2O9KA

Wdr5 in complex with dimethylated h3k4 peptide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat protein 5
publication title Structural Basis for Molecular Recognition and Presentation of Histone H3 by Wdr5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 97
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2o9kA00
2OIZA 3C9CA 3SVWD 1TYQC 4D0KA 3OL2B 1SHYB 3AFCA 3EG6A 5TF2A 2IUPA 3UVMA 2H9LA 4ESGA 4FAND 2MTAH 3UKUC 4L3HD 3F3FA 4K3JB 3J81g 5EMMB 3L4OD 4GGAA 4JSXC 5A2Qg 1JMXB 4XYIA 4O1QD 4A2MA 3SHFA 3DWLC 4AOWA 2H9MA 5IGQA 2P9PC 4MK0B 4R7AB 2TRCB 2P9KC 3FGBA 4PXWA 4XYHA 4CY2A 4A09B 2QC5A 2H68A 3PE7A 5C9ZB 5TEEA 4L9OA 4BH6A 1JJUB 3F3GA 4J82A 5FKRA 4L3GD 3SN6B 4O9DA 5SXMA 4CZYA 2HESX 4E54A 5GXHA 2J57G 3AH8B 5CXBB 1RI6A 2I3TA 3UR4A 2W18A 2HJ4A 4PNKB 2OK6A 3VH0A 2AGZA 3SBRA 5EMLB 3C75H 4GM9A 1JMZB 1OLZA 3OTTA 1SQ9A 3N0EA 5C2VB 4H5IA 4J8BA 4JSVC 2B5MA 3JROA 3RSEC 2OVQB 4FA9D 3I7NA 5IJ8E 4QT8A 5IGOA 3I7LA 3OKWA 3SWSD 4Y7RA 4FHLA 3W15A 5K1CC 1U2VC 4N14A 4ZOXA 3CIKB 2H13A 5CYKA 3HFQA 2IWKA 3VGZA 4YVDA 4EWRA 3SXTD 1XKSA 1JOFA 4Y5RD 1B9YA 3C99A 4J87A 3BG1A 3ODTA 3KRXB 2B5LA 4CY5A 4Z8LA 2HKMA 4IMMA 2I0TA 4J8GA 3UVLA 4A08A 4X60B 4D6VA 3SLED 4BL0A 2H47A 5TEFA 5HQGA 2AGWA 4J81A 4ZN4A 3EI1A 2AGXA 3N0DA 4JT6C 3CFSB 2PBIB 4UI9R 3ZWLB 5EARA 2Z2OA 4CY1A 3PSLA 1L0QA 3J80g 5EAMA 4J86A 4QRJA 5FKQA 3UKRC 5CYKB 3PXSD 1QNIA 4J0XA 2P9LC 5JWZA 2OVPB 3L4MD 4PSWB 4GZ8A 2UZXB 4QQEA 3UVNA 2YBAA 4FA4D 4G56B 1A0RB 4JD2C 3JB9L 2IWFA 2IAAA 3B7FA 5HE3B 4GGDA 4A7JA 4A0AA 2G99A 3RN1D 3EWEA 3RN0D 4A08B 2O9KA 1B9XA 4KFMB 1K32A 3EI1B 2H6NA 3MXXA 4J73A 3NVNA 5AMSA 4J77A 2P9IC 1MG2A 5EMKB 5GSAA 4PBZA 4LG9A 2PM9A 2IUVA 4X3EA 2YNNA 4J79A 2PM6B 4A2LA 4U1EI 5FKSA 5EAPA 3EU7A 2HKRA 4E5ZA 5I5IA 3K27A 4NSXA 4CI3A 4A0AB 4ERZA 5IC7A 4LG8A 5FA5B 3FRXA 3RRMC 4CC9A 2GC4A 3PSCB 1N6DA 5GMKn 2GC7A 3MMYA 3OW8A 4ES0A 2AQ5A 1PI6A 5FKTA 3C5MA 4IA9A 1ERJA 4O3UB 4CY3A 2HXCA 5THAA 3I8EA 4GQ1A 4XEIC 1R5MA 4ZOYA 5FLXg 4CZXA 2J56H 3SBPA 2PM9B 2Q7QA 3UVKA 3ORVD 5B4WA 3V7DB 4E54B 2GNQA 4PBYA 4AEZA 2P9SC 4X61B 3JRPA 5GXIA 5H1MA 5K19A 2XYIA 3AL9A 3F3PA 3NVXA 3KRWB 5KDOB 2IUQA 2IURA 2AH0A 4HDJA 4ERQA 4E5ZB 3DXKC 1VYHC 2J55H 3K26A 3CFVA 5AFU3 3U4YA 4ZOZA 2UZYB 2H6KA 3I7PA 4FB1D 4ERYA 2YNPA 3MKQA 5FXYA 5H17A 1TBGA 2H3XA 4CI2A 4L1QD 4ZOVA 5I5MA 1SQJA 3EMHA 3RFGA 3A0FA 3V5WB 2HYEA 4H5JA 2H9PA 4OWRA 3SJLD 4CI1A 3GFCA 2XL3A 2AGYA 2BCJB 4A11A 3EI3A 3MKSB 3PXTD 2CN3A 1PEVA 1GOTB 1N6FA 3RLMD 5HYNB 2CO0C 3AL8A 3IIYA 3I89A 3JZHA 4GQBB 3PVUB 1MDAH 2G9AA 5FQDA 3VA6A 3EI4A 4O3TB 1GXRA 5CXBA 1PGUA 3E0CA 1OMWB 2YNOA 1FWXA 4K3ID 2XU7A 4U7AA 5IJ7E 5CXCA 2CN2A 2XL2A 4X63B 1NR0A 3BWSA 3RFHA 4JT5C 3SBQA 3UVOA 2CE9A 4JSNC 3OKTA 4I79A 3GREA 4GM3A 2H6QA 1MG3A 1YFQA 5AJAA 2OK4A 3DSMA 4FA1D 1NEXB 2B5NA 