2O8WA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q/s195a) in complex with inhibitors
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase plasminogen activator
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8wA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8wA01
4DIHH 4GAWA 4AGJA 2TGDA 2P16A 1GJDB 2XBYA 1MTSA 4OS4A 4UE7H 3CENA 4VGCC 1WQSA 4GUXA 3MMGA 2A2XH 4ZXXH 4UFFH 1SGYE 3RXHA 1O3FA 1AE8H 1RJXB 1V2VT 1X7AC 1ANBA 5GWZA 4JCNA 4RKJB 3A7ZA 1C1SA 4ISOA 1G30B 2GX4A 2D1JA 1GL0E 3GY3A 3HATH 4D7FA 3ZVCA 1WAYB 2Y80A 1GMCF 2ZO3H 4LXBH 1GI7B 1V2TT 1DLKB 1WUNH 4ABDA 1GDQA 1AO5A 1S6HA 3DUXH 3C1KA 5GCHF 1HJ8A 3U1IB 1TBZH 1V2MT 1S84A 3UOUA 3SU4A 1UVOA 1OKXA 3BG4B 5LPEA 1CSOE 1EAUA 4FU7A 4IMZA 3GOVB 1TONA 5E2OA 2BDGA 2P93A 2JETB 3ZZCA 3Q3YA 1AKSB 4MVNA 1GCTC 1MKXH 2CF8H 3TJOA 2UUKB 5LPFA 1AFEH 1MAYA 4LZ1H 3P6ZB 2TGTA 5EOKA 1O3OA 1O5FH 4UFGH 2ZU1A 1ARCA 1K1PA 1NRQH 3QGJA 1LVMA 1IQNA 1VJAU 3QUMP 1RFNA 2JH0D 2ZU2A 2J34A 3LC5A 1YLDA 1O2PA 1O3AA 4F49A 3RMLH 1RIWC 4AB9A 1EPTC 1D4PB 4I8GA 5FBIA 1GVKB 1H8IH 5HYOA 1JBUH 1O34A 2J9NA 5C5OA 3S9AA 3UNSA 1FY8E 1FLEE 2VIVA 1NRPH 1WSSH 1Y3YA 1LHFH 3LONA 2PHBA 1FQ3A 1ZR0A 1MU6B 1C1NA 1N6YA 3GY7A 4BTIB 2BOHB 1C1QA 2VIOA 3KQEA 5T3HA 3RXAA 1TGSZ 1GDUA 1OWKA 1GHWH 3M3SA 1TMBH 1BIOA 2STAE 4NIXA 1LKAA 2FX6A 2O8TA 2DUCA 4IN1A 4DVAU 1F5KU 3URDA 1AMHA 3OX7U 1ZOMA 1UTNA 4GCHG 4CRAA 2GT8A 5JB8S 4WMFA 2ZFFH 1SGDE 3TIUA 3V7TA 5LH8A 3PLPA 1ZTJA 3BTHE 5JBCS 1YCPH 3UUZA 1E38B 3LKWA 1C1RA 1C5PA 4AYVB 3M7UA 2CXVA 2GMTB 3KNXA 2IN2A 3ZVAA 1RD3B 1NO9H 5F8TA 2G4UA 1L2EA 2ZTYA 3RXPA 2J2UA 4CBNA 2FOFA 3ITIA 1MQ5A 1HAHH 3ZZ9A 1C4U2 1IQMA 3NCLA 1XUHA 2SFAA 3RLWH 4ZMAH 7KMEH 2BQ7B 1D6WA 1P2MA 1ZGVA 1BTWA 1O5DH 4AFUA 4AG1A 4MQAA 4MNVA 2WYJA 1XMNB 2ZCHP 4Y11E 4BAOB 5LPRA 1GHYH 4ASHA 2QXIA 1CGJE 1P3EA 2ZCLP 3RC6A 5J4QA 2G81E 4D7GA 2TIOA 1QB6A 1S0RA 1GJ4H 2GCTC 2BDYA 1GJ7B 1P2OA 1CHGA 4A5TS 2C3SA 2NU1E 3T25A 2CJIA 2YNAA 1GJ8B 4INHA 4CRFA 1K1LA 1XM1A 5C1UA 1GBLA 3I29A 2Z3EA 3TU7H 1YPGH 3SNEA 7GCHG 1EOJA 4I8KA 1YPEH 1GMHG 2BQWB 1AZ8A 2OC8A 3M3TA 1PQ8A 3KL6A 1FMGA 2G5NA 1MTNC 1D3TB 1P01A 2UUYA 5T6DA 3ATIA 4B71A 1VGCB 1NU9A 1ELFA 1KTSB 1BJUA 2PKSC 1HDTH 1T8MA 2BD9A 2ZHWH 2HLCA 1AVWA 1YLCA 1H9IE 1EPTA 3LIWA 1FY5A 2OC0A 3ZZ3A 1GJ9B 4AZ2B 2EI8A 3SI3H 1V6DA 3KEEA 4Y10E 1LQEA 1O2YA 5G4BA 4ABJA 1VCWA 3DD2H 3UQVA 3SV8A 5FCKA 2AMPA 2G5VA 1CA0C 1SGPE 1EJMA 2F3CE 1MTUA 3AW1A 3AW0A 4WXVA 3T26A 2R3UA 2QXGA 3RU4T 2FM2A 3SUFA 4BAKB 3GCOA 1O2MA 2P8OB 4YM9A 2ZKSA 5GDSH 3E90B 1PJPA 4H42U 2P3FH 2C8ZB 4K5ZA 2D2DA 3H7TA 4DOQA 1VR1H 3BSQA 1QRXA 4Y8YA 1HGTH 4IGDA 1FI8A 1VITH 2A1DB 4XFQA 2I6SA 4Y79A 1A3EH 3NPSA 2ZU3A 1V2ST 1FY4A 1EAWA 1ZTLA 1VGCC 1GG6C 2ZA5A 2BD8A 5DPAA 3K9XB 1O32A 2HVXA 2FOEA 3A8AA 1MH0A 1TQ7B 2FZZA 1FUJA 3ODDA 1DDJA 3UY9A 4OS2A 4X6MA 4INLA 1NRSH 3NXPA 1G2LA 1GBTA 1OP0A 2EEKA 3ZV9A 1MMJN 3VFEA 3A85A 2BZAA 4R0IA 1ZSLA 2CMYA 1C2MA 1SQOA 1NU7B 1CGIE 4WMEA 1O2LA 3QWCH 1LPKB 2BXTH 4NFFA 1P57B 1ACBE 1A61H 1AN1E 2A7CA 4CRDA 1W14U 2FTMA 4O9VA 1MCTA 2DE9A 2F9OA 1GJ5H 3TGKE 1GJ6A 4A7IB 1MD8A 1GPZA 3M7QA 5FBEA 1TYNA 1XUGA 3GY5A 5GXPA 2D26C 1IQFA 1ZHMA 2D8WA 1AI8H 3PMAB 2HOBA 4X8VH 1PPFE 3A89A 3RM0H 2FOHA 3A82A 1C1OA 1LCYA 1LDTT 1DWEH 1AB9B 1BA8B 4MLFB 5ABWA 1UTMA 3ZYEA 4CHAC 1OXGA 2V6NA 4Z0KA 1KDQA 1TGCA 2CHAB 1DS2E 1FZZA 2OUAA 1HAXB 4F4OC 4I8HA 2Y82A 1W10U 2OTVA 1TIOA 2OCVB 3PMHB 2ANKH 5EG4A 1TNGA 1O5CB 1C9PA 3QDZB 1OWJA 2QC2A 3A80A 4CRGA 1QTFA 2QV1A 1C5VA 1PPZA 3A84A 1GHBF 5H4IB 2BX4A 1HRTH 1O2JA 4AB8A 1UVPA 4JZDH 1O2SA 2Z3DA 2OD3B 3BTGE 2ZHDA 3AVZA 5C1XA 1Y5BT 2XWAA 3RXQA 2KAIA 2WV5A 5L2ZH 2GZ8A 3DA9B 1NRNH 4IW4E 1EP5A 1UVUH 3SHAH 4TY6A 4GPGA 2UWOA 2WPIS 4X8UH 4SGBE 1AVXA 3AAVA 2NU0E 4B76A 2C4FH 5DG6A 1LQDB 1SLUB 4ISNA 1DLEA 2ZGCA 2PSXA 4NCYA 2R9PA 1OOKB 4HZHA 8LPRA 2ZDVH 5DK1A 9ESTA 1MCVA 1UK2A 4JZEH 1DUEA 1GI5A 3FANA 3MWIU 2A5KA 2OINA 4Y76A 1BRBE 1LPZB 1ZRKA 2HNTC 2TGAA 1C2DA 1N8OC 2V0BA 3K65B 4Q2KA 2PR3A 1QL8A 1FDPA 1C5UA 1KIGH 4O3UA 2QY0B 2B0FA 3M37A 1SC8U 3M5NA 4OS7A 1GI2A 5DP5A 3HKJB 1L1JA 3BG4C 1C1TA 1WQVH 2F9BH 2BVXH 2HWLB 1J8AA 1ZPZA 2P8OC 2AGEX 1M9UA 1QR3E 4ZHAA 1ANEA 4KP0A 2WPHS 6GCHF 2BB4A 1V2JT 3KGPA 5JBBS 4NIVA 3TK9A 1V2WT 1DWBH 3GY8A 2PSYA 4JZIA 2NWNA 5JPMH 1BTHH 5A0AE 3K6ZA 2A7HA 1P02A 2RG3A 3MNBA 2BX3A 2I6QA 3RXMA 5EQQA 3HGPA 1K1NA 2OLGA 3Q3KA 2B5TB 1P9UA 1Q31A 1QBOA 1OS8A 3MH4A 3SQHE 1GCTB 5EQSA 4K8YA 2P59A 1YPLH 1BT7A 1GI8B 2BD3A 2WYGA 3QZRA 3LPRA 4B1TA 1SGIB 2GV6A 3MFJA 1GBDA 3DFLA 4IC5A 3BEUA 2PV9B 4IN2A 1QQUA 2QF3A 2XCFA 1AKSA 1K22H 4WF8A 5DP7A 1Z7KA 4JK5A 3D65E 4D9QA 2PLXA 1Z8IB 3U69H 5DO4H 2R3YA 8ESTE 1BBRE 1TOCB 3TNSA 5HM2A 1C1UH 2GCTB 1THRH 4XSKU 3ZVGA 3TGJE 2XRCA 4A1XA 1SGFG 2JH6D 1DWCH 3UREA 3PTNA 1Q3XA 3BEIB 2ZECA 4JZ1A 2F9VA 3GYLB 3UQOA 3ZZBA 1ZJDA 2XBXA 1BDAA 5JYIA 4FUGA 4MPVA 1MZDA 2BLVA 3T2NA 1O2UA 1RIWB 1L1NA 1G3DA 1P06A 3PM3A 1GMDG 1INCA 2CHAC 2OBQA 5T6FA 5B6OA 5DP3A 2OXSA 1GBCA 4MPWA 1QB1A 2ZFTA 5FXLA 3T62A 1C2LA 1TNHA 1NESE 3A87A 3RC4A 2ZPRA 1NFYA 3GY4A 5E8EH 4CH8B 1IHSH 