2O8WA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q/s195a) in complex with inhibitors
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8wA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8wA01
4ZKOU 4XOJA 3H7TA 3KN2A 3SV6A 5E0GA 3P17H 3RXTA 1KTSB 1EOJA 2BD2A 4UFFH 3MNBA 2QXGA 1OWJA 1GBHA 2GCTC 1XUHA 3FZZA 1ELGA 2OXSA 4ABAA 2R0KA 4K2YA 1HBTH 4D9RA 1F92A 3UR6A 3SO3A 3LJOA 1GHXH 1A0JA 4ZHAA 3MWIU 4K1TA 1N6YA 1K2I1 1VJAU 3QTVH 1ID5H 1TBRH 1B0FA 3ZVDA 1LTOA 1GJCB 1ZR0A 5EODA 3QZRA 1CU1A 1ZSJA 2GZ9A 3NK8A 4AOQA 1Y5UT 3HK3B 1DITH 2BDYA 1H8DH 3RXVA 4Z6AH 4K60A 2PKAB 1BT7A 1JRTA 1GBEA 2DE8A 2ZTXA 2A0QB 1VITF 5GDSH 4FUBA 1GDQA 1J14A 1DVAH 2FM2A 3TJUA 1ZHMA 1UHBB 1LPZB 1P2NA 4UDWH 4Q7XA 5B6OA 1GBLA 2JH5D 4DURA 2ZCLP 2O8WA 1GL1A 1N6XA 4ABBA 3E3TA 3KQEA 1C5UA 3LH1A 2OBQA 2IOTA 4O3TA 5AFZH 1TIOA 3NWUA 2C93B 1UHBA 1O3CA 3QGJA 4YLQH 3QLPH 3MO6A 2WINI 3T28A 1O2WA 1Z8GA 1YPJH 2PSXA 3A82A 2WUCA 3I77A 1C5NH 1TYNA 2ILNA 1TPOA 2AH4X 4RKJB 1W0YH 1DUEA 1V2RT 4JZIA 2FYQA 3N7OA 2ZCHP 2AMQA 1QTFA 5C67A 2XW9A 2PHBA 1FUJA 3TVJB 1TNIA 1D3PB 1EZSC 4INKA 2OQUA 2G5VA 1BITA 3BSQA 2GCHG 2EC9H 3SBKA 1A1RA 1VJ9U 1TPPA 3BEUA 3GY5A 3UIRA 1C2DA 4I8KA 1HJAB 4X1RU 4Q80A 4OS5A 5HYOA 1FXYA 1SSXA 1ZPCA 3LONA 4A5TS 1XXDA 4BTUB 4B71A 2R3YA 2F9PA 5BRRE 1XXFA 3PLBA 1TA6A 1Z6EA 2FODA 1FDPA 1F5KU 4YOJA 4AX9H 1QRXA 2ZNKH 5JPMH 1DWBH 4B75A 1IHSH 2GD4B 4MNWA 1NPMA 1C5OH 1HXFH 3NPSA 4E7RG 2G4TA 4X2YA 2O8TA 2FTLE 4ZAEA 3A87A 3M3SA 1ZSKA 4GCHF 3RDZA 1ZLRA 2PLXA 3UWIA 3LGVA 1VITH 1FAXA 1EKBB 2Y5HA 1BRBE 1AWFH 1LKBA 2IPHA 1NRQH 1DT2A 1C9TA 4K5ZA 1G36A 1RD3B 3BTKE 3PYHA 2Q1JA 3ITIA 5DP4A 4DT7B 2BQ6B 1TABE 1O5CB 2ANWA 1H9HE 1SMFE 1ELCA 2P59A 4IC6A 3T26A 1F5LA 5E2OA 1AFQB 2H1UA 1P8VC 4B1TA 3UWJH 1ZSLA 4FU8A 4K8BA 1DS2E 4AFZA 3DA9B 2G00A 1GDUA 2PV9B 4XBCA 2RA3A 3LGIA 2KAIA 4CH8B 1UK2A 4X8UH 6CHAB 3SJ9A 3BF6H 2VIWA 4CBOA 1V2KT 3LGTA 3ATIA 1RFNA 4NIYA 4Y8YA 3QX5H 1BRUP 2CN0H 3DHKH 4AGJA 1GMCF 1SLUB 1RRKA 1GJ9B 1HAPH 1FJSA 4MDSA 2ZGJA 3MO3A 1Q31A 4CR9A 1EPTB 1C5PA 1F2SE 2A4QA 2FI3E 4E7NA 4RKOB 1HAGE 1CHOG 4R8TB 3A8AA 1V2QT 3P8NA 4R0IA 1MKXH 2BZ6H 3MU0A 1C5YB 2NU3E 3ZV9A 3C27B 1O2OA 1RGQA 5L30H 1W8BH 3AAVA 3PM3A 5SGAE 1ANEA 1GJ5H 1ACBE 1KXEA 2JKHA 3Q77A 1BTWA 1GMDG 1RIWB 4CRAA 2XNIA 4FUHA 1D6RA 2OC7A 4H6TA 2ANKH 2ZU2A 2ZU3A 3RMNH 2ZPQA 4KTSA 2Z9GA 1C2EA 1IQFA 1YPLH 1EATA 1TGTA 2ZGBH 3QWCH 3PWBA 1NTPA 2R0LA 1SGIB 3SJ8A 3RLYH 2H5DA 2NU1E 4FXGH 2QGRA 3SU4A 2UUYA 8LPRA 2HNTE 3GOVB 2XWAA 3BTEE 1DLEA 2ANYA 2BOKA 4RN6A 1IQHA 1PPFE 2BLWA 2UWPA 1FPHH 1THPB 3E1XB 3SJIA 1O2GH 5JBBS 4CRCA 1V2NT 3PLKA 1HIAA 3VEQB 2SGFE 1SBWA 1ANDA 2FLBH 4UFGH 1UCYH 1EAIA 1ZMJA 1GHBG 2BD3A 1QFKH 1ELFA 1TNKA 3AASA 5EPYA 5E0JA 2ZTZA 4WXIA 4ASHA 1GHAG 1ANCA 1YLCA 5EQRA 3U8OH 2V3HH 2FI4E 3GY4A 3ODFA 3UREA 2V3OH 4XFQA 2HOBA 1LHCH 3RXBA 5JDUB 3RM0H 3FAOA 3K6YA 1ELEE 5JB9S 2ANMH 3RXDA 4YO9A 1O33A 2D1JA 3ELAH 4YM9A 3SJKA 2BY8X 4I33A 3RP2A 2ZHDA 1VCQA 2ZFRH 5HM2A 3SU1A 5ETXA 4UFEH 3URCA 1SGDE 1D3QB 3MH6A 1BMAA 2OTVA 3MH5A 4FUDA 3BIUH 3A89A 3SQEE 4NFFA 2QF3A 2A5IA 1HDTH 2ALVA 1GCDA 4OS2A 1ZHPA 5T6DA 2GT7A 1H9IE 1AO5A 2C8YB 2TPIZ 3CS7A 2PW8H 4WY3A 5T3HA 1UMAH 1GBBA 3PLPA 4MTBA 4CHAB 3TNSA 3QGNB 1AUTC 4AYVB 2QYIA 3RXJA 2BQ7B 2PR3A 3LC5A 6GCHG 3E90B 1FZZA 1P2JA 2AMPA 2ZHWH 5F8TA 3RMOH 1C5TA 3P70B 1BQYA 1AVXA 2JETB 3SI3H 2ZZUH 5EXNA 5A0CA 1P03A 1OX1A 1W13U 2Y80A 2Y81A 1AD8H 4ZKNU 1KYNA 2HLCA 4M7GA 3B9FH 1ANBA 1UCYK 4X6OA 3RC5A 4DJZB 4I32A 4JZEH 1S84A 3M5OA 4WMFA 2ODPA 2C8WB 5T6FA 1YGCH 4FUEA 1PYTD 1TAWA 4NSVA 3TNTA 3P6ZB 2AERH 1O32A 2SGAA 1O3GA 1W7XH 3B23B 3ZVBA 1C2IA 4K69A 3SU2A 2ZP0H 1GCTC 3HKJB 2ZDMA 2ZTYA 1EJMA 4MQAA 5C1YA 3SNBA 5FX6A 4MNXA 2HWLB 3FZDA 3SOSA 1KLTA 1O5FH 6LPRA 1V2VT 2R2MB 4Q7YA 4O03A 1C5MD 2FI5E 1ZHRA 1GHYH 4Y76A 3ZYEA 4DW2U 2XXLA 1YPEH 1NESE 3E0PB 3BTQE 4DVAU 4ZMAH 1V2ST 3BG8A 5JYIA 2ZHEH 2JH6D 3QO6A 3AW1A 4X8TH 2ZKSA 1AZ8A 1SGPE 3RXUA 1BBRK 3TIUA 4ZKRU 4MLFB 5EG4A 5A0BA 1GDNA 3M61U 4LXBH 2PGBB 1Y5AT 1CVWH 1P2OA 3I78A 5F03A 2NU0E 1YYY1 1YPHE 2WV4A 3UQVA 1CHGA 3EA9A 4XDEA 1FMGA 1V2OT 3T29A 1BA8B 1FV9A 2Y82A 1ABIH 1TNJA 3RM2H 3SUFA 1AKSB 1TGCA 4HTCH 2FOHA 2ZGCA 3MU4A 1SL3A 1A3EH 3S69A 3PO1B 1NFXA 1L1GA 2P16A 4QT8C 3PMAB 4CBNA 4Y11E 1P11E 3S0NA 2XBVA 1A2CH 2TIOA 3FVFB 2G52A 1Y8TA 3T2NA 1G3CA 1GGDC 1O3OA 3FP7E 5F8XA 2CJIA 3SHCH 3EAJA 1ZRKA 5DO4H 3QUMP 5LH8A 4WMDA 1VCPA 2G55A 2F9BH 3UOPA 4X2XA 3ZZ3A 1GHZA 5FBEA 1UTQA 4KTUA 3ZZCA 1ZMLA 3AVZA 1Y3VA 2ZEBA 2ZDNA 2JH0D 4NA8A 1JRSA 1P02A 1NM6A 1GBFA 3TH4H 1WU1A 4NIVA 2Q6DA 3K2UA 3ZZAA 1L1NA 3QZQA 1TX8A 3DUXH 5C1UA 2W26A 2OP9A 3T5FH 2ZECA 1QA0A 3QTOH 1HXEH 2VGCC 3SHAH 1F5RA 1K1NA 2Z3EA 4UEHH 3JZ1B 2A1DB 1Z8RA 2BY6X 2RA0A 3RU4D 1DXWA 1Y3UA 1G37A 1KXDA 1BMMH 2ZDKA 1S0QA 5ESBA 4YOIA 3EA7A 4ABEA 1ESAA 4X1PU 6ESTA 1IQNA 2QY0B 1GMCG 1AWHB 1V6DA 3RMLH 1MQ5A 2FOBA 4NSYA 3VPKA 1ZJDA 3RMMH 7ESTE 2FOMB 4GAWA 1O2KA 1BRAA 1SC8U 4A7IB 1LQEA 1C1TA 2CHAB 2ZC9H 2EI6A 2I6QA 3SJOA 1O3AA 1P2QA 2SGEE 2FX6A 1PPBH 1YF4A 4X0WU 3BTHE 1O2RA 1TGBA 1GI1A 