2OVRB 5EM2A 2PM7B 3EI2A 3IJ0A 4GQ2P 4QL1A 2QXVA 5TDHB 5IT9g 3I7KA 2BBKH 1K8KC 4A0BA 4JSPC 1PBYB 4A11B 3EI3B 5HE0B 3NVQA 4TZ4A 3SFZA 1GG2B 3IKOA 3DXMC 4BUJC 4J84A 4CZVA 1GP2B 2Z2NA 3AL8B 2EBSA 3ULEC 1XHMA 1XIPA 3RMZD 3JPXA 2CE8A 3I7OA 4GM8A 3EI4B 2H14A 3OKYA 5I5JA 5HE1B 3MZLA 3IJCA 5CXCB 4GMBA 4CI8A 3FM0A 3IIWA 3IJ1A 4FAVD 4J78A 4FWWA 3I2NA 4PC0A 3BG0A 3I7HA 2HJBA 3SMRA 5EM2B 2P9NC 3EI2B 4O45A 2CO0A 3OL2A 4FA5D 2B4EA 5C2WB 4A0BB 4GGCA 4LGNA 3JAMg 3PVWB 2OJYA 2P9UC 3JZGA 3PXWD 2I0SA 5HE2B 1N6EA 1Q47A 2YB8B 5H14A 3V9FA 3OKYB 2I0RA 3DM0A 2Z2PA 3SCYA 2CNXA 4A09A 2I3SA 5EALA 2AH1A 1S4UX 2H9NA 3P4FA 1U4CA 4JXMA 2YMUA 5EMJB 4J0WA 1P22A 3I8CA 4PSXB 3JZNA 3MZKA 4OZUA 2AGLA
chains in the Genus database with same CATH superfamily
2OIZA 3K6SA 3C9CA 3SVWD 1TYQC 5M61A 4D0KA 3OL2B 5E6SA 1SHYB 3IJEA 3AFCA 3EG6A 5TF2A 3MUNA 2IUPA 3UVMA 2H9LA 4ESGA 4FAND 2VDRA 2MTAH 3UKUC 3ZE1A 4L3HD 3F3FA 4K3JB 3J81g 5EMMB 3L4OD 4GGAA 4NC4A 1A12A 3EQ8A 4JSXC 5A2Qg 1JMXB 4XYIA 4O1QD 4A2MA 3SHFA 3DWLC 4AOWA 2H9MA 5IGQA 2P9PC 4MK0B 3V4VA 3K72A 3ZDZA 4R7AB 5FFOA 2TRCB 2P9KC 3FGBA 4PXWA 4XYHA 4CY2A 1VZ3A 4A09B 2QC5A 2H68A 3PE7A 5C9ZB 5TEEA 5C92A 4L9OA 2VZ1A 3IUNA 4BH6A 1GOFA 1JJUB 3EQ7A 4DNUA 3F3GA 5E6RA 4J82A 5FKRA 4L3GD 3KCIA 3SN6B 4O9DA 4WK2A 5SXMA 4CZYA 2HESX 4E54A 5GXHA 2J57G 3AH8B 5CXBB 1RI6A 4MMZA 2I3TA 3UR4A 2W18A 2HJ4A 2EIDA 4PNKB 2OK6A 4G1EA 3VH0A 2AGZA 1C9IA 3SBRA 5EMLB 3C75H 4GM9A 1JMZB 1OLZA 3OTTA 1SQ9A 4Z7OA 3N0EA 4BCDA 5C2VB 4H5IA 4J8BA 4JSVC 2B5MA 3JROA 3RSEC 5M5UA 2OVQB 4FA9D 3ZDYA 3I7NA 5IJ8E 4QT8A 5M5TA 5IGOA 3I7LA 3OKWA 3SWSD 4Y7RA 4FHLA 3W15A 3MVDK 5K1CC 1U2VC 1UOPA 3IVMA 4N14A 4ZOXA 3CIKB 2H13A 5CYKA 3HFQA 2IWKA 3VGZA 4YVDA 3ZE2A 4EWRA 3SXTD 1XKSA 1JOFA 4Y5RD 1B9YA 3C99A 4J87A 3BG1A 2WQ8A 3ODTA 3KRXB 2B5LA 4L1MA 4BCBA 4CY5A 4Z8LA 2HKMA 4IMMA 1UTCA 2I0TA 4J8GA 3UVLA 4A08A 4IRZA 4X60B 3VI3A 4D6VA 3SLED 4BL0A 2H47A 5TEFA 5HQGA 2AGWA 3IURA 1E5TA 4J81A 4BP9A 1QFSA 4ZN4A 3IUJA 3EI1A 2AGXA 3N0DA 3NIDA 2VDMA 4JT6C 3CFSB 2VDQA 3NIFA 2PBIB 4UI9R 3ZWLB 5EARA 2Z2OA 4CY1A 1H2WA 1M1XA 3PSLA 1L0QA 3J80g 1K3IA 5EAMA 3IULA 4J86A 4Z7NA 4QRJA 1E8NA 5FKQA 3UKRC 5CYKB 3PXSD 1QNIA 4J0XA 2P9LC 5JWZA 2OVPB 3L4MD 4PSWB 4GZ8A 2UZXB 4QQEA 3UVNA 1BPOA 2YBAA 4FA4D 4G56B 5M5VA 1A0RB 4JD2C 3JB9L 4D9SA 2QR5A 2IWFA 2IAAA 3B7FA 5HE3B 4GGDA 4A7JA 4A0AA 2JKXA 2G99A 2BKLA 3EWEA 3RN1D 3RN0D 4A08B 4AN0A 4JHNA 4WK0A 2O9KA 1B9XA 4DNVA 4KFMB 1K32A 3EI1B 2H6NA 3MXXA 4J73A 3NVNA 5AMSA 1O6GA 2P9IC 4J77A 1MG2A 5EMKB 5GSAA 4UM9A 4PBZA 4LG9A 2PM9A 2IUVA 4X3EA 2YNNA 4J79A 2PM6B 4A2LA 4U1EI 3VI4A 5FKSA 5EAPA 3V4PA 3EU7A 1YR2A 3O4GA 2HKRA 4E5ZA 4OZUA 5I5IA 3K27A 3ZE0A 4NSXA 3IUQA 4CI3A 4ERZA 4A0AB 5IC7A 4LG8A 5FA5B 3FRXA 5M5SA 3RRMC 4CC9A 2GC4A 2XDWA 4AX4A 3PSCB 1C9LA 1GOGA 5M5RA 1N6DA 