2AERH 4X2XA 2BYAX 3M7TA 4AFZA 2BY7X 2PGBB 1O3HA 1YCPM 4Y0ZE 1P9SA 1FAXA 4SGAE 4YOJA 1D6RA 1YM0A 1Q2WA 4AORA 3SV9A 3LJJA 4BXWA 1ZMJA 1MUEB 1TBRH 6LPRA 3EGKH 3BTEE 4GHTA 4X2WA 1D3QB 1T4VH 1GI9B 1XX9A 1YYY1 2H5DA 3LT3A 1QBNA 5EGMA 3PWCA 2OQ5A 4ABIA 3S0NA 3IITA 1E36B 1TPPA 1ANCA 1V2OT 3HK3B 3KCGH 3T29A 3V13A 1HAGE 1HJAB 2H9HA 4UFEH 2ZDLA 1EB1H 4X6OA 3EA7A 1F92A 1OSSA 2ZFRH 3RUOA 1H4WA 5HGGA 3GDVA 1PQ5A 4X2YA 2BHGA 1E0FD 4O3TA 5E0JA 1GJCB 3MNSA 4WVPE 1GBMA 1W8BH 1JRTA 2BLOA 2W3KA 3TH3H 3ENSB 5HMAA 2GT7A 5C5NA 2C93B 3HK6B 2R0LA 1ZRBA 1NTPA 1MTVA 3H7OA 2PGQB 1JOUB 1BRCE 1A0LA 4YLQH 2HNTF 2ZU4A 1RTKA 1ELCA 3TJNA 2ASUB 3M5OA 2VGCB 3ZVFA 1EASA 1QJ6B 2JETC 2FOCA 2GTBA 1XUIA 4I33A 4X1QU 4OGYA 1E35B 2FTLE 4Q7ZA 1TPSA 3SGBE 3ZZDA 1SBWA 3MH6A 1SMFE 2NU3E 1WTGH 1ABJH 1LHCH 3JZ1B 3TVJB 2SGAA 1AUJA 2TBSA 1FN8A 1V2UT 1O3EA 4FUIA 3SBKA 2FOBA 4D8NA 3P95A 1SGQE 3SU3A 1T7CA 2G4TA 4A1TA 1O30A 1YBWA 1G32B 1Y5UT 1SFQB 3SZNA 1FIWA 5FX5A 1LPGB 3RXIA 3URCA 2J92A 2VGCC 2P95A 3UPEA 2HNTE 2W5EA 1Z8JB 4DW2U 1MBMA 3MH7A 2QA9E 2SNWA 1C2FA 2ZWLH 4ABHA 4HGCA 5A8XA 1GL1A 1P12E 1HYLA 2XYAA 3L33A 3GCHB 1IQLA 1SLVB 2G55A 3VB3A 1GBJA 4K60A 4K1TA 3F1SB 1RS0A 3RXVA 1H9LB 3UWIA 1NN6A 5C1YA 3RU4E 3RC5A 2PKSB 2XW9A 1ZMNA 1HLTH 4BXSA 1BTYA 1DUAA 5TCAA 3VXFH 1P2KA 1ELDE 1LKBA 1DX5M 3DT0H 1J15A 2PTCE 2R0KA 2WUCA 1O2WA 1SQAA 3R3GB 3BTKE 1RTLA 4KKDA 5BRRE 2VJ1A 2Y6TA 2J95A 1W2KH 1HAVA 3ELAH 1DWDH 1AFQB 4X1RU 3AAUA 4Y71A 4CREA 3SW2B 3M5LA 4B2AA 2Z9LA 3BIUH 4Y7AA 2FMJA 1QHRB 3CS7A 4FUFA 1L0ZA 2H6MA 3QTOH 1HAOH 3BTFE 2ZHQH 3LH1A 4ZROA 3V3MA 3PYHA 1KXFA 3P70B 5AHGH 4FUHA 1AHTH 1K2I1 4GCHF 1CHOG 4Q7XA 2ODPA 2PKAA 2UWLA 1TPAE 3U8TH 1Y3XA 4ZH8A 4KTCA 1O2VA 1AFQC 1EB2A 4NIYA 2ZDMA 1DSTA 1GMHF 4BAHB 1O3NA 2A0QB 3RXTA 2P3UB 1F5RA 4NA8A 1Z71A 4FUBA 5I46H 1FPCH 3KQDA 4CRCA 5I25A 2TGPZ 1C5RA 1G3EA 4DJZB 2ZFPH 2BD5A 1S82A 4WJG2 1C2JA 2BD2A 3EA8A 3PV4A 2Y5HA 3A8BA 1TRYA 1K9OE 5F8ZA 3RXJA 1MD7A 3L6PA 2OC7A 2AIQA 1WTHD 4OS1A 1Z1IA 3DHKH 1KXAA 1H1BA 4MTBA 5EU8A 3BN9A 1SGNE 3QX5H 4FUJA 4XOJA 3SN8A 3MTYA 3FVFB 1H8DH 3F9HA 1CT4E 1EXFA 1VCQA 1XXDA 2R2WU 4FVBA 1V2LT 4JK6A 4MNXA 1O33A 4WH8A 1EAIA 1QQ4A 3UOPA 1TGBA 3SV7A 3LGWA 1TX6A 1P8VC 4K69A 1NC6A 3PTBA 2BDIA 1C2EA 4ZKSU 3TPIZ 2H9TH 4GLYA 2QYIA 4A1VA 1NS3A 1OYTH 3A88A 2Z7FE 3A8CA 1A5IA 4B73A 1Y59T 3MO3A 2ZPQA 1FPHH 3E91A 4ABBA 1OWHA 3KF2A 4AGKA 1HFDA 1DXWA 2J94A 3OYPA 2DE8A 2FXRA 3VXEH 1FY3A 2UUJB 2BY6X 2ZQ2A 3Q00A 1RTFB 3LGYA 3S7KB 1D3PB 1B0FA 2ZTXA 1HIAA 3TK5A 1G36A 1GBKA 1AZZA 2GZ7A 2QIQA 1K1MA 1C9TA 2Q6FA 4OS5A 2K1QA 1A46H 4JYUH 1O2OA 1NY22 1MU8B 1TGTA 2XC0A 1GHBG 2EI7A 5PTPA 3M61U 3RMMH 2Y7XA 3ZZAA 3SU6A 1PPEE 3ZZ6A 1HAZB 1BRUP 1O3GA 3RP2A 1OWIA 4AX9H 1P3CA 1BUIA 1LVOA 3E16B 4Y7BA 1ABIH 5L30H 1SGRE 3ZZ8A 1PPBH 2QCYA 2Q1JA 2XC4A 5F6MA 2VU8E 3UNQA 1LVBA 1TRNA 2PWXA 3LU9B 1QCPA 2O8LA 3QTVH 4TWYA 5K0HA 3LDXH 1TFXA 1C2KA 2A4QA 2BY8X 1W0ZU 1EUFA 2C90B 3VB4A 5JBAS 4THNH 3PMBB 5A0CA 1SG8B 3TJUA 1PYTC 3F68H 3U8OH 1OX1A 2NU4E 1FIZA 1HJAC 4O97A 1EZUC 1QIXB 5LGOA 2FODA 1O3DA 2FEQH 2AEIH 3TGIE 1ZHPA 4NWKA 4MNYA 3SJIA 4AN7A 2VB0A 2RA3A 1ORFA 2AFQB 7GCHF 8GCHG 4B2BA 4BOHA 4NFEA 1IOEA 2HRVA 2V3OH 1P11E 3IWMA 3PWBA 3FFGA 1DE7H 3VEQB 5A2MH 3S7HB 1ELTA 1Z8RA 5TCCA 1AWFH 3A86A 5A8ZA 4K8BA 1K28D 1P10A 3ZVDA 3RXBA 2QXJA 4MNWA 2SGFE 2J38A 3NWUA 3RDZA 5F03A 3ATMA 1S6FA 3KQBA 4NGAH 1C2GA 1S83A 1O35A 1P2NA 1ZJKA 2FDAA 3A7XA 1UVSH 1HIAB 2ZU5A 5A0BA 1V3XA 1Z6EA 2SGQE 3SV2H 1T32A 1SGEE 4K2YA 4ZHMU 5CHAB 4KELA 1V2KT 2Y5FA 3JZ2B 2BY9X 2O8MA 4U2WA 3UTUH 3M35A 4ABFA 3WY8A 3U1JB 1G9IE 2A5AA 3FAOA 1G37A 2OP9A 1PPCE 1VITF 2FS8A 1UK4A 4BTTB 1OP2A 2WPMS 1BBRK 2C8XB 2BDHA 1SSXA 1BQYA 1YPHC 4I8LA 1EZSC 3MU1A 1TWXB 1O2NA 1BHXB 2BDAA 3SU0A 4Z6AH 2W26A 3FZDA 4DGJA 1GBBA 1H9HE 1AIXH 3I78A 2VWNA 1DXPA 2A4GA 2JH5D 3O8RA 2BVSH 1O2GH 3BV9B 4NWLA 4IMQA 5C2ZA 1IQIA 2RCEA 1ZZZA 1HAYB 1L1GA 2RA0A 1IQKA 3GDSA 4HFPB 2VVUA 4YZUA 5FPSA 4AFQA 1ZSKA 1PPGE 2BZ6H 3RXGA 4TPYA 1O3MA 3STIA 1YF4A 2WUBA 1A0HB 1G3BA 3LGTA 1DY8A 4XE4A 5E0HA 2VWOA 3SHCH 5ETXA 1O3PB 3KIDU 1MKXK 5E2PA 1XVOA 3O8BA 1YPKH 1SQTA 1TA2A 3D62A 3SNBA 1LO6A 3A7YA 2G52A 1TABE 5AF9H 3S9CA 1GVZA 1P2JA 3U98H 1YCPK 1HAIH 1HBTH 1SL3A 1A7SA 1VJ9U 2O8WA 3GISB 5TJXA 1CA8B 2CV3A 2QGRA 1YKTA 1QA7A 1ZPCA 2FLRH 1W12U 2FS9A 3SU5A 4U01A 2P94A 3A7TA 1C5SA 3I77A 1C5OH 1TA6A 1UCYH 1B7XB 1DFPA 3SUEA 1GHXH 4ISHH 2JKHA 2PUXB 1KLIH 1UCYE 4QT8C 1BOQA 2Y5GA 2ZGHA 3KHVA 1UTKA 5FPTA 3EYDA 1C5MD 1KSNA 2V35A 1PQ7A 3PMJA 4X8TH 4TY7A 6ESTA 1FJSA 5EW1H 5EXNA 1GDNA 1K1IA 2GVFA 3ATLA 4UD9H 4ABAA 1AVGH 3MNXA 3V0XA 3SNAA 1UTQA 4ZHLU 2BM2A 4MPXA 3LGIA 2HPPH 2ZC9H 1EOLA 1QFKH 4ISLA 1K21H 1BJVA 1BMMH 3EAJA 3VGCB 1NM6A 4KGAA 3TH2H 1ZMLA 4ABGA 4NSVA 1O2ZA 1TNLA 1G2MA 4U30A 3G01A 1KLTA 1DICA 1GBHA 5DP4A 2B7DH 4DT7B 1A2CH 1O38A 2Y81A 1T8LA 2EC9H 5EPNA 3SU2A 1GBIA 4ZUHA 2FESH 1HXFH 2F9PA 3P92A 1NROH 1PYTD 1JIRA 1ID5H 3UWJH 1LHDH 1EATA 1ESAA 1CO7E 1GJBB 1S0QA 2OC1A 1BITA 1UJ1A 3E3TA 2BDBA 1O0DH 4NIWA 5DKMA 5AFZH 1B5GH 2TRMA 2FPZA 4WY3A 4HI3A 1HAVB 1O5EH 