2ZU1A 3UY9A 4YLUA 3RXLA 1UVUH 7GCHG 2ALPA 2QA9E 1BCUH 2F9UA 2BB4A 3IWMA 3FANA 1W3CA 1FLEE 1DSUA 2GMTC 4LK4A 4ZXYH 1T7CA 4LZ1H 2Y7ZA 1WTHD 1BTPA 1GI8B 2OCVB 3FP6E 3RXEA 1WQVH 2K1QA 2XBXA 1MTNB 4WVPE 4A1XA 4O3UA 2FZZA 2OC0A 3R0FA 1QGFA 4LZ4B 2ODQA 3SQHE 1ESTA 1XMNB 3TK5A 2V35A 1G2MA 4NWKA 4NIXA 1P9SA 1LVOA 4FVBA 4Y0ZE 1Y3XA 1SPJA 2ODYB 1QBOA 2VB0A 1EX3A 1FQ3A 5HM9A 4BTIB 2FOGA 1WTGH 4NG9H 1P9UA 1G3BA 1C5SA 2ZG0H 2HNTC 1P2IA 1K1JA 1RXPA 4MVNA 3T62A 2VJ1A 5HXFA 1K28D 2I6SA 1NZQH 1O2HA 2PTNA 1NFYA 1RJXB 1ABJH 2BLVA 4NIWA 4OS1A 3KCGH 4CRGA 1C2LA 1TWXB 1TQ7B 1K1LA 4ABIA 1C5QA 1SGEE 1PQ8A 1P0SH 5I25A 2BD9A 1CO7E 4JK6A 3AW0A 5EXLA 1BDAA 3Q00A 2TGDA 4INLA 3U9AH 1ZGIA 1OWEA 4GUXA 2YOLA 1SFIA 1IQIA 1KXFA 1GI2A 4HI3A 1BTYA 4U30A 1SI5H 3PTNA 1UK3A 2PSYA 2OC1A 4FU9A 2FS8A 1DWCH 4WWYA 4CH2B 3M5MA 1QL7A 5H4IB 1SG8B 3NKKA 2UWLA 3A7YA 2WPKS 3SU5A 1SQTA 3O8DA 1O3LA 3S9AA 1EJNA 1O0DH 3D62A 4Y71A 2BX4A 1THRH 1Z6JH 1HPGA 1O2YA 4D8NA 1LVMA 1C1RA 1NRPH 3PMJA 1G3DA 1BJUA 1C4U2 2PTCE 1TFXA 1BTZA 2A4RA 3ZZDA 3D23A 1HJAC 2BVRH 3CP7A 1BHXB 4BNRA 1XUKA 1Q2WA 3TGKE 4ZUHA 4YT7H 4JZ1A 3GY6A 3VGCB 3GICB 3RXCA 1MBQA 5LPRA 4IBLH 2LPRA 4H6SB 3VB7A 1GMHF 1QY6A 1N8OB 2OD3B 5FCKA 1OYQA 4KP0A 1AQ7A 2UUJB 4UFDH 3A88A 3VB4A 1MTWA 3QN7A 1P04A 3LJJA 2VNTA 3E91A 2BDAA 4TWWA 2EI8A 3ZVFA 1K1PA 1FI8A 1MMJN 3S9CA 4WJG2 2ZU4A 1V2MT 2VU8E 5FXLA 1CE5A 1MZDA 2CGAA 1O5AB 4AB8A 3GY3A 3KF2A 1ZOMA 1K22H 5HGGA 2ZO3H 3TU7H 3LIWA 2G4UA 4BAHB 1BTUA 5DP7A 4ABDA 1DUAA 3SNEA 1GPZA 2ZPRA 3ZV8A 1K1OA 2Q6FA 1PQAA 3W95A 4MNYA 4ZROA 1SLWB 1TBZH 1PPEE 4UD9H 1GG6C 4ISIH 1D4PB 4K3JA 4Y79A 3LGYA 5ABWA 3MNCA 1NROH 1V2WT 4TYDA 2Z3CA 1QL8A 2UUKB 4X8VH 1LMWB 3TH2H 1DWDH 4GHTA 2O8MA 1AFQC 4NA9H 2ZGXH 2B5TB 3C1KA 1TOMH 1NN6A 4OGYA 4XBDA 1OKXA 1BTXA 3PWCA 2RDLA 2FOFA 3F9EA 1EJAA 3RXSA 4IN1A 3UOUA 2VVVA 6CHAC 2AGGX 1EAWA 1D6WA 2XBWA 2QIQA 1G2LA 1NRSH 3LOXA 3OY6U 5EQSA 3V12A 5C1XA 1X7AC 1CT2E 1C1PA 4HFPB 1HAVA 3STJA 1F0SA 3KNXA 1EB1H 2BLOA 1YPHC 2GP9B 3SV9A 1C5ZB 4ABGA 1GG6B 2KAIB 3TJNA 1IQJA 3A8DA 4AG2A 1SHYA 1EPTC 4BAKB 1IQMA 1XUFA 1SOZA 1TOCB 3MYWA 1VGCB 1AE8H 3MH7A 2QF0A 4WH6A 7LPRA 3BG4B 4U32A 1WV7H 4XBBA 1UCYE 1C4V2 1FAKH 3UQOA 1PPGE 4MG3A 2P3FH 2CMYA 1AN1E 1CA0B 1QJ7B 1S0RA 1S83A 1Z8IB 2FMJA 3LU9B 4HZHA 5EGMA 1O2TA 1RIWC 3ZVGA 1P05A 2BM2A 4DOQA 3BTWE 1O3PB 4NZLA 3BTME 1EZXC 1TNLA 4KKDA 3A7ZA 1C5XB 1TQ0B 1ELTA 1XUIA 2THFB 3PV4A 1G3EA 3GY2A 3F9FA 2QXJA 1V2PT 4A1TA 3RXFA 1T32A 1AMHA 1UTNA 1K1MA 1CBWB 4FUGA 3VB5A 3MFJA 1YPMH 2D2DA 5DJ7A 1GI4A 1UTJA 8GCHF 1NY22 4J1YA 1O2UA 1RTKA 2Z9IA 3A7VA 1BBRE 5EXMA 7KMEH 5L2YH 2WYJA 1TMUH 3SU0A 2XWBI 1EP6A 1O2MA 2ZQ1A 1NFWA 2SNWA 4B2AA 1W10U 1HGTH 3SU6A 1YCPK 1C5VA 9LPRA 1JIRA 3M37A 5DP5A 1C5RA 2XYAA 2WPMS 5DP3A 2W3IA 2QXHA 2FDAA 2J9NA 1HIAB 1VR1H 1GHWH 4NFEA 1C9PA 1O36A 3TK6A 1C1UH 5GCHG 3IITA 3A7WA 1GI9B 3SN8A 1JMOH 1PPHE 2C4FH 3M7TA 2A2XH 3A83A 4FUJA 1EAXA 4JCNA 1GBDA 1L2EA 1GI0A 5C2ZA 1HJ8A 2FYRA 1HAZB 2Z3DA 4ABFA 1MCVA 4KGAA 1ZZZA 1LQDB 3GISB 5FHTA 1NC6A 3CENA 3RU4E 5GWZA 3SV2H 3BEIB 3K6ZA 1BHXF 3OTJE 2TGAA 4ISLA 4BTTB 3OX7U 1WUNH 3MTYA 2VH0A 1FPCH 4YOGA 3TJOA 2BMGB 4IC5A 1ORFA 4B2CA 1DM4B 3TJVA 1B0EA 2ZDLA 2FX4A 5CHAB 4CHAC 5GPIB 3TLOA 1CA8B 1FN8A 1E0FD 2ZGHA 4OGXA 4ABHA 1J15A 2WUBA 5EW2H 2IJOB 1ZYOA 3TGIE 2BYAX 1GI5A 1MAYA 2XCFA 3HATH 4FU7A 1NO9H 2JETC 1T4VH 1AB9B 1G9IE 1VZQH 2BD7A 1DFPA 4THNH 2A5AA 1BBRH 2BDHA 3M7UA 1LPGB 1LKAA 1TRNA 2H9TH 1QNJA 2W7SA 1O2JA 2GX4A 5K7RA 2AYWA 3ZZ6A 1BZXE 2J38A 2PWXA 3ESTA 1GJ7B 3VXFH 1P2MA 2C90B 1AHTH 5DPAA 3MU8A 1ELDE 5FPSA 3GDSA 1O31A 2BVXH 3DFLA 1SGQE 2ZHQH 2G51A 1MTVA 3SV7A 1K21H 1FIZA 1Z8JB 1VITG 3CS0A 1PJPA 3MO9A 3EA8A 1JBUH 3HK6B 4FUIA 2GV6A 1EASA 5J4SA 5FPTA 4JK5A 2A7CA 1WOFA 1DE7H 5C3NA 1UVPA 4NCYA 1GJ4H 1QBVH 4ZH8A 2ASUB 2VINA 2H5CA 3UR9A 3RXMA 3SI4H 3FP8E 1L4ZA 3O8BA 1TMBH 2BD5A 4Y10E 4A92A 1FY1A 1KSNA 3V13A 1O3JA 4A1VA 4GSOA 1KLIH 1IHTH 2ZIQH 2ZQ2A 1FY4A 3PTBA 3PO1C 3P92A 5G4BA 1ZJKA 3EQ0H 1MAXA 5BPEA 1FIWA 1YPGH 1D3TB 2P3TB 3E8LA 2WPIS 1QL9A 2YNBA 3UFAA 1SGCA 2W5EA 1AY6H 1OYTH 1UJ1A 3MMGA 1DY9A 2A2QH 2SGDE 1HV7A 2C8ZB 1SGFG 1IQKA 3S7HB 2VWMA 4NWLA 1EQ9A 3A84A 3V7TA 1J16A 2OQ5A 3VB6A 3ZYDA 4BXSA 1GJ6A 2BZAA 1HFDA 1AUJA 3A8BA 2ZHFH 1PFXC 3KQDA 1QB9A 1EAUA 3RXHA 4FUCA 4TWYA 1O3EA 3A81A 1A4WH 1QJ6B 1NFUA 4DGJA 4O9VA 2GT8A 4ZKSU 1MUEB 1QURH 1C4Y2 5I46H 1AE5A 2FEQH 4GCHG 1O2IA 1GBKA 1SGRE 1UVTH 3EGKH 2FP7B 3U1JB 4B76A 1QB6A 1SLVB 3V0XA 4MPXA 2ZPSA 1GVZA 2BY7X 2FOEA 4GHQA 1XKBC 4CRDA 1TGNA 4AZ2B 2F83A 1OXGA 4D76A 1HB0B 1KXAA 2BDBA 4JZDH 5AVDA 3VXEH 3ZZ9A 2CHAC 2Z9LA 4VGCB 2J95A 2BD8A 4DIHH 1A7SA 1G32B 3LKWA 1EUFA 3MU5A 2NWNA 5PTPA 4D7GA 4IGDA 1B7XB 3FFGA 1TLDA 2OUAA 2OLGA 3QK1A 2VWLA 1H8IH 5A09A 1ETSH 1OS8A 1PYTC 3Q3KA 1FNIA 1LPKB 1K1IA 4TY6A 2AIPA 2D26C 1DWEH 5GXPA 1O2PA 4Z0KA 1YBWA 3D65E 3SZNA 3MU1A 1O2NA 3DFJA 3E16B 4IW4E 3M3TA 3M7QA 5FX5A 3R3GB 1MTNC 1WYKA 5FAHA 1P10A 3UNRA 1CT4E 3KGPA 1NU7B 1E38B 2P94A 2STBE 2VIQA 3KQBA 3U8TH 1TRMA 3GCTF 2H6MA 2VVCA 2NU4E 1ZRBA 1C1OA 1MCTA 1CHOF 4J2YB 