NPB A;  2V41 A;  6GSY A;  2K6V A;  2GT6 A;  4N30 A;  1KBN A;  3TRP A;  4EO3 A;  4MJB A;  5ECN B;  1Z9H A;  3KMO A;  1SK2 A;  1A2L A;  3L4N A;  4WET A;  4Q5F A;  5HQP A;  2HLS A;  4KA0 A;  5DQY A;  2V32 A;  4EUY A;  2VL2 C;  4LLR A;  4L0U A;  1B4P A;  1H4O A;  4FYU A;  1GRX A;  5AIX A;  2ON5 A;  4GST A;  3ZVJ A;  1EV9 A;  8GSS A;  1NHO A;  3GSS A;  1ZOF A;  3KTB A;  1PN9 A;  2H0H A;  2DKH A;  4N0Z A;  4KDU A;  2IL3 A;  1K0A A;  3N9J A;  1EOH A;  1UVZ A;  1T1V A;  1ZYP A;  1V57 A;  3QDN A;  5ECI B;  2H6Z A;  2R0G A;  2CAI A;  3EIN A;  2OBI A;  4QL9 A;  1SK0 A;  2L4Q A;  4LA1 A;  5IMV A;  1A23 A;  5DQS A;  4ECJ A;  2VL2 A;  4KSM A;  3A2X A;  3GYK A;  2OAD A;  3EYT A;  4KF9 A;  2FCH A;  5AN1 A;  4GSS A;  3LFL A;  1O7U A;  4I2U A;  5KOW A;  2L5L A;  1WIK A;  1USB A;  1QK8 A;  2DJ0 A;  4KCA A;  4L0W A;  3PPU A;  3HVS A;  3EMP A;  4YQU A;  1C72 A;  4TVE A;  4BL7 B;  3LWA A;  1A0R P;  3ZIJ A;  2GGT A;  3GL3 A;  4IHU A;  4X1U A;  4FH8 A;  2B5Y A;  2XHF A;  4MK3 A;  1GTU A;  3KMN A;  1GSS A;  5D96 A;  2WGR A;  2C3N A;  4POK A;  4MH3 A;  5H5Q A;  4KDY A;  2PU9 C;  4EF0 A;  3APO A;  5FWG A;  5C04 A;  1PKZ A;  3IK7 A;  2CVB A;  3HJM A;  2B1K A;  2PVO C;  4IN0 A;  4OFN A;  2MZC A;  4IGJ A;  3GRX A;  2I81 A;  2Z9S A;  1TK8 B;  4K5S A;  3ISO A;  4KE3 A;  2MMZ A;  3P2A A;  3HKR A;  3S9F A;  2LEG A;  1ILO A;  2WDU A;  4MMM A;  2H6Y A;  2JAD A;  3D6I A;  3L0H A;  3LW9 A;  5DAK A;  2R6K A;  1EWX A;  1X5E A;  1X5D A;  2HRK A;  4IJI A;  4J56 E;  1M2A A;  1SKS B;  2I9H A;  3FZ4 A;  5EY6 A;  2C80 A;  2X64 A;  4G2E A;  3FR6 A;  3FZ9 A;  2M80 A;  4MPF A;  2PWJ A;  5DBQ A;  1TJD A;  4XS4 B;  1EP7 A;  3N5O A;  5ECH B;  5JWQ B;  4WR4 A;  3GNJ A;  3VWX A;  2VLV A;  4Z2U A;  5FHI A;  1F6M C;  3LQ7 A;  2AHE A;  4V2N A;  3P8W A;  2B5X A;  2P31 A;  3FHK A;  2MMN A;  4V2M A;  2JSY A;  2A2S A;  3GFK A;  4MLY A;  2YAN A;  4V2L A;  2QGV A;  1K0B A;  2C3T A;  4N0V A;  3DKS A;  5DAL B;  1O6J A;  1PX6 A;  1WPI A;  5CRW A;  3D5J A;  3M3M A;  3F4T A;  1WMJ A;  3UIW A;  4BVY A;  1ERW A;  2H1D A;  2CZ3 A;  2HNL A;  4NAX A;  2WCI A;  5AGY A;  1OYJ A;  2R3X A;  5CO3 