5GMKn 2GC7A 1O6FA 4O02A 3MMYA 3OW8A 4ES0A 2AQ5A 1PI6A 5FKTA 3C5MA 4IA9A 1ERJA 4NBMA 4O3UB 4CY3A 2HXCA 5THAA 3I8EA 2EICA 4GQ1A 4XEIC 1R5MA 4ZOYA 5FLXg 4CZXA 2J56H 3SBPA 2PM9B 2Q7QA 3UVKA 3ORVD 5HDBA 5B4WA 3V7DB 4MMXA 4UM8A 4E54B 2GNQA 4PBYA 4AEZA 2P9SC 4X61B 3JRPA 1UOQA 5GXIA 5H1MA 5K19A 2XYIA 3FCUA 3AL9A 3F3PA 3NVXA 3KRWB 5KDOB 2IUQA 2IURA 2AH0A 4HDJA 1L5GA 4ERQA 1QFMA 3DXKC 1VYHC 4E5ZB 3IUMA 2J55H 3K26A 3CFVA 5AFU3 3U4YA 4ZOZA 2UZYB 1UOOA 1JTDB 2H6KA 1VE7A 3I7PA 4FB1D 4ERYA 2YNPA 3MKQA 4QAMA 5FXYA 5H17A 1TBGA 2H3XA 4CI2A 1VZ2A 4G1MA 1VE6A 4L1QD 4ZOVA 5I5MA 1SQJA 3EMHA 3O4JA 3RFGA 2XE4A 3A0FA 2EIBA 3V5WB 2HYEA 4H5JA 2H9PA 4OWRA 3SJLD 4CI1A 3GFCA 2XL3A 2AGYA 3O4IA 4AMZA 2BCJB 4A11A 3EI3A 3MKSB 3PXTD 4WK4A 2CN3A 1TYEA 1PEVA 1T2XA 1GOTB 1N6FA 1E8MA 2VDKA 3RLMD 5HYNB 4JHPC 2XZGA 2CO0C 4DNWA 3AL8A 1H2ZA 3IIYA 1H2YA 3I89A 3JZHA 4GQBB 4RE6A 3PVUB 1MDAH 2G9AA 5FQDA 3VA6A 3EI4A 4O3TB 1GXRA 5CXBA 1PGUA 3E0CA 1OMWB 2YNOA 3T3PA 1FWXA 4K3ID 2XU7A 4U7AA 5IJ7E 5CXCA 2CN2A 2XL2A 4X63B 1NR0A 3BWSA 3RFHA 4JT5C 3SBQA 3UVOA 2CE9A 4JSNC 3O4HA 2HU7A 3OKTA 4I79A 3GREA 2H6QA 4GM3A 1YFQA 1MG3A 5AJAA 4AN1A 2OK4A 3DSMA 4FA1D 2VDPA 1NEXB 2B5NA 3ZDXA 2OVRB 5EM2A 4O2WA 2PM7B 3EI2A 5C86A 3IJ0A 4GQ2P 4QL1A 2QXVA 4BCCA 5TDHB 5IT9g 3I7KA 2BBKH 1K8KC 2VZ3A 3NIGA 4A0BA 4JSPC 4G55A 1PBYB 4A11B 3EI3B 5HE0B 3NVQA 4TZ4A 1GOHA 3SFZA 1GG2B 3IKOA 3DXMC 4BUJC 4J84A 2HU5A 4CZVA 1GP2B 2Z2NA 3AL8B 2EBSA 3ULEC 1XHMA 1XIPA 3RMZD 3JPXA 2CE8A 3I7OA 4GM8A 3DDUA 3EI4B 1I2MB 2H14A 3OKYA 5I5JA 5HE1B 3GC3B 3MZLA 3K71A 3IJCA 5CXCB 3MUOA 4GMBA 4CI8A 4RE5A 3FM0A 3IIWA 5E6UA 3IJ1A 4FAVD 4J78A 2EIEA 4FWWA 3I2NA 4PC0A 3BG0A 3I7HA 2HJBA 3SMRA 5EM2B 2P9NC 3EI2B 1U8CA 4O45A 2CO0A 3OL2A 4BP8A 4FA5D 2VC2A 2B4EA 5C2WB 4A0BB 4GGCA 2HU8A 4LGNA 3JAMg 3PVWB 2OJYA 3EQ9A 4Z7QA 2P9UC 4AMYA 3JZGA 3FCSA 4MMYA 3PXWD 2I0SA 5HE2B 1JV2A 1N6EA 1Q47A 3QHYB 2YB8B 2VDLA 5H14A 5FFGA 3V9FA 3OKYB 2I0RA 4NENA 3DM0A 4WJKA 2Z2PA 3SCYA 2CNXA 4A09A 2I3SA 1H2XA 5EALA 3QI0A 3OF7A 2AH1A 1S4UX 2H9NA 3P4FA 3T3MA 3GD1I 1U4CA 4JXMA 2YMUA 5EMJB 2VDOA 4J0WA 1P22A 3I8CA 2QZPA 4PSXB 2VDNA 3JZNA 3MZKA 4NAAA 2AGLA
chains in the Genus database with same CATH topology
2OIZA 3C9CA 3SVWD 1TYQC 4D0KA 3OL2B 1SHYB 3AFCA 3EG6A 5TF2A 2IUPA 3UVMA 2H9LA 4ESGA 4FAND 2MTAH 3UKUC 4L3HD 3F3FA 4K3JB 3J81g 5EMMB 3L4OD 4GGAA 4JSXC 5A2Qg 1JMXB 4XYIA 4O1QD 4A2MA 3SHFA 3DWLC 4AOWA 2H9MA 5IGQA 2P9PC 4MK0B 4R7AB 2TRCB 2P9KC 3FGBA 4PXWA 4XYHA 4CY2A 4A09B 2QC5A 2H68A 3PE7A 5C9ZB 5TEEA 4L9OA 4BH6A 1JJUB 3F3GA 4J82A 5FKRA 4L3GD 3SN6B 4O9DA 5SXMA 4CZYA 2HESX 4E54A 5GXHA 2J57G 3AH8B 5CXBB 1RI6A 2I3TA 3UR4A 2W18A 2HJ4A 4PNKB 2OK6A 3VH0A 2AGZA 3SBRA 5EMLB 3C75H 4GM9A 1JMZB 1OLZA 3OTTA 1SQ9A 3N0EA 5C2VB 4H5IA 4J8BA 4JSVC 2B5MA 3JROA 3RSEC 2OVQB 4FA9D 3I7NA 