2O8WA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q/s195a) in complex with inhibitors
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase plasminogen activator
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8wA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8wA01
2EA3A 3UFAA 2GCTB 1MD7A 1BTPA 3VGCB 1FLEE 5L2ZH 1QBNA 4NWLA 1MU8B 5EXMA 3BEUA 1T7CA 4Z6AH 2DUCA 1MCVA 3GY5A 1GBJA 2TGTA 4NSVA 4BXWA 3GY7A 5C1YA 2TRMA 4AFQA 2TGPZ 3QO6A 3F9EA 3UTUH 1XUHA 2HPPH 2WPKS 3RMNH 3VGCC 7KMEH 1F5RA 1NO9H 3A7ZA 3ESTA 4H4FA 3TNTA 1TA6A 5EPYA 2Y81A 4DVAU 3N7OA 1CBWC 4K60A 4MNWA 1XMNB 3UUZA 1Z7KA 2C8ZB 1ZPZA 1ELTA 1C2IA 4H6SB 1ZR0A 1OX1A 1G9IE 4ZH8A 1TBQH 5EQSA 3KCGH 4RSPA 5AFYH 1M9UA 1TE0A 1TRYA 1V2RT 1P57B 2ZNKH 1G36A 1GJ9B 4Q7XA 2P3FH 5BPEA 1QQUA 2TBSA 3MU5A 3O8CA 2BD3A 1HYLA 4GCHF 2BOKA 1O2UA 3NKKA 4Y79A 2R2MB 4JK5A 4DGJA 2OP9A 3H5CB 4UDWH 1SQOA 1EAIA 3LGVA 3MNBA 3M37A 4XBCA 3FZZA 1N6YA 1O5CB 2WPIS 1GMHF 4MPUA 4X2WA 1YCPK 1DX5M 1AI8H 1LVBA 1GVKB 3TLOA 5FCKA 2ZA5A 1A5IA 1L2EA 2Z9IA 2ZGHA 3T5FH 2GCHF 1TRMA 2BQ6B 1O2RA 1EOLA 4CRDA 1G2LA 5L6NH 4ZUHA 4I31A 2XWBI 4UFDH 1PQ8A 1YF4A 3VEQB 1C5NH 1H4WA 4YOIA 4ABIA 2ZHQH 1HAPH 2ZFQH 4CRAA 2AS9A 1QL9A 1XUKA 3NK8A 3BG4C 1G2MA 5T6DA 2ZIQH 1YC0A 1FV9A 4J2YB 3SUEA 1C5TA 4AG1A 1ZGIA 4WH6A 3E16B 3BTWE 2ZTZA 2YNBA 3GISB 1C2HA 1WCZA 3M5LA 1BB0B 5C5OA 2BD5A 3QZRA 3UWIA 1ZSJA 5T3HA 2VGCB 2F9OA 2HALA 2Q6DA 1O5FH 4E05H 3ODFA 1B7XB 1AZ8A 4NWKA 5HYOA 3F9GA 1HIAB 3A7VA 1T4UH 4Y76A 3Q00A 4CBOA 3B9FH 4WXVA 4B73A 1DT2A 3SQHE 2VGCC 2FDAA 2WYJA 4A92A 1QURH 2A45B 3BTHE 3F6UH 3T2NA 4DCDA 3E91A 2ZKSA 3A7WA 1OWDA 1WOFA 3RXDA 1K21H 3VPKA 1OWJA 1QL7A 2PV9B 5G4BA 1KTSB 3SNEA 2NU1E 1O3PB 4UFFH 4INHA 2ZDMA 2C8WB 2BY6X 2OLGA 1O5GH 1ZMLA 3EAJA 2XRCA 1FY3A 3BTKE 2GP9B 2A4GA 1TMBH 4I32A 4I7YH 1GBEA 5EODA 4X1SU 2BXUH 1RFNA 1S5SA 2GT7A 2OC7A 1Z8IB 4YO9A 5T6FA 4FUDA 4Y8XA 1EJAA 5DK1A 1NROH 1CA0C 5AF9H 4U32A 1CGHA 1DANH 1BTWA 5H4IB 1B0EA 4O03A 3U98H 2AYWA 1BRBE 1C2JA 1TALA 4HTCH 1FONA 3LT3A 1O3KA 2Z9JA 4HZHA 3ZVCA 1A46H 4B1TA 1ANCA 2BTCE 3HK6B 2A7CA 4O3TA 3RXTA 5A8ZA 5LPRA 3PV4A 3TGJE 1V2LT 4I33A 1NZQH 1SHYA 1SMFE 3ENSB 4F4OC 1O5BB 1BTXA 1DVAH 2QV1A 2PLXA 4TY7A 3U1IB 2IJOB 3GDUA 1QJ6B 2C90B 4K1EA 3LJOA 3LONA 1NM6A 5E0GA 2FWWA 3U8RH 4FUFA 1KXBA 3IG6B 1FN6A 1O3BA 2FOBA 4J1YA 5EXNA 4KP0A 4WF8A 2SGEE 2KAIB 2WPHS 3ZVGA 1D3TB 1C5ZB 1C5WB 2VVVA 3RXRA 1UHBB 6ESTA 4B75A 4GUXA 2F3CE 3ZZDA 3W94A 3GCTF 3PO1B 1DY9A 5FBIA 1P2MA 2ZFRH 1O2YA 2AFQB 4BOHA 1P10A 1V2WT 3DFJA 1MZDA 4LZ1H 1ELDE 1GMDG 3GY4A 5TCCA 1O3LA 1TNHA 2AGIX 1FY5A 1SI5H 1BBRE 8LPRA 1N8OB 4U2WA 1MH0A 2C8XB 3RXGA 5GDSH 5FPTA 3QGJA 3JZ1B 1GI0A 3R3GB 1WQSA 3UQOA 4A5TS 4O97A 1WTHD 1CA8B 2ZGXH 2F9VA 1KDQA 4B71A 1UCYK 3PMBB 1O3OA 1W7XH 3O8BA 2R0LA 1DS2E 3HKJB 4Y10E 5F8TA 2BDAA 1O3EA 3GCOA 2XC5A 4BAHB 1MBMA 3PMJA 1O3IA 2ULLA 3TITA 1MKWH 3M35A 3SW2B 4CHAB 1ARBA 1GDNA 2XCNA 4ASHA 3BIUH 1PJPA 3I78A 4CR9A 3ZVBA 3P17H 2ZU5A 3TK6A 3T29A 1MQ5A 1NFXA 2NU0E 4MDSA 4PROA 3K6YA 1ESTA 3P95A 1XUGA 1HAVA 1ZOMA 4AGJA 4NFFA 2GMTB 3V3MA 1XUFA 5GXPA 4X6PA 1AQ7A 3BTTE 5E2OA 1C5PA 2FZZA 1ELGA 4H6TA 2GD4B 4B74A 1TLDA 1S84A 4ISLA 1P2JA 1V2NT 2FTLE 1QJ7B 1YKTA 4JMYA 3SV8A 3RM0H 4MPWA 2ZTXA 1TQ7B 3OY5U 1C1NA 2XBVA 5I25A 2BQ7B 1V2UT 3TH3H 5A0CA 1FY8E 3SHAH 5C5NA 2BVRH 1P06A 1HAIH 5L30H 1S83A 1W0YH 1BA8B 1EZSC 2XBXA 4KELA 1P11E 1O35A 3U8OH 1LQEA 2OBOA 4I8LA 1GJCB 4A1XA 3S9AA 2NU4E 1IQEA 1SLXB 3RXCA 1DWEH 3IWMA 2WV5A 4TYDA 1AKSA 3A8DA 4A7IB 2HGTH 2QYIA 1SGPE 2H2ZA 2FX4A 1GHZA 1AMHA 6CHAC 4FUBA 1VR1H 2RDLA 4ZXXH 2ZDLA 1QB9A 2FTMA 1C2FA 1LMWB 3NUMA 1QA0A 3RUOA 4GAWA 4ABEA 2V35A 3D62A 3SO3A 1O3NA 2C3SA 2ZDKA 1P8VC 2QA9E 2GTBA 4WWYA 1Z1JA 2FS9A 1XUJA 1XX9A 1O3JA 1ZSLA 3SV7A 1C5RA 1RJXB 1L1GA 5DGJA 1GGDB 3A8CA 1W11U 1GMCF 3LH3A 2Y7ZA 1GI6A 1ORFA 1S6FA 1EPTB 2OC8A 1WQVH 1J17T 1RTFB 3P8FA 1NU7B 4U30A 3BG8A 5F8ZA 3Q3KA 4XDEA 1LCYA 1K1NA 3FP8E 1Y5BT 3SJKA 1KLIH 2ZCKP 5LGOA 3OY6U 1V2TT 1C5MD 7GCHF 2VIVA 4DW2U 2ZC9H 4BTUB 1G3CA 1NFYA 1CO7E 4SGBE 2ZU2A 2R0KA 3DFLA 3Q3XA 2J34A 2C8YB 1UTQA 3HATH 1Z8JB 3PO1C 1Y5UT 2FX6A 1MTSA 2BY9X 2STAE 4I8GA 4IC6A 3BTME 3M7TA 1OPHB 4WMFA 1ZRBA 4ZHAA 2ALPA 1BITA 2ZDVH 4NIXA 1KTTB 1J8AA 2HRVA 2BLVA 5EG4A 2ZHDA 3SI4H 1MTUA 4Y8YA 2ZFSA 2FO9A 1GVLA 1AGJA 3RU4E 3KGPA 1D3QB 2VNTA 1EB1H 2ESTE 4A6LA 1Y3YA 2BDYA 1NRPH 4JCNA 1GBTA 1YPLH 4FUIA 4CHAC 1ANDA 1HXEH 1EAXA 4Q2KA 1SSXA 5DPAA 1GPZA 1MKXK 2BLQA 4ABDA 4LK4A 3KL6A 5HM2A 3RC4A 1TX6A 2BB4A 1TGTA 1HPGA 4K69A 1LVMA 4E7NA 1THRH 3BTEE 4FUCA 4NZQA 1PPFE 3KN2A 1SQTA 2BY7X 3MOCA 1LHGH 1ELBA 1NU9A 3A7TA 1ZRKA 2AH4X 3RU4D 2UUJB 5SGAE 1GI9B 2A32A 4SGAE 1GDQA 1MKWK 3LGWA 3UREA 2FOMB 5EW2H 4MLFB 1ZTLA 1Z71A 3TJOA 1PPZA 4NIYA 1CT4E 1SGQE 1K2I1 4BTIB 3SOSA 3QGNB 1NRRH 1BHXB 2AERH 2ANWA 4FXGH 1YLCA 1ETRH 2ZU1A 1CT0E 2HNTF 5DJ7A 5BRRE 1F5LA 1OS8A 2G5NA 2VIPA 1O2ZA 1BJUA 2FEQH 3SI3H 2GT8A 2Y6TA 2G4UA 4TWWA 4CREA 1AIXH 5JDUB 1QNJA 1WU1A 1FIWA 3L33A 1GMDF 4Y71A 2O9QA 1GMCG 1JMOH 4X2VA 3MHWU 4X6OA 2D26C 2VWOA 1PFXC 3RXLA 3DHKH 1O39A 3ZVAA 