A;  3ZZX A;  5J41 A;  2PPT A;  2EIQ A;  3ZTL A;  1GTB A;  2B7K A;  2C0E A;  3ZMK A;  5IPG A;  3WT2 A;  5G31 A;  1ZYE A;  2BTO T;  3VI5 A;  1E2Y A;  4HJM A;  1Z6M A;  5ECP B;  4YAV A;  2VAF A;  1THO A;  2FA4 A;  3UAR A;  3O76 A;  4MF5 A;  1F9M A;  4O7H A;  1K0C A;  2PVQ A;  5DCH A;  2VIM A;  2L6D A;  3TKS C;  4ECI A;  2H01 A;  1SKW B;  1GSF A;  3F3Q A;  2WRT A;  1T8E B;  2OA7 A;  5DJL A;  4PQI A;  2GLR A;  3H93 A;  2WB9 A;  5ECO B;  1FOV A;  1G6W A;  2JZR A;  4TR1 A;  4IQA A;  2HSM A;  1TI3 A;  2VO4 A;  2YWM A;  1UN2 A;  1DE1 A;  2GZZ A;  4WXT A;  4FO5 A;  1I5G A;  3EWL A;  3IPZ A;  4WF4 A;  4GLT A;  6GSX A;  3HD5 A;  4DSR A;  4K7O A;  1PD2 1;  2K9F A;  4TXO A;  3GH6 A;  5ELA A;  3CRU A;  3TKS E;  3TOT A;  4LMW A;  1TI1 A;  3UAP A;  1X9S B;  2MMA A;  2FUG 2;  3TKS A;  5COH A;  2H19 A;  3VWW A;  3UOM A;  1R5A A;  4A5P A;  4HJ2 A;  2GT5 A;  3P90 A;  1FG4 A;  1ERU A;  1ZMA A;  3AY8 A;  4IP1 A;  4PUF C;  5L71 A;  5JWO B;  2LNT A;  2IWT A;  3KP9 A;  3Q18 A;  2GSS A;  4K0G A;  2WJU A;  2YJ7 A;  1M9A A;  2X99 A;  2C1Y A;  4NV2 A;  5IQY A;  5CRH A;  2DJ2 A;  3UJ1 A;  1TRV A;  3UBL A;  1SD8 A;  4ZBB A;  1SYX A;  2IFQ A;  3TJK A;  4KAE A;  1JLW A;  2AV4 A;  1LBK A;  4JRR A;  2YN1 A;  3SWL A;  1QFN A;  3VPQ A;  3QAV A;  5IOW A;  2YOI A;  1IYH A;  3WYW A;  4EC0 A;  3EC3 A;  4FYB A;  4IP6 A;  4ZIJ A;  3GMF A;  3KM6 A;  4K8M A;  3BCI A;  3ERW A;  1U3I A;  1ZZY A;  1GUH A;  5F06 A;  2GST A;  4IEL A;  1SJI A;  4FIW A;  3DIE A;  2CT6 A;  5ECQ B;  3G9B A;  3LG6 A;  2VCQ A;  5A4V A;  3GX8 A;  2AYT A;  2OE3 A;  4IBP A;  1B9X C;  1XW6 A;  4WBR D;  1TP9 A;  4GSN A;  4O92 A;  3RPN A;  3MIX A;  4K9Z A;  5AIS A;  3TJF A;  3KTL A;  2VLT A;  3GKM A;  1WRY A;  1LJR A;  2CVD A;  2R5G A;  3F0I A;  1YQ1 A;  2X8H A;  1UA5 A;  4HUA A;  2AB6 A;  3TRX A;  2CX3 A;  4PXO A;  4DEJ A;  4NHZ A;  5F05 A;  5D9V A;  1ZL9 A;  2R0C A;  2F8A A;  3EUR A;  1EEJ A;  1AW9 A;  1SJZ A;  4FQU A;  4MJA A;  5IMC A;  3LXZ A;  1U6T A;  1R7H A;  4K1F A;  3ZFL A;  3NZN A;  4BWS A;  2TRC P;  2KOK A;  1SK1 A;  1MD4 A;  4WBJ A;  4HOJ A;  2R0P A;  2FD3 A;  4MZW A;  2N5B A;  2CQ9 A;  