2FX4A 4X6NA 4WWYA 3KQCA 3BG8A 4ESTE 3W94A 1WBGB 2FP7B 7ESTE 2VVVA 2FIRH 2ODQA 1DT2A 2BVRH 1GG6B 3MH5A 1EX3A 3S69A 4X1NU 1C5ZB 3PO1C 4X2VA 1F0UA 3SGQE 2R2MB 1C1VH 1IQHA 4YOIA 1FAKH 4IS5A 2XBWA 3NUMA 1N8OB 2BLQA 3ODFA 3UR6A 2Z6BD 1F0SA 1UVTH 3MYWA 5JDUB 4DIIH 2AGIX 4AOQA 1TBQH 1F0RA 2SGPE 3BIVH 4E7RG 5T6GA 3L3TA 4H6SB 3VB6A 1EKBB 2ESTE 1KDQB 2CF9H 4KTUA 4ZKNU 2V3HH 1KXEA 4WXIA 1C2IA 5AVDA 1AY6H 1F0TA 2PW8H 2ZDKA 3E1XB 1P2QA 1ANDA 2Z9GA 2FOAA 3CP7A 2VIPA 2XC5A 3MO9A 1BTXA 1QRZA 1XXFA 5DGJA 2XXLA 2ZHEH 1EZXC 3QN7A 4FXGH 5ESTE 4YLUA 1C1PA 3B23B 2QXHA 2A45B 3LGVA 1WYKA 1KY9A 3PLBA 1HJ9A 3RXKA 1UTLM 3O8DA 4KTSA 1TNJA 3AASA 2GD4B 1T8OA 1BTUA 8GCHF 2UUFB 3B9FH 2FI5E 1EZQA 4BAMB 1O37A 1MTWA 3GYMA 1AB9C 3P8FA 2XNIA 3P17H 3LOXA 2ZDAH 1W3CA 1Y3VA 5GJ4B 1TNIA 4MDSA 1C5XB 4DURA 3QO6A 1BMLA 1CBWB 2A7JA 5C3NA 2ZFQH 3ESTA 3MHWU 3OY6U 4E05H 5FAHA 1OP8A 1XUJA 1QRWA 2O9QA 2STBE 1S5SA 1KXCA 3NKKA 2FOMB 3U9AH 5A09A 5EW2H 1ETTH 3D23A 3SUGA 1JRSA 3MI4A 4CR9A 1AUTC 3RMOH 1ELAA 3RXCA 2ALVA 4RKOB 4I7YH 2VIDA 5GPIB 1QURH 3MU8A 5FX6A 3HGNA 4ISIH 1AU8A 1DSUA 2ODYB 3FZZA 3QGNB 1W11U 3PO1B 4A92A 2B9LA 1ESBA 1L4DA 1O2KA 5GIBA 2ILNA 3VPKA 4D76A 4TWWA 4LOYH 3FP8E 4I31A 2VNTA 1O31A 6CHAC 3RU4D 4YT6H 5FHTA 1A0JA 1J17T 1NT1A 3UR9A 1BTZA 3C27B 4NA7A 4Y0YE 3HPTB 1Z8GA 4AG2A 3QK1A 3P8NA 3NZIA 4NSYA 1F7ZA 2SNVA 2ZGJA 2P3TB 1FY1A 1LHGH 2W3IA 3BEFB 4X1PU 1JIMA 1GHZA 1QL7A 3LC3A 4LK4A 1W7GH 2Z94A 3SOSA 3VB5A 4CH2B 4XDEA 3R0FA 3TNTA 1TE0A 4X0WU 1Y3WA 1JMOH 1K1OA 2ZGBH 3A8DA 2AIPA 4PROA 5IYTA 4Y8XA 2ZGXH 1EAXA 3F9GA 3Q76A 5AFYH 1THPB 3PLKA 3PB1E 4E7NA 2H5CA 2GZ9A 3K2UA 5EODA 3N7OA 2ZF0H 4YT7H 1N6XA 3ZVBA 1O3KA 2VH6A 1V2PT 2BTCE 1GWAA 4O03A 1UHBB 3CS0A 1CA0B 1ZHRA 1B0EA 1JXPA 2ZP0H 2BLWA 1AQ7A 2VIQA 3A7VA 3UNRA 4TPIZ 3FP7E 5CMXH 3BTME 4ZAEA 1XVMA 4NA9H 3SU1A 1C5LH 1CQQA 1BMNH 2PFEA 3EQ0H 2A5IA 4JZFH 3O8CA 2AH4X 3VGCC 4FVDA 3HKIB 3RLYH 2VH0A 1ZPBA 1BMAA 1PPHE 2WINI 2O8UA 1T8NA 3TLOA 1F5LA 1O2XA 3RXFA 4B74A 4I8JA 1TX7A 1QY6A 2WV4A 1GMDF 5HM9A 4MPUA 4A6LA 5L6NH 1SHYA 1A5HA 2IPHA 5BPEA 1MQ6A 1SOTA 1O5BB 3RXLA 4K1SA 4ZKOU 1CHOF 4GHQA 1GBAA 2GP9B 3P8OA 1ESTA 2ZQ1A 3BTTE 3ZZ5A 1C5YB 4INKA 5DP9A 3E0NB 2BQ6B 3TJVA 2ZEBA 1YP9A 4FU8A 4Q7YA 2F83A 2GKVE 1J16A 1MBQA 1S81A 1MAXA 3SORA 4BTUB 2PTNA 4H4FA 1W7XH 2F9UA 4JYVH 1FN6A 1E37B 2AYWA 3P8GA 1VITG 3ZV8A 4AFSA 3V12A 1P04A 3A7WA 1C5NH 3SJ9A 1PQAA 3TH4H 2H9EH 1XUFA 1IHTH 1TRMA 2FO9A 1OYQA 1VCPA 1TPOA 4NZQA 4MG3A 5SGAE 8KME2 1P05A 1KXBA 3ATWA 1P09A 1O2TA 1NFWA 2ANYA 3MU0A 1UTOA 1ZTKA 5E0GA 3UFAA 1HNEE 2Z9JA 1V2NT 1BHXF 4DG4A 1C5TA 1N1LA 1VZQH 5ESBA 4TYDA 1SOZA 1MKWK 1EQ9A 1T31A 5CE1A 5F8XA 4YESB 2AS9A 4CHAB 1O3IA 1KLJH 2C8YB 3OTJE 2ZTZA 3F9EA 1EP6A 2VWMA 4E06H 1LTOA 1EJAA 1DPOA 2ALPA 2BDCA 1GHVH 2IJOB 2PKAB 5CHAC 2EI6A 2WPLS 1O2RA 1QNJA 1PFXC 1TMTH 2ANWA 1SFIA 2BD4A 3GCNA 2ZG0H 3GY6A 1E34B 2FYRA 1C5QA 2XTTB 1SGCA 5K7RA 2RDLA 1MKWH 1UCYK 4ABEA 3RM2H 5DP6A 1O3CA 3RXEA 1CT2E 3BF6H 2W7SA 1C2HA 4YO9A 3UIRA 1MTNB 4NZLA 3D49H 1MZAA 2CGAA 2FYQA 1Z6JH 5C20A 1O2IA 1BCUH 3SJKA 2PUQH 4K1EA 4FUEA 5FPYA 4OS6A 1HV7A 2F9NA 9LPRA 3M3VA 3E0PB 1ARBA 1J9CH 1F2SE 2ANMH 4CR5A 1XUKA 2H1UA 1O3JA 1CT0E 2VVCA 1ETRH 1CBWC 2XWBI 2XBVA 1XKBC 2QN5T 3ATKA 3QLPH 2WPJS 2EA3A 1KXDA 2YNBA 4ZKRU 1FV9A 5FCRA 2OBOA 1WV7H 4YTAA 2Y7ZA 3QZQA 4IBLH 3MU5A 3LJOA 1GGDB 1GI4A 2A2QH 2FI4E 4LZ4B 1WCZA 3M36A 3T28A 1GBEA 1GVLA 2ZDNA 2LPRA 3GCTG 2GMTC 3RMNH 1C1WH 1A4WH 1FNIA 1SVPA 1HAPH 1UO6A 1TOMH 3EA9A 1HXEH 3FP6E 1C1MA 3RXRA 1C5WB 1GJAB 4VGCB 1QGFA 1EJNA 5EXLA 1BZXE 1TMUH 1DOJA 1QJ7B 4FUDA 1EPTB 4D9RA 3LGUA 1IAUA 2A4RA 1O2QA 2GDDA 3K6YA 4OGXA 4YOGA 2GV7A 4BNRA 5EQRA 1ELVA 1BTPA 3BTWE 3F6UH 2ULLA 1AD8H 1IQJA 1K1JA 2AGGX 1O5GH 3RXOA 1SR5C 3MO6A 1P03A 2VIWA 4R8TB 1OWDA 1RRKA 2FLBH 1LVYA 2ZI2H 1GHAF 1OWEA 4NG9H 2Q6GA 2QAAA 1T4UH 2W7UA 4AYYB 1S85A 2FOGA 3OSYA 3GDUA 1SLXB 1BBRH 4X6PA 3VB7A 4ZXYH 1P0SH 1TNKA 2YOLA 3RXDA 4B2CA 1BRAA 1O39A 2Q6DA 2IOTA 3SNCA 1G3CA 3RXUA 3PROA 1KYNA 1GCDA 3TK6A 1NFXA 2HPQH 2GGVB 1WOFA 1TX8A 1YPHE 4J2YB 4M7GA 1JWTA 3OU0A 4GSOA 2H2ZA 3F9FA 5J4SA 1ELEE 1YPJH 3SJOA 2J4IA 1C4V2 1ZSJA 3T5FH 4IC6A 1Y3UA 1DY9A 4RN6A 2OQUA 2M5TA 5DP8A 1BB0B 2AMDA 3W95A 6GCHG 2WPKS 4RSPA 4UFDH 1SI5H 1C4Y2 3Q77A 2BD7A 1IQEA 4JMYA 1ELBA 3U8RH 3GCTF 5GCHG 3EDXB 2GCHF 3MU4A 1AGJA 2HALA 4FU9A 1TLDA 1J14A 2A4OA 5JBTA 1UMAH 3SJ8A 1OPHB 3ZZ7A 1QL9A 1U6QA 2Z3CA 3GY2A 1A3BH 1D9IA 3M5MA 1O36A 1QA0A 2TPIZ 4K3JA 3ZZ4A 2ZIQH 1GI1A 1GGDC 2UWPA 3MOCA 1TAWA 3SO3A 1TB6H 1GI3A 1TQ0B 1XKAC 3STJA 1NRRH 1UHBA 1SGTA 4GVUA 2GCHG 3T27A 1UTPA 4BAQB 1LMWB 1YGCH 4X8SH 1O5AB 2QF0A 2GDEH 2HGTH 2BMGB 3NK8A 1QB9A 3A83A 3SNDA 2VINA 3MNCA 1YC0A 3LH3A 4Y8ZA 5A8YA 4H6TA 2SGEE 4XBDA 1FONA 6CHAB 4UDWH 2AMQA 1CGHA 3OY5U 1RGQA 1FXYA 1AWHB 4JYTA 4B75A 3SI4H 5EXMA 4CRBA 1YPMH 3GCHC 1O2HA 1WU1A 3E6PH 1UTJA 2G00A 3E8LA 1P2IA 1Y8TA 1GI6A 2ZCKP 1UK3A 3ZYDA 4CBOA 4U32A 1A1RA 4WMDA 3DFJA 5L2YH 1NFUA 2FI3E 2C8WB 1HPGA 1GBFA 4DY7B 3Q3XA 3ZVEA 2BOKA 1L4ZA 1O3LA 2FWWA 1AE5A 3SV6A 2BY5X 1V2QT 1DM4B 2Z9IA 1SPJA 1V2RT 1CU1A 1DVAH 2VWLA 2G8TA 3RXSA 4DCDA 1THSH 2B8OH 1CVWH 2A31A 1SB1H 2CN0H 3BTDE 4Q80A 2THFB 5HXFA 1SLWB 2ZNKH 3IG6B 3SUDA 1W13U 2LNCA 3B8JA 1ETSH 3SQEE 2KAIB 1ZYOA 1RXPA 3GICB 1QBVH 1Y5AT 5EPYA 4HTCH 1O3BA 4XBBA 5IDKA 1SGFA 2ZPSA 5JB9S 2ZFSA 1IQGA 5DJ7A 3KN2A 1SHHB 4FUCA 4I32A 1DITH 2F91A 3BTQE 1W0YH 2ZHFH 1QJ1B 1GI0A 1HUTH 1NPMA 2ZZUH 1ZLRA 2A32A 3S9BA 4BANB 2Z9KA 4J1YA 7LPRA 4XBCA 4Y6DA 1GHAG 2G51A 1ELGA 1HB0B 1Z1JA 3EE0B 1HCGA 4X1SU 1A5GH 3SGAE 1KTTB 1D3DB 4UEHH 4UONA 3A81A 1DANH 2SGDE 1GMCG 2NU2E 2BXUH 3TITA 3H5CB 1CE5A 5C67A 1LHEH 1TALA 1ZGIA 1TGNA 1NZQH 2XCNA 4WH6A