5FCRA 2ESTE 2BHGA 2FS9A 5DG6A 1HCGA 5ESTE 4I8GA 1SB1H 1IQLA 1QRWA 3DT0H 4BXWA 1TE0A 2ULLA 1Z1IA 3UUZA 1GMDF 1BMNH 4NGAH 1GBTA 1O35A 5EW1H 4AGKA 1LHDH 1CGIE 2CXVA 1CQQA 2OBOA 3HKIB 1PPCE 1ZTKA 3M5LA 3A85A 2G8TA 5L2ZH 1HYLA 1A5GH 3OYPA 4BAQB 4MPUA 2WPLS 2Z9KA 1OWDA 3GDVA 2TRMA 2QV1A 2XC0A 4JYVH 2P8OC 2QAAA 1T8MA 2BXUH 1TGSZ 2ZU5A 2XTTB 1HUTH 3O8CA 1O2XA 4MPVA 3OSYA 4Y7BA 1O5DH 5EU8A 5LPEA 1C2HA 3SNCA 1SGTA 1A3BH 2LNCA 3U8RH 1BJVA 3H7OA 5DP9A 2VWNA 2STAE 4DCDA 1SGYE 1S85A 2QXIA 1WBGB 3SGQE 1ETRH 2Z7FE 4IMQA 1AGJA 1CT0E 1J17T 1FY3A 1NT1A 4CRBA 1TNGA 1C1NA 1GL0E 2BX3A 3NCLA 4WF8A 1OP2A 2TGTA 4JZFH 1GHAF 2XC4A 4ISOA 4DG4A 1C2JA 1O3MA 2WPJS 3ZZ8A 5T6GA 4X2WA 2QCYA 3F1SB 2WV5A 2P8OB 5FPYA 3TITA 5EPNA 4AG1A 4H4FA 4K1SA 2VIVA 3A80A 1DOJA 3BTGE 1LO6A 3PB1E 1SR5C 1BOQA 3VGCC 5TCAA 1YCPM 3KQCA 3Q76A 1N8OC 1V2TT 2C3SA 4I31A 2BXTH 2HVXA 3BV9B 4B73A 1O5BB 1DICA 2BY9X 1UTKA 4WMEA 4X1NU 3RXRA 2GDEH 1C1VH 5AF9H 2R3UA 1XUGA 3RU4T 1Y3WA 3SUGA 1P01A 3HPTB 1O3BA 1HAXB 1TBQH 4FUFA 1CGHA 4I8LA 4TY7A 1MH0A 5IYTA 3NUMA 1OP0A 2ZFPH 2FOAA 4JMYA 1UO6A 1TB6H 1BMLA 1F7ZA 1RTFB 3TK9A 6GCHF 2GVFA 2EA3A 3ENSB 1ZGVA 2GV7A 1OP8A 3SU3A 1C1MA 2A7JA 8KME2 1P57B 2GCTB 1DLKB 2BDIA 4Q7ZA 2PKAA 4AYYB 2Q6GA 2AFQB 3U98H 1P3EA 3LH3A 2J4IA 1WCZA 2Y5FA 1S6FA 1GJBB 4O97A 5GIBA 4E06H 2B8OH 2C8XB 4PROA 5F6MA 3M35A 1MZAA 1V2JT 1TNHA 3MI4A 4ISHH 1DXPA 2PGQB 1TX6A 1EOLA 1P3CA 1GHVH 3RC4A 3SNDA 1O3KA 2BVSH 3MNSA 1S5SA 3S9BA 2XRCA 5AFYH 2PUQH 4IS5A 1H9LB 2AIQA 4AN7A 1VGCC 1MU6B 2O8LA 1BTHH 1O2LA 3BG4C 3RXQA 2SGQE 5C5OA 1E34B 1HAVB 2GZ8A 4H42U 2ZF0H 3L33A 3LGUA 4MNVA 4ZXXH 1ELBA 1CA0C 3SV8A 1C1SA 2XBYA 1LDTT 2ZFSA 2AGIX 1V2LT 2R9PA 1PQ7A 4SGBE 1OSSA 2ZWLH 2HALA 1YCPH 4LOYH 2XC5A 2AS9A 3F9GA 4OS6A 1ZPBA 1L1JA 2M5TA 2XCNA 3A86A 1CGJE 1GBIA 1WAYB 1C2KA 3URDA 4OS7A 4GLYA 1T8NA 1YPKH 4Q2KA 1CBWC 2B7DH 1QA7A 1GWAA 1YM0A 1DANH 4AB9A 1PQ5A 2F9NA 1C2GA 2A7HA 1DX5M 1NRRH 5JBAS 1MD8A 1F0TA 3IG6B 3EE0B 2F91A 2ZA5A 3U1IB 2BOHB 4MPWA 1BUIA 3RLWH 3V3MA 5EOKA 1AU8A 5FBIA 1MKWH 1IOEA 1ELAA 3I29A 4X6MA 1TALA 1E37B 1BRCE 2FWWA 1EZUC 3A8CA 4AORA 1TX7A 3M3VA 1O2ZA 5E2PA 2BY5X 1CSOE 2AMDA 5CE1A 8ESTE 2UWOA 3NZIA 1MTUA 1FY8E 3RXAA 3K9XB 1KIGH 1THSH 2QN5T 1HRTH 3RUOA 1TA2A 4UE7H 2ZFFH 2H9EH 5DKMA 2A31A 3TGJE 2Z6BD 4WH8A 1O5GH 1TRYA 1XM1A 2A45B 2FLRH 1GBAA 3ATKA 3GCTG 3T25A 2Z9JA 3GYMA 3HGNA 1D3DB 1L4DA 1O34A 4GVUA 1GVLA 1TONA 3S7KB 3ZZ5A 4JYTA 1PPZA 1HAIH 3VFEA 5IDKA 1LVYA 1YC0A 3RXKA 4JYUH 4U2WA 3HGPA 3SGBE 1YLDA 2DUCA 3JZ2B 4Y6DA 3W94A 4FVDA 3B8JA 1VCWA 3BTTE 3A7XA 5CHAC 1EPTA 1A5IA 1KXBA 1SOTA 2OC8A 2PKSC 3EYDA 3Q3XA 4ZHMU 7GCHF 1N1LA 1G30B 2HPPH 2F9OA 2UUFB 2P93A 2PFEA 2VIPA 1ESBA 2BQWB 1T31A 4BOHA 1MBMA 1ETTH 1AB9C 3F68H 4DY7B 2HNTF 2HRVA 3GDUA 2GGVB 2YNAA 4Y7AA 3KL6A 1GI3A 1HLTH 3BTDE 1O3FA 3ZVEA 2SFAA 1MKWK 4NZQA 1QB1A 3RXOA 2FXRA 2Y7XA 2SGPE 1L0ZA 3PROA 5E8EH 4OS4A 2F3CE 2VIOA 1O3HA 1O30A 5DP8A 2VVUA 2G81E 3BN9A 3P95A 1UTOA 2R2WU 4KTCA 2PKSB 1DSTA 1W7GH 3ZZ4A 5E0HA 1XVOA 1EP5A 2CF8H 5DK1A 2OINA 1IAUA 3MNXA 1UVSH 1GBMA 4AFUA 1OPHB 2TGPZ 2ZFTA 3ZVAA 3ATWA 4I7YH 1QRZA 1LHFH 4BAMB 2Z94A 3U69H 4X2VA 5DGJA 2ZI2H 5EQQA 1LHEH 1MKXK 3RC6A 1S81A 4E05H 1W12U 4TPYA 1QQ4A 1SHHB 5DP6A 3ZVCA 3EDXB 4X6NA 1W14U 1EZQA 3MHWU 1NU9A 2HGTH 1O2QA 3ZZBA 1BB0B 4D9QA 4XE4A 1K9OE 1KY9A 4K8YA 2BD4A 2FESH 4YESB 1ELVA 1T8OA 5AHGH 2O8UA 1ARCA 1D9IA 4XSKU 1TPAE 1MQ6A 5TCCA 3L3TA 1P2KA 3LDXH 3ODDA 5LGOA 5C5NA 1P09A 1HAOH 2WYGA 4B2BA 1F0UA 5L6NH 4Y8ZA 4Y0YE 4BAOB 2BDGA 1C1WH 1GMHG 4ISNA 2CF9H 4AFSA 3PMHB 1V2UT 1Z71A 9ESTA 1NS3A 2W3KA 3RXGA 5J4QA 2CV3A 2Y6TA 1QJ1B 1YP9A 1OOKB 1LCYA 1O3DA 3OU0A 2VWOA 3GY7A 1QBNA 1Z1JA 1TPSA 1T8LA 1UTLM 3NXPA 3Q3YA 2H2ZA 2J94A 2PUXB 1ZMNA 3TPIZ 1XX9A 1IQEA 3H5CB 4RSPA 2TBSA 1QR3E 4F49A 2AEIH 5A0AE 1INCA 2IN2A 3UNSA 3UPEA 1JWTA 1WQSA 3SUEA 1U6QA 1BIOA 1B5GH 1FN6A 5A2MH 2FIRH 5JBTA 1A0HB 1QQUA 2H9HA 1C5LH 2GCHF 5CMXH 3VB3A 1MTSA 2A5KA 1HNEE 2GZ7A 4DIIH 4UONA 4NA7A 3MH4A 3MOCA 4IMZA 2BLQA 4VGCC 2NU2E 3ATMA 1TMTH 1A61H 3RXIA 4X1QU 4YTAA 4AFQA 3BTFE 1A46H 2ZDAH 2O9QA 2A4GA 1O2VA 1UK4A 1AVWA 1O39A 1SLXB 4SGAE 1JIMA 4D7FA 1GCTB 1C5WB 1GVKB 3O8RA 1GBCA 1Q3XA 1O5EH 2FPZA 1AVGH 3KHVA 3ZZ7A 1SQAA 3M5NA 1XUJA 5A8ZA 3GY8A 5F8ZA 2RCEA 2EI7A 3F9HA 5A8YA 3SGAE 3WY8A 4X6PA 2P95A 2BTCE 1JOUB 1DPOA 5C20A 4X1SU 2FTMA 1AIXH 3P8GA 1HJ9A 1DY8A 1KTTB 1SFQB 1OWIA 3AAUA 1QCPA 1Y5BT 1GI7B 1W0ZU 2VIDA 2P3UB 2B0FA 3LC3A 1MU8B 3RXPA 1AKSA 3BEFB 3E6PH 5JB8S 4INHA 4BANB 2Y5GA 3STIA 1MD7A 4B74A 4ESTE 4I8JA 1GJ8B 1GJAB 3DD2H 1OWHA 1T4UH 4CRFA 1EB2A 1C1QA 5GJ4B 1QIXB 4GPGA 4TPIZ 1RTLA 1O3IA 1AZZA 2RG3A 3SORA 1O3NA 1C2MA 1UVOA 2FO9A 1OWKA 3ATLA 1GBJA 1FONA 1HAYB 1A0LA 3D49H 1FY5A 3UTUH 3P8FA 1QHRB 1XKAC 2W7UA 1DDJA 1H1BA 3GCHC 1GI6A 2J2UA 2SNVA 5JBCS 3E0NB 1GGDB 3F6UH 1W2KH 8GCHG 1AI8H 1P06A 2J92A 4ABJA 2VH6A 1O38A 1KXCA 3LT3A 1SGFA 3LGWA 1F0RA 1RS0A 2FOCA 4X8SH 3BIVH 2GDDA 2B9LA 3KIDU 3TH3H 2BDCA 2HPQH 4F4OC 3SW2B 4ZHLU 1A5HA 1XVMA 1LHGH 4U01A 4YZUA 3M36A 3K65B 2J34A 5K0HA 5HMAA 2G5NA 1HAHH 1YKTA 3SNAA 2D8WA 2VGCB 3A7TA 1Y3YA 1ARBA 1KDQB 1NRNH 2GTBA 3SUDA 3GCHB 3GYLB 3G01A 2DE9A 2V0BA 4KELA 1IQGA 1O2SA 4WXVA 1S82A 2A32A 1Z7KA 3QDZB 1J9CH 1SQOA 5GCHF 2QC2A 1W11U 3LPRA 1KDQA 1P12E 1ZPZA 1EXFA 2A4OA 1UTPA 3L6PA 2GKVE 3P8OA 4HGCA 4YT6H 4CREA 1Y59T 2F9VA 1M9UA 4K1EA 3OY5U 1UTMA 2ZFQH 2WPHS 3GCOA 3PMBB 1GHBF 1E36B 4Y8XA 1JXPA 1LVBA 1GJDB 1O37A 4I8HA 1V3XA 1SGNE 1SVPA 2EEKA 4CR5A 1ZTJA 5LPFA 1ZTLA 2V6NA 4A6LA 5A8XA 3UNQA 1H4WA 1KLJH 4IN2A 1WSSH 2ZCKP 3GCNA 3KEEA 2ZDVH 2AGEX 1J8AA 3T27A 1S6HA 2GMTB 1E35B 5TJXA 1AFEH 1C2FA