5IJ8E 4QT8A 5IGOA 3I7LA 3OKWA 3SWSD 4Y7RA 4FHLA 3W15A 5K1CC 1U2VC 4N14A 4ZOXA 3CIKB 2H13A 5CYKA 3HFQA 2IWKA 3VGZA 4YVDA 4EWRA 3SXTD 1XKSA 1JOFA 4Y5RD 1B9YA 3C99A 4J87A 3BG1A 3ODTA 3KRXB 2B5LA 4CY5A 4Z8LA 2HKMA 4IMMA 2I0TA 4J8GA 3UVLA 4A08A 4X60B 4D6VA 3SLED 4BL0A 2H47A 5TEFA 5HQGA 2AGWA 4J81A 4ZN4A 3EI1A 2AGXA 3N0DA 4JT6C 3CFSB 2PBIB 4UI9R 3ZWLB 5EARA 2Z2OA 4CY1A 3PSLA 1L0QA 3J80g 5EAMA 4J86A 4QRJA 5FKQA 3UKRC 5CYKB 3PXSD 1QNIA 4J0XA 2P9LC 5JWZA 2OVPB 3L4MD 4PSWB 4GZ8A 2UZXB 4QQEA 3UVNA 2YBAA 4FA4D 4G56B 1A0RB 4JD2C 3JB9L 2IWFA 2IAAA 3B7FA 5HE3B 4GGDA 4A7JA 4A0AA 2G99A 3RN1D 3EWEA 3RN0D 4A08B 2O9KA 1B9XA 4KFMB 1K32A 3EI1B 2H6NA 3MXXA 4J73A 3NVNA 5AMSA 4J77A 2P9IC 1MG2A 5EMKB 5GSAA 4PBZA 4LG9A 2PM9A 2IUVA 4X3EA 2YNNA 4J79A 2PM6B 4A2LA 4U1EI 5FKSA 5EAPA 3EU7A 2HKRA 4E5ZA 5I5IA 3K27A 4NSXA 4CI3A 4A0AB 4ERZA 5IC7A 4LG8A 5FA5B 3FRXA 3RRMC 4CC9A 2GC4A 3PSCB 1N6DA 5GMKn 2GC7A 3MMYA 3OW8A 4ES0A 2AQ5A 1PI6A 5FKTA 3C5MA 4IA9A 1ERJA 4O3UB 4CY3A 2HXCA 5THAA 3I8EA 4GQ1A 4XEIC 1R5MA 4ZOYA 5FLXg 4CZXA 2J56H 3SBPA 2PM9B 2Q7QA 3UVKA 3ORVD 5B4WA 3V7DB 4E54B 2GNQA 4PBYA 4AEZA 2P9SC 4X61B 3JRPA 5GXIA 5H1MA 5K19A 2XYIA 3AL9A 3F3PA 3NVXA 3KRWB 5KDOB 2IUQA 2IURA 2AH0A 4HDJA 4ERQA 4E5ZB 3DXKC 1VYHC 2J55H 3K26A 3CFVA 5AFU3 3U4YA 4ZOZA 2UZYB 2H6KA 3I7PA 4FB1D 4ERYA 2YNPA 3MKQA 5FXYA 5H17A 1TBGA 2H3XA 4CI2A 4L1QD 4ZOVA 5I5MA 1SQJA 3EMHA 3RFGA 3A0FA 3V5WB 2HYEA 4H5JA 2H9PA 4OWRA 3SJLD 4CI1A 3GFCA 2XL3A 2AGYA 2BCJB 4A11A 3EI3A 3MKSB 3PXTD 2CN3A 1PEVA 1GOTB 1N6FA 3RLMD 5HYNB 2CO0C 3AL8A 3IIYA 3I89A 3JZHA 4GQBB 3PVUB 1MDAH 2G9AA 5FQDA 3VA6A 3EI4A 4O3TB 1GXRA 5CXBA 1PGUA 3E0CA 1OMWB 2YNOA 1FWXA 4K3ID 2XU7A 4U7AA 5IJ7E 5CXCA 2CN2A 2XL2A 4X63B 1NR0A 3BWSA 3RFHA 4JT5C 3SBQA 3UVOA 2CE9A 4JSNC 3OKTA 4I79A 3GREA 4GM3A 2H6QA 1MG3A 1YFQA 5AJAA 2OK4A 3DSMA 4FA1D 1NEXB 2B5NA 2OVRB 5EM2A 2PM7B 3EI2A 3IJ0A 4GQ2P 4QL1A 2QXVA 5TDHB 5IT9g 3I7KA 2BBKH 1K8KC 4A0BA 4JSPC 1PBYB 4A11B 3EI3B 5HE0B 3NVQA 4TZ4A 3SFZA 1GG2B 3IKOA 3DXMC 4BUJC 4J84A 4CZVA 1GP2B 2Z2NA 3AL8B 2EBSA 3ULEC 1XHMA 1XIPA 3RMZD 3JPXA 2CE8A 3I7OA 4GM8A 3EI4B 2H14A 3OKYA 5I5JA 5HE1B 3MZLA 3IJCA 5CXCB 4GMBA 4CI8A 3FM0A 3IIWA 3IJ1A 4FAVD 4J78A 4FWWA 3I2NA 4PC0A 3BG0A 3I7HA 2HJBA 3SMRA 5EM2B 2P9NC 3EI2B 4O45A 2CO0A 3OL2A 4FA5D 2B4EA 5C2WB 4A0BB 4GGCA 4LGNA 3JAMg 3PVWB 2OJYA 2P9UC 3JZGA 3PXWD 2I0SA 5HE2B 1N6EA 1Q47A 2YB8B 5H14A 3V9FA 3OKYB 2I0RA 3DM0A 2Z2PA 3SCYA 2CNXA 4A09A 2I3SA 5EALA 2AH1A 1S4UX 2H9NA 3P4FA 1U4CA 4JXMA 2YMUA 5EMJB 4J0WA 1P22A 3I8CA 4PSXB 3JZNA 3MZKA 4OZUA 2AGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIZ A;  3C9C A;  3SVW D;  1TYQ C;  4D0K A;  3OL2 B;  1SHY B;  3AFC A;  3EG6 A;  5TF2 A;  2IUP A;  3UVM A;  2H9L A;  4ESG A;  4FAN D;  2MTA H;  3UKU C;  4L3H D;  3F3F A;  4K3J B;  3J81 