chains in the Genus database with same CATH superfamily
4DIHH 4GAWA 4AGJA 2TGDA 3KYFA 2P16A 1GJDB 3MQKC 2XBYA 1MTSA 4OS4A 4UE7H 3CENA 1E79D 4VGCC 1WQSA 4GUXA 3MMGA 2A2XH 4ZXXH 4UFFH 1SGYE 3RXHA 5KEDA 1O3FA 1AE8H 1RJXB 1V2VT 1X7AC 1ANBA 5GWZA 4JCNA 4RKJB 3A7ZA 1C1SA 4ISOA 1G30B 2GX4A 2D1JA 1GL0E 3GY3A 3HATH 4D7FA 3ZVCA 1WAYB 2Y80A 1GMCF 2ZO3H 4LXBH 1GI7B 1V2TT 1DLKB 1WUNH 4ABDA 1GDQA 1AO5A 1S6HA 3DUXH 3C1KA 5GCHF 1HJ8A 3U1IB 1TBZH 1V2MT 1S84A 3UOUA 3SU4A 1UVOA 1OKXA 3BG4B 5LPEA 1CSOE 1EAUA 2J5UA 4FU7A 4IMZA 3GOVB 1TONA 5E2OA 2BDGA 2P93A 3N99A 2JETB 3ZZCA 3Q3YA 1AKSB 4MVNA 1GCTC 1MKXH 2CF8H 3TJOA 2UUKB 5LPFA 1AFEH 1MAYA 4LZ1H 3P6ZB 2TGTA 2V7QD 1O3OA 1O5FH 5EOKA 4UFGH 2ZU1A 1ARCA 1K1PA 1NRQH 2F43B 3QGJA 1LVMA 1IQNA 1VJAU 3QUMP 1RFNA 2JH0D 2ZU2A 2J34A 3LC5A 1YLDA 1O2PA 1O3AA 4F49A 3RMLH 1RIWC 4AB9A 1EPTC 1D4PB 4I8GA 5FBIA 1GVKB 1H8IH 5HYOA 1JBUH 1O34A 2J9NA 5C5OA 3S9AA 3UNSA 1FY8E 1FLEE 2VIVA 1NRPH 1WSSH 3DSGA 1Y3YA 1LHFH 3LONA 2PHBA 2RDEA 1FQ3A 1ZR0A 1MU6B 1C1NA 1N6YA 3GY7A 4BTIB 2BOHB 1C1QA 2VIOA 3KQEA 5T3HA 1E1QD 2JJ1D 3RXAA 1TGSZ 1GDUA 1OWKA 1GHWH 3M3SA 1TMBH 2WPDD 1BIOA 2STAE 4NIXA 3KQ5A 1LKAA 2FX6A 2O8TA 2DUCA 4IN1A 4DVAU 1F5KU 3URDA 1AMHA 3OX7U 1ZOMA 1UTNA 2HVYB 4GCHG 4CRAA 2GT8A 5JB8S 4WMFA 2ZFFH 1SGDE 3TIUA 3V7TA 5LH8A 3PLPA 1ZTJA 3BTHE 5JBCS 1YCPH 3UUZA 1E38B 5IK2D 3LKWA 1C1RA 1C5PA 4AYVB 3M7UA 2CXVA 2GMTB 3KNXA 2IN2A 3ZVAA 1RD3B 1NO9H 5F8TA 5DN6D 2G4UA 1L2EA 2ZTYA 3RXPA 2J2UA 4CBNA 2FOFA 3ITIA 1MQ5A 1HAHH 3ZZ9A 1C4U2 2IPQX 1IQMA 3NCLA 1XUHA 2SFAA 3RLWH 4AC9A 4ZMAH 7KMEH 2BQ7B 1D6WA 2OK5A 1P2MA 1ZGVA 4TT3D 1BTWA 1O5DH 4AFUA 4AG1A 4MQAA 4MNVA 2WYJA 1XMNB 2ZCHP 4Y11E 2AHME 4BAOB 5LPRA 1GHYH 4ASHA 2QXIA 1CGJE 1P3EA 2ZCLP 3RC6A 5J4QA 2G81E 3VG8A 4D7GA 2TIOA 1QB6A 1S0RA 1GJ4H 2GCTC 2BDYA 1GJ7B 1P2OA 1CHGA 4A5TS 2C3SA 2NU1E 5F53A 3T25A 2CJIA 2YNAA 1GJ8B 4INHA 4CRFA 1K1LA 1XM1A 5C1UA 1GBLA 3I29A 2Z3EA 3TU7H 1YPGH 3SNEA 7GCHG 1EOJA 4I8KA 1YPEH 1GMHG 2BQWB 2OC8A 1AZ8A 1E1RD 3M3TA 1PQ8A 3KL6A 4M9FA 1FMGA 2G5NA 1MTNC 1D3TB 1P01A 2UUYA 5T6DA 3ATIA 4B71A 1VGCB 3F2HA 1NU9A 1ELFA 1KTSB 1BJUA 2PKSC 1HDTH 1T8MA 2BD9A 2ZHWH 2YMSB 2HLCA 1AVWA 1YLCA 2KCYA 1H9IE 1EPTA 3LIWA 1FY5A 2OC0A 3ZZ3A 1GJ9B 4AZ2B 2EI8A 3SI3H 1V6DA 3KEEA 4Y10E 1LQEA 1O2YA 5G4BA 4ABJA 1VCWA 3DD2H 3UQVA 3SV8A 5FCKA 2AMPA 2G5VA 1CA0C 1SGPE 1EJMA 5C0UA 2F3CE 1MTUA 3AW1A 3AW0A 4WXVA 3T26A 2R3UA 2QXGA 3KYGA 3RU4T 2FM2A 3SUFA 4BAKB 3GCOA 1O2MA 2P8OB 4YM9A 2ZKSA 5GDSH 3E90B 2YMSD 1PJPA 4H42U 2P3FH 2C8ZB 4ASUD 4K5ZA 2D2DA 3H7TA 4DOQA 1VR1H 3BSQA 1QRXA 4Y8YA 1HGTH 4IGDA 1FI8A 1VITH 2A1DB 4XFQA 2I6SA 4Y79A 1A3EH 3NPSA 2ZU3A 1V2ST 1FY4A 1EAWA 5DSFA 1ZTLA 1VGCC 1GG6C 2ZA5A 2BD8A 5DPAA 3K9XB 1O32A 2HVXA 2FOEA 3A8AA 4FOUC 1MH0A 1TQ7B 2FZZA 1S6LA 1FUJA 3ODDA 1DDJA 3UY9A 4OS2A 4X6MA 4INLA 1NRSH 3NXPA 1G2LA 1GBTA 1OP0A 2EEKA 3ZV9A 1MMJN 3VFEA 3A85A 2BZAA 4R0IA 1ZSLA 2CMYA 1C2MA 1SQOA 3CNRA 1NU7B 1CGIE 4WMEA 1O2LA 3QWCH 1LPKB 2BXTH 4NFFA 1P57B 1ACBE 1A61H 1AN1E 2A7CA 4CRDA 1W14U 2FTMA 4ACAA 4O9VA 1MCTA 2DE9A 2F9OA 1GJ5H 3TGKE 1GJ6A 4A7IB 1MD8A 1GPZA 3M7QA 5FBEA 1TYNA 1XUGA 3GY5A 5GXPA 2D26C 1IQFA 1ZHMA 2D8WA 1AI8H 3PMAB 2HOBA 4X8VH 1PPFE 3A89A 3RM0H 2FOHA 3A82A 1C1OA 1LCYA 1LDTT 2W6JD 1DWEH 1AB9B 1BA8B 4MLFB 5ABWA 1UTMA 3ZYEA 4CHAC 1OXGA 2V6NA 4Z0KA 1KDQA 1TGCA 2CHAB 1DS2E 1FZZA 4P02A 2OUAA 1HAXB 4F4OC 3DCLA 4I8HA 2Y82A 1W10U 2OTVA 1TIOA 2OCVB 3PMHB 2ANKH 5EG4A 1TNGA 1O5CB 1C9PA 3QDZB 1OWJA 2QC2A 3A80A 4CRGA 1QTFA 2QV1A 1C5VA 1PPZA 3A84A 1GHBF 5H4IB 2BX4A 1HRTH 1O2JA 4AB8A 1UVPA 4JZDH 1O2SA 2Z3DA 2OD3B 3BTGE 2ZHDA 3AVZA 5C1XA 1Y5BT 2XWAA 3RXQA 2KAIA 2WV5A 5L2ZH 2GZ8A 3DA9B 1NRNH 4IW4E 1EP5A 1UVUH 3SHAH 4TY6A 2KM0A 4GPGA 2UWOA 2WPIS 4X8UH 4SGBE 1AVXA 3AAVA 1QZ8A 2NU0E 4B76A 2C4FH 5DG6A 1LQDB 1SLUB 4ISNA 2W6ID 1DLEA 2ZGCA 2PSXA 4NCYA 2R9PA 1OOKB 4HZHA 8LPRA 2ZDVH 5DK1A 9ESTA 1MCVA 1UK2A 4JZEH 1DUEA 1GI5A 3FANA 3MWIU 2J98A 2A5KA 2OINA 4Y76A 1BRBE 1LPZB 1ZRKA 4HG6A 2HNTC 2TGAA 1C2DA 4OM9A 1N8OC 2V0BA 3K65B 4Q2KA 2PR3A 1QL8A 1FDPA 1C5UA 1KIGH 4O3UA 2QY0B 2B0FA 3M37A 2JDID 1SC8U 3M5NA 4OS7A 1GI2A 5DP5A 3HKJB 1L1JA 3BG4C 1C1TA 1WQVH 2F9BH 2BVXH 2HWLB 5B6LA 1J8AA 1ZPZA 2P8OC 2AGEX 1M9UA 1QR3E 4ZHAA 1ANEA 4KP0A 2WPHS 3ZIAD 6GCHF 2BB4A 1V2JT 3KGPA 5JBBS 4NIVA 3TK9A 1V2WT 1DWBH 3GY8A 2PSYA 4JZIA 2NWNA 5JPMH 1BTHH 5A0AE 3K6ZA 2A7HA 1P02A 2RG3A 3MNBA 2BX3A 2I6QA 3RXMA 5EQQA 3HGPA 3U28C 1K1NA 2OLGA 3PV2A 3Q3KA 2B5TB 