2ZWLH 1NFUA 1FAXA 1TOMH 2XWAA 1O2HA 4YT7H 1BCUH 2P95A 4FVDA 4ZROA 3MNXA 1MTVA 1AB9B 1O2KA 5K0HA 2JETC 1VITH 3TGIE 2OBQA 1EOJA 1K22H 1YM0A 3KQEA 5DP6A 2H6MA 1O31A 3RC5A 3SV6A 1F0RA 2FESH 3K2UA 4Y0YE 4ZHLU 1K1JA 2XCFA 1GJBB 3O8RA 1ETSH 1AB9C 1ETTH 1OXGA 4XSKU 2Q1JA 2ZHWH 1ID5H 1NRNH 2HLCA 3E0NB 3HGNA 5FBEA 4K8BA 4ZAEA 1KXCA 2W7UA 3RXKA 2V3HH 4Y0ZE 3ZV9A 1GHXH 3M7UA 3BN9A 2BDGA 3AW1A 2F9NA 4D7GA 1O3FA 1T32A 5CHAB 3KQDA 1DY8A 1FDPA 1HJ9A 1TPAE 5FX5A 3LJJA 2PSYA 1J9CH 4DJZB 3AW0A 1MKXH 1O2NA 1A3BH 3ATIA 4CRCA 2BY5X 1P2IA 1G3DA 3QWCH 1XM1A 2VJ1A 1MZAA 2FYQA 4ESTE 1O3MA 4MG3A 4YOGA 5JB8S 1F92A 2XXLA 2R9PA 1P2QA 2Z3EA 1EQ9A 1J14A 3W95A 1HBTH 3VB4A 1ELEE 3QDZB 1O0DH 3GY3A 3T28A 3MO3A 4YT6H 4JZEH 1KLTA 2AMQA 2PKSB 3MWIU 1XKAC 1IOEA 5CMXH 4YM9A 1C5QA 4NA9H 1CGJE 4AYYB 3QTVH 2FOEA 2BQWB 1E37B 2FI4E 1ZHRA 4KKDA 1O2PA 4ABGA 3ZZ9A 1Y3WA 1DUEA 1WSSH 1H9IE 1O3GA 2BZAA 3RMMH 1FAKH 2SFAA 4NCYA 2NU2E 2FI5E 1BMNH 1DOJA 1YYY1 8GCHF 3SJOA 2OCVB 4AG2A 1GJ4H 3SGBE 1IQLA 1K1PA 2FOAA 1KXFA 2QXGA 1TMTH 4IMQA 3V13A 2FLRH 1T8MA 1GMHG 3E6PH 1IQFA 4AOQA 2F9PA 1Q3XA 1HNEE 2O8WA 5DP5A 2A4QA 2GV6A 4NIWA 5IDKA 1ARCA 2WPMS 5GJ4B 2B5TB 2V0BA 2VB0A 2H5DA 1C1SA 1GBKA 1U6QA 1RIWB 1F7ZA 3MMGA 2BOHB 5C1UA 2ZFFH 4CR5A 1P04A 1CQQA 1F0UA 1ACBE 3RXFA 1HV7A 1A0JA 1P2NA 1EP6A 1NS3A 1E36B 1QQ4A 2PSXA 3A84A 3GOVB 1RTKA 3BEFB 3HGPA 3OX7U 5EQRA 2AEIH 1JIRA 1IHSH 3L3TA 4JZDH 1TBRH 3SU1A 5AVDA 1Q31A 4DIHH 3RXIA 1Y8TA 3RXUA 3ATMA 4FUJA 1Y5AT 2XC0A 1MTNC 4K5ZA 1D6WA 3SUFA 4AB8A 1O2MA 1AWFH 1C2KA 2VIWA 1GBAA 2QGRA 1QBVH 1GCTC 4MVNA 4AN7A 1C1VH 1HXFH 3VB7A 5IYTA 5C3NA 2JETB 1KYNA 2ZP0H 5FHTA 2VINA 2W3IA 1BTZA 2GVFA 1SG8B 2OINA 3GCHC 1UO6A 1J15A 5JB9S 2G4TA 1RTLA 1UHBA 3QLPH 2BX3A 1T31A 3PWCA 1QCPA 1VITG 3U1JB 1XXFA 3UQVA 3SORA 4OS4A 3SU0A 2C93B 3M36A 2Q6FA 2BDBA 1DICA 1TMUH 1W14U 1UK3A 1DWCH 1GHYH 2VWMA 3SNAA 5A0AE 2PW8H 1HCGA 1MAYA 3A86A 2XBYA 1DLEA 1UK2A 1C5YB 2Z6BD 4ISOA 1LTOA 4FUGA 2BYAX 4YLUA 1SPJA 5HGGA 1YPEH 1PPCE 4KGAA 5CHAC 3SJIA 1XVOA 3OTJE 1G3EA 3TH2H 3A85A 1FXYA 3A7XA 1O2VA 2IPHA 4XFQA 1FPCH 1GJ7B 3BTFE 4IC5A 1C1WH 3TJVA 3RMOH 2THFB 3Q77A 1BOQA 2CJIA 1DDJA 3KQBA 3DUXH 1TGBA 1X7AC 4A1VA 1QFKH 1BRCE 1FZZA 2AIPA 1LQDB 3I77A 3GDVA 1GBBA 1TONA 2JH0D 3M3TA 4HGCA 1AD8H 1HJAC 3D49H 6GCHF 3PWBA 1S0QA 1LHFH 3BTQE 2GV7A 3E0PB 2HNTC 2ANYA 3MI4A 1C1QA 1SOZA 2FM2A 1SGNE 3BF6H 1BMMH 1SGDE 1AFQB 1JRTA 4X1QU 1LDTT 2UWOA 4QT8C 1P09A 2BY8X 7ESTE 1DM4B 1D9IA 3URCA 4NZLA 1UTLM 2ALVA 1UVUH 2XW9A 3MFJA 1GVZA 1SBWA 3EDXB 4TPIZ 5GCHG 1HLTH 4NA8A 3CP7A 2H9TH 2RCEA 1A7SA 3HKIB 5E0JA 1CSOE 1V3XA 4CRBA 3F9HA 4AORA 2AIQA 4OS2A 1YP9A 2AMDA 4UFEH 1ZHMA 1LVOA 3MTYA 2F83A 4DURA 3K9XB 1DSUA 2OQ5A 2A2QH 1SLVB 4NG9H 4WJG2 2VWLA 3LGUA 1S0RA 2ZPQA 1QRXA 3UNRA 4NIVA 4XOJA 4AGKA 2PUXB 3PLPA 4ZMAH 2CXVA 3QN7A 1A0LA 2SGPE 4LXBH 2ZU3A 1QGFA 1GHAG 2ZTYA 1UTMA 3DD2H 1GI3A 1UK4A 2OXSA 3PLBA 1O2LA 4Y11E 1AKSB 2BMGB 2VWNA 3ZZ5A 3ELAH 3V7TA 4Q7ZA 1TRNA 1TGNA 1BTUA 2CV3A 4D7FA 1UVOA 1J16A 1BT7A 4VGCC 1C4Y2 2ZI2H 1UTNA 3QUMP 2P94A 3T62A 3PB1E 1OYQA 4E06H 2G00A 2IOTA 1C2GA 1TIOA 1P3EA 3SNCA 1NC6A 1NTPA 1FJSA 2AGEX 1H9HE 1SGTA 2UWPA 1P9SA 2ASUB 2FXRA 3R0FA 3SU6A 2YNAA 1UJ1A 4VGCB 3SHCH 4ABAA 3UR9A 3MU8A 1SGFA 3ATWA 1W0ZU 2O8TA 4IBLH 4XBBA 1K1LA 1MTNB 2FOCA 2ZO3H 3KF2A 5CE1A 1W8BH 3OSYA 2FP7B 3EGKH 3DT0H 3SV9A 1GBFA 1IQJA 1UTPA 2AMPA 3ZZBA 1O5AB 4M7GA 1K1OA 2BDIA 1NFWA 2FLBH 1O32A 3M61U 1QB1A 1TGCA 1CVWH 2QXHA 3M5MA 1VGCB 1OWHA 3EA8A 1G37A 1GBMA 4IW4E 4FVBA 2BD7A 1TX8A 1ANEA 1GI8B 3PTNA 1C2MA 1E0FD 2ZQ2A 3SGQE 3H7TA 4YZUA 4ABHA 2GKVE 1XUIA 1P02A 4ISNA 2A4OA 1FMGA 1SGYE 3GY6A 3B8JA 2Z9KA 3UIRA 1KLJH 1TABE 4DIIH 1PQ7A 3A82A 4ABFA 2WUCA 1W7GH 4FUHA 3MO6A 1LO6A 4LOYH 3A7YA 1UTKA 2P8OC 2R3UA 2A7JA 3BSQA 3GY8A 3MH4A 1GI2A 4JZ1A 3UNQA 3F1SB 2ANKH 1TQ0B 3SBKA 5A09A 2Z7FE 4WVPE 4THNH 1TOCB 3VB5A 2EI6A 3GYLB 1C1MA 1GBHA 5J4QA 1YBWA 1P9UA 1GHBG 1MAXA 2ZCLP 1ZJDA 2P8OB 1SOTA 1UVTH 1GI7B 1EX3A 1LPZB 1O5DH 1S6HA 5JBAS 2ZFPH 5HMAA 4OS6A 1O30A 2F9BH 1HJAB 2PR3A 2SNVA 3RXAA 3VFEA 2CN0H 1GL1A 1HAOH 3BG4B 1G32B 5ESBA 1VZQH 2HOBA 1YPKH 3PM3A 3RXSA 2QY0B 3S0NA 4X1NU 1BRAA 3UNSA 1VJAU 4JYVH 5DG6A 1O36A 4BTTB 1P2KA 2I6SA 2Z3DA 3T27A 1QTFA 3GY2A 3VB3A 1IQKA 1QL8A 2PKAB 2Y5HA 3JZ2B 2ZFTA 4FU8A 1FPHH 4BAKB 1CE5A 1P2OA 5E0HA 1A0HB 3NPSA 1O2XA 1DSTA 1KXDA 5A0BA 2PGBB 4O9VA 3ZZ4A 1CHGA 3ZVDA 1K1MA 4ABBA 3S9CA 5ETXA 2LNCA 2WUBA 1SGFG 4ZXYH 5AFZH 1DUAA 1HAZB 3NWUA 4Q7YA 2A5AA 1ABIH 2EEKA 2FI3E 4TWYA 4X8TH 2ZEBA 3SZNA 3FZDA 1O2GH 3NCLA 1O33A 2BZ6H 4JK6A 1Z1IA 1O3CA 2O8UA 2R3YA 2Z3CA 3KNXA 1V2PT 1BBRH 4IN1A 1MTWA 4IS5A 1AE8H 3QK1A 1W13U 3LC3A 2V6NA 2WPJS 1P01A 1CA0B 1SFQB 4GSOA 4NSYA 2WINI 2JH5D 2ZG0H 1QHRB 3K65B 1A3EH 1GGDC 1GCDA 3AASA 1KSNA 1AUTC 4E7RG 1EAUA 1NN6A 1OP8A 4NGAH 5DP7A 1EPTC 1C1OA 4RKOB 4ZKRU 1ZTJA 1BTYA 2GX4A 1HGTH 1ZJKA 2ZHEH 3C1KA 1FI8A 2Z9GA 2P3UB 2ODPA 3RXMA 2ZQ1A 2ZPRA 3F9FA 3RXOA 2JH6D 3ZV8A 1L1NA 2BLOA 1TPSA 3KIDU 3ZZ3A 3SQEE 2WPLS 4MPVA 1NT1A 1FNIA 7LPRA 2PWXA 4R0IA 1JBUH 1THPB 1AVXA 1AVWA 2BD4A 1SQAA 4B76A 