g;  5EMM B;  3L4O D;  4GGA A;  4JSX C;  5A2Q g;  1JMX B;  4XYI A;  4O1Q D;  4A2M A;  3SHF A;  3DWL C;  4AOW A;  2H9M A;  5IGQ A;  2P9P C;  4MK0 B;  4R7A B;  2TRC B;  2P9K C;  3FGB A;  4PXW A;  4XYH A;  4CY2 A;  4A09 B;  2QC5 A;  2H68 A;  3PE7 A;  5C9Z B;  5TEE A;  4L9O A;  4BH6 A;  1JJU B;  3F3G A;  4J82 A;  5FKR A;  4L3G D;  3SN6 B;  4O9D A;  5SXM A;  4CZY A;  2HES X;  4E54 A;  5GXH A;  2J57 G;  3AH8 B;  5CXB B;  1RI6 A;  2I3T A;  3UR4 A;  2W18 A;  2HJ4 A;  4PNK B;  2OK6 A;  3VH0 A;  2AGZ A;  3SBR A;  5EML B;  3C75 H;  4GM9 A;  1JMZ B;  1OLZ A;  3OTT A;  1SQ9 A;  3N0E A;  5C2V B;  4H5I A;  4J8B A;  4JSV C;  2B5M A;  3JRO A;  3RSE C;  2OVQ B;  4FA9 D;  3I7N A;  5IJ8 E;  4QT8 A;  5IGO A;  3I7L A;  3OKW A;  3SWS D;  4Y7R A;  4FHL A;  3W15 A;  5K1C C;  1U2V C;  4N14 A;  4ZOX A;  3CIK B;  2H13 A;  5CYK A;  3HFQ A;  2IWK A;  3VGZ A;  4YVD A;  4EWR A;  3SXT D;  1XKS A;  1JOF A;  4Y5R D;  1B9Y A;  3C99 A;  4J87 A;  3BG1 A;  3ODT A;  3KRX B;  2B5L A;  4CY5 A;  4Z8L A;  2HKM A;  4IMM A;  2I0T A;  4J8G A;  3UVL A;  4A08 A;  4X60 B;  4D6V A;  3SLE D;  4BL0 A;  2H47 A;  5TEF A;  5HQG A;  2AGW A;  4J81 A;  4ZN4 A;  3EI1 A;  2AGX A;  3N0D A;  4JT6 C;  3CFS B;  2PBI B;  4UI9 R;  3ZWL B;  5EAR A;  2Z2O A;  4CY1 A;  3PSL A;  1L0Q A;  3J80 g;  5EAM A;  4J86 A;  4QRJ A;  5FKQ A;  3UKR C;  5CYK B;  3PXS D;  1QNI A;  4J0X A;  2P9L C;  5JWZ A;  2OVP B;  3L4M D;  4PSW B;  4GZ8 A;  2UZX B;  4QQE A;  3UVN A;  2YBA A;  4FA4 D;  4G56 B;  1A0R B;  4JD2 C;  3JB9 L;  2IWF A;  2IAA A;  3B7F A;  5HE3 B;  4GGD A;  4A7J A;  4A0A A;  2G99 A;  3RN1 D;  3EWE A;  3RN0 D;  4A08 B;  2O9K A;  1B9X A;  4KFM B;  1K32 A;  3EI1 B;  2H6N A;  3MXX A;  4J73 A;  3NVN A;  5AMS A;  4J77 A;  2P9I C;  1MG2 A;  5EMK B;  5GSA A;  4PBZ A;  4LG9 A;  2PM9 A;  2IUV A;  4X3E A;  2YNN A;  4J79 A;  2PM6 B;  4A2L A;  4U1E I;  5FKS A;  5EAP A;  3EU7 A;  2HKR A;  4E5Z A;  5I5I A;  3K27 A;  4NSX A;  4CI3 A;  4A0A B;  4ERZ A;  5IC7 A;  4LG8 A;  5FA5 B;  3FRX A;  3RRM C;  4CC9 A;  2GC4 A;  3PSC B;  1N6D A;  5GMK n;  2GC7 A;  3MMY A;  3OW8 A;  4ES0 A;  2AQ5 A;  1PI6 A;  5FKT A;  3C5M A;  4IA9 A;  1ERJ A;  4O3U B;  4CY3 A;  2HXC A;  5THA A;  3I8E A;  4GQ1 A;  4XEI C;  1R5M A;  4ZOY A;  5FLX g;  4CZX A;  2J56 H;  3SBP A;  2PM9 B;  2Q7Q A;  3UVK A;  3ORV D;  5B4W A;  3V7D B;  4E54 B;  2GNQ A;  4PBY A;  4AEZ A;  2P9S C;  4X61 B;  3JRP A;  5GXI A;  5H1M A;  5K19 A;  2XYI A;  3AL9 A;  3F3P A;  3NVX A;  3KRW B;  5KDO B;  2IUQ A;  2IUR A;  2AH0 A;  4HDJ A;  4ERQ A;  4E5Z B;  3DXK C;  1VYH C;  2J55 H;  3K26 A;  3CFV A;  5AFU 3;  3U4Y A;  4ZOZ A;  2UZY B;  2H6K A;  3I7P A;  4FB1 D;  4ERY A;  2YNP A;  3MKQ A;  5FXY A;  5H17 A;  1TBG A;  2H3X A;  4CI2 A;  4L1Q D;  4ZOV A;  5I5M A;  1SQJ A;  3EMH A;  