chains in the Genus database with same CATH superfamily
4ZKOU 4F48B 4XOJA 1YY3A 3H7TA 3KN2A 3SV6A 5E0GA 3P17H 3RXTA 1KTSB 1EOJA 2BD2A 4UFFH 3MNBA 2QXGA 1OWJA 1GBHA 2GCTC 1XUHA 3FZZA 1ELGA 2OXSA 4ABAA 2R0KA 4K2YA 1HBTH 4D9RA 1F92A 3UR6A 3SO3A 3LJOA 1GHXH 3OTPA 1A0JA 4ZHAA 3MWIU 4K1TA 1N6YA 1K2I1 1VJAU 3QTVH 1ID5H 1TBRH 1B0FA 3ZVDA 1LTOA 1GJCB 1ZR0A 5EODA 3QZRA 1CU1A 1ZSJA 2GZ9A 3NK8A 4AOQA 1BMFD 1Y5UT 3HK3B 1DITH 2BDYA 1H8DH 3RXVA 4Z6AH 4K60A 2PKAB 1BT7A 1JRTA 5C17A 3FO8D 1GBEA 2DE8A 2ZTXA 2A0QB 1VITF 5GDSH 4FUBA 1GDQA 1J14A 1DVAH 2FM2A 3TJUA 1ZHMA 1UHBB 1LPZB 1P2NA 4UDWH 4Q7XA 5B6OA 1GBLA 2JH5D 4DURA 2ZCLP 2O8WA 1GL1A 1N6XA 4ABBA 3NRLA 3E3TA 3KQEA 1C5UA 3LH1A 2OBQA 2IOTA 4O3TA 2XOKD 5AFZH 1TIOA 3NWUA 2C93B 1UHBA 1O3CA 3QGJA 4YLQH 3QLPH 3MO6A 2WINI 3T28A 1O2WA 1Z8GA 1YPJH 2PSXA 3A82A 2WUCA 3I77A 1C5NH 1TYNA 2ILNA 1TPOA 2AH4X 4RKJB 1W0YH 3KYGA 1DUEA 1V2RT 4JZIA 2FYQA 3N7OA 2ZCHP 2AMQA 1QTFA 5C67A 2XW9A 2PHBA 1FUJA 3TVJB 1TNIA 1D3PB 1EZSC 4INKA 2OQUA 2G5VA 1BITA 3BSQA 2GCHG 2EC9H 3SBKA 1A1RA 1VJ9U 1TPPA 3BEUA 3GY5A 3UIRA 1C2DA 4I8KA 1HJAB 4X1RU 4Q80A 4OS5A 2YMSD 5HYOA 1FXYA 3OE7D 2HVYB 1SSXA 1ZPCA 3LONA 4A5TS 1XXDA 4BTUB 4ACAA 4B71A 2R3YA 2WSSD 2F9PA 4AC9A 5BRRE 1XXFA 3PLBA 1TA6A 1Z6EA 2FODA 1FDPA 1F5KU 4YOJA 4AX9H 1QRXA 2ZNKH 5JPMH 1DWBH 4B75A 1IHSH 2GD4B 4MNWA 1NPMA 1C5OH 1HXFH 3NPSA 4E7RG 2G4TA 4X2YA 2O8TA 2FTLE 4ZAEA 3A87A 3M3SA 1ZSKA 4GCHF 3RDZA 1ZLRA 2PLXA 3UWIA 3LGVA 1VITH 1FAXA 1EKBB 2Y5HA 1BRBE 1AWFH 2RDEA 1LKBA 2IPHA 1NRQH 1DT2A 1C9TA 4K5ZA 1G36A 1RD3B 3BTKE 3PYHA 2L74A 2Q1JA 3ITIA 5DP4A 3UAIC 2BQ6B 3DSPA 4DT7B 1TABE 1O5CB 2ANWA 1H9HE 1SMFE 1ELCA 3F2HA 2P59A 4IC6A 5EJLA 3T26A 1F5LA 5E2OA 1AFQB 2H1UA 1P8VC 4B1TA 3UWJH 1ZSLA 4FU8A 4K8BA 1DS2E 4AFZA 3DA9B 2G00A 1GDUA 2PV9B 4XBCA 2RA3A 3LGIA 2KAIA 2KFWA 4CH8B 1UK2A 4X8UH 6CHAB 3SJ9A 3BF6H 2F43B 2VIWA 4CBOA 1V2KT 3LGTA 3ATIA 1RFNA 4NIYA 4Y8YA 3QX5H 1BRUP 2CN0H 3DHKH 5HIZA 4AGJA 1GMCF 1SLUB 1RRKA 1GJ9B 1HAPH 1FJSA 4MDSA 2ZGJA 3MO3A 1Q31A 4CR9A 1EPTB 1C5PA 1F2SE 2A4QA 2FI3E 4E7NA 4RKOB 1HAGE 1CHOG 4R8TB 3A8AA 1V2QT 3P8NA 4R0IA 1MKXH 2BZ6H 3MU0A 1C5YB 2NU3E 3ZV9A 3C27B 1O2OA 1RGQA 5L30H 1W8BH 3AAVA 3OFND 3PM3A 5SGAE 1ANEA 1GJ5H 1ACBE 1KXEA 2JKHA 3Q77A 1BTWA 1GMDG 1RIWB 4CRAA 2XNIA 4FUHA 1D6RA 2OC7A 4H6TA 2ANKH 2ZU2A 2ZU3A 3RMNH 2ZPQA 4KTSA 2Z9GA 1C2EA 1IQFA 1YPLH 1EATA 1TGTA 2ZGBH 3QWCH 3PWBA 1NTPA 2R0LA 1SGIB 3SJ8A 3RLYH 2H5DA 2NU1E 4FXGH 2QGRA 3SU4A 2UUYA 2WV9A 8LPRA 2HNTE 3GOVB 2XWAA 3BTEE 1DLEA 2ANYA 2BOKA 4RN6A 1IQHA 1PPFE 2BLWA 2UWPA 1FPHH 1THPB 3E1XB 3SJIA 1O2GH 5JBBS 4CRCA 1V2NT 3PLKA 1HIAA 3VEQB 2SGFE 1SBWA 1ANDA 2FLBH 4UFGH 1UCYH 1EAIA 1ZMJA 1GHBG 2BD3A 4P02A 4XRNA 1QFKH 1ELFA 4P00A 1TNKA 3AASA 5EPYA 5E0JA 2ZTZA 4WXIA 4ASHA 1GHAG 1ANCA 1YLCA 5EQRA 3U8OH 2V3HH 2FI4E 3GY4A 3ODFA 3UREA 2V3OH 4XFQA 2HOBA 1LHCH 3RXBA 5JDUB 3RM0H 3FAOA 3K6YA 1ELEE 5JB9S 2ANMH 3RXDA 4YO9A 1O33A 2D1JA 3ELAH 4YM9A 3SJKA 4ASUD 2BY8X 4I33A 3RP2A 1UW7A 2ZHDA 1VCQA 2ZFRH 5HM2A 3SU1A 2V7QD 5ETXA 4UFEH 3URCA 1SGDE 1D3QB 3MH6A 1BMAA 2OTVA 3MH5A 4FUDA 3N7DA 4YXWD 3BIUH 3A89A 3SQEE 4NFFA 2QF3A 2A5IA 1HDTH 2ALVA 1GCDA 4OS2A 1ZHPA 5T6DA 2GT7A 1H9IE 1AO5A 2C8YB 2TPIZ 3CS7A 2PW8H 4WY3A 5T3HA 1UMAH 1GBBA 3PLPA 4MTBA 4CHAB 3TNSA 3QGNB 1AUTC 4AYVB 2QYIA 3RXJA 2BQ7B 2PR3A 3DSOA 3LC5A 6GCHG 2IPQX 3E90B 1FZZA 1P2JA 2AMPA 2ZHWH 5F8TA 3RMOH 1C5TA 3FKSD 3P70B 1BQYA 1AVXA 2JETB 3SI3H 2ZZUH 5EXNA 5A0CA 1P03A 1OX1A 1W13U 2Y80A 2Y81A 1AD8H 4ZKNU 1KYNA 2HLCA 4M7GA 3B9FH 1ANBA 1UCYK 4X6OA 3RC5A 4DJZB 4I32A 4JZEH 1S84A 3M5OA 4WMFA 2ODPA 2C8WB 5T6FA 2LP6A 1YGCH 4FUEA 1PYTD 1TAWA 4NSVA 3TNTA 3P6ZB 2AERH 1O32A 2SGAA 1O3GA 1W7XH 3B23B 3ZVBA 1C2IA 4K69A 3SU2A 2ZP0H 1GCTC 3HKJB 2ZDMA 2ZTYA 1EJMA 4MQAA 5C1YA 3SNBA 5FX6A 4MNXA 2HWLB 3FZDA 3SOSA 1KLTA 1O5FH 6LPRA 1V2VT 2R2MB 4Q7YA 4O03A 1C5MD 2FI5E 1ZHRA 1GHYH 4Y76A 3ZYEA 4DW2U 2XXLA 1YPEH 1NESE 3E0PB 3BTQE 4DVAU 4ZMAH 1V2ST 3BG8A 5CHBA 5JYIA 2ZHEH 2JH6D 3QO6A 3AW1A 4X8TH 2ZKSA 1AZ8A 3FOAA 1SGPE 3RXUA 1BBRK 3TIUA 4ZKRU 4MLFB 5EG4A 5A0BA 1GDNA 3M61U 4LXBH 2PGBB 1Y5AT 1CVWH 1P2OA 3I78A 5F03A 2NU0E 1YYY1 1YPHE 2WV4A 3UQVA 1CHGA 3EA9A 4XDEA 1FMGA 1V2OT 3T29A 1BA8B 1FV9A 2Y82A 1ABIH 1TNJA 3RM2H 3SUFA 1AKSB 1TGCA 4HTCH 2FOHA 2ZGCA 3MU4A 1SL3A 1A3EH 3S69A 3PO1B 1NFXA 1L1GA 2P16A 4QT8C 3PMAB 4CBNA 4FETA 4Y11E 1P11E 3S0NA 2XBVA 1A2CH 2TIOA 3FVFB 2G52A 1Y8TA 3T2NA 1G3CA 1GGDC 1O3OA 3FP7E 5F8XA 2CJIA 3SHCH 3EAJA 1ZRKA 5DO4H 3QUMP 5LH8A 4WMDA 