3Q19 A;  2OBK A;  2MBT A;  5ECK B;  2HT9 A;  3RHB A;  4TR0 A;  5HR2 A;  4D73 A;  3GKN A;  4TRX A;  1XOB A;  4Z7X A;  16GS A;  2D2Z A;  3LJR A;  4EKZ A;  1OAZ A;  2XPD A;  3HZ8 A;  3VWU A;  5BMU A;  6GSS A;  3HVX A;  1HNB A;  1MTC A;  1TRS A;  2VCX A;  2H76 A;  3C1R A;  1ML6 A;  4OCE A;  5ID2 A;  4EDY A;  4OD7 A;  4IS0 A;  3GV1 A;  5KEJ A;  4F2I A;  3CSJ A;  4G10 A;  3MAK A;  4MJE A;  1N8J A;  5D9X A;  4XRD A;  1RQM A;  4XIH A;  1TU7 A;  5GSS A;  3ZYW A;  1MDJ A;  1O8X A;  4POB A;  4ZIL A;  1S3C A;  3APS A;  3CYN A;  3GUS A;  1A2J A;  2QKE A;  1Z7R A;  3FR3 A;  4ML6 A;  3LGC A;  1WJK A;  4USS A;  4K0N A;  4XRA A;  2IMF A;  2V6O A;  5EL8 A;  5IMF A;  4K2D A;  2CX4 A;  3DXB A;  3ME8 A;  3C73 A;  4RI6 A;  2DMM A;  2FGX A;  2YWN A;  5B6M A;  4TKY A;  4EVM A;  2PMT A;  3K8N A;  2VD0 A;  5JCW A;  2HZE B;  4Q5Q A;  4YKG A;  3M1G A;  1A2M A;  4KDX A;  3A3T A;  4JZQ A;  1AQV A;  1OVN A;  1F2E A;  2DJ1 A;  1VF3 A;  4BVX B;  4PTS A;  4K2X A;  5CP1 A;  3KXO A;  2ALB A;  3KP8 A;  2LUS A;  1JZO A;  1M99 A;  3OR5 A;  1A0F A;  2DSA A;  2LRN A;  4K5R A;  4MZB A;  2OJL A;  1FB6 A;  1JHB A;  5F0G A;  2HI7 A;  1Z7P A;  4Z2R A;  3SBC A;  3KCM A;  2PGT A;  13GS A;  2VCW A;  4EL1 A;  5G2Z A;  1Q98 A;  3HY2 A;  2FWF A;  4GRF A;  3ZRD A;  2NBS A;  4GXZ A;  1PMT A;  2RUF A;  1TKD B;  4ECC A;  1K3L A;  3ZFB A;  2H75 A;  2IMI A;  3KEB A;  4I8B A;  2VCT A;  2A4H A;  2B5E A;  2L57 A;  3GST A;  2XBI A;  1GTI A;  3QPM A;  2GVP A;  5KN3 A;  2LRT A;  1GWC A;  4MH2 A;  2VL3 A;  5G5E A;  2GQM A;  5CRD A;  3JCM L;  2JZT A;  1MDK A;  3R3E A;  4POL A;  2P0G A;  3ZLP A;  1B48 A;  1TW9 A;  2N5F A;  3H8Q A;  5A5K A;  4PQ1 A;  1K0N A;  3TRQ A;  2H71 A;  3ME7 A;  1A8L A;  1GNE A;  2PER A;  2LJR A;  3BD2 A;  4G0K A;  2ZUP A;  1I9D A;  4F82 A;  3RAZ A;  4L5O A;  2AAW A;  2IMD A;  3R2Q A;  3A5W A;  4MPG A;  4ZXG A;  2YP6 A;  3GTU B;  2R37 A;  1HNA A;  1T3B A;  3IOS A;  1YDK A;  2YCD A;  2GZP A;  4N11 A;  2EIR A;  1Z5Y E;  2LKU A;  3J7Y b;  4MF7 A;  2KUC A;  1Q4J A;  2A2R A;  4GQC A;  1AIU A;  1O8W A;  3W6G A;  5GAP D;  3HVV A;  2X4A A;  5D93 A;  2QSI A;  3QCP A;  1GSQ A;  1PSQ A;  5IOX A;  1PN0 A;  3HHV A;  20GS A;  5J5N A;  3CTF A;  4XS1 A;  5F07 A;  1HD2 A;  3ERF A;  2RUE A;  2V1M A;  1BED A;  3CTG A;  5GST A;  4X43 A;  3ZML A;  5CRG A;  5J3R A;  1EOG A;  4CW9 A;  4O5R A;  3UL3 A;  2FA8 A;  2KP2 A;  18GS A;  1VF1 A;  3HZ4 A;  4OFM A;  5H5S A;  4F0B A;  1QQ2 A;  2C3Q A;  1OC3 A;  3IC4 A;  3LXT A;  4ZB6 A;  2I3Y A;  4K7I A;  6GST A;  5AIV A;  4BL7 A;  2LNS A;  4DSS A;  5BRT A;  1J0F A;  3TKQ A;  1DE2 A;  3HXS A;  2YZH A;  3KIJ A;  2E7P A;  2QC7 A;  4HEA 2;  1EEM A;  4ACS A;  2B3S A;  4G0L A;  2QA2 A;  1V2A A;  3DVX A;  4L8E A;  4PNG A;  3O3T A;  1FHE A;  2K8V A;  2O89 A;  4TXV A;  5ECL B;  3FW2 A;  2O85 A;  1FVJ A;  3BOA A;  3TJG A;  2MMO A;  3D4T A;  4ICY A;  5KN1 A;  4X4J A;  4YH2 A;  4I2T A;  2IME A;  2QA1 A;  4TR4 A;  4CY8 A;  2L6C A;  4XCS A;  1ABA A;  3PGT A;  2XBQ A;  4EXJ A;  1XVW A;  3CSI A;  5IO0 A;  4YQV A;  1AC1 A;  1XCC A;  3ZRE A;  3D4M A;  2DBC A;  1VGL A;  2VCZ A;  4CDO A;  2DIY A;  2GSQ A;  3GX0 A;  4ECB A;  2FLS A;  2UZ8 A;  2YPM A;  3QR6 A;  19GS A;  3IDV A;  1ZYQ B;  1JZD A;  3UBK A;  1AQX A;  2C4J A;  2J9H A;  2C0D A;  4KGI A;  4Z2T A;  2DJJ A;  2GQK A;  1V40 A;  1KTE A;  1GTA A;  12GS A;  4NXI A;  1N2A A;  3TCO A;  4HZ2 A;  1HYU A;  2I1U A;  1WOU A;  2O7K A;  4ZL7 A;  3E3E A;  2H1B A;  3VLN A;  4AF2 A;  2JL4 A;  4NPB A;  2HRN A;  2H66 A;  1VRS D;  2K18 A;  5KOX A;  3QAG A;  4F0C A;  4N10 A;  2DC5 A;  5DVB A;  2NVL A;  1XWB A;  1ERT A;  4G19 A;  3PIN A;  5IMD A;  1TK0 B;  4XS4 A;  4TW5 A;  4MP4 A;  2CAQ A;  3F8U A;  2AJQ B;  4MAB A;  1PA3 A;  3FYG A;  4QQ7 A;  3IR4 A;  1OC9 B;  1K3Y A;  1AUC A;  4LL1 B;  1EP8 A;  4AJ7 A;  3ZIV A;  1THX A;  2YJH A;  1J08 A;  5HR1 A;  2H6X A;  4D73 B;  4WF5 A;  2MBS A;  1VF2 A;  2EC4 A;  1TK5 B;  5DAL A;  1DSB A;  3VPT A;  2REM A;  4MF6 A;  1OE7 A;  4I97 A;  3MYD A;  3CXG A;  1FO5 A;  1W89 A;  3QFA C;  3F9U A;  3I6A A;  1F37 A;  3ED3 A;  1JZW A;  2HSY A;  4NV5 A;  1NW2 A;  1KEB A;  1M2B A;  3NIV A;  5CRE A;  2DLX A;  3CSH A;  1B9Y C;  5E4W A;  2H8L A;  3QOU A;  1S3D A;  2B1L A;  3IHG A;  1TU8 A;  1XPV A;  2N5A A;  1X9W B;  5B8A A;  