3RFG A;  3A0F A;  3V5W B;  2HYE A;  4H5J A;  2H9P A;  4OWR A;  3SJL D;  4CI1 A;  3GFC A;  2XL3 A;  2AGY A;  2BCJ B;  4A11 A;  3EI3 A;  3MKS B;  3PXT D;  2CN3 A;  1PEV A;  1GOT B;  1N6F A;  3RLM D;  5HYN B;  2CO0 C;  3AL8 A;  3IIY A;  3I89 A;  3JZH A;  4GQB B;  3PVU B;  1MDA H;  2G9A A;  5FQD A;  3VA6 A;  3EI4 A;  4O3T B;  1GXR A;  5CXB A;  1PGU A;  3E0C A;  1OMW B;  2YNO A;  1FWX A;  4K3I D;  2XU7 A;  4U7A A;  5IJ7 E;  5CXC A;  2CN2 A;  2XL2 A;  4X63 B;  1NR0 A;  3BWS A;  3RFH A;  4JT5 C;  3SBQ A;  3UVO A;  2CE9 A;  4JSN C;  3OKT A;  4I79 A;  3GRE A;  4GM3 A;  2H6Q A;  1MG3 A;  1YFQ A;  5AJA A;  2OK4 A;  3DSM A;  4FA1 D;  1NEX B;  2B5N A;  2OVR B;  5EM2 A;  2PM7 B;  3EI2 A;  3IJ0 A;  4GQ2 P;  4QL1 A;  2QXV A;  5TDH B;  5IT9 g;  3I7K A;  2BBK H;  1K8K C;  4A0B A;  4JSP C;  1PBY B;  4A11 B;  3EI3 B;  5HE0 B;  3NVQ A;  4TZ4 A;  3SFZ A;  1GG2 B;  3IKO A;  3DXM C;  4BUJ C;  4J84 A;  4CZV A;  1GP2 B;  2Z2N A;  3AL8 B;  2EBS A;  3ULE C;  1XHM A;  1XIP A;  3RMZ D;  3JPX A;  2CE8 A;  3I7O A;  4GM8 A;  3EI4 B;  2H14 A;  3OKY A;  5I5J A;  5HE1 B;  3MZL A;  3IJC A;  5CXC B;  4GMB A;  4CI8 A;  3FM0 A;  3IIW A;  3IJ1 A;  4FAV D;  4J78 A;  4FWW A;  3I2N A;  4PC0 A;  3BG0 A;  3I7H A;  2HJB A;  3SMR A;  5EM2 B;  2P9N C;  3EI2 B;  4O45 A;  2CO0 A;  3OL2 A;  4FA5 D;  2B4E A;  5C2W B;  4A0B B;  4GGC A;  4LGN A;  3JAM g;  3PVW B;  2OJY A;  2P9U C;  3JZG A;  3PXW D;  2I0S A;  5HE2 B;  1N6E A;  1Q47 A;  2YB8 B;  5H14 A;  3V9F A;  3OKY B;  2I0R A;  3DM0 A;  2Z2P A;  3SCY A;  2CNX A;  4A09 A;  2I3S A;  5EAL A;  2AH1 A;  1S4U X;  2H9N A;  3P4F A;  1U4C A;  4JXM A;  2YMU A;  5EMJ B;  4J0W A;  1P22 A;  3I8C A;  4PSX B;  3JZN A;  3MZK A;  4OZU A;  2AGL A; 
#chains in the Genus database with same CATH topology
 2OIZ A;  3K6S A;  3C9C A;  3SVW D;  1TYQ C;  5M61 A;  4D0K A;  3OL2 B;  5E6S A;  1SHY B;  3IJE A;  3AFC A;  3EG6 A;  5TF2 A;  3MUN A;  2IUP A;  3UVM A;  2H9L A;  4ESG A;  4FAN D;  2VDR A;  2MTA H;  3UKU C;  3ZE1 A;  4L3H D;  3F3F A;  4K3J B;  3J81 g;  5EMM B;  3L4O D;  4GGA A;  4NC4 A;  1A12 A;  3EQ8 A;  4JSX C;  5A2Q g;  1JMX B;  4XYI A;  4O1Q D;  4A2M A;  3SHF A;  3DWL C;  4AOW A;  2H9M A;  5IGQ A;  2P9P C;  4MK0 B;  3V4V A;  3K72 A;  3ZDZ A;  4R7A B;  5FFO A;  2TRC B;  2P9K C;  3FGB A;  4PXW A;  4XYH A;  4CY2 A;  1VZ3 A;  4A09 B;  2QC5 A;  2H68 A;  3PE7 A;  5C9Z B;  5TEE A;  5C92 A;  4L9O A;  2VZ1 A;  3IUN A;  4BH6 A;  1GOF A;  1JJU B;  3EQ7 A;  4DNU A;  3F3G A;  5E6R A;  4J82 A;  5FKR A;  4L3G D;  3KCI A;  3SN6 B;  4O9D A;  4WK2 A;  5SXM A;  4CZY A;  2HES X;  4E54 A;  5GXH A;  2J57 G;  3AH8 B;  5CXB B;  1RI6 A;  4MMZ A;  2I3T A;  3UR4 A;  2W18 A;  2HJ4 A;  2EID A;  4PNK B;  2OK6 A;  4G1E A;  3VH0 A;  2AGZ A;  1C9I A;  3SBR A;  5EML B;  3C75 