2YOLA 1WTGH 1IHTH 3D23A 3EA7A 1O38A 3STJA 5PTPA 3I29A 5ABWA 4AFUA 3FFGA 1RD3B 1UCYE 2QN5T 1HRTH 1LVYA 1SLWB 3AAUA 3B23B 4CH8B 3TVJB 1DFPA 2F91A 3VXFH 3CS7A 3RXQA 3P8NA 4B2AA 3L6PA 3S9BA 1EPTA 1WV7H 1LKBA 3ZVFA 1DLKB 4K8YA 3SUDA 2KAIA 3FVFB 1GHWH 1V2OT 2C4FH 2SNWA 3O8DA 2A4RA 1VCWA 5FPYA 2HPQH 3V12A 2UUFB 5EPNA 1W2KH 3EQ0H 5DKMA 2STBE 5F6MA 3FP6E 1RS0A 5GWZA 5JPMH 2Y5FA 1GI1A 1ESAA 2G55A 1QBOA 1G30B 2H5CA 4NFEA 2NWNA 4U01A 1Y3XA 3P8OA 2J92A 3SU2A 2BLWA 1GBIA 3SNBA 1ELFA 4DY7B 3Q3YA 5I46H 5F03A 1GWAA 1CHOF 4MNXA 1BMLA 4UD9H 3A80A 3PLKA 2ANMH 1TAWA 1GJ5H 1OWIA 1AE5A 2DE9A 1KIGH 1V2JT 1E38B 3MU0A 4B2BA 1DPOA 1BTHH 1AO5A 4ZKNU 1EJMA 2A0QB 2SGQE 4WMEA 2H9EH 3RU4T 1K28D 1EP5A 1H8IH 1PPGE 1FQ3A 5GIBA 1EASA 1F5KU 3OU0A 3BTDE 1WYKA 3URDA 1FY1A 1QY6A 3KEEA 3G01A 1C2LA 2HWLB 1NY22 3ZZ7A 2G52A 2XTTB 5JYIA 1GL0E 2FPZA 2QXJA 5JBCS 4WMDA 2OUAA 2D8WA 4CH2B 1S85A 1GBLA 1D3PB 3T25A 6CHAB 4X2XA 1Z6JH 4Y7BA 3VB6A 1AU8A 1IQNA 2Y7XA 2SGFE 3E1XB 3TK9A 1YPJH 3OYPA 4D8NA 1HAXB 3SU4A 1YPGH 2HVXA 3MH5A 1HJ8A 3LIWA 1TB6H 2H9HA 3LPRA 3RLYH 5EU8A 1L4DA 1QJ1B 2ODQA 1N6XA 5E2PA 4XBDA 3ZZ8A 1HAHH 1MCTA 3EE0B 3A8BA 3QX5H 1AHTH 4Y6DA 1VJ9U 4JZIA 1D6RA 3T26A 5FPSA 2G5VA 3SN8A 1CU1A 1OOKB 1TNLA 4IGDA 3SUGA 1O5EH 4OGYA 3ODDA 3MH6A 1LKAA 2XBWA 2PUQH 2B9LA 3GICB 1VCQA 2M5TA 4BAMB 1ZMNA 4D9QA 3TGKE 1G3BA 1SGIB 1Z6EA 1C2DA 3SGAE 2TGDA 2JKHA 4K1SA 1QA7A 1MBQA 1TPOA 4AFSA 1Z8GA 2QAAA 1C9TA 2UUYA 3MNSA 1JIMA 1C4U2 4XE4A 2EI8A 1QB6A 3PYHA 2VH0A 2FS8A 5GCHF 4CRFA 1KDQB 2Y5GA 1TX7A 5EXLA 2FMJA 3D65E 1GHBF 1B0FA 1LPGB 1RRKA 4OS5A 5FAHA 2CHAC 1OP0A 3LGIA 3FP7E 1ZMJA 3M5OA 3ATKA 3STIA 1W3CA 1P0SH 5A2MH 1N8OC 1Q2WA 1ZYOA 1EZUC 4D9RA 1C9PA 1OYTH 2PKAA 3ATLA 3RM2H 2A5KA 2QCYA 3VXEH 1XVMA 1GJ8B 4FU9A 3MYWA 5EQQA 1UCYH 4AFZA 1K1IA 3A88A 4Y8ZA 1S81A 5LPFA 5EGMA 1JOUB 1DXPA 4Y7AA 3IITA 2VIOA 3MU4A 2V3OH 1ANBA 2FOHA 4X1RU 2P3TB 4KTSA 2FYRA 1SGRE 3TU7H 4JYTA 3UOUA 2TIOA 1GJDB 1A4WH 3NXPA 2XNIA 1V2QT 1GJ6A 4BAOB 3BIVH 4ISHH 1JWTA 3A8AA 2GMTC 4GVUA 1NRQH 4I8JA 5AHGH 4B2CA 3GYMA 3LDXH 1O2TA 1TFXA 1V2MT 3BEIB 3EYDA 2ZCHP 3PTBA 3TIUA 2GZ8A 3C27B 1BHXF 1TPPA 1O3HA 1LHDH 1OSSA 1NESE 3PMAB 3ZZAA 1UVSH 3LC5A 3LU9B 5C67A 4A1TA 1BJVA 3H7OA 2GDEH 4OS7A 1BQYA 2A2XH 2FOGA 5E8EH 1DXWA 3V0XA 2BX4A 1HB0B 1W12U 4WH8A 1ZPBA 1N1LA 1P05A 5LH8A 2P59A 2PTCE 3HK3B 3M5NA 2TGAA 4DT7B 4LZ4B 5FXLA 5TJXA 3RXPA 3EA9A 1YPHE 2CF9H 3MO9A 4BAQB 4WXIA 8KME2 3PROA 2IN2A 3RLWH 6GCHG 3FANA 3ZYEA 4BNRA 1BDAA 2A5IA 2W5EA 1TNIA 2WYGA 2Z9LA 1TNKA 1ZSKA 2A1DB 3QTOH 2CGAA 1V6DA 1A5HA 2UUKB 4INLA 2VVUA 3SNDA 2RA3A 2O8LA 2VIDA 1GI5A 2BD2A 1PQAA 1HAYB 2ZDNA 3SV2H 1O2QA 3UPEA 2UWLA 3Q76A 4HI3A 3RXBA 1GCTB 1TWXB 3GCNA 1TBZH 1TNJA 1TA2A 3WY8A 3P92A 1SGCA 2Z94A 3TH4H 2QXIA 1F0TA 1IQMA 1O2IA 4Z0KA 1INCA 3FAOA 1O2WA 2BDHA 4IN2A 1P3CA 2BHGA 2D2DA 4GHTA 2W7SA 3S7KB 5DO4H 3TK5A 1DITH 3MH7A 3ZZCA 1SL3A 4X6MA 1TGSZ 2ILNA 3RXHA 1K9OE 1SGEE 2ZGBH 1C1PA 1CHOG 1SVPA 2BXTH 2ZDAH 1AVGH 2A7HA 1OWEA 1T4VH 1VITF 1H1BA 2LPRA 2ODYB 4FUEA 4GLYA 3TJNA 1TYNA 3TPIZ 1O2OA 1NPMA 1C5OH 1EZQA 1O3DA 1YCPH 2OC1A 2EC9H 9LPRA 2R2WU 1KY9A 1LPKB 2B7DH 5F8XA 2J95A 5GPIB 2CHAB 3F68H 4X8UH 2XYAA 9ESTA 1GBDA 4ZKOU 1C5SA 1QIXB 4D76A 4MPXA 1MMJN 5B6OA 3U69H 3SJ9A 1O34A 5HM9A 4TPYA 3UWJH 5JBBS 4FU7A 1H8DH 1AY6H 1F2SE 1YPHC 5EW1H 2GCHG 4JZFH 4GCHG 1EJNA 1T8OA 3E8LA 1C4V2 3S69A 3LGTA 2EI7A 1BRUP 4DOQA 3KQCA 3RMLH 1ZZZA 1P12E 2QC2A 2Q6GA 3CS0A 2Y82A 1AFQC 5K7RA 5DP4A 5TCAA 1GI4A 2BD9A 4CRGA 1Y3VA 3A87A 1A61H 2NU3E 1UTOA 1CGIE 1V2VT 1SFIA 1UMAH 1Z8RA 4R8TB 5C1XA 1HFDA 1ZTKA 2QIQA 2RG3A 4MQAA 2DE8A 3P70B 1BUIA 1GG6C 5L2YH 5HXFA 3PMHB 2VU8E 2F9UA 3HPTB 5T6GA 1THSH 1V2ST 3TJUA 1ZLRA 1LHCH 2TPIZ 4UE7H 3M7QA 1ELCA 4OS1A 3LOXA 7GCHG 1C5LH 4CBNA 2J4IA 1GHAF 1O2SA 3P8GA 3UR6A 1DWBH 1GG6B 8ESTE 5JBTA 3S7HB 1L4ZA 2PHBA 1UVPA 1YLDA 3UY9A 1EUFA 2J38A 3RXEA 1O2JA 3LKWA 1RXPA 1RIWC 1GBCA 2SGAA 2VVCA 2QF0A 1T8LA 4JYUH 4X6NA 2FIRH 2WV4A 5FCRA 1D4PB 4I8HA 1AN1E 1IAUA 4X8SH 2HNTE 1QR3E 4YLQH 5FX6A 2GCTC 3M3VA 1SC8U 5DP9A 3A81A 2GGVB 1C5XB 1S82A 2BVSH 4ISIH 8GCHG 4ZKSU 1E35B 2B0FA 4MNVA 3CENA 1Y59T 4UFGH 4MNYA 1JXPA 4TY6A 1H9LB 3BV9B 4O3UA 3SJ8A 1WAYB 2PFEA 3A89A 1FIZA 3SU3A 1KXAA 1T8NA 1D3DB 2ZPSA 4GHQA 1IQIA 1AWHB 4KTUA 2ZGJA 2CMYA 5C20A 3RP2A 2QF3A 5DP3A 1PPEE 2OD3B 1CBWB 4UEHH 1L1JA 2GZ9A 2ZZUH 1NRSH 4MTBA 1MU6B 1ZHPA 2H1UA 5LPEA 1BMAA 1V2KT 2GZ7A 3M3SA 3SU5A 2D1JA 1MUEB 1AZZA 4AX9H 1RGQA 4RN6A 4BANB 1EB2A 1MD8A 1GJAB 1HUTH 1ZGVA 1A2CH 4ABJA 1FY4A 1MQ6A 2Y80A 1PPHE 1EATA 4X2YA 4Q80A 1VGCC 1VCPA 2J94A 1HAVB 4F49A 1ELAA 1C1RA 3LH1A 5A8XA 2G51A 4ZHMU 2RA0A 1PQ5A 4K3JA 1C2EA 2PTNA 3GCHB 5C2ZA 4YOJA 1B5GH 6LPRA 4AB9A 1HDTH 3A83A 1GHVH 4RKJB 3NZIA 1AUJA 2BVXH 4I8KA 2GDDA 4NA7A 4OGXA 3K6ZA 4GPGA 4H42U 1DWDH 1YCPM 4WY3A 3MNCA 5EOKA 1UTJA 4YESB 1ZPCA 2VIQA 1W10U 1IQGA 1KXEA 1EZXC 2J2UA 1BZXE 1WBGB 1SB1H 1ABJH 4AYVB 1SLUB 1OWKA 3BTGE 1YGCH 1SHHB 1HAGE 3ZZ6A 1XKBC 3ITIA 3E90B 4BXSA 2ZU4A 2VH6A 5J4SA 2CF8H 4X1PU 3AAVA 1QRZA 1XXDA 2O8MA 3ZYDA 1DE7H 3QZQA 3U9AH 2OTVA 2ZGCA 1TNGA 2OQUA 1EXFA 2A31A 1JRSA 2FODA 2PKSC 3E3TA 4YTAA 1PPBH 1PYTD 2W26A 2XC4A 1O3AA 1ELVA 4KTCA 1F0SA 4IMZA 3KHVA 3DA9B 1E34B 2BDCA 5A8YA 1C1TA 1QRWA 1OKXA 1FN8A 4DG4A 2I6QA 2B8OH 3LGYA 3ZVEA 4K2YA 2SGDE 3GCTG 5DP8A 4INKA 1ESBA 1GDUA 5ESTE 3MU1A 3U8TH 2W3KA 4X0WU 2G8TA 2BD8A 1C5VA 1A5GH 2P93A 3GDSA 1A1RA 1BBRK 1OP2A 3P6ZB 3RXJA 2G81E 2ZHFH 1AFEH 2P16A 1BIOA 1Y3UA 1FUJA 1L0ZA 1PYTC 2ZECA 2J9NA 1IQHA 1WUNH 2OC0A 4X8VH 3RDZA 4UONA 1C1UH 4AZ2B 2FOFA 2BM2A 1EKBB 1O37A 3TNSA 3RXVA 1HIAA 2ZF0H 3UOPA 2K1QA 3RC6A 1SR5C 1C5UA 1YPMH 4K1TA 4HFPB 1CT2E 1P03A 1EAWA 2PGQB 2AGGX 1LHEH 3AVZA