1P9UA 1Q31A 1QBOA 1OS8A 3MH4A 3SQHE 1GCTB 5EQSA 4K8YA 2P59A 1YPLH 1BT7A 1GI8B 2BD3A 2WYGA 3QZRA 3LPRA 4B1TA 1SGIB 2GV6A 3MFJA 1GBDA 3DFLA 4IC5A 3BEUA 2PV9B 3SYJA 4IN2A 1QQUA 2QF3A 2XCFA 1AKSA 1K22H 4WF8A 5DP7A 1Z7KA 4JK5A 3D65E 4D9QA 2PLXA 1Z8IB 2L6OA 3U69H 5DO4H 1NBME 2R3YA 3UAIC 3WWFA 8ESTE 1BBRE 1TOCB 3TNSA 5HM2A 1C1UH 2GCTB 1THRH 4XSKU 3ZVGA 3TGJE 2XRCA 2YMSC 4A1XA 1SGFG 2JH6D 1DWCH 3UREA 3N7DA 3PTNA 1Q3XA 3BEIB 2ZECA 4JZ1A 2F9VA 1UW7A 3GYLB 3UQOA 3ZZBA 1ZJDA 2XBXA 1BDAA 5JYIA 4FUGA 4MPVA 1MZDA 2BLVA 3T2NA 1O2UA 1RIWB 1L1NA 1G3DA 1P06A 3PM3A 1GMDG 1INCA 2CHAC 2OBQA 5T6FA 5B6OA 5DP3A 2OXSA 1GBCA 4MPWA 1QB1A 2ZFTA 5FXLA 3T62A 1C2LA 1TNHA 1NESE 3A87A 3RC4A 2ZPRA 1NFYA 3GY4A 5E8EH 4CH8B 1IHSH 2AERH 4X2XA 2BYAX 3M7TA 4AFZA 2BY7X 2PGBB 1O3HA 1YCPM 4Y0ZE 1P9SA 1FAXA 4SGAE 4YOJA 1D6RA 1YM0A 1Q2WA 4AORA 3SV9A 3LJJA 4BXWA 1ZMJA 1MUEB 1TBRH 6LPRA 3EGKH 3BTEE 4GHTA 4X2WA 1D3QB 1T4VH 1GI9B 1XX9A 1YYY1 2H5DA 3LT3A 1QBNA 5EGMA 5HIYA 3PWCA 5FL7D 2OQ5A 4ABIA 3S0NA 3IITA 1E36B 1TPPA 1ANCA 1V2OT 3HK3B 3KCGH 3T29A 3V13A 1HAGE 1HJAB 2H9HA 4UFEH 2ZDLA 1EB1H 4X6OA 3EA7A 1F92A 1OSSA 2ZFRH 3RUOA 1H4WA 2KX4A 5HGGA 3GDVA 1PQ5A 4X2YA 2BHGA 1E0FD 4O3TA 5E0JA 1GJCB 3MNSA 4WVPE 1GBMA 1W8BH 1JRTA 2BLOA 2W3KA 3TH3H 3ENSB 5HMAA 2GT7A 5C5NA 2C93B 3HK6B 2R0LA 1ZRBA 1NTPA 1MTVA 3H7OA 2PGQB 1JOUB 1BRCE 1A0LA 4YLQH 2HNTF 2ZU4A 1RTKA 1ELCA 3TJNA 2ASUB 3M5OA 2VGCB 3ZVFA 1EASA 1QJ6B 2JETC 3F3BA 2FOCA 2GTBA 1XUIA 4I33A 4X1QU 4OGYA 1E35B 2FTLE 2WV9A 4Q7ZA 1TPSA 3SGBE 3ZZDA 1SBWA 3MH6A 1SMFE 2NU3E 1WTGH 1ABJH 1LHCH 3JZ1B 3TVJB 2SGAA 1AUJA 2TBSA 1FN8A 1V2UT 1O3EA 3PRDA 4FUIA 3SBKA 2FOBA 4D8NA 3P95A 1SGQE 3SU3A 1T7CA 2XNDD 2G4TA 4A1TA 3OFND 1O30A 1YBWA 1G32B 1Y5UT 1SFQB 3SZNA 1FIWA 5FX5A 1LPGB 2K8IA 3RXIA 3URCA 2J92A 2VGCC 2P95A 3UPEA 2HNTE 2W5EA 1Z8JB 4DW2U 1MBMA 3MH7A 2QA9E 2SNWA 1C2FA 2ZWLH 4ABHA 4HGCA 5A8XA 5KECA 1GL1A 1P12E 1HYLA 2XYAA 3FN8A 3L33A 3GCHB 1IQLA 1SLVB 2G55A 3VB3A 1GBJA 1K0HA 4K60A 4K1TA 3F1SB 1RS0A 3RXVA 1H9LB 3UWIA 1NN6A 5C1YA 3RU4E 3RC5A 2PKSB 2XW9A 1ZMNA 1HLTH 4BXSA 1BTYA 1DUAA 5TCAA 3VXFH 1P2KA 1ELDE 1LKBA 1DX5M 3DT0H 1J15A 2PTCE 2R0KA 2WUCA 5EIYA 1O2WA 1SQAA 3R3GB 4F55A 3BTKE 1RTLA 2HLDD 4KKDA 5BRRE 2VJ1A 2Y6TA 2J95A 1W2KH 4FETA 1HAVA 3ELAH 1DWDH 1AFQB 4X1RU 4Q63A 3AAUA 4Y71A 2WZQA 4CREA 3SW2B 3M5LA 4B2AA 2Z9LA 3BIUH 4Y7AA 2FMJA 1QHRB 3CS7A 4FUFA 1L0ZA 2H6MA 3QTOH 1HAOH 3BTFE 2ZHQH 3LH1A 4ZROA 3V3MA 3PYHA 1KXFA 3P70B 5AHGH 4FUHA 1AHTH 1K2I1 4GCHF 1CHOG 4Q7XA 2ODPA 2PKAA 2UWLA 1TPAE 3U8TH 1Y3XA 4ZH8A 4KTCA 1NBMD 1O2VA 2KR7A 1AFQC 1EB2A 4NIYA 2ZDMA 1DSTA 1GMHF 3OAAD 2M2AA 4BAHB 1O3NA 2A0QB 3RXTA 2P3UB 1F5RA 4NA8A 1Z71A 5EJ1A 4TSFD 4FUBA 5I46H 1FPCH 3KQDA 4CRCA 2KCPA 5I25A 2TGPZ 1C5RA 1G3EA 4DJZB 2ZFPH 2BD5A 1S82A 2L74A 1C2JA 4WJG2 2BD2A 3EA8A 3PV4A 2Y5HA 3A8BA 1TRYA 1K9OE 5F8ZA 3RXJA 1MD7A 3L6PA 2OC7A 1YLNA 2AIQA 2WHXA 1WTHD 4OS1A 1Z1IA 3DHKH 1KXAA 1H1BA 4MTBA 5EU8A 3BN9A 1SGNE 3QX5H 4FUJA 4XOJA 3SN8A 3MTYA 3FVFB 1H8DH 3F9HA 1CT4E 1EXFA 1VCQA 1XXDA 2R2WU 4FVBA 1V2LT 4JK6A 4MNXA 1O33A 4WH8A 1EAIA 1QQ4A 3UOPA 1TGBA 1MABB 3SV7A 3LGWA 1TX6A 1P8VC 4K69A 1H8ED 1NC6A 2BDIA 3PTBA 1C2EA 4ZKSU 3TPIZ 2H9TH 4GLYA 2QYIA 4A1VA 1NS3A 1OYTH 3A88A 2Z7FE 3A8CA 1A5IA 4B73A 1Y59T 3MO3A 2ZPQA 1FPHH 3E91A 4ABBA 1OWHA 3KF2A 4AGKA 1HFDA 1DXWA 2J94A 3OYPA 2DE8A 2FXRA 3VXEH 1SQRA 1FY3A 2UUJB 2BY6X 2ZQ2A 3Q00A 1RTFB 3LGYA 3S7KB 5KGOA 1D3PB 1B0FA 2ZTXA 4P00A 1HIAA 3TK5A 1G36A 1GBKA 1AZZA 2GZ7A 2QIQA 1K1MA 1C9TA 2Q6FA 4OS5A 2K1QA 1A46H 4Z1MD 4JYUH 1O2OA 5HKKD 1NY22 1MU8B 1TGTA 2XC0A 1GHBG 2EI7A 5PTPA 3M61U 3RMMH 2Y7XA 3ZZAA 3SU6A 1PPEE 3ZZ6A 1HAZB 1BRUP 1O3GA 3RP2A 1OWIA 4AX9H 1P3CA 1BUIA 1LVOA 3E16B 4Y7BA 1ABIH 2JIZD 5L30H 4I86A 1SGRE 3ZZ8A 3NRLA 1PPBH 2QCYA 2Q1JA 2XC4A 5F6MA 2VU8E 3UNQA 1LVBA 1TRNA 2PWXA 3LU9B 1QCPA 2O8LA 3QTVH 4TWYA 5K0HA 1YY3A 3LDXH 1TFXA 1C2KA 2LELA 2A4QA 2BY8X 1W0ZU 1EUFA 2C90B 3VB4A 5JBAS 4THNH 3PMBB 5A0CA 1SG8B 3TJUA 1PYTC 3F68H 3U8OH 1OX1A 2NU4E 1FIZA 1HJAC 4O97A 1EZUC 1QIXB 5LGOA 2FODA 1O3DA 2FEQH 2AEIH 3TGIE 1ZHPA 2QF5A 4NWKA 4MNYA 3SJIA 4AN7A 1BMFD 2VB0A 2RA3A 1ORFA 2AFQB 7GCHF 8GCHG 4B2BA 4BOHA 4NFEA 5C0TA 1IOEA 2HRVA 2V3OH 1P11E 3IWMA 3PWBA 3FFGA 1DE7H 3VEQB 5A2MH 3S7HB 1ELTA 1KMHB 1Z8RA 5TCCA 1AWFH 3A86A 5A8ZA 4K8BA 1K28D 1COWD 1P10A 3ZVDA 3RXBA 2QXJA 4MNWA 2SGFE 2J38A 3NWUA 2KCOA 3RDZA 5F03A 3ATMA 1S6FA 3KQBA 4NGAH 1C2GA 1S83A 1O35A 1P2NA 1ZJKA 2FDAA 3A7XA 1UVSH 1HIAB 2ZU5A 5A0BA 1V3XA 1Z6EA 2SGQE 3SV2H 1T32A 1SGEE 4K2YA 4ZHMU 5CHAB 4KELA 1V2KT 2Y5FA 3JZ2B 2BY9X 2O8MA 4U2WA 3UTUH 3M35A 3FOAA 4ABFA 3WY8A 3U1JB 1G9IE 2A5AA 3FAOA 1G37A 2OP9A 1PPCE 1VITF 2FS8A 1UK4A 4BTTB 1OP2A 1BBRK 2C8XB 2WPMS 2BDHA 1SSXA 1BQYA 1YPHC 4I8LA 1EZSC 3MU1A 1TWXB 1O2NA 1BHXB 2BDAA 3SU0A 4Z6AH 2W26A 3FZDA 4DGJA 1GBBA 1H9HE 1AIXH 3I78A 2VWNA 1DXPA 2A4GA 2JH5D 3O8RA 2BVSH 1O2GH 3BV9B 4NWLA 4IMQA 5C2ZA 1IQIA 2RCEA 1ZZZA 1HAYB 1L1GA 2RA0A 1IQKA 2QF4A 3GDSA 4HFPB 2VVUA 4YZUA 5FPSA 4DT4A 4AFQA 1ZSKA 1PPGE 2BZ6H 3RXGA 4TPYA 1O3MA 3STIA 1YF4A 2WUBA 1A0HB 