H;  4GM9 A;  1JMZ B;  1OLZ A;  3OTT A;  1SQ9 A;  4Z7O A;  3N0E A;  4BCD A;  5C2V B;  4H5I A;  4J8B A;  4JSV C;  2B5M A;  3JRO A;  3RSE C;  5M5U A;  2OVQ B;  4FA9 D;  3ZDY A;  3I7N A;  5IJ8 E;  4QT8 A;  5M5T A;  5IGO A;  3I7L A;  3OKW A;  3SWS D;  4Y7R A;  4FHL A;  3W15 A;  3MVD K;  5K1C C;  1U2V C;  1UOP A;  3IVM A;  4N14 A;  4ZOX A;  3CIK B;  2H13 A;  5CYK A;  3HFQ A;  2IWK A;  3VGZ A;  4YVD A;  3ZE2 A;  4EWR A;  3SXT D;  1XKS A;  1JOF A;  4Y5R D;  1B9Y A;  3C99 A;  4J87 A;  3BG1 A;  2WQ8 A;  3ODT A;  3KRX B;  2B5L A;  4L1M A;  4BCB A;  4CY5 A;  4Z8L A;  2HKM A;  4IMM A;  1UTC A;  2I0T A;  4J8G A;  3UVL A;  4A08 A;  4IRZ A;  4X60 B;  3VI3 A;  4D6V A;  3SLE D;  4BL0 A;  2H47 A;  5TEF A;  5HQG A;  2AGW A;  3IUR A;  1E5T A;  4J81 A;  4BP9 A;  1QFS A;  4ZN4 A;  3IUJ A;  3EI1 A;  2AGX A;  3N0D A;  3NID A;  2VDM A;  4JT6 C;  3CFS B;  2VDQ A;  3NIF A;  2PBI B;  4UI9 R;  3ZWL B;  5EAR A;  2Z2O A;  4CY1 A;  1H2W A;  1M1X A;  3PSL A;  1L0Q A;  3J80 g;  1K3I A;  5EAM A;  3IUL A;  4J86 A;  4Z7N A;  4QRJ A;  1E8N A;  5FKQ A;  3UKR C;  5CYK B;  3PXS D;  1QNI A;  4J0X A;  2P9L C;  5JWZ A;  2OVP B;  3L4M D;  4PSW B;  4GZ8 A;  2UZX B;  4QQE A;  3UVN A;  1BPO A;  2YBA A;  4FA4 D;  4G56 B;  5M5V A;  1A0R B;  4JD2 C;  3JB9 L;  4D9S A;  2QR5 A;  2IWF A;  2IAA A;  3B7F A;  5HE3 B;  4GGD A;  4A7J A;  4A0A A;  2JKX A;  2G99 A;  2BKL A;  3EWE A;  3RN1 D;  3RN0 D;  4A08 B;  4AN0 A;  4JHN A;  4WK0 A;  2O9K A;  1B9X A;  4DNV A;  4KFM B;  1K32 A;  3EI1 B;  2H6N A;  3MXX A;  4J73 A;  3NVN A;  5AMS A;  1O6G A;  2P9I C;  4J77 A;  1MG2 A;  5EMK B;  5GSA A;  4UM9 A;  4PBZ A;  4LG9 A;  2PM9 A;  2IUV A;  4X3E A;  2YNN A;  4J79 A;  2PM6 B;  4A2L A;  4U1E I;  3VI4 A;  5FKS A;  5EAP A;  3V4P A;  3EU7 A;  1YR2 A;  3O4G A;  2HKR A;  4E5Z A;  4OZU A;  5I5I A;  3K27 A;  3ZE0 A;  4NSX A;  3IUQ A;  4CI3 A;  4ERZ A;  4A0A B;  5IC7 A;  4LG8 A;  5FA5 B;  3FRX A;  5M5S A;  3RRM C;  4CC9 A;  2GC4 A;  2XDW A;  4AX4 A;  3PSC B;  1C9L A;  1GOG A;  5M5R A;  1N6D A;  5GMK n;  2GC7 A;  1O6F A;  4O02 A;  3MMY A;  3OW8 A;  4ES0 A;  2AQ5 A;  1PI6 A;  5FKT A;  3C5M A;  4IA9 A;  1ERJ A;  4NBM A;  4O3U B;  4CY3 A;  2HXC A;  5THA A;  3I8E A;  2EIC A;  4GQ1 A;  4XEI C;  1R5M A;  4ZOY A;  5FLX g;  4CZX A;  2J56 H;  3SBP A;  2PM9 B;  2Q7Q A;  3UVK A;  3ORV D;  5HDB A;  5B4W A;  3V7D B;  4MMX A;  4UM8 A;  4E54 B;  2GNQ A;  4PBY A;  4AEZ A;  2P9S C;  4X61 B;  3JRP A;  1UOQ A;  5GXI A;  5H1M A;  5K19 A;  2XYI A;  3FCU A;  3AL9 A;  3F3P A;  3NVX A;  3KRW B;  5KDO B;  2IUQ A;  2IUR A;  2AH0 A;  4HDJ A;  1L5G A;  4ERQ A;  1QFM A;  3DXK C;  1VYH C;  4E5Z B;  3IUM A;  2J55 H;  3K26 A;  3CFV A;  5AFU 3;  3U4Y A;  4ZOZ A;  2UZY B;  1UOO A;  1JTD B;  2H6K A;  1VE7 A;  3I7P A;  4FB1 D;  4ERY A;  