chains in the Genus database with same CATH superfamily
2EA3A 3UFAA 2GCTB 1MD7A 1BTPA 3VGCB 1FLEE 5L2ZH 1QBNA 4NWLA 1MU8B 5EXMA 3BEUA 3KYFA 1T7CA 4Z6AH 2DUCA 1MCVA 3GY5A 1GBJA 2TGTA 4NSVA 4BXWA 3GY7A 5C1YA 2TRMA 4AFQA 3UB0A 2TGPZ 3QO6A 3F9EA 3UTUH 1XUHA 2HPPH 5C17A 2WPKS 3RMNH 3VGCC 7KMEH 1F5RA 1NO9H 3A7ZA 3ESTA 4H4FA 3TNTA 1TA6A 5EPYA 2Y81A 4DVAU 3N7OA 1CBWC 4K60A 4MNWA 1XMNB 3UUZA 1Z7KA 2C8ZB 1ZPZA 1ELTA 1C2IA 4H6SB 1ZR0A 1OX1A 4FETA 1G9IE 4ZH8A 1TBQH 5EQSA 3KCGH 2K8IA 4RSPA 5AFYH 1M9UA 1TE0A 1TRYA 1V2RT 1P57B 2ZNKH 1G36A 1GJ9B 4Q7XA 2P3FH 5BPEA 1QQUA 2TBSA 3MU5A 3O8CA 2BD3A 1HYLA 4HG6A 4GCHF 2BOKA 1O2UA 3NKKA 4Y79A 2R2MB 4JK5A 4DGJA 2OP9A 3H5CB 4UDWH 1SQOA 1EAIA 3LGVA 3MNBA 3M37A 4XBCA 3FZZA 1N6YA 1O5CB 2WPIS 1GMHF 4MPUA 4X2WA 1YCPK 1DX5M 1AI8H 1LVBA 1GVKB 3TLOA 5FCKA 2ZA5A 1A5IA 1L2EA 2Z9IA 2ZGHA 3T5FH 2GCHF 1TRMA 2BQ6B 1O2RA 1EOLA 1W0KD 3OTPA 1G2LA 4CRDA 4F48B 5L6NH 4ZUHA 4I31A 2XWBI 4UFDH 1PQ8A 1YF4A 3VEQB 1C5NH 1H4WA 4YOIA 4ABIA 2ZHQH 1HAPH 2ZFQH 4CRAA 2AS9A 1QL9A 1K0HA 1XUKA 3NK8A 3BG4C 1G2MA 5T6DA 2ZIQH 1YC0A 1FV9A 4J2YB 3SUEA 1C5TA 4AG1A 1ZGIA 4WH6A 3E16B 3BTWE 2ZTZA 2YNBA 3GISB 1C2HA 1WCZA 3M5LA 1BB0B 5C5OA 2BD5A 3QZRA 3UWIA 4TT3D 1ZSJA 5T3HA 2VGCB 2F9OA 2HALA 2Q6DA 1O5FH 4E05H 3ODFA 1B7XB 1AZ8A 4NWKA 5HYOA 3F9GA 1HIAB 3A7VA 1T4UH 4Y76A 3Q00A 2AHME 4CBOA 3B9FH 4WXVA 4B73A 1DT2A 3SQHE 2VGCC 2FDAA 2WYJA 4A92A 1QURH 2A45B 3BTHE 3F6UH 3T2NA 4DCDA 3E91A 2ZKSA 3A7WA 1OWDA 1WOFA 3RXDA 1K21H 3VPKA 1OWJA 1QL7A 2PV9B 5G4BA 1KTSB 3SNEA 2NU1E 1O3PB 4UFFH 4INHA 2ZDMA 2C8WB 2BY6X 2OLGA 1O5GH 1ZMLA 3EAJA 2XRCA 1FY3A 3BTKE 3PV5A 2GP9B 2A4GA 1TMBH 4I32A 1QZ8A 4I7YH 1GBEA 5EODA 4X1SU 2XOKD 2BXUH 1RFNA 1S5SA 2GT7A 2OC7A 1Z8IB 4YO9A 5T6FA 4FUDA 4Y8XA 1EJAA 5DK1A 1NROH 1CA0C 5AF9H 2V7QD 4U32A 1CGHA 1DANH 1BTWA 5H4IB 1B0EA 4O03A 3U98H 2KX4A 2AYWA 1BRBE 1C2JA 1TALA 4HTCH 1FONA 3LT3A 1O3KA 2Z9JA 4HZHA 3ZVCA 1A46H 4B1TA 1ANCA 2BTCE 3PRDA 3HK6B 2A7CA 4O3TA 3FN8A 5EJZA 3RXTA 5A8ZA 5LPRA 3PV4A 3TGJE 1V2LT 4I33A 1NZQH 1SHYA 1SMFE 3ENSB 4F4OC 1O5BB 1BTXA 1DVAH 2QV1A 2PLXA 4TY7A 3U1IB 2IJOB 5DSFA 3GDUA 1QJ6B 2C90B 4K1EA 3LJOA 3LONA 1NM6A 5E0GA 2FWWA 3U8RH 4FUFA 1KXBA 3IG6B 1FN6A 1O3BA 2FOBA 4J1YA 5EXNA 4KP0A 4WF8A 2SGEE 2KAIB 2WPHS 3ZVGA 1D3TB 1C5ZB 1C5WB 2K0QA 2VVVA 1UHBB 3RXRA 6ESTA 4B75A 4GUXA 2F3CE 3ZZDA 3W94A 3GCTF 3PO1B 1DY9A 5FBIA 1P2MA 2ZFRH 1O2YA 2AFQB 4BOHA 1P10A 1V2WT 3DFJA 1MZDA 4LZ1H 1ELDE 1GMDG 3GY4A 5TCCA 1O3LA 1TNHA 2AGIX 3CNRA 1FY5A 3U28C 1SI5H 1BBRE 8LPRA 1N8OB 4U2WA 4XRNA 1MH0A 2C8XB 3RXGA 5GDSH 5FPTA 3QGJA 1S6LA 3JZ1B 1GI0A 3R3GB 1WQSA 3UQOA 4A5TS 4O97A 1WTHD 1CA8B 2ZGXH 2F9VA 1KDQA 4B71A 3WWFA 1UCYK 3PMBB 1O3OA 1W7XH 3O8BA 2R0LA 1DS2E 3HKJB 4Y10E 5F8TA 2BDAA 1O3EA 3GCOA 2XC5A 4BAHB 1MBMA 3PMJA 1O3IA 2ULLA 3TITA 1MKWH 3M35A 3SW2B 4CHAB 1ARBA 1GDNA 2XCNA 4ASHA 3BIUH 1PJPA 3I78A 4CR9A 3ZVBA 3P17H 2ZU5A 2J98B 3TK6A 3T29A 1MQ5A 1NFXA 2NU0E 4MDSA 4PROA 3K6YA 1ESTA 3P95A 1XUGA 1HAVA 1ZOMA 4AGJA 4NFFA 2GMTB 3V3MA 1XUFA 5GXPA 4X6PA 1AQ7A 3BTTE 5E2OA 1C5PA 2FZZA 1ELGA 4H6TA 2GD4B 4B74A 1TLDA 1S84A 4ACBA 4ISLA 1P2JA 1V2NT 2FTLE 1QJ7B 1YKTA 4JMYA 3SV8A 3RM0H 4MPWA 2ZTXA 1MABB 1TQ7B 3OY5U 1C1NA 2XBVA 5I25A 2BQ7B 1V2UT 3TH3H 5A0CA 1FY8E 3SHAH 5C5NA 2BVRH 1P06A 1HAIH 5L30H 2RDEA 1S83A 1W0YH 1BA8B 1EZSC 2XBXA 4KELA 1P11E 1O35A 3U8OH 1LQEA 2OBOA 4I8LA 1GJCB 4A1XA 3S9AA 2NU4E 1IQEA 1SLXB 3RXCA 3SYJA 1DWEH 3IWMA 2WV5A 4TYDA 1AKSA 3A8DA 4A7IB 2HGTH 2QYIA 1SGPE 2H2ZA 2FX4A 1GHZA 1AMHA 3NRLA 6CHAC 4FUBA 1VR1H 2RDLA 4ZXXH 2ZDLA 1QB9A 2FTMA 1C2FA 1LMWB 3NUMA 1QA0A 3RUOA 4GAWA 4ABEA 3DCLA 2V35A 3D62A 2EQNA 3SO3A 1O3NA 2C3SA 2ZDKA 1P8VC 2QA9E 2GTBA 2QE7D 4WWYA 1Z1JA 2FS9A 1XUJA 1XX9A 1O3JA 1ZSLA 2PP6A 3SV7A 1C5RA 1RJXB 2J5UA 1L1GA 1EFRD 5DGJA 1GGDB 3A8CA 1W11U 1GMCF 3LH3A 2Y7ZA 1GI6A 5KEDA 1ORFA 1S6FA 1EPTB 2OC8A 1WQVH 1J17T 1RTFB 1YLNA 2WZQA 3P8FA 1NU7B 4U30A 3BG8A 5F8ZA 3Q3KA 4XDEA 1LCYA 1K1NA 3FP8E 1Y5BT 5CDFE 3SJKA 1KLIH 1VKYA 2ZCKP 2JJ1D 5LGOA 3N7EA 2KCAA 3OY6U 1V2TT 1C5MD 7GCHF 2VIVA 4DW2U 2ZC9H 4BTUB 1G3CA 1NFYA 1CO7E 4SGBE 2ZU2A 2R0KA 3DFLA 3Q3XA 2J34A 2C8YB 1UTQA 3HATH 1Z8JB 3PO1C 3UAIC 1Y5UT 3F3BA 2FX6A 1MTSA 2BY9X 2STAE 4I8GA 4IC6A 3BTME 3M7TA 1OHHD 1OPHB 4WMFA 1ZRBA 4ZHAA 2ALPA 1BITA 2ZDVH 4NIXA 1KTTB 1J8AA 2W6ID 2HRVA 2BLVA 5EG4A 2ZHDA 3SI4H 1MTUA 4Y8YA 2ZFSA 2FO9A 1GVLA 1AGJA 3RU4E 3KGPA 1D3QB 2VNTA 1EB1H 2ESTE 4A6LA 1Y3YA 3FKSD 2BDYA 1NRPH 4JCNA 1GBTA 