1G3BA 3LGTA 1DY8A 4XE4A 5E0HA 2VWOA 3SHCH 5ETXA 1O3PB 3KIDU 1MKXK 5E2PA 1XVOA 3O8BA 1YPKH 1SQTA 1TA2A 3D62A 3SNBA 1LO6A 3N7EA 3A7YA 2G52A 1TABE 5AF9H 3S9CA 1GVZA 1P2JA 3U98H 1YCPK 1HAIH 1HBTH 1SL3A 1A7SA 1VJ9U 2O8WA 3GISB 5TJXA 1CA8B 2CV3A 2QGRA 1YKTA 1QA7A 1ZPCA 2FLRH 1W12U 2FS9A 3SU5A 4U01A 2P94A 3A7TA 1C5SA 3I77A 1C5OH 1TA6A 1UCYH 1B7XB 1DFPA 3SUEA 1GHXH 4ISHH 2JKHA 2PUXB 1KLIH 1UCYE 4QT8C 2EQNA 1BOQA 2Y5GA 2ZGHA 3KHVA 1UTKA 5FPTA 3EYDA 1C5MD 1KSNA 2V35A 1PQ7A 3OE7D 3PMJA 4X8TH 4TY7A 6ESTA 1FJSA 5EW1H 5EXNA 1GDNA 1K1IA 2GVFA 3ATLA 4UD9H 4ABAA 1AVGH 3MNXA 3V0XA 3SNAA 1UTQA 4ZHLU 2BM2A 4MPXA 3LGIA 2HPPH 2ZC9H 1EOLA 1QFKH 4ISLA 1K21H 1BJVA 1BMMH 3EAJA 3VGCB 1NM6A 4KGAA 3TH2H 1ZMLA 1W0KD 4NSVA 4ABGA 1O2ZA 1TNLA 1G2MA 4U30A 3G01A 1KLTA 1DICA 1GBHA 5DP4A 2B7DH 4DT7B 1A2CH 1O38A 2Y81A 1T8LA 2EC9H 5EPNA 3SU2A 1GBIA 4ZUHA 2FESH 1HXFH 2F9PA 3P92A 1NROH 1PYTD 1JIRA 1FX0B 1ID5H 3UWJH 1LHDH 1EATA 1ESAA 1CO7E 1GJBB 1S0QA 2OC1A 1BITA 1UJ1A 3E3TA 2BDBA 1O0DH 4NIWA 5DKMA 5AFZH 1B5GH 2TRMA 2FPZA 4WY3A 4HI3A 1YWUA 1HAVB 1O5EH 2FX4A 4X6NA 4WWYA 3KQCA 3BG8A 4ESTE 3W94A 2WSSD 1WBGB 2FP7B 7ESTE 2VVVA 2FIRH 2ODQA 1DT2A 2BVRH 1GG6B 3MH5A 1EX3A 2EY4C 3S69A 4X1NU 1C5ZB 3PO1C 4X2VA 1F0UA 3SGQE 2R2MB 1C1VH 1IQHA 4YOIA 1FAKH 4IS5A 2XBWA 3NUMA 1N8OB 2BLQA 3ODFA 3UR6A 2Z6BD 1F0SA 1UVTH 3MYWA 5JDUB 4DIIH 2AGIX 4AOQA 1TBQH 1F0RA 2SGPE 3BIVH 4E7RG 1WDIA 5T6GA 3L3TA 4H6SB 3VB6A 1EKBB 2ESTE 1KDQB 2CF9H 4KTUA 4ZKNU 2V3HH 1KXEA 4WXIA 1C2IA 5AVDA 1AY6H 1F0TA 2PW8H 2ZDKA 3E1XB 1P2QA 1ANDA 2Z9GA 2FOAA 3CP7A 2VIPA 2XC5A 3MO9A 1BTXA 1QRZA 1XXFA 5DGJA 2XXLA 2ZHEH 1EZXC 3QN7A 4FXGH 5ESTE 4YLUA 1C1PA 3B23B 2QXHA 2A45B 3LGVA 1WYKA 2CK3D 1KY9A 3PLBA 1HJ9A 3RXKA 1UTLM 3O8DA 4KTSA 1TNJA 3AASA 2GD4B 1T8OA 1BTUA 3PV5A 8GCHF 2GJGA 2UUFB 3B9FH 2FI5E 1EZQA 4BAMB 1O37A 1MTWA 3GYMA 1AB9C 3P8FA 2XNIA 3P17H 3LOXA 2ZDAH 1W3CA 1Y3VA 5GJ4B 1TNIA 4MDSA 5EJZA 1C5XB 4DURA 3QO6A 1BMLA 1CBWB 2A7JA 5C3NA 2ZFQH 2QE7D 2K0QA 3ESTA 3MHWU 3OY6U 4E05H 5FAHA 1OP8A 1XUJA 1QRWA 2O9QA 2STBE 1S5SA 1KXCA 3NKKA 2FOMB 3U9AH 5A09A 5EW2H 1ETTH 3D23A 3SUGA 1JRSA 3MI4A 4CR9A 1AUTC 3RMOH 1ELAA 3RXCA 2ALVA 4RKOB 4I7YH 2VIDA 5GPIB 1QURH 3MU8A 5FX6A 3HGNA 4ISIH 1AU8A 1DSUA 2ODYB 3FZZA 2VBCA 3QGNB 1W11U 3PO1B 4A92A 2B9LA 1ESBA 1L4DA 1O2KA 5GIBA 2ILNA 3VPKA 4D76A 4TWWA 4LOYH 3FP8E 4I31A 2VNTA 1O31A 4RT1A 3RU4D 6CHAC 4YT6H 5FHTA 1A0JA 1J17T 1NT1A 3UR9A 1BTZA 3C27B 4NA7A 4Y0YE 3HPTB 1Z8GA 4AG2A 3QK1A 3P8NA 3NZIA 4NSYA 1F7ZA 2SNVA 2ZGJA 2P3TB 1FY1A 1LHGH 2W3IA 3BEFB 4X1PU 1JIMA 1GHZA 1QL7A 4B6EA 3LC3A 4LK4A 1W7GH 2Z94A 3SOSA 3VB5A 4CH2B 4XDEA 3R0FA 3TNTA 1TE0A 4X0WU 1Y3WA 1JMOH 1K1OA 2ZGBH 3A8DA 2AIPA 4PROA 5IYTA 4Y8XA 2ZGXH 1EAXA 3F9GA 3Q76A 5AFYH 1THPB 3PLKA 3PB1E 4E7NA 2H5CA 2GZ9A 3K2UA 5EODA 3N7OA 2ZF0H 4YT7H 1N6XA 3ZVBA 1O3KA 2VH6A 1V2PT 2BTCE 1GWAA 4O03A 1UHBB 3CS0A 1CA0B 1ZHRA 1B0EA 1JXPA 2ZP0H 2BLWA 1AQ7A 2VIQA 3A7VA 3UNRA 4TPIZ 3FP7E 5CMXH 3BTME 4ZAEA 3F0PA 1XVMA 3GS9A 4NA9H 3SU1A 1C5LH 1CQQA 1BMNH 2PFEA 3EQ0H 2A5IA 4JZFH 3O8CA 2V3MA 2AH4X 3VGCC 4FVDA 3HKIB 3RLYH 2VH0A 1ZPBA 1BMAA 1PPHE 2WINI 2O8UA 1T8NA 3TLOA 1F5LA 1O2XA 3RXFA 4B74A 4I8JA 1TX7A 1QY6A 2WV4A 1GMDF 5C94A 5HM9A 4MPUA 4A6LA 5L6NH 3F0OA 1SHYA 1A5HA 2IPHA 2KCAA 1MQ6A 5BPEA 4YXWD 1SOTA 1O5BB 3RXLA 4K1SA 4ZKOU 1CHOF 4GHQA 1GBAA 2GP9B 3P8OA 1ESTA 2ZQ1A 3BTTE 3ZZ5A 1C5YB 4INKA 5DP9A 3E0NB 3OTPA 2BQ6B 3TJVA 2ZEBA 1YP9A 4FU8A 4Q7YA 2F83A 2GKVE 1J16A 4ACBA 1MBQA 1S81A 1MAXA 3SORA 4BTUB 2PTNA 2F4LA 4H4FA 1W7XH 2F9UA 4JYVH 1FN6A 1E37B 2AYWA 3P8GA 1VITG 3FO8D 3ZV8A 3V12A 4AFSA 1P04A 3A7WA 1C5NH 3SJ9A 1PQAA 3TH4H 2H9EH 1XUFA 1IHTH 1TRMA 2FO9A 1OYQA 1VCPA 1TPOA 4NZQA 4MG3A 5SGAE 8KME2 1P05A 1KXBA 3WWBA 3ATWA 1P09A 1O2TA 1NFWA 2ANYA 4XD7D 3MU0A 1UTOA 1ZTKA 5E0GA 3UFAA 1HNEE 2Z9JA 1V2NT 1BHXF 4DG4A 1C5TA 1N1LA 1VZQH 5ESBA 4TYDA 1SOZA 1MKWK 1EQ9A 1T31A 5CE1A 5F8XA 4YESB 2AS9A 4CHAB 1O3IA 1KLJH 2C8YB 3OTJE 2ZTZA 3DSPA 3F9EA 1EP6A 2VWMA 4E06H 1LTOA 1EJAA 1DPOA 3SZEA 2ALPA 2BDCA 1GHVH 2IJOB 2PKAB 5CHAC 2EI6A 2WPLS 1O2RA 1QNJA 5CHBA 1PFXC 1TMTH 2ANWA 1SFIA 2BD4A 3GCNA 2ZG0H 3GY6A 1E34B 4Q4LA 2FYRA 1C5QA 2XTTB 1SGCA 5K7RA 2RDLA 1MKWH 1UCYK 1VKYA 4ABEA 3RM2H 5DP6A 1O3CA 3RXEA 1CT2E 3BF6H 2W7SA 1C2HA 4YO9A 3UIRA 1MTNB 4NZLA 3D49H 1MZAA 2CGAA 2FYQA 3F2FA 1Z6JH 5C20A 1O2IA 1BCUH 3SJKA 2PUQH 4K1EA 4FUEA 5FPYA 4OS6A 1HV7A 2F9NA 9LPRA 3M3VA 3E0PB 1ARBA 1J9CH 1F2SE 2ANMH 4CR5A 1XUKA 2H1UA 1O3JA 1CT0E 2VVCA 1ETRH 1CBWC 2XWBI 2XBVA 1XKBC 4B6FA 2QN5T 3ATKA 3QLPH 2WPJS 2EA3A 1KXDA 2YNBA 5T1VA 4ZKRU 1FV9A 5FCRA 2OBOA 1WV7H 4YTAA 2Y7ZA 3QZQA 4IBLH 2JJ2D 3LJOA 3MU5A 1GGDB 1GI4A 2A2QH 3DSOA 2FI4E 4LZ4B 1WCZA 3M36A 3T28A 1GBEA 1GVLA 2ZDNA 2LPRA 3GCTG 2GMTC 5C17A 3RMNH 1C1WH 1A4WH 1FNIA 1SVPA 1HAPH 1UO6A 1TOMH 3EA9A 1HXEH 3FP6E 1C1MA 3RXRA 1C5WB 5CDFE 1GJAB 4VGCB 1QGFA 1EJNA 5EXLA 1BZXE 1TMUH 1DOJA 1QJ7B 4FUDA 1EPTB 4D9RA 3LGUA 1IAUA 2A4RA 2RFKC 3FKSD 1O2QA 2GDDA 3K6YA 4OGXA 4YOGA 2GV7A 4BNRA 5EQRA 4F48B 4RT0A 1ELVA 1BTPA 3BTWE 3F6UH 2ULLA 1AD8H 1IQJA 1K1JA 