4CY6 A;  5J9C A;  3FMW A;  4I6X A;  2H70 A;  1G7O A;  1R4W A;  1XW9 A;  4JR6 A;  5LNK e;  1NM3 A;  2HFD A;  5D8I A;  3UMA A;  2YNX A;  1F3B A;  1TOF A;  5ENU A;  1AXD A;  2OKA A;  1H75 A;  2WFC A;  1GSY A;  2JAC A;  2WS2 A;  1FVK A;  5JWR B;  1WE0 A;  2DKI A;  2VM2 A;  3P7X A;  2HYX A;  5JCG A;  4K6X A;  5IIZ A;  2JZS A;  3NOF A;  1Y6E A;  1V98 A;  1CQH A;  5GAN D;  1J9B A;  4Q5R A;  3UVH A;  5HR3 A;  1PRX A;  1YF0 A;  1TDI A;  3TB2 A;  4PX1 A;  1QUW A;  3U5R E;  5B8B A;  1GSD A;  3IA1 A;  1B8X A;  2M46 A;  4J57 E;  2KHP A;  2XC2 A;  2H72 A;  1ACV A;  3LYP A;  3C1S A;  1XFL A;  5B7C A;  4QL7 A;  3RHC A;  5IPH A;  4AGS A;  4GTU A;  1YEP A;  4PGT A;  2CVK A;  2LV3 A;  1PX7 A;  5IO2 A;  1KNG A;  1VF4 A;  3TJB A;  1PL2 A;  4LL4 B;  2G2Q A;  14GS A;  3ZIT A;  1YF1 A;  4GF0 A;  1MD3 A;  1ZGN A;  1CQG A;  3U6V A;  4BA7 A;  2LTK A;  2RM6 A;  3G7I A;  5D9T A;  1M7T A;  1YKA A;  3M8N A;  3WGE A;  1RK4 A;  4HQS A;  2PN8 A;  3M9J A;  4GWR A;  2PUK C;  4G9H A;  5LD0 A;  1V9W A;  3F6D A;  4PNF A;  2E0Q A;  3L9U A;  3Q6O A;  4WR5 A;  2A4V A;  2JSZ A;  1SYR A;  1PKW A;  3IXR A;  5DAK B;  2LJK A;  1LU4 A;  4P3Y B;  1XBS A;  4TOP A;  2ES7 A;  4JED A;  2LQO A;  4HS1 A;  5ABR A;  1YY7 A;  3A2V A;  3IAM 2;  3Q74 A;  1DBY A;  5H5R A;  2X49 A;  1U3A A;  3CMI A;  4POM A;  2IIY A;  3DWV A;  3HJO A;  3M0F A;  5KN2 A;  2GZY A;  5DJM A;  3QMX A;  3VUR A;  1JFU A;  1GLQ A;  4JR4 A;  1XVQ A;  5CNW A;  2GQL A;  3H4K A;  3PR8 A;  4K7N A;  1F3A A;  1WP0 A;  1QGV A;  2HE3 A;  4KND A;  4L5L A;  1OKD A;  1ZCP A;  5G1L A;  1T4Z A;  2ZNM A;  3D0Z A;  5HFK A;  5D9W A;  3RPP A;  2JU5 A;  3KJY A;  3TOU A;  1TTZ A;  1ST9 A;  2VLU A;  3DGQ A;  2DIZ A;  2P5R A;  4ZB8 A;  4BVY B;  2HZF A;  1SL2 B;  4KH7 A;  4DSS B;  2DML A;  1WWJ A;  2V2G A;  4XHM A;  1K3O A;  2F9S A;  2RLI A;  2LST A;  4NHW A;  2IMK A;  3IK9 A;  1MEK A;  1SU9 A;  2O87 A;  3ZVJ D;  3GUR A;  1U87 A;  2KLX A;  5HFG A;  4IQ1 A;  1PQN A;  4XTS A;  3FZ5 A;  4EIQ A;  3EU3 A;  1URM A;  3L9V A;  3HA9 A;  3BBY A;  4MNN A;  5G1K A;  3VK9 A;  4JE1 A;  1V58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...