1YPLH 3AK5A 4FUIA 4CHAC 1ANDA 1HXEH 1EAXA 4Q2KA 1SSXA 4P02A 5DPAA 1GPZA 1MKXK 2BLQA 4ABDA 4LK4A 3KL6A 5HM2A 3RC4A 1TX6A 2BB4A 1TGTA 1HPGA 4K69A 1LVMA 4E7NA 1THRH 3BTEE 4FUCA 4NZQA 1PPFE 3KN2A 1SQTA 2BY7X 3MOCA 1LHGH 1ELBA 1NU9A 3A7TA 1ZRKA 2AH4X 3RU4D 2UUJB 5SGAE 1GI9B 2A32A 4SGAE 1GDQA 1MKWK 2CK3D 3LGWA 3UREA 2FOMB 5EW2H 4MLFB 1ZTLA 1Z71A 3TJOA 1PPZA 4NIYA 1CT4E 1SGQE 1K2I1 4BTIB 3SOSA 3QGNB 1NRRH 1BHXB 5EIYA 2AERH 2ANWA 4FXGH 1YLCA 1ETRH 2ZU1A 1CT0E 2HNTF 5DJ7A 5BRRE 2QF5A 1F5LA 1OS8A 2G5NA 2VIPA 1O2ZA 1BJUA 2FEQH 3SI3H 2GT8A 2Y6TA 2WHXA 2G4UA 3OEED 4TWWA 4CREA 1AIXH 5JDUB 1QNJA 1WU1A 1FIWA 3L33A 1GMDF 4Y71A 2O9QA 1GMCG 1JMOH 4X2VA 3MHWU 4X6OA 2D26C 1PFXC 2VWOA 3RXLA 3DHKH 1O39A 3ZVAA 2ZWLH 1NFUA 1FAXA 1TOMH 2XWAA 1O2HA 4YT7H 1BCUH 2P95A 4FVDA 4ZROA 3MNXA 1MTVA 2JJ2D 1AB9B 3OAAD 1O2KA 5K0HA 2JETC 1VITH 3TGIE 2OBQA 1EOJA 1K22H 1YM0A 3KQEA 5DP6A 2H6MA 1O31A 3RC5A 3SV6A 1F0RA 1H8HD 2FESH 3K2UA 4Y0YE 4ZHLU 1K1JA 2XCFA 1GJBB 3O8RA 1ETSH 1AB9C 1ETTH 1OXGA 2YMSD 4XSKU 2Q1JA 2ZHWH 1ID5H 1NRNH 2HLCA 3E0NB 3HGNA 5FBEA 4K8BA 4ZAEA 1KXCA 2W7UA 3RXKA 2V3HH 4Q63A 4Y0ZE 3ZV9A 1GHXH 3F2FA 4AC9A 3M7UA 3BN9A 2BDGA 3AW1A 2F9NA 4D7GA 1O3FA 1T32A 5CHAB 3KQDA 1DY8A 1FDPA 1HJ9A 3F2GA 1TPAE 3N99A 4B6FA 5FX5A 3LJJA 2PSYA 1J9CH 4DJZB 3AW0A 1MKXH 1O2NA 1A3BH 3ATIA 4CRCA 2BY5X 1P2IA 1G3DA 3QWCH 1XM1A 2VJ1A 1MZAA 2FYQA 4ESTE 1O3MA 4MG3A 4YOGA 5JB8S 3F0OA 1F92A 2XXLA 2R9PA 1P2QA 2Z3EA 1EQ9A 1J14A 5C0UA 3W95A 1HBTH 3VB4A 1ELEE 3QDZB 1O0DH 3GY3A 3T28A 3MO3A 4YT6H 4JZEH 1KLTA 2AMQA 2PKSB 5HIYA 3MWIU 1XKAC 1IOEA 5CMXH 4YM9A 1C5QA 4NA9H 1CGJE 4AYYB 1YWUA 3QTVH 2FOEA 2BQWB 1E37B 2FI4E 1ZHRA 4KKDA 1O2PA 4ABGA 3ZZ9A 1Y3WA 1DUEA 1WSSH 1H9IE 1O3GA 2BZAA 3RMMH 1FAKH 2SFAA 4NCYA 4ACAA 2NU2E 2FI5E 1BMNH 1DOJA 2EY4C 1YYY1 8GCHF 3SJOA 2OCVB 4AG2A 1GJ4H 2M2AA 3SGBE 1IQLA 1K1PA 2FOAA 1KXFA 2QXGA 1TMTH 4IMQA 3V13A 5DN6D 2FLRH 1T8MA 1GMHG 3E6PH 1IQFA 4AOQA 2F9PA 1Q3XA 1HNEE 2O8WA 5DP5A 2A4QA 2GV6A 4NIWA 5IDKA 1ARCA 2WPMS 5GJ4B 2B5TB 2V0BA 1FX0B 2VB0A 2H5DA 1C1SA 1GBKA 1U6QA 1RIWB 1F7ZA 3MMGA 2QF4A 2BOHB 5C1UA 2ZFFH 4CR5A 1P04A 1CQQA 1F0UA 1ACBE 3RXFA 1HV7A 1A0JA 1P2NA 1EP6A 1NS3A 1E36B 3PRBA 1QQ4A 2PSXA 3A84A 3GOVB 1RTKA 3BEFB 3HGPA 3OX7U 5EQRA 2AEIH 1JIRA 1IHSH 3L3TA 4JZDH 1TBRH 3SU1A 5AVDA 1Q31A 4DIHH 3RXIA 1Y8TA 3RXUA 3ATMA 4FUJA 1Y5AT 2XC0A 1MTNC 4K5ZA 1D6WA 3SUFA 4AB8A 2W6JD 1O2MA 1AWFH 1C2KA 2VIWA 1GBAA 2QGRA 1QBVH 1GCTC 4MVNA 4AN7A 1C1VH 1HXFH 1BMFD 3VB7A 5IYTA 5C3NA 2JETB 1KYNA 2HVYB 2ZP0H 5FHTA 2VINA 2W3IA 1BTZA 2GVFA 1SG8B 2OINA 3GCHC 1UO6A 1J15A 5JB9S 2G4TA 1RTLA 1UHBA 3QLPH 2BX3A 1T31A 3PWCA 1QCPA 1VITG 3U1JB 1XXFA 3UQVA 1YY3A 4OS4A 3SORA 3SU0A 2C93B 3M36A 2Q6FA 2BDBA 1DICA 1TMUH 1W14U 1UK3A 1DWCH 1GHYH 2VWMA 3SNAA 5A0AE 2PW8H 1HCGA 1MAYA 3A86A 2XBYA 4RT0A 1DLEA 1UK2A 1C5YB 2Z6BD 4ISOA 1LTOA 2YMSC 4FUGA 2BYAX 4YLUA 3F0PA 1SPJA 5HGGA 1YPEH 1PPCE 4KGAA 5CHAC 5F53A 1XVOA 3SJIA 3OTJE 4RT1A 1G3EA 3TH2H 3A85A 1FXYA 3A7XA 3W1EA 1O2VA 2IPHA 4XFQA 5T1VA 1FPCH 1GJ7B 3BTFE 4IC5A 1C1WH 3TJVA 3RMOH 2THFB 3Q77A 1BOQA 2CJIA 1DDJA 3KQBA 3DUXH 1TGBA 1X7AC 4A1VA 1QFKH 1BRCE 1FZZA 2AIPA 1LQDB 3I77A 3GDVA 1GBBA 3GS9A 1TONA 2JH0D 2J97A 3M3TA 1AD8H 2WV9A 4HGCA 1HJAC 3D49H 6GCHF 3PWBA 1S0QA 1LHFH 3BTQE 2GV7A 3E0PB 2HNTC 2ANYA 3MI4A 1C1QA 1SOZA 2FM2A 1SGNE 1WDIA 3BF6H 4I86A 1BMMH 1SGDE 1AFQB 1JRTA 4X1QU 1LDTT 2UWOA 4QT8C 1P09A 2BY8X 7ESTE 1DM4B 1D9IA 3URCA 4NZLA 1UTLM 2ALVA 1H8ED 1UVUH 2XW9A 3MFJA 1GVZA 1SBWA 3EDXB 4TPIZ 5GCHG 3DSGA 1HLTH 4Z1MD 1COWD 4NA8A 3CP7A 2H9TH 2RCEA 1A7SA 3HKIB 5E0JA 1CSOE 1V3XA 4CRBA 3F9HA 5EJ1A 2WPDD 4AORA 2AIQA 4OS2A 1YP9A 2AMDA 4UFEH 1ZHMA 1LVOA 3MTYA 2F83A 4DURA 3K9XB 1DSUA 2OQ5A 2A2QH 1SLVB 4NG9H 4WJG2 2VWLA 3LGUA 1S0RA 2ZPQA 1QRXA 3UNRA 4NIVA 4XOJA 2IPQX 4AGKA 2PUXB 3PLPA 4ZMAH 2VBCA 2CXVA 3QN7A 1A0LA 5HIZA 2SGPE 4LXBH 2ZU3A 1QGFA 2JDID 1GHAG 1UTMA 2ZTYA 3DD2H 1GI3A 1UK4A 2OXSA 4YXWD 3PLBA 1O2LA 4Y11E 1AKSB 2BMGB 2VWNA 3ZZ5A 3ELAH 4Q4LA 3V7TA 2V3MA 4Q7ZA 1TRNA 1TGNA 1BTUA 2CV3A 4D7FA 1UVOA 1J16A 1BT7A 4VGCC 1C4Y2 2ZI2H 1UTNA 3QUMP 2P94A 3T62A 3PB1E 1OYQA 4E06H 2G00A 2IOTA 1C2GA 1SKYE 1TIOA 1P3EA 3SNCA 1NC6A 1NTPA 1FJSA 2AGEX 1H9HE 1SGTA 2UWPA 1P9SA 2ASUB 2FXRA 3R0FA 3SU6A 2YNAA 1UJ1A 4VGCB 3SHCH 4ABAA 3UR9A 3MU8A 1SGFA 3ATWA 1W0ZU 2O8TA 4IBLH 4XBBA 1K1LA 1MTNB 2FOCA 2ZO3H 3KF2A 5CE1A 1W8BH 3OSYA 2FP7B 3EGKH 3DT0H 3SV9A 1GBFA 1IQJA 1UTPA 2AMPA 3ZZBA 1O5AB 4M7GA 1K1OA 2BDIA 1NFWA 2FLBH 1O32A 3M61U 1QB1A 1TGCA 1CVWH 2QXHA 3M5MA 1VGCB 1OWHA 3EA8A 1G37A 1GBMA 4IW4E 4FVBA 2BD7A 1TX8A 1ANEA 1GI8B 3PTNA 1C2MA 1E0FD 2ZQ2A 3SGQE 3H7TA 4YZUA 4ABHA 2GKVE 1XUIA 1P02A 4ISNA 2A4OA 1FMGA 1SGYE 3GY6A 3B8JA 2Z9KA 3UIRA 1KLJH 1TABE 2JIZD 4DIIH 1PQ7A 3A82A 4ABFA 2WUCA 1W7GH 2KCYA 4FUHA 3MO6A 1LO6A 4LOYH 3A7YA 1UTKA 2P8OC 3KQ5A 2R3UA 2A7JA 3BSQA 3GY8A 3MH4A 1GI2A 4JZ1A 3UNQA 3F1SB 2ANKH 1TQ0B 3SBKA 5A09A 2Z7FE 4WVPE 4THNH 1TOCB 3VB5A 2EI6A 3GYLB 1C1MA 1GBHA 5J4QA 1YBWA 1P9UA 1GHBG 1MAXA 2ZCLP 1ZJDA 2P8OB 1SOTA 1UVTH 1GI7B 1EX3A 1LPZB 1O5DH 1S6HA 5JBAS 