1VCPA 1VKYA 2F9BH 2G55A 3UOPA 4X2XA 3ZZ3A 1GHZA 5FBEA 1UTQA 4KTUA 3ZZCA 1ZMLA 3AVZA 1Y3VA 2ZEBA 2ZDNA 2JH0D 4NA8A 1WXRA 4DT4A 1JRSA 1P02A 1NM6A 1GBFA 3TH4H 1WU1A 4NIVA 2Q6DA 3K2UA 3ZZAA 1L1NA 3QZQA 1TX8A 3DUXH 5C1UA 2W26A 2OP9A 3T5FH 2ZECA 1QA0A 3QTOH 1HXEH 2VGCC 3SHAH 1F5RA 1K1NA 2Z3EA 4UEHH 3JZ1B 2A1DB 1Z8RA 2BY6X 2RA0A 3RU4D 3PV5A 1DXWA 1Y3UA 1G37A 1KXDA 1BMMH 2ZDKA 1S0QA 5ESBA 4YOIA 3EA7A 4ABEA 1ESAA 4X1PU 6ESTA 1IQNA 2QY0B 1GMCG 1AWHB 1V6DA 5T1VA 3RMLH 1MQ5A 2FOBA 4NSYA 4XD7D 3VPKA 1ZJDA 3RMMH 7ESTE 2FOMB 4GAWA 1O2KA 1BRAA 2AHME 1SC8U 4A7IB 1LQEA 1C1TA 2CHAB 2ZC9H 2EI6A 2I6QA 3SJOA 1O3AA 1P2QA 2SGEE 2FX6A 1PPBH 1YF4A 2J97A 4X0WU 3BTHE 1O2RA 1TGBA 1GI1A 2ZU1A 3UY9A 4YLUA 3RXLA 1UVUH 7GCHG 2ALPA 2QA9E 1BCUH 2F9UA 2BB4A 3IWMA 3FANA 1W3CA 1FLEE 1DSUA 2GMTC 4LK4A 1NBMD 4ZXYH 1T7CA 4LZ1H 2Y7ZA 1WTHD 1BTPA 1GI8B 2OCVB 3FP6E 3RXEA 1WQVH 2K1QA 2XBXA 1MTNB 4WVPE 4A1XA 4O3UA 2FZZA 2OC0A 3R0FA 1QGFA 4LZ4B 2ODQA 3SQHE 1ESTA 1XMNB 3TK5A 2V35A 1G2MA 4NWKA 4NIXA 1P9SA 1LVOA 4FVBA 4Y0ZE 1Y3XA 1SPJA 2ODYB 1QBOA 2VB0A 3F0PA 1EX3A 1FQ3A 5HM9A 4BTIB 2FOGA 1WTGH 4NG9H 1P9UA 1G3BA 1C5SA 2ZG0H 2HNTC 1P2IA 1K1JA 1RXPA 4MVNA 3T62A 2VJ1A 5HXFA 1K28D 3OAAD 2I6SA 1NZQH 1O2HA 2PTNA 1NFYA 1RJXB 1ABJH 2BLVA 4NIWA 4OS1A 3KCGH 4CRGA 1C2LA 1TWXB 1TQ7B 1K1LA 4ABIA 1C5QA 1SGEE 1PQ8A 1P0SH 5I25A 2BD9A 1CO7E 4JK6A 3AW0A 5EXLA 1OHHD 1BDAA 3Q00A 2TGDA 4INLA 3U9AH 1ZGIA 1OWEA 4GUXA 2YOLA 1SFIA 1IQIA 1KXFA 1GI2A 4HI3A 1BTYA 4U30A 1SI5H 3PTNA 1H8HD 1SQRA 1UK3A 2PSYA 2OC1A 4FU9A 2FS8A 1DWCH 4WWYA 4CH2B 3M5MA 1QL7A 5H4IB 1SG8B 1K0HA 3NKKA 2UWLA 3A7YA 4RT1A 2WPKS 3SU5A 1H8ED 1SQTA 3O8DA 1O3LA 3S9AA 1EJNA 1O0DH 3D62A 4Y71A 2BX4A 1THRH 1Z6JH 1HPGA 1SKYE 1O2YA 3DCLA 4D8NA 1LVMA 1C1RA 1NRPH 3PMJA 3F3BA 1G3DA 3WWFA 1BJUA 1C4U2 2PTCE 1TFXA 1BTZA 2A4RA 2XNDD 3ZZDA 3D23A 1HJAC 2BVRH 3CP7A 5DSFA 1BHXB 4BNRA 1XUKA 1Q2WA 3TGKE 4ZUHA 4YT7H 4JZ1A 3GY6A 3VGCB 3GICB 3RXCA 1MBQA 5LPRA 4IBLH 2LPRA 4H6SB 3VB7A 1GMHF 1QY6A 1N8OB 2OD3B 5FCKA 1OYQA 4KP0A 1AQ7A 2UUJB 4UFDH 3A88A 3VB4A 1MTWA 3QN7A 1P04A 3LJJA 2VNTA 3E91A 3MQKC 2BDAA 4TWWA 2EI8A 3ZVFA 1K1PA 1FI8A 1MMJN 3S9CA 4WJG2 2ZU4A 1V2MT 2VU8E 5FXLA 1CE5A 1MZDA 2CGAA 1O5AB 4AB8A 3GY3A 3KF2A 1ZOMA 1K22H 5HGGA 2ZO3H 3TU7H 3LIWA 2G4UA 4BAHB 5KGOA 1BTUA 5DP7A 4ABDA 1DUAA 3SNEA 1GPZA 2ZPRA 3ZV8A 1K1OA 2Q6FA 1PQAA 2OK5A 3W95A 4MNYA 4ZROA 1SLWB 1TBZH 1PPEE 4UD9H 1GG6C 4ISIH 1D4PB 4K3JA 4Y79A 3LGYA 5CDFE 5ABWA 3MNCA 1NROH 1V2WT 4TYDA 2Z3CA 1QL8A 2UUKB 4X8VH 1LMWB 3TH2H 2QF4A 1DWDH 2VBCA 2O8MA 1AFQC 4GHTA 4NA9H 2ZGXH 2B5TB 3C1KA 1TOMH 1NN6A 4OGYA 4XBDA 2RFKC 1OKXA 2W6JD 1BTXA 3PWCA 2RDLA 2FOFA 3F9EA 1EJAA 3RXSA 4IN1A 3UOUA 2VVVA 6CHAC 2AGGX 1EAWA 1D6WA 2XBWA 2QIQA 1G2LA 1NRSH 3LOXA 3OY6U 5EQSA 3V12A 5C1XA 1X7AC 2WZQA 3CNRA 1CT2E 1C1PA 4HFPB 1HAVA 3STJA 1F0SA 3KNXA 1EB1H 2BLOA 1YPHC 2GP9B 3SV9A 1C5ZB 4ABGA 1GG6B 2KAIB 3TJNA 1IQJA 3A8DA 4AG2A 1SHYA 1EPTC 4BAKB 1IQMA 1XUFA 1SOZA 1TOCB 3MYWA 2QF5A 1VGCB 1AE8H 3MH7A 2QF0A 4WH6A 7LPRA 3BG4B 4U32A 1WV7H 4XBBA 1UCYE 1C4V2 1FAKH 3UQOA 1PPGE 4MG3A 2P3FH 2CMYA 1AN1E 1CA0B 1QJ7B 1S0RA 1S83A 1Z8IB 2FMJA 3LU9B 4HZHA 5EGMA 1O2TA 1RIWC 3ZVGA 1P05A 2BM2A 4DOQA 3BTWE 1O3PB 4NZLA 3BTME 4ZCNA 1EZXC 1TNLA 4KKDA 3A7ZA 1C5XB 1TQ0B 3OEHD 1ELTA 1XUIA 2THFB 3PV4A 1G3EA 3GY2A 3F9FA 4M9FA 2QXJA 3WW7A 1V2PT 4A1TA 2F4LA 3RXFA 1T32A 1AMHA 1UTNA 1K1MA 1CBWB 4FUGA 3VB5A 3MFJA 1YPMH 2D2DA 4I86A 5DJ7A 1GI4A 1UTJA 8GCHF 1NY22 4J1YA 1O2UA 1RTKA 2Z9IA 2YMSC 3A7VA 1BBRE 5EXMA 7KMEH 5L2YH 2KCYA 2WYJA 1TMUH 3SU0A 2XWBI 1EP6A 1O2MA 2ZQ1A 1NFWA 2SNWA 4B2AA 1W10U 2V3MA 1HGTH 3SU6A 1YCPK 1C5VA 9LPRA 1JIRA 3M37A 5DP5A 1C5RA 2XYAA 2J98B 2WPMS 5DP3A 2W3IA 2QXHA 2FDAA 2J9NA 1HIAB 1VR1H 1GHWH 4NFEA 1C9PA 1O36A 3TK6A 1C1UH 5GCHG 3IITA 3A7WA 1GI9B 3SN8A 1JMOH 1PPHE 2C4FH 3M7TA 2J98A 2A2XH 2HLDD 2YMSB 3A83A 4FUJA 1EAXA 4JCNA 1GBDA 1L2EA 1GI0A 5C2ZA 1HJ8A 2FYRA 1HAZB 2Z3DA 4ABFA 1MCVA 4KGAA 1ZZZA 1LQDB 3GISB 5FHTA 1NC6A 3CENA 5FL7D 3RU4E 5GWZA 3SV2H 3BEIB 3K6ZA 1BHXF 3OTJE 2TGAA 4ISLA 4BTTB 3OX7U 1WUNH 3MTYA 2VH0A 1FPCH 4YOGA 3TJOA 2BMGB 4IC5A 1ORFA 4B2CA 1DM4B 3TJVA 1B0EA 2ZDLA 2FX4A 5CHAB 4CHAC 5GPIB 3TLOA 1CA8B 1FN8A 1E0FD 2ZGHA 4OGXA 4ABHA 1J15A 2WUBA 5EW2H 2IJOB 1ZYOA 3TGIE 2BYAX 1GI5A 1MAYA 2XCFA 3HATH 4FU7A 1NO9H 2JETC 1T4VH 1AB9B 1G9IE 1VZQH 2BD7A 2KCPA 1DFPA 4THNH 2A5AA 5B6LA 1BBRH 2BDHA 3M7UA 1LPGB 1LKAA 1TRNA 2H9TH 1QNJA 2W7SA 2EY4C 1O2JA 2GX4A 5K7RA 2AYWA 3ZZ6A 1BZXE 2J38A 2PWXA 3ESTA 1GJ7B 3VXFH 1P2MA 2C90B 1AHTH 5DPAA 3MU8A 1ELDE 5FPSA 3GDSA 1O31A 2GJGA 2BVXH 3DFLA 1SGQE 2ZHQH 2G51A 5EJ1A 1MTVA 3SV7A 1K21H 1FIZA 1Z8JB 1VITG 3CS0A 1PJPA 3MO9A 4B6EA 3EA8A 1JBUH 3HK6B 4FUIA 2GV6A 1EASA 5J4SA 5FPTA 4JK5A 2A7CA 1WOFA 1DE7H 5C3NA 1UVPA 4NCYA 1GJ4H 1QBVH 4ZH8A 2ASUB 2VINA 2H5CA 3UR9A 3RXMA 3SI4H 3FP8E 1L4ZA 3O8BA 3PRBA 1TMBH 2BD5A 4Y10E 4A92A 1FY1A 1KSNA 3V13A 1O3JA 3PV2A 4A1VA 4GSOA 1KLIH 1IHTH 2ZIQH 2ZQ2A 1FY4A 4B6FA 3PTBA 3PO1C 3P92A 5G4BA 1ZJKA 3EQ0H 1MAXA 5C0TA 5BPEA 1FIWA 1YPGH 1D3TB 2P3TB 3E8LA 2WPIS 