2AGGX 1O5GH 3RXOA 1SR5C 3MO6A 1P03A 2VIWA 4R8TB 3PRBA 1OWDA 1RRKA 2FLBH 2KFWA 1LVYA 2ZI2H 1GHAF 1OWEA 4NG9H 2Q6GA 2QAAA 1T4UH 2W7UA 4AYYB 1S85A 2FOGA 3OSYA 3GDUA 1SLXB 1BBRH 4X6PA 3VB7A 4ZXYH 1P0SH 1TNKA 2YOLA 3RXDA 4B2CA 1BRAA 1O39A 2Q6DA 2IOTA 3SNCA 1G3CA 5GNDA 3PROA 3RXUA 3H09A 1KYNA 2IJD1 1GCDA 3TK6A 1NFXA 2HPQH 1W0JD 2GGVB 1WOFA 1TX8A 1YPHE 3WW7A 4J2YB 4M7GA 1JWTA 3OU0A 4GSOA 1OHHD 2H2ZA 3F9FA 5J4SA 1ELEE 1YPJH 3SJOA 2J4IA 1C4V2 1ZSJA 3T5FH 1SKYE 4IC6A 2LP6A 1Y3UA 1DY9A 4RN6A 2OQUA 2M5TA 5DP8A 1BB0B 2AMDA 3W95A 6GCHG 2WPKS 4RSPA 4UFDH 1SI5H 5HIZA 1C4Y2 3Q77A 2BD7A 2PP6A 1IQEA 4JMYA 1ELBA 3U8RH 3GCTF 1WXRA 5GCHG 3F2GA 3EDXB 2GCHF 3MU4A 1AGJA 2HALA 4FU9A 1TLDA 1J14A 2A4OA 5JBTA 1UMAH 3SJ8A 1OPHB 3ZZ7A 1QL9A 1U6QA 2Z3CA 3GY2A 1A3BH 1D9IA 3M5MA 1O36A 1QA0A 2TPIZ 4K3JA 3ZZ4A 2ZIQH 1GI1A 1GGDC 2UWPA 3MOCA 1TAWA 3SO3A 1TB6H 1GI3A 1TQ0B 1XKAC 3STJA 1NRRH 1UHBA 1SGTA 4GVUA 2GCHG 3T27A 1UTPA 2KZ4A 4BAQB 1LMWB 1YGCH 4X8SH 1O5AB 2QF0A 3OEED 2GDEH 2HGTH 2BMGB 3NK8A 1QB9A 3A83A 3SNDA 2VINA 3MNCA 1YC0A 3LH3A 4Y8ZA 5A8YA 4H6TA 2SGEE 3UB0A 4XBDA 2J98B 1FONA 6CHAB 4UDWH 2AMQA 1CGHA 3OY5U 1RGQA 1FXYA 1AWHB 4JYTA 4B75A 3SI4H 5EXMA 4CRBA 1YPMH 3AK5A 3GCHC 1O2HA 1WU1A 3E6PH 1UTJA 2G00A 3E8LA 1P2IA 1Y8TA 1GI6A 2ZCKP 1UK3A 3ZYDA 4CBOA 4U32A 1A1RA 4WMDA 1H8HD 3DFJA 5L2YH 1NFUA 2FI3E 2C8WB 1HPGA 1GBFA 4DY7B 3Q3XA 3ZVEA 4XRNA 2BOKA 1L4ZA 1O3LA 2FWWA 1AE5A 3SV6A 2BY5X 1V2QT 1DM4B 2Z9IA 3W1EA 1SPJA 1V2RT 1CU1A 1DVAH 1EFRD 2VWLA 2G8TA 3RXSA 4DCDA 1THSH 2B8OH 1CVWH 2A31A 1SB1H 2CN0H 3BTDE 4Q80A 2THFB 5HXFA 1SLWB 2ZNKH 3IG6B 3SUDA 1W13U 2LNCA 3B8JA 1ETSH 3SQEE 2KAIB 1ZYOA 1RXPA 3GICB 1QBVH 1Y5AT 5EPYA 4HTCH 1O3BA 4XBBA 5IDKA 1SGFA 2ZPSA 4RI0A 5JB9S 2ZFSA 1IQGA 2J97A 5DJ7A 3KN2A 1SHHB 4FUCA 4I32A 1DITH 2F91A 3BTQE 1W0YH 2ZHFH 1QJ1B 1GI0A 2XOKD 1NPMA 3EE7A 1HUTH 2ZZUH 1ZLRA 2A32A 3S9BA 4BANB 2Z9KA 4J1YA 7LPRA 4XBCA 4Y6DA 1GHAG 2G51A 1ELGA 1HB0B 3OEHD 1Z1JA 3EE0B 4ZCNA 1HCGA 4X1SU 1A5GH 3SGAE 1KTTB 1D3DB 4UEHH 4UONA 3A81A 1DANH 2SGDE 1GMCG 2NU2E 2BXUH 5EJLA 3TITA 3H5CB 1CE5A 5C67A 1LHEH 1TALA 1ZGIA 1TGNA 1NZQH 2XCNA 4WH6A
chains in the Genus database with same CATH topology
4DIHH 4GAWA 4AGJA 2TGDA 2P16A 1GJDB 2XBYA 1MTSA 4OS4A 4UE7H 3CENA 4VGCC 1WQSA 4GUXA 3MMGA 2A2XH 4ZXXH 4UFFH 1SGYE 3RXHA 1O3FA 1AE8H 1RJXB 1V2VT 1X7AC 1ANBA 5GWZA 4JCNA 4RKJB 3A7ZA 1C1SA 4ISOA 1G30B 2GX4A 2D1JA 1GL0E 3GY3A 3HATH 4D7FA 3ZVCA 1WAYB 2Y80A 1GMCF 2ZO3H 4LXBH 1GI7B 1V2TT 1DLKB 1WUNH 4ABDA 1GDQA 1AO5A 1S6HA 3DUXH 3C1KA 5GCHF 1HJ8A 3U1IB 1TBZH 1V2MT 1S84A 3UOUA 3SU4A 1UVOA 1OKXA 3BG4B 5LPEA 1CSOE 1EAUA 4FU7A 4IMZA 3GOVB 1TONA 5E2OA 2BDGA 2P93A 2JETB 3ZZCA 3Q3YA 1AKSB 4MVNA 1GCTC 1MKXH 2CF8H 3TJOA 2UUKB 5LPFA 1AFEH 1MAYA 4LZ1H 3P6ZB 2TGTA 5EOKA 1O3OA 1O5FH 4UFGH 2ZU1A 1ARCA 1K1PA 1NRQH 3QGJA 1LVMA 1IQNA 1VJAU 3QUMP 1RFNA 2JH0D 2ZU2A 2J34A 3LC5A 1YLDA 1O2PA 1O3AA 4F49A 3RMLH 1RIWC 4AB9A 1EPTC 1D4PB 4I8GA 5FBIA 1GVKB 1H8IH 5HYOA 1JBUH 1O34A 2J9NA 5C5OA 3S9AA 3UNSA 1FY8E 1FLEE 2VIVA 1NRPH 1WSSH 1Y3YA 1LHFH 3LONA 2PHBA 1FQ3A 1ZR0A 1MU6B 1C1NA 1N6YA 3GY7A 4BTIB 2BOHB 1C1QA 2VIOA 3KQEA 5T3HA 3RXAA 1TGSZ 1GDUA 1OWKA 1GHWH 3M3SA 1TMBH 1BIOA 2STAE 4NIXA 1LKAA 2FX6A 2O8TA 2DUCA 4IN1A 4DVAU 1F5KU 3URDA 1AMHA 3OX7U 1ZOMA 1UTNA 4GCHG 4CRAA 2GT8A 5JB8S 4WMFA 2ZFFH 1SGDE 3TIUA 3V7TA 5LH8A 3PLPA 1ZTJA 3BTHE 5JBCS 1YCPH 3UUZA 1E38B 3LKWA 1C1RA 1C5PA 4AYVB 3M7UA 2CXVA 2GMTB 3KNXA 2IN2A 3ZVAA 1RD3B 1NO9H 5F8TA 2G4UA 1L2EA 2ZTYA 3RXPA 2J2UA 4CBNA 2FOFA 3ITIA 1MQ5A 1HAHH 3ZZ9A 1C4U2 1IQMA 3NCLA 1XUHA 2SFAA 3RLWH 4ZMAH 7KMEH 2BQ7B 1D6WA 1P2MA 1ZGVA 1BTWA 1O5DH 4AFUA 4AG1A 4MQAA 4MNVA 2WYJA 1XMNB 2ZCHP 4Y11E 4BAOB 5LPRA 1GHYH 4ASHA 2QXIA 1CGJE 1P3EA 2ZCLP 3RC6A 5J4QA 2G81E 4D7GA 2TIOA 1QB6A 1S0RA 1GJ4H 2GCTC 2BDYA 1GJ7B 1P2OA 1CHGA 4A5TS 2C3SA 2NU1E 3T25A 2CJIA 2YNAA 1GJ8B 4INHA 4CRFA 1K1LA 1XM1A 5C1UA 1GBLA 3I29A 2Z3EA 3TU7H 1YPGH 3SNEA 7GCHG 1EOJA 4I8KA 1YPEH 1GMHG 2BQWB 1AZ8A 2OC8A 3M3TA 1PQ8A 3KL6A 1FMGA 2G5NA 1MTNC 1D3TB 1P01A 2UUYA 5T6DA 3ATIA 4B71A 1VGCB 1NU9A 1ELFA 1KTSB 1BJUA 2PKSC 1HDTH 1T8MA 2BD9A 2ZHWH 2HLCA 1AVWA 1YLCA 1H9IE 1EPTA 3LIWA 1FY5A 2OC0A 3ZZ3A 1GJ9B 4AZ2B 2EI8A 3SI3H 1V6DA 3KEEA 4Y10E 1LQEA 1O2YA 5G4BA 4ABJA 1VCWA 3DD2H 3UQVA 3SV8A 5FCKA 2AMPA 2G5VA 1CA0C 1SGPE 1EJMA 2F3CE 1MTUA 3AW1A 3AW0A 4WXVA 3T26A 2R3UA 2QXGA 3RU4T 2FM2A 3SUFA 4BAKB 3GCOA 1O2MA 2P8OB 4YM9A 2ZKSA 5GDSH 3E90B 1PJPA 4H42U 2P3FH 2C8ZB 4K5ZA 2D2DA 3H7TA 4DOQA 1VR1H 3BSQA 1QRXA 4Y8YA 1HGTH 4IGDA 1FI8A 1VITH 2A1DB 4XFQA 2I6SA 4Y79A 1A3EH 3NPSA 2ZU3A 1V2ST 1FY4A 1EAWA 1ZTLA 1VGCC 1GG6C 2ZA5A 2BD8A 5DPAA 3K9XB 1O32A 2HVXA 2FOEA 3A8AA 1MH0A 1TQ7B 2FZZA 1FUJA 3ODDA 1DDJA 3UY9A 4OS2A 4X6MA 4INLA 1NRSH 3NXPA 1G2LA 1GBTA 1OP0A 2EEKA 3ZV9A 1MMJN 3VFEA 3A85A 2BZAA 4R0IA 1ZSLA 2CMYA 1C2MA 1SQOA 1NU7B 1CGIE 4WMEA 1O2LA 3QWCH 1LPKB 2BXTH 4NFFA 1P57B 1ACBE 1A61H 1AN1E 2A7CA 4CRDA 1W14U 2FTMA 4O9VA 1MCTA 2DE9A 2F9OA 1GJ5H 3TGKE 1GJ6A 4A7IB 1MD8A 1GPZA 3M7QA 5FBEA 1TYNA 1XUGA 3GY5A 5GXPA 2D26C 1IQFA 1ZHMA 