2ZFPH 5HMAA 4OS6A 5B6LA 1O30A 2F9BH 1HJAB 2PR3A 3DSPA 2SNVA 3RXAA 3VFEA 2CN0H 1GL1A 1HAOH 3BG4B 1G32B 5ESBA 1VZQH 2HOBA 1YPKH 3PM3A 3RXSA 2QY0B 3S0NA 4X1NU 1BRAA 3UNSA 1VJAU 4JYVH 5DG6A 1O36A 4BTTB 1P2KA 3EE7A 2I6SA 2Z3DA 1WXRA 3T27A 1QTFA 3GY2A 3VB3A 1IQKA 1QL8A 2PKAB 2Y5HA 3JZ2B 2ZFTA 4FU8A 1FPHH 4BAKB 1CE5A 1P2OA 5E0HA 1A0HB 3NPSA 1O2XA 1DSTA 1KXDA 5A0BA 2PGBB 4O9VA 3ZZ4A 1CHGA 3ZVDA 1K1MA 4ABBA 3S9CA 5KECA 5ETXA 2LNCA 2WUBA 1SGFG 4ZXYH 5AFZH 1DUAA 1HAZB 3NWUA 4Q7YA 2A5AA 1ABIH 2EEKA 2FI3E 5EJLA 4TWYA 4X8TH 2ZEBA 3SZNA 3FZDA 1O2GH 3NCLA 1O33A 2BZ6H 4JK6A 1Z1IA 1O3CA 2O8UA 2R3YA 2Z3CA 3KNXA 1V2PT 1BBRH 4IN1A 1MTWA 4IS5A 1AE8H 3QK1A 1W13U 3LC3A 2V6NA 2WPJS 1P01A 1CA0B 1SFQB 4GSOA 4NSYA 2WINI 2JH5D 4DT4A 2ZG0H 1QHRB 3K65B 1A3EH 1GGDC 1GCDA 3AASA 1KSNA 1AUTC 4E7RG 1EAUA 1NN6A 1OP8A 4NGAH 5DP7A 1EPTC 2KM0A 1C1OA 4RKOB 2J98A 4ZKRU 1ZTJA 2KR7A 1BTYA 2GX4A 1HGTH 1ZJKA 2ZHEH 3C1KA 1FI8A 2Z9GA 2P3UB 2ODPA 3RXMA 3OE7D 2ZQ1A 2ZPRA 3F9FA 3FOAA 3RXOA 2JH6D 3ZV8A 1L1NA 2BLOA 1TPSA 3KIDU 3ZZ3A 3SQEE 2WPLS 4MPVA 1NT1A 1FNIA 7LPRA 2PWXA 4R0IA 1JBUH 1THPB 1AVXA 1AVWA 2BD4A 1SQAA 4B76A 2YOLA 1WTGH 1IHTH 3D23A 3EA7A 1O38A 3STJA 5PTPA 3I29A 5ABWA 4AFUA 3FFGA 1E1RD 1RD3B 1UCYE 2QN5T 1HRTH 1LVYA 1SLWB 3AAUA 3B23B 4CH8B 3TVJB 1DFPA 2F91A 3VXFH 3CS7A 3RXQA 3P8NA 4B2AA 3L6PA 3S9BA 1EPTA 1WV7H 1LKBA 3ZVFA 1DLKB 4K8YA 3SUDA 2KAIA 3FVFB 1NBME 1GHWH 1V2OT 2C4FH 2SNWA 3O8DA 2A4RA 1VCWA 5FPYA 2HPQH 3V12A 2UUFB 5EPNA 1W2KH 3EQ0H 5DKMA 2STBE 5F6MA 3FP6E 1RS0A 5GWZA 5JPMH 2Y5FA 1GI1A 1ESAA 2G55A 1QBOA 1G30B 2H5CA 4NFEA 2NWNA 4U01A 1Y3XA 3F2HA 2J92A 3P8OA 3SU2A 2BLWA 1GBIA 3SNBA 1ELFA 4DY7B 3Q3YA 5I46H 5F03A 1UW7A 1GWAA 1CHOF 4MNXA 1BMLA 4UD9H 3A80A 2KCPA 3PLKA 2ANMH 1TAWA 1GJ5H 1OWIA 1AE5A 2DE9A 1KIGH 4M9FA 1V2JT 1E38B 3MU0A 4B2BA 1DPOA 1BTHH 1AO5A 4ZKNU 1EJMA 2A0QB 2SGQE 4WMEA 2H9EH 5GNDA 3RU4T 1K28D 1EP5A 1H8IH 1PPGE 1FQ3A 5GIBA 1EASA 1F5KU 3OU0A 3BTDE 1WYKA 3URDA 1FY1A 1QY6A 3KEEA 4B6EA 3G01A 1C2LA 2HWLB 1NY22 3ZZ7A 2G52A 2XTTB 5JYIA 1GL0E 2FPZA 2QXJA 5JBCS 4WMDA 2OUAA 2D8WA 4CH2B 1S85A 1GBLA 1D3PB 3T25A 6CHAB 4X2XA 1Z6JH 4Y7BA 3VB6A 1AU8A 1IQNA 2Y7XA 2SGFE 3E1XB 3TK9A 1YPJH 3OYPA 4D8NA 1HAXB 3SU4A 1YPGH 2HVXA 3MH5A 1HJ8A 3LIWA 1TB6H 2H9HA 3LPRA 3RLYH 5EU8A 1L4DA 1QJ1B 2ODQA 1N6XA 5E2PA 4XBDA 2IJD1 3ZZ8A 1HAHH 1MCTA 3EE0B 3ZIAD 3A8BA 1KMHB 3QX5H 1AHTH 4Y6DA 1VJ9U 4JZIA 1D6RA 3T26A 5FPSA 2G5VA 3SN8A 1CU1A 1OOKB 1TNLA 4IGDA 3SUGA 1SQRA 1O5EH 4OGYA 3ODDA 4FOUC 3MH6A 1LKAA 2XBWA 2PUQH 2B9LA 3GICB 1VCQA 2M5TA 4BAMB 1ZMNA 4D9QA 3TGKE 1G3BA 1SGIB 1Z6EA 1C2DA 3SGAE 2TGDA 2JKHA 4K1SA 1QA7A 1MBQA 1TPOA 4AFSA 1Z8GA 2QAAA 1C9TA 2UUYA 3MNSA 1JIMA 5FL7D 1C4U2 4XE4A 2EI8A 1QB6A 3PYHA 2VH0A 4TSFD 2FS8A 5GCHF 1NBMD 4CRFA 1KDQB 2Y5GA 1TX7A 5EXLA 2FMJA 3D65E 1GHBF 1B0FA 1LPGB 1RRKA 4OS5A 5FAHA 2CHAC 1OP0A 3FO8D 3LGIA 3FP7E 1ZMJA 3M5OA 3ATKA 4OM9A 5KGOA 3STIA 1W3CA 1P0SH 5A2MH 1N8OC 2F43B 1Q2WA 1ZYOA 1EZUC 4D9RA 1C9PA 1OYTH 2PKAA 3ATLA 3RM2H 2A5KA 2QCYA 3VXEH 1XVMA 1GJ8B 4FU9A 3MYWA 5EQQA 1UCYH 4AFZA 1K1IA 3A88A 4Y8ZA 1S81A 5LPFA 5EGMA 1JOUB 1W0JD 1DXPA 4Y7AA 3IITA 2VIOA 3MU4A 2V3OH 1ANBA 2FOHA 4X1RU 2P3TB 4KTSA 2FYRA 1SGRE 3TU7H 4JYTA 3UOUA 2TIOA 1GJDB 1A4WH 3NXPA 2XNIA 1V2QT 1GJ6A 4BAOB 3BIVH 4ISHH 1JWTA 3A8AA 2GMTC 4GVUA 1NRQH 4I8JA 4P00A 5AHGH 4B2CA 3GYMA 3LDXH 1O2TA 1TFXA 1V2MT 3BEIB 3EYDA 2ZCHP 3PTBA 3TIUA 2GZ8A 2KCOA 3C27B 1BHXF 1TPPA 1O3HA 3MQKC 1LHDH 1OSSA 1NESE 3PMAB 3ZZAA 1UVSH 3LC5A 3LU9B 5C67A 4A1TA 1BJVA 3H7OA 2GDEH 4OS7A 1BQYA 2A2XH 2FOGA 5E8EH 1DXWA 3V0XA 2BX4A 1HB0B 1W12U 4WH8A 1ZPBA 1N1LA 1P05A 5LH8A 2P59A 2PTCE 3HK3B 3M5NA 2TGAA 4DT7B 4LZ4B 5FXLA 5TJXA 3RXPA 3EA9A 1YPHE 2CF9H 3MO9A 4BAQB 4WXIA 2KFWA 8KME2 2F4LA 3PROA 2IN2A 3RLWH 6GCHG 3FANA 3ZYEA 4BNRA 1BDAA 2A5IA 2W5EA 1TNIA 2WYGA 2Z9LA 1TNKA 2OK5A 1ZSKA 2A1DB 3QTOH 2CGAA 3PV2A 1V6DA 1A5HA 2UUKB 4INLA 2VVUA 3SNDA 2RA3A 2O8LA 2HLDD 1GI5A 2BD2A 2VIDA 1PQAA 1HAYB 2ZDNA 3SV2H 1O2QA 3UPEA 2UWLA 3Q76A 4HI3A 3RXBA 1GCTB 1TWXB 3GCNA 1TBZH 1TNJA 1TA2A 3WY8A 3P92A 1SGCA 2Z94A 3TH4H 2QXIA 1F0TA 1IQMA 1O2IA 4Z0KA 1INCA 3FAOA 1O2WA 2BDHA 4IN2A 1P3CA 2BHGA 2D2DA 4GHTA 4F55A 2W7SA 3S7KB 5DO4H 3TK5A 1DITH 3MH7A 3ZZCA 1SL3A 4X6MA 1TGSZ 2ILNA 3RXHA 1K9OE 1SGEE 2ZGBH 1C1PA 1CHOG 1SVPA 2BXTH 2ZDAH 1AVGH 2A7HA 2YMSB 1OWEA 1T4VH 1VITF 1H1BA 2LPRA 2ODYB 4FUEA 4GLYA 3TJNA 1TYNA 3TPIZ 1O2OA 1NPMA 1C5OH 1EZQA 1O3DA 1YCPH 2OC1A 2EC9H 9LPRA 2R2WU 3DSOA 1KY9A 1LPKB 2B7DH 5F8XA 2J95A 5GPIB 2CHAB 5C0TA 3F68H 4X8UH 2XYAA 9ESTA 1GBDA 4ZKOU 1C5SA 1QIXB 4D76A 4MPXA 2L74A 1MMJN 5B6OA 3U69H 3SJ9A 1O34A 5HM9A 4TPYA 3UWJH 5JBBS 4FU7A 1H8DH 1AY6H 1F2SE 1YPHC 2L6OA 5EW1H 2GCHG 4JZFH 4GCHG 1EJNA 1T8OA 3E8LA 1C4V2 3S69A 3LGTA 2EI7A 1BRUP 4DOQA 3KQCA 3RMLH 1ZZZA 1P12E 2QC2A 2Q6GA 3CS0A 2Y82A 1AFQC 5K7RA 5DP4A 5TCAA 1GI4A 2BD9A 3KYGA 4CRGA 1Y3VA 3A87A 1A61H 3SZEA 2NU3E 1UTOA 1CGIE 1V2VT 1SFIA 1UMAH 1Z8RA 4R8TB 5C1XA 1HFDA 1ZTKA 2QIQA 2RG3A 4MQAA 2DE8A 3P70B 1BUIA 1GG6C 5L2YH 5HXFA 3PMHB 2VU8E 2F9UA 3HPTB 3OEHD 1THSH 5T6GA 