1QL9A 2YNBA 3UFAA 1SGCA 2W5EA 3SYJA 1AY6H 1OYTH 1UJ1A 3MMGA 1DY9A 2A2QH 2SGDE 1HV7A 2C8ZB 1SGFG 5F53A 1IQKA 3S7HB 2VWMA 4NWLA 1EQ9A 3A84A 3V7TA 1J16A 2OQ5A 3VB6A 3ZYDA 4BXSA 1GJ6A 5HKKD 2BZAA 1HFDA 1AUJA 3A8BA 2ZHFH 1PFXC 3KQDA 1QB9A 1EAUA 3RXHA 4FUCA 4TWYA 1O3EA 3A81A 1A4WH 2WHXA 1QJ6B 1NFUA 4DGJA 4O9VA 2GT8A 4ZKSU 1MUEB 5KEDA 1QURH 1C4Y2 5I46H 1AE5A 2FEQH 4GCHG 1O2IA 1GBKA 1SGRE 1UVTH 3EGKH 2FP7B 3U1JB 4FOUC 4B76A 1QB6A 1SLVB 3V0XA 4MPXA 2ZPSA 1GVZA 2BY7X 2FOEA 4GHQA 1XKBC 4CRDA 1TGNA 4AZ2B 2F83A 1OXGA 4D76A 1HB0B 1KXAA 2KZ4A 2BDBA 4JZDH 5AVDA 3VXEH 3ZZ9A 5EJZA 2CHAC 2Z9LA 4VGCB 2J95A 2BD8A 1E1QD 4DIHH 1A7SA 1G32B 3LKWA 1EUFA 3MU5A 2NWNA 5PTPA 4D7GA 4IGDA 1B7XB 3FFGA 1TLDA 2OUAA 2OLGA 3QK1A 2VWLA 1H8IH 5A09A 1ETSH 1OS8A 1PYTC 3Q3KA 1FNIA 1LPKB 2KX4A 1K1IA 4TY6A 2AIPA 2D26C 1DWEH 5GXPA 1O2PA 2PP6A 4Z0KA 1YBWA 3WWBA 3D65E 3SZNA 3MU1A 1O2NA 3DFJA 3E16B 4IW4E 2CK3D 3M3TA 3M7QA 5FX5A 3R3GB 1MTNC 1WYKA 2K0QA 5FAHA 1P10A 3UNRA 1CT4E 3KGPA 1NU7B 1E38B 2P94A 2STBE 2VIQA 3KQBA 3U8TH 1TRMA 3GCTF 2H6MA 2VVCA 2NU4E 1ZRBA 1C1OA 1MCTA 1CHOF 4J2YB 5FCRA 2ESTE 2BHGA 2FS9A 5DG6A 1HCGA 5ESTE 4I8GA 1SB1H 1IQLA 1QRWA 3DT0H 4BXWA 1TE0A 2ULLA 1Z1IA 3UUZA 1GMDF 5C0UA 1BMNH 4NGAH 1GBTA 1O35A 5EW1H 4AGKA 1LHDH 1CGIE 2CXVA 1CQQA 2OBOA 3HKIB 1PPCE 1ZTKA 3M5LA 3A85A 2G8TA 5L2ZH 1HYLA 1A5GH 3OYPA 4BAQB 5IK2D 1YLNA 4MPUA 2WPLS 2Z9KA 1OWDA 3GDVA 2TRMA 2QV1A 2XC0A 4JYVH 2P8OC 2QAAA 1T8MA 2BXUH 1TGSZ 4TT3D 2ZU5A 2XTTB 1HUTH 3O8CA 1O2XA 4MPVA 3OSYA 4Y7BA 1O5DH 5EU8A 5LPEA 1C2HA 3SNCA 1SGTA 1A3BH 2LNCA 3U8RH 1BJVA 3H7OA 4HG6A 5DP9A 2VWNA 4Q4LA 2STAE 4DCDA 3U28C 1SGYE 1S85A 2QXIA 1WBGB 3SGQE 1ETRH 2Z7FE 4IMQA 1AGJA 1CT0E 1J17T 1FY3A 1NT1A 4CRBA 1TNGA 1C1NA 1GL0E 2BX3A 3NCLA 4WF8A 1OP2A 2TGTA 4JZFH 1GHAF 2XC4A 4ISOA 4DG4A 1C2JA 1O3MA 2WPJS 3PRDA 3ZZ8A 5T6GA 4X2WA 2QCYA 3F1SB 2WV5A 2P8OB 5FPYA 3TITA 5EPNA 4AG1A 3UB0A 4H4FA 4K1SA 2VIVA 3A80A 1DOJA 3BTGE 1LO6A 3PB1E 1SR5C 1BOQA 3VGCC 3GS9A 5TCAA 1YCPM 3KQCA 3Q76A 1N8OC 1V2TT 2C3SA 4I31A 2BXTH 2HVXA 3BV9B 1KMHB 4B73A 1O5BB 1DICA 3F2GA 2BY9X 1UTKA 4WMEA 4X1NU 3RXRA 2GDEH 1C1VH 5AF9H 2WPDD 2R3UA 1XUGA 3RU4T 1Y3WA 3SUGA 1P01A 3HPTB 1O3BA 1HAXB 1TBQH 4FUFA 1CGHA 4I8LA 4TY7A 1FX0B 1MH0A 5IYTA 3NUMA 1OP0A 4RT0A 2ZFPH 2FOAA 4JMYA 1UO6A 1TB6H 1BMLA 1F7ZA 1RTFB 3TK9A 6GCHF 2GVFA 2EA3A 3ENSB 1ZGVA 2GV7A 1OP8A 3SU3A 3ZIAD 1C1MA 2A7JA 8KME2 1P57B 2GCTB 1DLKB 2BDIA 4Q7ZA 3OEED 4Q63A 2PKAA 4AYYB 2IJD1 2Q6GA 2AFQB 3U98H 1P3EA 3LH3A 2J4IA 3KYFA 1WCZA 2Y5FA 1S6FA 1GJBB 4O97A 5GIBA 4E06H 2B8OH 2C8XB 4PROA 5F6MA 3M35A 1MZAA 1V2JT 1TNHA 3MI4A 4ISHH 1DXPA 2PGQB 1TX6A 1EOLA 1P3CA 1GHVH 3RC4A 3SNDA 4RI0A 1O3KA 2BVSH 3MNSA 1S5SA 4OM9A 3S9BA 2XRCA 5AFYH 2PUQH 4IS5A 1H9LB 2AIQA 4AN7A 1VGCC 1MU6B 2O8LA 1BTHH 1O2LA 3BG4C 3RXQA 2SGQE 5C5OA 1E34B 1HAVB 2GZ8A 4H42U 2ZF0H 3L33A 3LGUA 4MNVA 4TSFD 4ZXXH 1ELBA 1CA0C 3SV8A 1C1SA 2XBYA 1LDTT 2ZFSA 2AGIX 1V2LT 2R9PA 1PQ7A 4SGBE 1OSSA 2ZWLH 2HALA 1YCPH 4LOYH 2XC5A 3H09A 2AS9A 3F9GA 4OS6A 1ZPBA 1L1JA 2M5TA 2XCNA 3A86A 1CGJE 1GBIA 1WAYB 1C2KA 3URDA 4OS7A 5DN6D 4GLYA 1T8NA 1YPKH 2JDID 4Q2KA 1CBWC 3KQ5A 2B7DH 1QA7A 1GWAA 1YM0A 1DANH 4AB9A 1PQ5A 2F9NA 1C2GA 2A7HA 1DX5M 1NRRH 5JBAS 1MD8A 1F0TA 3IG6B 3EE0B 2F91A 1YWUA 2ZA5A 3U1IB 2BOHB 4MPWA 1BUIA 3RLWH 3V3MA 5EOKA 1AU8A 5FBIA 1MKWH 1IOEA 1ELAA 3I29A 4X6MA 1TALA 1E37B 1BRCE 2FWWA 1EZUC 3A8CA 4AORA 1TX7A 3M3VA 1O2ZA 5E2PA 2BY5X 1CSOE 2AMDA 5CE1A 8ESTE 2UWOA 3NZIA 1MTUA 1FY8E 3RXAA 3K9XB 1KIGH 1THSH 2QN5T 1HRTH 3RUOA 1TA2A 4UE7H 2ZFFH 2H9EH 5DKMA 2A31A 2KM0A 3TGJE 2Z6BD 4WH8A 1O5GH 1TRYA 1XM1A 2A45B 2FLRH 1GBAA 2KCOA 3ATKA 3GCTG 3T25A 2Z9JA 3GYMA 3HGNA 1D3DB 1L4DA 1O34A 4GVUA 1GVLA 1TONA 3S7KB 3ZZ5A 4JYTA 1PPZA 1HAIH 3VFEA 5IDKA 1LVYA 2M2AA 1YC0A 3RXKA 4JYUH 4U2WA 3HGPA 3SGBE 1YLDA 2DUCA 3JZ2B 5KECA 4Y6DA 3W94A 4FVDA 3B8JA 1VCWA 3BTTE 3A7XA 2W6ID 5CHAC 1EPTA 1A5IA 1KXBA 1SOTA 2OC8A 4ACBA 3FN8A 2PKSC 3EYDA 3Q3XA 4ZHMU 7GCHF 1N1LA 1G30B 2HPPH 2F9OA 2UUFB 2P93A 2PFEA 2VIPA 2J5UA 1ESBA 2JIZD 2BQWB 1T31A 4BOHA 4Z1MD 1MBMA 1ETTH 1AB9C 3F68H 4DY7B 2HNTF 2HRVA 3GDUA 2GGVB 2YNAA 4Y7AA 3KL6A 1GI3A 1HLTH 3SZEA 3BTDE 1O3FA 3ZVEA 2SFAA 3AK5A 1MKWK 4NZQA 1QB1A 3RXOA 2FXRA 2Y7XA 2SGPE 1L0ZA 3PROA 2JJ1D 5E8EH 4OS4A 2F3CE 2VIOA 1O3HA 5C94A 2KR7A 1O30A 5DP8A 2VVUA 2G81E 3BN9A 3P95A 1UTOA 2R2WU 4KTCA 2PKSB 1DSTA 1W7GH 3ZZ4A 5E0HA 1XVOA 1EP5A 2CF8H 5DK1A 2OINA 1IAUA 3EE7A 3MNXA 1UVSH 1GBMA 2QE7D 4AFUA 1OPHB 2TGPZ 1COWD 2ZFTA 3ZVAA 3ATWA 4I7YH 1QRZA 1LHFH 4BAMB 2Z94A 3N99A 3U69H 4X2VA 5DGJA 2ZI2H 5EQQA 1LHEH 1MKXK 3RC6A 1S81A 4E05H 1NBME 1W12U 4TPYA 1QQ4A 1SHHB 5DP6A 3ZVCA 2JJ2D 3EDXB 4X6NA 1W14U 1EZQA 3MHWU 1NU9A 2HGTH 1S6LA 1O2QA 3ZZBA 1BB0B 4D9QA 4XE4A 4F55A 1K9OE 1KY9A 1W0JD 4K8YA 1WDIA 2BD4A 2FESH 4YESB 1ELVA 1T8OA 5AHGH 2O8UA 1ARCA 1D9IA 4XSKU 1TPAE 1MQ6A 5TCCA 3L3TA 1P2KA 3LDXH 3ODDA 5LGOA 5C5NA 1P09A 1HAOH 2WYGA 4B2BA 1F0UA 2K8IA 5L6NH 4Y8ZA 4Y0YE 4BAOB 2BDGA 1C1WH 2EQNA 1GMHG 4ISNA 2CF9H 4AFSA 3PMHB 1V2UT 1Z71A 9ESTA 1NS3A 2W3KA 5HIYA 3RXGA 5J4QA 2CV3A 2Y6TA 1QJ1B 1YP9A 1OOKB 1LCYA 1O3DA 2LELA 3OU0A 2VWOA 3GY7A 1QBNA 1Z1JA 1TPSA 1T8LA 1UTLM 3NXPA 3Q3YA 5GNDA 2H2ZA 2J94A 2KCAA 2PUXB 1ZMNA 3TPIZ 1XX9A 1IQEA 3H5CB 4RSPA 2TBSA 1QR3E 4F49A 2AEIH 5A0AE 1INCA 2IN2A 3UNSA 3UPEA 1JWTA 1WQSA 3SUEA 1U6QA 1BIOA 1B5GH 1FN6A 5A2MH 2FIRH 5JBTA 1A0HB 1QQUA 3N7EA 2H9HA 1C5LH 1MABB 2GCHF 5CMXH 3VB3A 1MTSA 2A5KA 3F0OA 1HNEE 2GZ7A 4DIIH 4UONA 4NA7A 3W1EA 3MH4A 3MOCA 4IMZA 2BLQA 2L6OA 4VGCC 2NU2E 3ATMA 1TMTH 1A61H 3RXIA 4X1QU 4YTAA 4AFQA 1W0KD 3BTFE 1A46H 2ZDAH 2O9QA 2A4GA 1O2VA 1UK4A 1AVWA 1O39A 1SLXB 4SGAE 1JIMA 4D7FA 1GCTB 1C5WB 1GVKB 3O8RA 1GBCA 1Q3XA 1O5EH 2FPZA 1AVGH 3KHVA 3ZZ7A 1SQAA 1E79D 1XUJA 3M5NA 3GY8A 5F8ZA 2RCEA 5A8ZA 2EI7A 3F9HA 5A8YA 3SGAE 3WY8A 4X6PA 2P95A 2BTCE 1JOUB 1DPOA 5C20A 4X1SU 2FTMA 1AIXH 3P8GA 1HJ9A 1DY8A 1KTTB 1SFQB 1OWIA 3AAUA 1QCPA 1Y5BT 1GI7B 1W0ZU 2VIDA 2P3UB 2B0FA 3LC3A 1MU8B 3RXPA 3F2FA 1AKSA 3BEFB 3E6PH 5JB8S 4INHA 4BANB 2Y5GA 3STIA 1MD7A 4B74A 4ESTE 4I8JA 1GJ8B 1GJAB 3DD2H 1OWHA 1T4UH 1EFRD 4CRFA 1EB2A 1C1QA 5GJ4B 1QIXB 4GPGA 4TPIZ 1RTLA 1O3IA 1AZZA 2RG3A 3SORA 1O3NA 1C2MA 1UVOA 2FO9A 1OWKA 3ATLA 1GBJA 1FONA 1HAYB 1A0LA 3D49H 1FY5A 3UTUH 3P8FA 1QHRB 1XKAC 2W7UA 1DDJA 1H1BA 3GCHC 1GI6A 2J2UA 2SNVA 5JBCS 3E0NB 1GGDB 3F6UH 1W2KH 8GCHG 1AI8H 1P06A 2J92A 4ABJA 2VH6A 1O38A 1KXCA 3LT3A 1SGFA 3LGWA 1F0RA 1RS0A 2FOCA 4X8SH 3BIVH 2GDDA 2B9LA 3KIDU 3TH3H 2BDCA 2HPQH 4F4OC 3SW2B 4ZHLU 1A5HA 1XVMA 1LHGH 4U01A 4YZUA 3M36A 3K65B 2J34A 5K0HA 5HMAA 2G5NA 1HAHH 1YKTA 3SNAA 2D8WA 2VGCB 3A7TA 1Y3YA 1ARBA 1KDQB 1NRNH 2GTBA 3SUDA 1QZ8A 3GCHB 3GYLB 3G01A 2DE9A 2V0BA 4KELA 1IQGA 1O2SA 4WXVA 1S82A 2A32A 1Z7KA 5EIYA 3QDZB 1J9CH 1SQOA 5GCHF 2QC2A 1W11U 3LPRA 1KDQA 1P12E 1ZPZA 1EXFA 2A4OA 1UTPA 3L6PA 2GKVE 3P8OA 4HGCA 4YT6H 4CREA 1Y59T 2F9VA 1M9UA 3DSGA 4K1EA 3OY5U 1UTMA 2ZFQH 2WPHS 3GCOA 3PMBB 1GHBF 1E36B 4Y8XA 1JXPA 1LVBA 1GJDB 1O37A 4I8HA 1V3XA 1SGNE 1SVPA 2EEKA 4CR5A 1ZTJA 5LPFA 1ZTLA 2V6NA 4A6LA 5A8XA 3UNQA 1E1RD 1H4WA 1KLJH 4IN2A 3VG8A 1WSSH 2ZCKP 3GCNA 3KEEA 2ZDVH 2AGEX 1J8AA 3T27A 1S6HA 2GMTB 1E35B 5TJXA 1AFEH 1C2FA
chains in the Genus database with same CATH topology
4ZKOU 4XOJA 3H7TA 3KN2A 3SV6A 5E0GA 3P17H 3RXTA 1KTSB 1EOJA 2BD2A 4UFFH 3MNBA 2QXGA 1OWJA 1GBHA 2GCTC 1XUHA 3FZZA 1ELGA 2OXSA 4ABAA 2R0KA 4K2YA 1HBTH 4D9RA 1F92A 3UR6A 3SO3A 3LJOA 1GHXH 1A0JA 4ZHAA 3MWIU 4K1TA 1N6YA 1K2I1 1VJAU 3QTVH 1ID5H 1TBRH 1B0FA 3ZVDA 1LTOA 1GJCB 1ZR0A 5EODA 3QZRA 1CU1A 1ZSJA 2GZ9A 3NK8A 4AOQA 1Y5UT 3HK3B 1DITH 2BDYA 1H8DH 3RXVA 4Z6AH 4K60A 2PKAB 1BT7A 1JRTA 1GBEA 2DE8A 2ZTXA 2A0QB 1VITF 5GDSH 4FUBA 1GDQA 1J14A 1DVAH 2FM2A 3TJUA 1ZHMA 1UHBB 1LPZB 1P2NA 4UDWH 4Q7XA 5B6OA 1GBLA 2JH5D 4DURA 2ZCLP 2O8WA 1GL1A 1N6XA 4ABBA 3E3TA 3KQEA 1C5UA 3LH1A 2OBQA 2IOTA 4O3TA 5AFZH 1TIOA 3NWUA 2C93B 1UHBA 1O3CA 3QGJA 4YLQH 3QLPH 3MO6A 2WINI 3T28A 1O2WA 1Z8GA 1YPJH 2PSXA 3A82A 2WUCA 3I77A 1C5NH 1TYNA 2ILNA 1TPOA 2AH4X 4RKJB 1W0YH 1DUEA 1V2RT 4JZIA 2FYQA 3N7OA 2ZCHP 2AMQA 1QTFA 5C67A 2XW9A 2PHBA 1FUJA 3TVJB 1TNIA 1D3PB 1EZSC 4INKA 2OQUA 2G5VA 1BITA 3BSQA 2GCHG 2EC9H 3SBKA 1A1RA 1VJ9U 1TPPA 3BEUA 3GY5A 3UIRA 1C2DA 4I8KA 1HJAB 4X1RU 4Q80A 4OS5A 5HYOA 1FXYA 1SSXA 1ZPCA 3LONA 4A5TS 1XXDA 4BTUB 4B71A 2R3YA 2F9PA 5BRRE 1XXFA 3PLBA 1TA6A 1Z6EA 2FODA 1FDPA 1F5KU 4YOJA 4AX9H 1QRXA 2ZNKH 5JPMH 1DWBH 4B75A 1IHSH 2GD4B 4MNWA 1NPMA 1C5OH 1HXFH 3NPSA 4E7RG 2G4TA 4X2YA 2O8TA 2FTLE 4ZAEA 3A87A 3M3SA 1ZSKA 4GCHF 3RDZA 1ZLRA 2PLXA 3UWIA 3LGVA 1VITH 1FAXA 1EKBB 2Y5HA 1BRBE 1AWFH 1LKBA 2IPHA 1NRQH 1DT2A 1C9TA 4K5ZA 1G36A 1RD3B 3BTKE 3PYHA 2Q1JA 3ITIA 5DP4A 4DT7B 2BQ6B 1TABE 1O5CB 2ANWA 1H9HE 1SMFE 1ELCA 2P59A 4IC6A 3T26A 1F5LA 5E2OA 1AFQB 2H1UA 1P8VC 4B1TA 3UWJH 1ZSLA 4FU8A 4K8BA 1DS2E 4AFZA 3DA9B 2G00A 1GDUA 2PV9B 4XBCA 2RA3A 3LGIA 2KAIA 4CH8B 1UK2A 4X8UH 6CHAB 3SJ9A 3BF6H 2VIWA 4CBOA 1V2KT 3LGTA 3ATIA 1RFNA 4NIYA 4Y8YA 3QX5H 1BRUP 2CN0H 3DHKH 4AGJA 1GMCF 1SLUB 1RRKA 1GJ9B 1HAPH 1FJSA 4MDSA 2ZGJA 3MO3A 1Q31A 4CR9A 1EPTB 1C5PA 1F2SE 2A4QA 2FI3E 4E7NA 4RKOB 1HAGE 1CHOG 4R8TB 3A8AA 1V2QT 3P8NA 4R0IA 1MKXH 2BZ6H 3MU0A 1C5YB 2NU3E 3ZV9A 3C27B 1O2OA 1RGQA 5L30H 1W8BH 3AAVA 3PM3A 5SGAE 1ANEA 1GJ5H 1ACBE 1KXEA 2JKHA 3Q77A 1BTWA 1GMDG 1RIWB 4CRAA 2XNIA 4FUHA 1D6RA 2OC7A 4H6TA 2ANKH 2ZU2A 2ZU3A 3RMNH 2ZPQA 4KTSA 2Z9GA 1C2EA 1IQFA 1YPLH 1EATA 1TGTA 2ZGBH 3QWCH 3PWBA 1NTPA 2R0LA 1SGIB 3SJ8A 3RLYH 2H5DA 2NU1E 4FXGH 2QGRA 3SU4A 2UUYA 8LPRA 2HNTE 3GOVB 2XWAA 3BTEE 1DLEA 2ANYA 2BOKA 4RN6A 1IQHA 1PPFE 2BLWA 2UWPA 1FPHH 1THPB 3E1XB 3SJIA 1O2GH 5JBBS 4CRCA 1V2NT 3PLKA 1HIAA 3VEQB 2SGFE 1SBWA 1ANDA 2FLBH 4UFGH 1UCYH 1EAIA 1ZMJA 1GHBG 2BD3A 1QFKH 1ELFA 1TNKA 3AASA 5EPYA 5E0JA 2ZTZA 4WXIA 4ASHA 1GHAG 1ANCA 1YLCA 5EQRA 3U8OH 2V3HH 2FI4E 3GY4A 3ODFA 3UREA 2V3OH 4XFQA 2HOBA 1LHCH 3RXBA 5JDUB 3RM0H 3FAOA 3K6YA 1ELEE 5JB9S 2ANMH 3RXDA 4YO9A 1O33A 2D1JA 3ELAH 4YM9A 3SJKA 2BY8X 4I33A 3RP2A 2ZHDA 1VCQA 2ZFRH 5HM2A 3SU1A 5ETXA 4UFEH 3URCA 1SGDE 1D3QB 3MH6A 1BMAA 2OTVA 3MH5A 4FUDA 3BIUH 3A89A 3SQEE 4NFFA 2QF3A 2A5IA 