2D8WA 1AI8H 3PMAB 2HOBA 4X8VH 1PPFE 3A89A 3RM0H 2FOHA 3A82A 1C1OA 1LCYA 1LDTT 1DWEH 1AB9B 1BA8B 4MLFB 5ABWA 1UTMA 3ZYEA 4CHAC 1OXGA 2V6NA 4Z0KA 1KDQA 1TGCA 2CHAB 1DS2E 1FZZA 2OUAA 1HAXB 4F4OC 4I8HA 2Y82A 1W10U 2OTVA 1TIOA 2OCVB 3PMHB 2ANKH 5EG4A 1TNGA 1O5CB 1C9PA 3QDZB 1OWJA 2QC2A 3A80A 4CRGA 1QTFA 2QV1A 1C5VA 1PPZA 3A84A 1GHBF 5H4IB 2BX4A 1HRTH 1O2JA 4AB8A 1UVPA 4JZDH 1O2SA 2Z3DA 2OD3B 3BTGE 2ZHDA 3AVZA 5C1XA 1Y5BT 2XWAA 3RXQA 2KAIA 2WV5A 5L2ZH 2GZ8A 3DA9B 1NRNH 4IW4E 1EP5A 1UVUH 3SHAH 4TY6A 4GPGA 2UWOA 2WPIS 4X8UH 4SGBE 1AVXA 3AAVA 2NU0E 4B76A 2C4FH 5DG6A 1LQDB 1SLUB 4ISNA 1DLEA 2ZGCA 2PSXA 4NCYA 2R9PA 1OOKB 4HZHA 8LPRA 2ZDVH 5DK1A 9ESTA 1MCVA 1UK2A 4JZEH 1DUEA 1GI5A 3FANA 3MWIU 2A5KA 2OINA 4Y76A 1BRBE 1LPZB 1ZRKA 2HNTC 2TGAA 1C2DA 1N8OC 2V0BA 3K65B 4Q2KA 2PR3A 1QL8A 1FDPA 1C5UA 1KIGH 4O3UA 2QY0B 2B0FA 3M37A 1SC8U 3M5NA 4OS7A 1GI2A 5DP5A 3HKJB 1L1JA 3BG4C 1C1TA 1WQVH 2F9BH 2BVXH 2HWLB 1J8AA 1ZPZA 2P8OC 2AGEX 1M9UA 1QR3E 4ZHAA 1ANEA 4KP0A 2WPHS 6GCHF 2BB4A 1V2JT 3KGPA 5JBBS 4NIVA 3TK9A 1V2WT 1DWBH 3GY8A 2PSYA 4JZIA 2NWNA 5JPMH 1BTHH 5A0AE 3K6ZA 2A7HA 1P02A 2RG3A 3MNBA 2BX3A 2I6QA 3RXMA 5EQQA 3HGPA 1K1NA 2OLGA 3Q3KA 2B5TB 1P9UA 1Q31A 1QBOA 1OS8A 3MH4A 3SQHE 1GCTB 5EQSA 4K8YA 2P59A 1YPLH 1BT7A 1GI8B 2BD3A 2WYGA 3QZRA 3LPRA 4B1TA 1SGIB 2GV6A 3MFJA 1GBDA 3DFLA 4IC5A 3BEUA 2PV9B 4IN2A 1QQUA 2QF3A 2XCFA 1AKSA 1K22H 4WF8A 5DP7A 1Z7KA 4JK5A 3D65E 4D9QA 2PLXA 1Z8IB 3U69H 5DO4H 2R3YA 8ESTE 1BBRE 1TOCB 3TNSA 5HM2A 1C1UH 2GCTB 1THRH 4XSKU 3ZVGA 3TGJE 2XRCA 4A1XA 1SGFG 2JH6D 1DWCH 3UREA 3PTNA 1Q3XA 3BEIB 2ZECA 4JZ1A 2F9VA 3GYLB 3UQOA 3ZZBA 1ZJDA 2XBXA 1BDAA 5JYIA 4FUGA 4MPVA 1MZDA 2BLVA 3T2NA 1O2UA 1RIWB 1L1NA 1G3DA 1P06A 3PM3A 1GMDG 1INCA 2CHAC 2OBQA 5T6FA 5B6OA 5DP3A 2OXSA 1GBCA 4MPWA 1QB1A 2ZFTA 5FXLA 3T62A 1C2LA 1TNHA 1NESE 3A87A 3RC4A 2ZPRA 1NFYA 3GY4A 5E8EH 4CH8B 1IHSH 2AERH 4X2XA 2BYAX 3M7TA 4AFZA 2BY7X 2PGBB 1O3HA 1YCPM 4Y0ZE 1P9SA 1FAXA 4SGAE 4YOJA 1D6RA 1YM0A 1Q2WA 4AORA 3SV9A 3LJJA 4BXWA 1ZMJA 1MUEB 1TBRH 6LPRA 3EGKH 3BTEE 4GHTA 4X2WA 1D3QB 1T4VH 1GI9B 1XX9A 1YYY1 2H5DA 3LT3A 1QBNA 5EGMA 3PWCA 2OQ5A 4ABIA 3S0NA 3IITA 1E36B 1TPPA 1ANCA 1V2OT 3HK3B 3KCGH 3T29A 3V13A 1HAGE 1HJAB 2H9HA 4UFEH 2ZDLA 1EB1H 4X6OA 3EA7A 1F92A 1OSSA 2ZFRH 3RUOA 1H4WA 5HGGA 3GDVA 1PQ5A 4X2YA 2BHGA 1E0FD 4O3TA 5E0JA 1GJCB 3MNSA 4WVPE 1GBMA 1W8BH 1JRTA 2BLOA 2W3KA 3TH3H 3ENSB 5HMAA 2GT7A 5C5NA 2C93B 3HK6B 2R0LA 1ZRBA 1NTPA 1MTVA 3H7OA 2PGQB 1JOUB 1BRCE 1A0LA 4YLQH 2HNTF 2ZU4A 1RTKA 1ELCA 3TJNA 2ASUB 3M5OA 2VGCB 3ZVFA 1EASA 1QJ6B 2JETC 2FOCA 2GTBA 1XUIA 4I33A 4X1QU 4OGYA 1E35B 2FTLE 4Q7ZA 1TPSA 3SGBE 3ZZDA 1SBWA 3MH6A 1SMFE 2NU3E 1WTGH 1ABJH 1LHCH 3JZ1B 3TVJB 2SGAA 1AUJA 2TBSA 1FN8A 1V2UT 1O3EA 4FUIA 3SBKA 2FOBA 4D8NA 3P95A 1SGQE 3SU3A 1T7CA 2G4TA 4A1TA 1O30A 1YBWA 1G32B 1Y5UT 1SFQB 3SZNA 1FIWA 5FX5A 1LPGB 3RXIA 3URCA 2J92A 2VGCC 2P95A 3UPEA 2HNTE 2W5EA 1Z8JB 4DW2U 1MBMA 3MH7A 2QA9E 2SNWA 1C2FA 2ZWLH 4ABHA 4HGCA 5A8XA 1GL1A 1P12E 1HYLA 2XYAA 3L33A 3GCHB 1IQLA 1SLVB 2G55A 3VB3A 1GBJA 4K60A 4K1TA 3F1SB 1RS0A 3RXVA 1H9LB 3UWIA 1NN6A 5C1YA 3RU4E 3RC5A 2PKSB 2XW9A 1ZMNA 1HLTH 4BXSA 1BTYA 1DUAA 5TCAA 3VXFH 1P2KA 1ELDE 1LKBA 1DX5M 3DT0H 1J15A 2PTCE 2R0KA 2WUCA 1O2WA 1SQAA 3R3GB 3BTKE 1RTLA 4KKDA 5BRRE 2VJ1A 2Y6TA 2J95A 1W2KH 1HAVA 3ELAH 1DWDH 1AFQB 4X1RU 3AAUA 4Y71A 4CREA 3SW2B 3M5LA 4B2AA 2Z9LA 3BIUH 4Y7AA 2FMJA 1QHRB 3CS7A 4FUFA 1L0ZA 2H6MA 3QTOH 1HAOH 3BTFE 2ZHQH 3LH1A 4ZROA 3V3MA 3PYHA 1KXFA 3P70B 5AHGH 4FUHA 1AHTH 1K2I1 4GCHF 1CHOG 4Q7XA 2ODPA 2PKAA 2UWLA 1TPAE 3U8TH 1Y3XA 4ZH8A 4KTCA 1O2VA 1AFQC 1EB2A 4NIYA 2ZDMA 1DSTA 1GMHF 4BAHB 1O3NA 2A0QB 3RXTA 2P3UB 1F5RA 4NA8A 1Z71A 4FUBA 5I46H 1FPCH 3KQDA 4CRCA 5I25A 2TGPZ 1C5RA 1G3EA 4DJZB 2ZFPH 2BD5A 1S82A 4WJG2 1C2JA 2BD2A 3EA8A 3PV4A 2Y5HA 3A8BA 1TRYA 1K9OE 5F8ZA 3RXJA 1MD7A 3L6PA 2OC7A 2AIQA 1WTHD 4OS1A 1Z1IA 3DHKH 1KXAA 1H1BA 4MTBA 5EU8A 3BN9A 1SGNE 3QX5H 4FUJA 4XOJA 3SN8A 3MTYA 3FVFB 1H8DH 3F9HA 1CT4E 1EXFA 1VCQA 1XXDA 2R2WU 4FVBA 1V2LT 4JK6A 4MNXA 1O33A 4WH8A 1EAIA 1QQ4A 3UOPA 1TGBA 3SV7A 3LGWA 1TX6A 1P8VC 4K69A 1NC6A 3PTBA 2BDIA 1C2EA 4ZKSU 3TPIZ 2H9TH 4GLYA 2QYIA 4A1VA 1NS3A 1OYTH 3A88A 2Z7FE 3A8CA 1A5IA 4B73A 1Y59T 3MO3A 2ZPQA 1FPHH 3E91A 4ABBA 1OWHA 3KF2A 4AGKA 1HFDA 1DXWA 2J94A 3OYPA 2DE8A 2FXRA 3VXEH 1FY3A 2UUJB 2BY6X 2ZQ2A 3Q00A 1RTFB 3LGYA 3S7KB 1D3PB 1B0FA 2ZTXA 1HIAA 3TK5A 1G36A 1GBKA 1AZZA 2GZ7A 2QIQA 1K1MA 1C9TA 2Q6FA 4OS5A 2K1QA 1A46H 4JYUH 1O2OA 1NY22 1MU8B 1TGTA 2XC0A 1GHBG 2EI7A 5PTPA 3M61U 3RMMH 2Y7XA 3ZZAA 3SU6A 1PPEE 3ZZ6A 1HAZB 1BRUP 1O3GA 3RP2A 1OWIA 4AX9H 1P3CA 1BUIA 1LVOA 3E16B 4Y7BA 1ABIH 5L30H 1SGRE 3ZZ8A 1PPBH 2QCYA 2Q1JA 2XC4A 5F6MA 2VU8E 3UNQA 1LVBA 1TRNA 2PWXA 3LU9B 1QCPA 2O8LA 3QTVH 4TWYA 5K0HA 3LDXH 1TFXA 1C2KA 2A4QA 2BY8X 1W0ZU 1EUFA 2C90B 3VB4A 5JBAS 4THNH 3PMBB 5A0CA 1SG8B 3TJUA 1PYTC 3F68H 3U8OH 1OX1A 2NU4E 1FIZA 1HJAC 4O97A 1EZUC 1QIXB 5LGOA 2FODA 1O3DA 2FEQH 2AEIH 3TGIE 1ZHPA 4NWKA 4MNYA 3SJIA 4AN7A 2VB0A 2RA3A 1ORFA 2AFQB 7GCHF 8GCHG 4B2BA 4BOHA 4NFE