1V2ST 3TJUA 1ZLRA 1LHCH 2TPIZ 4UE7H 3M7QA 1ELCA 4OS1A 3LOXA 7GCHG 1C5LH 4CBNA 2J4IA 1GHAF 1O2SA 3P8GA 3UR6A 1DWBH 1GG6B 3WWBA 8ESTE 5JBTA 3S7HB 1L4ZA 2PHBA 1UVPA 1YLDA 3UY9A 1EUFA 4ASUD 2J38A 3RXEA 1O2JA 2XNDD 3N7DA 3LKWA 1RXPA 1RIWC 1GBCA 2SGAA 2VVCA 2QF0A 1T8LA 3VG8A 4JYUH 4X6NA 2FIRH 2WV4A 5FCRA 1D4PB 4I8HA 1AN1E 1IAUA 4X8SH 3H09A 2HNTE 1QR3E 4YLQH 5FX6A 2GCTC 3M3VA 1SC8U 5DP9A 3A81A 2GGVB 1C5XB 1S82A 2BVSH 4ISIH 8GCHG 4ZKSU 1E35B 2B0FA 4MNVA 3CENA 1Y59T 4UFGH 4MNYA 1JXPA 4TY6A 1H9LB 3BV9B 4O3UA 3SJ8A 1WAYB 2PFEA 3A89A 1FIZA 3SU3A 1KXAA 1T8NA 1D3DB 2ZPSA 4GHQA 1IQIA 1AWHB 4KTUA 2ZGJA 2CMYA 5C20A 1E79D 3RP2A 2QF3A 5DP3A 1PPEE 2OD3B 1CBWB 1E1QD 4UEHH 1L1JA 2GZ9A 2ZZUH 1NRSH 4MTBA 1MU6B 1ZHPA 2H1UA 5LPEA 1BMAA 1V2KT 2GZ7A 3M3SA 3SU5A 2D1JA 1MUEB 1AZZA 4AX9H 1RGQA 4RN6A 4BANB 1EB2A 1MD8A 1GJAB 1HUTH 1ZGVA 1A2CH 4ABJA 1FY4A 1MQ6A 2Y80A 5CHBA 1PPHE 1EATA 4X2YA 4Q80A 1VGCC 1VCPA 2J94A 1HAVB 4F49A 3WW7A 1ELAA 4RI0A 1C1RA 3LH1A 5A8XA 2G51A 4ZHMU 2RA0A 1PQ5A 4K3JA 2RFKC 1C2EA 2PTNA 3GCHB 5C2ZA 4YOJA 1B5GH 6LPRA 4AB9A 1HDTH 2GJGA 3A83A 1GHVH 4RKJB 3NZIA 1AUJA 2BVXH 4I8KA 2GDDA 4NA7A 4OGXA 3K6ZA 4GPGA 4H42U 1DWDH 1YCPM 4WY3A 3MNCA 5EOKA 1UTJA 4YESB 1ZPCA 2VIQA 1W10U 1IQGA 1KXEA 1EZXC 2J2UA 4ZCNA 1BZXE 1WBGB 1SB1H 1ABJH 4AYVB 1SLUB 1OWKA 3BTGE 1YGCH 1SHHB 1HAGE 3ZZ6A 1XKBC 3ITIA 3E90B 4BXSA 2ZU4A 2VH6A 5J4SA 2CF8H 5IK2D 4X1PU 3AAVA 1QRZA 1XXDA 2O8MA 2LELA 3ZYDA 1DE7H 3QZQA 3U9AH 2OTVA 2ZGCA 1TNGA 2OQUA 5C94A 1EXFA 2A31A 1JRSA 2FODA 2PKSC 3E3TA 4YTAA 1PPBH 1PYTD 2W26A 2XC4A 1O3AA 1ELVA 4KTCA 1F0SA 4IMZA 3KHVA 3DA9B 1E34B 2BDCA 5A8YA 1C1TA 1QRWA 1OKXA 1FN8A 4DG4A 2I6QA 2B8OH 3LGYA 3ZVEA 4K2YA 2SGDE 3GCTG 5DP8A 4INKA 1ESBA 1GDUA 5ESTE 3MU1A 3U8TH 2W3KA 4X0WU 2G8TA 2BD8A 1C5VA 1A5GH 5HKKD 2P93A 3GDSA 1A1RA 1BBRK 1OP2A 3P6ZB 3RXJA 2G81E 2WSSD 2ZHFH 1AFEH 2P16A 1BIOA 1Y3UA 1FUJA 2KZ4A 1L0ZA 1PYTC 2ZECA 4XD7D 2J9NA 1IQHA 1WUNH 2OC0A 4X8VH 3RDZA 3OFND 4UONA 1C1UH 4AZ2B 2FOFA 2BM2A 1EKBB 1O37A 3TNSA 3RXVA 1HIAA 2ZF0H 3UOPA 2K1QA 3RC6A 1SR5C 1C5UA 1YPMH 4K1TA 4HFPB 1CT2E 1P03A 1EAWA 2LP6A 2PGQB 2AGGX 1LHEH 3AVZA
chains in the Genus database with same CATH topology
2EA3A 3UFAA 2GCTB 1MD7A 1BTPA 3VGCB 1FLEE 5L2ZH 1QBNA 4NWLA 1MU8B 5EXMA 3BEUA 1T7CA 4Z6AH 2DUCA 1MCVA 3GY5A 1GBJA 2TGTA 4NSVA 4BXWA 3GY7A 5C1YA 2TRMA 4AFQA 2TGPZ 3QO6A 3F9EA 3UTUH 1XUHA 2HPPH 2WPKS 3RMNH 3VGCC 7KMEH 1F5RA 1NO9H 3A7ZA 3ESTA 4H4FA 3TNTA 1TA6A 5EPYA 2Y81A 4DVAU 3N7OA 1CBWC 4K60A 4MNWA 1XMNB 3UUZA 1Z7KA 2C8ZB 1ZPZA 1ELTA 1C2IA 4H6SB 1ZR0A 1OX1A 1G9IE 4ZH8A 1TBQH 5EQSA 3KCGH 4RSPA 5AFYH 1M9UA 1TE0A 1TRYA 1V2RT 1P57B 2ZNKH 1G36A 1GJ9B 4Q7XA 2P3FH 5BPEA 1QQUA 2TBSA 3MU5A 3O8CA 2BD3A 1HYLA 4GCHF 2BOKA 1O2UA 3NKKA 4Y79A 2R2MB 4JK5A 4DGJA 2OP9A 3H5CB 4UDWH 1SQOA 1EAIA 3LGVA 3MNBA 3M37A 4XBCA 3FZZA 1N6YA 1O5CB 2WPIS 1GMHF 4MPUA 4X2WA 1YCPK 1DX5M 1AI8H 1LVBA 1GVKB 3TLOA 5FCKA 2ZA5A 1A5IA 1L2EA 2Z9IA 2ZGHA 3T5FH 2GCHF 1TRMA 2BQ6B 1O2RA 1EOLA 4CRDA 1G2LA 5L6NH 4ZUHA 4I31A 2XWBI 4UFDH 1PQ8A 1YF4A 3VEQB 1C5NH 1H4WA 4YOIA 4ABIA 2ZHQH 1HAPH 2ZFQH 4CRAA 2AS9A 1QL9A 1XUKA 3NK8A 3BG4C 1G2MA 5T6DA 2ZIQH 1YC0A 1FV9A 4J2YB 3SUEA 1C5TA 4AG1A 1ZGIA 4WH6A 3E16B 3BTWE 2ZTZA 2YNBA 3GISB 1C2HA 1WCZA 3M5LA 1BB0B 5C5OA 2BD5A 3QZRA 3UWIA 1ZSJA 5T3HA 2VGCB 2F9OA 2HALA 2Q6DA 1O5FH 4E05H 3ODFA 1B7XB 1AZ8A 4NWKA 5HYOA 3F9GA 1HIAB 3A7VA 1T4UH 4Y76A 3Q00A 4CBOA 3B9FH 4WXVA 4B73A 1DT2A 3SQHE 2VGCC 2FDAA 2WYJA 4A92A 1QURH 2A45B 3BTHE 3F6UH 3T2NA 4DCDA 3E91A 2ZKSA 3A7WA 1OWDA 1WOFA 3RXDA 1K21H 3VPKA 1OWJA 1QL7A 2PV9B 5G4BA 1KTSB 3SNEA 2NU1E 1O3PB 4UFFH 4INHA 2ZDMA 2C8WB 2BY6X 2OLGA 1O5GH 1ZMLA 3EAJA 2XRCA 1FY3A 3BTKE 2GP9B 2A4GA 1TMBH 4I32A 4I7YH 1GBEA 5EODA 4X1SU 2BXUH 1RFNA 1S5SA 2GT7A 2OC7A 1Z8IB 4YO9A 5T6FA 4FUDA 4Y8XA 1EJAA 5DK1A 1NROH 1CA0C 5AF9H 4U32A 1CGHA 1DANH 1BTWA 5H4IB 1B0EA 4O03A 3U98H 2AYWA 1BRBE 1C2JA 1TALA 4HTCH 1FONA 3LT3A 1O3KA 2Z9JA 4HZHA 3ZVCA 1A46H 4B1TA 1ANCA 2BTCE 3HK6B 2A7CA 4O3TA 3RXTA 5A8ZA 5LPRA 3PV4A 3TGJE 1V2LT 4I33A 1NZQH 1SHYA 1SMFE 3ENSB 4F4OC 1O5BB 1BTXA 1DVAH 2QV1A 2PLXA 4TY7A 3U1IB 2IJOB 3GDUA 1QJ6B 2C90B 4K1EA 3LJOA 3LONA 1NM6A 5E0GA 2FWWA 3U8RH 4FUFA 1KXBA 3IG6B 1FN6A 1O3BA 2FOBA 4J1YA 5EXNA 4KP0A 4WF8A 2SGEE 2KAIB 2WPHS 3ZVGA 1D3TB 1C5ZB 1C5WB 2VVVA 3RXRA 1UHBB 6ESTA 4B75A 4GUXA 2F3CE 3ZZDA 3W94A 3GCTF 3PO1B 1DY9A 5FBIA 1P2MA 2ZFRH 1O2YA 2AFQB 4BOHA 1P10A 1V2WT 3DFJA 1MZDA 4LZ1H 1ELDE 1GMDG 3GY4A 5TCCA 1O3LA 1TNHA 2AGIX 1FY5A 1SI5H 1BBRE 8LPRA 1N8OB 4U2WA 1MH0A 2C8XB 3RXGA 5GDSH 5FPTA 3QGJA 3JZ1B 1GI0A 3R3GB 1WQSA 3UQOA 4A5TS 4O97A 1WTHD 1CA8B 2ZGXH 2F9VA 1KDQA 4B71A 1UCYK 3PMBB 1O3OA 1W7XH 3O8BA 2R0LA 1DS2E 3HKJB 4Y10E 5F8TA 2BDAA 1O3EA 3GCOA 2XC5A 4BAHB 1MBMA 3PMJA 1O3IA 2ULLA 3TITA 1MKWH 3M35A 3SW2B 4CHAB 1ARBA 1GDNA 2XCNA 4ASHA 3BIUH 1PJPA 3I78A 4CR9A 3ZVBA 3P17H 2ZU5A 3TK6A 3T29A 1MQ5A 1NFXA 2NU0E 4MDSA 4PROA 3K6YA 1ESTA 3P95A 1XUGA 1HAVA 1ZOMA 4AGJA 4NFFA 2GMTB 3V3MA 1XUFA 5GXPA 4X6PA 1AQ7A 3BTTE 5E2OA 1C5PA 2FZZA 1ELGA 4H6TA 2GD4B 4B74A 1TLDA 