1HDTH 2ALVA 1GCDA 4OS2A 1ZHPA 5T6DA 2GT7A 1H9IE 1AO5A 2C8YB 2TPIZ 3CS7A 2PW8H 4WY3A 5T3HA 1UMAH 1GBBA 3PLPA 4MTBA 4CHAB 3TNSA 3QGNB 1AUTC 4AYVB 2QYIA 3RXJA 2BQ7B 2PR3A 3LC5A 6GCHG 3E90B 1FZZA 1P2JA 2AMPA 2ZHWH 5F8TA 3RMOH 1C5TA 3P70B 1BQYA 1AVXA 2JETB 3SI3H 2ZZUH 5EXNA 5A0CA 1P03A 1OX1A 1W13U 2Y80A 2Y81A 1AD8H 4ZKNU 1KYNA 2HLCA 4M7GA 3B9FH 1ANBA 1UCYK 4X6OA 3RC5A 4DJZB 4I32A 4JZEH 1S84A 3M5OA 4WMFA 2ODPA 2C8WB 5T6FA 1YGCH 4FUEA 1PYTD 1TAWA 4NSVA 3TNTA 3P6ZB 2AERH 1O32A 2SGAA 1O3GA 1W7XH 3B23B 3ZVBA 1C2IA 4K69A 3SU2A 2ZP0H 1GCTC 3HKJB 2ZDMA 2ZTYA 1EJMA 4MQAA 5C1YA 3SNBA 5FX6A 4MNXA 2HWLB 3FZDA 3SOSA 1KLTA 1O5FH 6LPRA 1V2VT 2R2MB 4Q7YA 4O03A 1C5MD 2FI5E 1ZHRA 1GHYH 4Y76A 3ZYEA 4DW2U 2XXLA 1YPEH 1NESE 3E0PB 3BTQE 4DVAU 4ZMAH 1V2ST 3BG8A 5JYIA 2ZHEH 2JH6D 3QO6A 3AW1A 4X8TH 2ZKSA 1AZ8A 1SGPE 3RXUA 1BBRK 3TIUA 4ZKRU 4MLFB 5EG4A 5A0BA 1GDNA 3M61U 4LXBH 2PGBB 1Y5AT 1CVWH 1P2OA 3I78A 5F03A 2NU0E 1YYY1 1YPHE 2WV4A 3UQVA 1CHGA 3EA9A 4XDEA 1FMGA 1V2OT 3T29A 1BA8B 1FV9A 2Y82A 1ABIH 1TNJA 3RM2H 3SUFA 1AKSB 1TGCA 4HTCH 2FOHA 2ZGCA 3MU4A 1SL3A 1A3EH 3S69A 3PO1B 1NFXA 1L1GA 2P16A 4QT8C 3PMAB 4CBNA 4Y11E 1P11E 3S0NA 2XBVA 1A2CH 2TIOA 3FVFB 2G52A 1Y8TA 3T2NA 1G3CA 1GGDC 1O3OA 3FP7E 5F8XA 2CJIA 3SHCH 3EAJA 1ZRKA 5DO4H 3QUMP 5LH8A 4WMDA 1VCPA 2G55A 2F9BH 3UOPA 4X2XA 3ZZ3A 1GHZA 5FBEA 1UTQA 4KTUA 3ZZCA 1ZMLA 3AVZA 1Y3VA 2ZEBA 2ZDNA 2JH0D 4NA8A 1JRSA 1P02A 1NM6A 1GBFA 3TH4H 1WU1A 4NIVA 2Q6DA 3K2UA 3ZZAA 1L1NA 3QZQA 1TX8A 3DUXH 5C1UA 2W26A 2OP9A 3T5FH 2ZECA 1QA0A 3QTOH 1HXEH 2VGCC 3SHAH 1F5RA 1K1NA 2Z3EA 4UEHH 3JZ1B 2A1DB 1Z8RA 2BY6X 2RA0A 3RU4D 1DXWA 1Y3UA 1G37A 1KXDA 1BMMH 2ZDKA 1S0QA 5ESBA 4YOIA 3EA7A 4ABEA 1ESAA 4X1PU 6ESTA 1IQNA 2QY0B 1GMCG 1AWHB 1V6DA 3RMLH 1MQ5A 2FOBA 4NSYA 3VPKA 1ZJDA 3RMMH 7ESTE 2FOMB 4GAWA 1O2KA 1BRAA 1SC8U 4A7IB 1LQEA 1C1TA 2CHAB 2ZC9H 2EI6A 2I6QA 3SJOA 1O3AA 1P2QA 2SGEE 2FX6A 1PPBH 1YF4A 4X0WU 3BTHE 1O2RA 1TGBA 1GI1A 2ZU1A 3UY9A 4YLUA 3RXLA 1UVUH 7GCHG 2ALPA 2QA9E 1BCUH 2F9UA 2BB4A 3IWMA 3FANA 1W3CA 1FLEE 1DSUA 2GMTC 4LK4A 4ZXYH 1T7CA 4LZ1H 2Y7ZA 1WTHD 1BTPA 1GI8B 2OCVB 3FP6E 3RXEA 1WQVH 2K1QA 2XBXA 1MTNB 4WVPE 4A1XA 4O3UA 2FZZA 2OC0A 3R0FA 1QGFA 4LZ4B 2ODQA 3SQHE 1ESTA 1XMNB 3TK5A 2V35A 1G2MA 4NWKA 4NIXA 1P9SA 1LVOA 4FVBA 4Y0ZE 1Y3XA 1SPJA 2ODYB 1QBOA 2VB0A 1EX3A 1FQ3A 5HM9A 4BTIB 2FOGA 1WTGH 4NG9H 1P9UA 1G3BA 1C5SA 2ZG0H 2HNTC 1P2IA 1K1JA 1RXPA 4MVNA 3T62A 2VJ1A 5HXFA 1K28D 2I6SA 1NZQH 1O2HA 2PTNA 1NFYA 1RJXB 1ABJH 2BLVA 4NIWA 4OS1A 3KCGH 4CRGA 1C2LA 1TWXB 1TQ7B 1K1LA 4ABIA 1C5QA 1SGEE 1PQ8A 1P0SH 5I25A 2BD9A 1CO7E 4JK6A 3AW0A 5EXLA 1BDAA 3Q00A 2TGDA 4INLA 3U9AH 1ZGIA 1OWEA 4GUXA 2YOLA 1SFIA 1IQIA 1KXFA 1GI2A 4HI3A 1BTYA 4U30A 1SI5H 3PTNA 1UK3A 2PSYA 2OC1A 4FU9A 2FS8A 1DWCH 4WWYA 4CH2B 3M5MA 1QL7A 5H4IB 1SG8B 3NKKA 2UWLA 3A7YA 2WPKS 3SU5A 1SQTA 3O8DA 1O3LA 3S9AA 1EJNA 1O0DH 3D62A 4Y71A 2BX4A 1THRH 1Z6JH 1HPGA 1O2YA 4D8NA 1LVMA 1C1RA 1NRPH 3PMJA 1G3DA 1BJUA 1C4U2 2PTCE 1TFXA 1BTZA 2A4RA 3ZZDA 3D23A 1HJAC 2BVRH 3CP7A 1BHXB 4BNRA 1XUKA 1Q2WA 3TGKE 4ZUHA 4YT7H 4JZ1A 3GY6A 3VGCB 3GICB 3RXCA 1MBQA 5LPRA 4IBLH 2LPRA 4H6SB 3VB7A 1GMHF 1QY6A 1N8OB 2OD3B 5FCKA 1OYQA 4KP0A 1AQ7A 2UUJB 4UFDH 3A88A 3VB4A 1MTWA 3QN7A 1P04A 3LJJA 2VNTA 3E91A 2BDAA 4TWWA 2EI8A 3ZVFA 1K1PA 1FI8A 1MMJN 3S9CA 4WJG2 2ZU4A 1V2MT 2VU8E 5FXLA 1CE5A 1MZDA 2CGAA 1O5AB 4AB8A 3GY3A 3KF2A 1ZOMA 1K22H 5HGGA 2ZO3H 3TU7H 3LIWA 2G4UA 4BAHB 1BTUA 5DP7A 4ABDA 1DUAA 3SNEA 1GPZA 2ZPRA 3ZV8A 1K1OA 2Q6FA 1PQAA 3W95A 4MNYA 4ZROA 1SLWB 1TBZH 1PPEE 4UD9H 1GG6C 4ISIH 1D4PB 4K3JA 4Y79A 3LGYA 5ABWA 3MNCA 1NROH 1V2WT 4TYDA 2Z3CA 1QL8A 2UUKB 4X8VH 1LMWB 3TH2H 1DWDH 4GHTA 2O8MA 1AFQC 4NA9H 2ZGXH 2B5TB 3C1KA 1TOMH 1NN6A 4OGYA 4XBDA 1OKXA 1BTXA 3PWCA 2RDLA 2FOFA 3F9EA 1EJAA 3RXSA 4IN1A 3UOUA 2VVVA 6CHAC 2AGGX 1EAWA 1D6WA 2XBWA 2QIQA 1G2LA 1NRSH 3LOXA 3OY6U 5EQSA 3V12A 5C1XA 1X7AC 1CT2E 1C1PA 4HFPB 1HAVA 3STJA 1F0SA 3KNXA 1EB1H 2BLOA 1YPHC 2GP9B 3SV9A 1C5ZB 4ABGA 1GG6B 2KAIB 3TJNA 1IQJA 3A8DA 4AG2A 1SHYA 1EPTC 4BAKB 1IQMA 1XUFA 1SOZA 1TOCB 3MYWA 1VGCB 1AE8H 3MH7A 2QF0A 4WH6A 7LPRA 3BG4B 4U32A 1WV7H 4XBBA 1UCYE 1C4V2 1FAKH 3UQOA 1PPGE 4MG3A 2P3FH 2CMYA 1AN1E 1CA0B 1QJ7B 1S0RA 1S83A 1Z8IB 2FMJA 3LU9B 4HZHA 5EGMA 1O2TA 1RIWC 3ZVGA 1P05A 2BM2A 4DOQA 3BTWE 1O3PB 4NZLA 3BTME 1EZXC 1TNLA 4KKDA 3A7ZA 1C5XB 1TQ0B 1ELTA 1XUIA 2THFB 3PV4A 1G3EA 3GY2A 3F9FA 2QXJA 1V2PT 4A1TA 3RXFA 1T32A 1AMHA 1UTNA 1K1MA 1CBWB 4FUGA 3VB5A 3MFJA 1YPMH 2D2DA 5DJ7A 1GI4A 1UTJA 8GCHF 1NY22 4J1YA 1O2UA 1RTKA 2Z9IA 3A7VA 1BBRE 5EXMA 7KMEH 5L2YH 2WYJA 1TMUH 3SU0A 2XWBI 1EP6A 1O2MA 2ZQ1A 1NFWA 2SNWA 4B2AA 1W10U 1HGTH 3SU6A 1YCPK 1C5VA 9LPRA 1JIRA 3M37A 5DP5A 1C5RA 2XYAA 2WPMS 5DP3A 2W3IA 2QXHA 2FDAA 2J9NA 1HIAB 1VR1H 1GHWH 4NFEA 1C9PA 1O36A 3TK6A 1C1UH 5GCHG 3IITA 3A7WA 1GI9B 3SN8A 1JMOH 1PPHE 2C4FH 3M7TA 2A2XH 3A83A 4FUJA 1EAXA 4JCNA 1GBDA 1L2EA 1GI0A 5C2ZA 1HJ8A 2FYRA 1HAZB 2Z3DA 4ABFA 1MCVA 4KGAA 1ZZZA 1LQDB 3GISB 5FHTA 1NC6A 3CENA 3RU4E 5GWZA 3SV2H 3BEIB 3K6ZA 1BHXF 3OTJE 2TGAA 4ISLA