1S84A 4ISLA 1P2JA 1V2NT 2FTLE 1QJ7B 1YKTA 4JMYA 3SV8A 3RM0H 4MPWA 2ZTXA 1TQ7B 3OY5U 1C1NA 2XBVA 5I25A 2BQ7B 1V2UT 3TH3H 5A0CA 1FY8E 3SHAH 5C5NA 2BVRH 1P06A 1HAIH 5L30H 1S83A 1W0YH 1BA8B 1EZSC 2XBXA 4KELA 1P11E 1O35A 3U8OH 1LQEA 2OBOA 4I8LA 1GJCB 4A1XA 3S9AA 2NU4E 1IQEA 1SLXB 3RXCA 1DWEH 3IWMA 2WV5A 4TYDA 1AKSA 3A8DA 4A7IB 2HGTH 2QYIA 1SGPE 2H2ZA 2FX4A 1GHZA 1AMHA 6CHAC 4FUBA 1VR1H 2RDLA 4ZXXH 2ZDLA 1QB9A 2FTMA 1C2FA 1LMWB 3NUMA 1QA0A 3RUOA 4GAWA 4ABEA 2V35A 3D62A 3SO3A 1O3NA 2C3SA 2ZDKA 1P8VC 2QA9E 2GTBA 4WWYA 1Z1JA 2FS9A 1XUJA 1XX9A 1O3JA 1ZSLA 3SV7A 1C5RA 1RJXB 1L1GA 5DGJA 1GGDB 3A8CA 1W11U 1GMCF 3LH3A 2Y7ZA 1GI6A 1ORFA 1S6FA 1EPTB 2OC8A 1WQVH 1J17T 1RTFB 3P8FA 1NU7B 4U30A 3BG8A 5F8ZA 3Q3KA 4XDEA 1LCYA 1K1NA 3FP8E 1Y5BT 3SJKA 1KLIH 2ZCKP 5LGOA 3OY6U 1V2TT 1C5MD 7GCHF 2VIVA 4DW2U 2ZC9H 4BTUB 1G3CA 1NFYA 1CO7E 4SGBE 2ZU2A 2R0KA 3DFLA 3Q3XA 2J34A 2C8YB 1UTQA 3HATH 1Z8JB 3PO1C 1Y5UT 2FX6A 1MTSA 2BY9X 2STAE 4I8GA 4IC6A 3BTME 3M7TA 1OPHB 4WMFA 1ZRBA 4ZHAA 2ALPA 1BITA 2ZDVH 4NIXA 1KTTB 1J8AA 2HRVA 2BLVA 5EG4A 2ZHDA 3SI4H 1MTUA 4Y8YA 2ZFSA 2FO9A 1GVLA 1AGJA 3RU4E 3KGPA 1D3QB 2VNTA 1EB1H 2ESTE 4A6LA 1Y3YA 2BDYA 1NRPH 4JCNA 1GBTA 1YPLH 4FUIA 4CHAC 1ANDA 1HXEH 1EAXA 4Q2KA 1SSXA 5DPAA 1GPZA 1MKXK 2BLQA 4ABDA 4LK4A 3KL6A 5HM2A 3RC4A 1TX6A 2BB4A 1TGTA 1HPGA 4K69A 1LVMA 4E7NA 1THRH 3BTEE 4FUCA 4NZQA 1PPFE 3KN2A 1SQTA 2BY7X 3MOCA 1LHGH 1ELBA 1NU9A 3A7TA 1ZRKA 2AH4X 3RU4D 2UUJB 5SGAE 1GI9B 2A32A 4SGAE 1GDQA 1MKWK 3LGWA 3UREA 2FOMB 5EW2H 4MLFB 1ZTLA 1Z71A 3TJOA 1PPZA 4NIYA 1CT4E 1SGQE 1K2I1 4BTIB 3SOSA 3QGNB 1NRRH 1BHXB 2AERH 2ANWA 4FXGH 1YLCA 1ETRH 2ZU1A 1CT0E 2HNTF 5DJ7A 5BRRE 1F5LA 1OS8A 2G5NA 2VIPA 1O2ZA 1BJUA 2FEQH 3SI3H 2GT8A 2Y6TA 2G4UA 4TWWA 4CREA 1AIXH 5JDUB 1QNJA 1WU1A 1FIWA 3L33A 1GMDF 4Y71A 2O9QA 1GMCG 1JMOH 4X2VA 3MHWU 4X6OA 2D26C 2VWOA 1PFXC 3RXLA 3DHKH 1O39A 3ZVAA 2ZWLH 1NFUA 1FAXA 1TOMH 2XWAA 1O2HA 4YT7H 1BCUH 2P95A 4FVDA 4ZROA 3MNXA 1MTVA 1AB9B 1O2KA 5K0HA 2JETC 1VITH 3TGIE 2OBQA 1EOJA 1K22H 1YM0A 3KQEA 5DP6A 2H6MA 1O31A 3RC5A 3SV6A 1F0RA 2FESH 3K2UA 4Y0YE 4ZHLU 1K1JA 2XCFA 1GJBB 3O8RA 1ETSH 1AB9C 1ETTH 1OXGA 4XSKU 2Q1JA 2ZHWH 1ID5H 1NRNH 2HLCA 3E0NB 3HGNA 5FBEA 4K8BA 4ZAEA 1KXCA 2W7UA 3RXKA 2V3HH 4Y0ZE 3ZV9A 1GHXH 3M7UA 3BN9A 2BDGA 3AW1A 2F9NA 4D7GA 1O3FA 1T32A 5CHAB 3KQDA 1DY8A 1FDPA 1HJ9A 1TPAE 5FX5A 3LJJA 2PSYA 1J9CH 4DJZB 3AW0A 1MKXH 1O2NA 1A3BH 3ATIA 4CRCA 2BY5X 1P2IA 1G3DA 3QWCH 1XM1A 2VJ1A 1MZAA 2FYQA 4ESTE 1O3MA 4MG3A 4YOGA 5JB8S 1F92A 2XXLA 2R9PA 1P2QA 2Z3EA 1EQ9A 1J14A 3W95A 1HBTH 3VB4A 1ELEE 3QDZB 1O0DH 3GY3A 3T28A 3MO3A 4YT6H 4JZEH 1KLTA 2AMQA 2PKSB 3MWIU 1XKAC 1IOEA 5CMXH 4YM9A 1C5QA 4NA9H 1CGJE 4AYYB 3QTVH 2FOEA 2BQWB 1E37B 2FI4E 1ZHRA 4KKDA 1O2PA 4ABGA 3ZZ9A 1Y3WA 1DUEA 1WSSH 1H9IE 1O3GA 2BZAA 3RMMH 1FAKH 2SFAA 4NCYA 2NU2E 2FI5E 1BMNH 1DOJA 1YYY1 8GCHF 3SJOA 2OCVB 4AG2A 1GJ4H 3SGBE 1IQLA 1K1PA 2FOAA 1KXFA 2QXGA 1TMTH 4IMQA 3V13A 2FLRH 1T8MA 1GMHG 3E6PH 1IQFA 4AOQA 2F9PA 1Q3XA 1HNEE 2O8WA 5DP5A 2A4QA 2GV6A 4NIWA 5IDKA 1ARCA 2WPMS 5GJ4B 2B5TB 2V0BA 2VB0A 2H5DA 1C1SA 1GBKA 1U6QA 1RIWB 1F7ZA 3MMGA 2BOHB 5C1UA 2ZFFH 4CR5A 1P04A 1CQQA 1F0UA 1ACBE 3RXFA 1HV7A 1A0JA 1P2NA 1EP6A 1NS3A 1E36B 1QQ4A 2PSXA 3A84A 3GOVB 1RTKA 3BEFB 3HGPA 3OX7U 5EQRA 2AEIH 1JIRA 1IHSH 3L3TA 4JZDH 1TBRH 3SU1A 5AVDA 1Q31A 4DIHH 3RXIA 1Y8TA 3RXUA 3ATMA 4FUJA 1Y5AT 2XC0A 1MTNC 4K5ZA 1D6WA 3SUFA 4AB8A 1O2MA 1AWFH 1C2KA 2VIWA 1GBAA 2QGRA 1QBVH 1GCTC 4MVNA 4AN7A 1C1VH 1HXFH 3VB7A 5IYTA 5C3NA 2JETB 1KYNA 2ZP0H 5FHTA 2VINA 2W3IA 1BTZA 2GVFA 1SG8B 2OINA 3GCHC 1UO6A 1J15A 5JB9S 2G4TA 1RTLA 1UHBA 3QLPH 2BX3A 1T31A 3PWCA 1QCPA 1VITG 3U1JB 1XXFA 3UQVA 3SORA 4OS4A 3SU0A 2C93B 3M36A 2Q6FA 2BDBA 1DICA 1TMUH 1W14U 1UK3A 1DWCH 1GHYH 2VWMA 3SNAA 5A0AE 2PW8H 1HCGA 1MAYA 3A86A 2XBYA 1DLEA 1UK2A 1C5YB 2Z6BD 4ISOA 1LTOA 4FUGA 2BYAX 4YLUA 1SPJA 5HGGA 1YPEH 1PPCE 4KGAA 5CHAC 3SJIA 1XVOA 3OTJE 1G3EA 3TH2H 3A85A 1FXYA 3A7XA 1O2VA 2IPHA 4XFQA 1FPCH 1GJ7B 3BTFE 4IC5A 1C1WH 3TJVA 3RMOH 2THFB 3Q77A 1BOQA 2CJIA 1DDJA 3KQBA 3DUXH 1TGBA 1X7AC 4A1VA 1QFKH 1BRCE 1FZZA 2AIPA 1LQDB 3I77A 3GDVA 1GBBA 1TONA 2JH0D 3M3TA 4HGCA 1AD8H 1HJAC 3D49H 6GCHF 3PWBA 1S0QA 1LHFH 3BTQE 2GV7A 3E0PB 2HNTC 2ANYA 3MI4A 1C1QA 1SOZA 2FM2A 1SGNE 3BF6H 1BMMH 1SGDE 1AFQB 1JRTA 4X1QU 1LDTT 2UWOA 4QT8C 1P09A 2BY8X 7ESTE 1DM4B 1D9IA 3URCA 4NZLA 1UTLM 2ALVA 1UVUH 2XW9A 3MFJA 1GVZA 1SBWA 3EDXB 4TPIZ 5GCHG 1HLTH 4NA8A 3CP7A 2H9TH 2RCEA 1A7SA 3HKIB 5E0JA 1CSOE 1V3XA 4CRBA 3F9HA 4AORA 2AIQA 4OS2A 1YP9A 2AMDA 4UFEH 1ZHMA 1LVOA 3MTYA 2F83A 4DURA 3K9XB 1DSUA 2OQ5A 2A2QH 1SLVB 4NG9H 4WJG2 2VWLA 3LGUA 1S0RA 2ZPQA 1QRXA 3UNRA 4NIVA 4XOJA 4AGKA 2PUXB 3PLPA 4ZMAH 2CXVA 3QN7A 1A0LA 2SGPE 4LXBH 2ZU3A 1QGFA 1GHAG 2ZTYA 1UTMA 3DD2H 1GI3A 1UK4A 2OXSA 3PLBA 1O2LA 4Y11E 1AKSB 2BMGB 2VWNA 3ZZ5A 3ELAH 3V7TA 4Q7ZA 1TRNA 1TGNA 1BTUA 2CV3A 4D7FA 1UVOA 1J16A 1BT7A 4VGCC 1C4Y2 2ZI2H 1UTNA 3QUMP 2P94A 3T62A 3PB1E 1OYQA 4E06H 2G00A 2IOTA 1C2GA 1TIOA 1P3EA 3SNCA 1NC6A 1NTPA 1FJSA 2AGEX 1H9HE 1SGTA 2UWPA 1P9SA 2ASU