2YNP A;  3MKQ A;  4QAM A;  5FXY A;  5H17 A;  1TBG A;  2H3X A;  4CI2 A;  1VZ2 A;  4G1M A;  1VE6 A;  4L1Q D;  4ZOV A;  5I5M A;  1SQJ A;  3EMH A;  3O4J A;  3RFG A;  2XE4 A;  3A0F A;  2EIB A;  3V5W B;  2HYE A;  4H5J A;  2H9P A;  4OWR A;  3SJL D;  4CI1 A;  3GFC A;  2XL3 A;  2AGY A;  3O4I A;  4AMZ A;  2BCJ B;  4A11 A;  3EI3 A;  3MKS B;  3PXT D;  4WK4 A;  2CN3 A;  1TYE A;  1PEV A;  1T2X A;  1GOT B;  1N6F A;  1E8M A;  2VDK A;  3RLM D;  5HYN B;  4JHP C;  2XZG A;  2CO0 C;  4DNW A;  3AL8 A;  1H2Z A;  3IIY A;  1H2Y A;  3I89 A;  3JZH A;  4GQB B;  4RE6 A;  3PVU B;  1MDA H;  2G9A A;  5FQD A;  3VA6 A;  3EI4 A;  4O3T B;  1GXR A;  5CXB A;  1PGU A;  3E0C A;  1OMW B;  2YNO A;  3T3P A;  1FWX A;  4K3I D;  2XU7 A;  4U7A A;  5IJ7 E;  5CXC A;  2CN2 A;  2XL2 A;  4X63 B;  1NR0 A;  3BWS A;  3RFH A;  4JT5 C;  3SBQ A;  3UVO A;  2CE9 A;  4JSN C;  3O4H A;  2HU7 A;  3OKT A;  4I79 A;  3GRE A;  2H6Q A;  4GM3 A;  1YFQ A;  1MG3 A;  5AJA A;  4AN1 A;  2OK4 A;  3DSM A;  4FA1 D;  2VDP A;  1NEX B;  2B5N A;  3ZDX A;  2OVR B;  5EM2 A;  4O2W A;  2PM7 B;  3EI2 A;  5C86 A;  3IJ0 A;  4GQ2 P;  4QL1 A;  2QXV A;  4BCC A;  5TDH B;  5IT9 g;  3I7K A;  2BBK H;  1K8K C;  2VZ3 A;  3NIG A;  4A0B A;  4JSP C;  4G55 A;  1PBY B;  4A11 B;  3EI3 B;  5HE0 B;  3NVQ A;  4TZ4 A;  1GOH A;  3SFZ A;  1GG2 B;  3IKO A;  3DXM C;  4BUJ C;  4J84 A;  2HU5 A;  4CZV A;  1GP2 B;  2Z2N A;  3AL8 B;  2EBS A;  3ULE C;  1XHM A;  1XIP A;  3RMZ D;  3JPX A;  2CE8 A;  3I7O A;  4GM8 A;  3DDU A;  3EI4 B;  1I2M B;  2H14 A;  3OKY A;  5I5J A;  5HE1 B;  3GC3 B;  3MZL A;  3K71 A;  3IJC A;  5CXC B;  3MUO A;  4GMB A;  4CI8 A;  4RE5 A;  3FM0 A;  3IIW A;  5E6U A;  3IJ1 A;  4FAV D;  4J78 A;  2EIE A;  4FWW A;  3I2N A;  4PC0 A;  3BG0 A;  3I7H A;  2HJB A;  3SMR A;  5EM2 B;  2P9N C;  3EI2 B;  1U8C A;  4O45 A;  2CO0 A;  3OL2 A;  4BP8 A;  4FA5 D;  2VC2 A;  2B4E A;  5C2W B;  4A0B B;  4GGC A;  2HU8 A;  4LGN A;  3JAM g;  3PVW B;  2OJY A;  3EQ9 A;  4Z7Q A;  2P9U C;  4AMY A;  3JZG A;  3FCS A;  4MMY A;  3PXW D;  2I0S A;  5HE2 B;  1JV2 A;  1N6E A;  1Q47 A;  3QHY B;  2YB8 B;  2VDL A;  5H14 A;  5FFG A;  3V9F A;  3OKY B;  2I0R A;  4NEN A;  3DM0 A;  4WJK A;  2Z2P A;  3SCY A;  2CNX A;  4A09 A;  2I3S A;  1H2X A;  5EAL A;  3QI0 A;  3OF7 A;  2AH1 A;  1S4U X;  2H9N A;  3P4F A;  3T3M A;  3GD1 I;  1U4C A;  4JXM A;  2YMU A;  5EMJ B;  2VDO A;  4J0W A;  1P22 A;  3I8C A;  2QZP A;  4PSX B;  2VDN A;  3JZN A;  3MZK A;  4NAA A;  2AGL A; 
#chains in the Genus database with same CATH homology
 2OIZ A;  3C9C A;  3SVW D;  1TYQ C;  4D0K A;  3OL2 B;  1SHY B;  3AFC A;  3EG6 A;  5TF2 A;  2IUP A;  3UVM A;  2H9L A;  4ESG A;  4FAN D;  2MTA H;  3UKU C;  4L3H D;  3F3F A;  4K3J B;  3J81 g;  5EMM B;  3L4O D;  4GGA A;  4JSX C;  5A2Q g;  1JMX B;  4XYI A;  4O1Q D;  4A2M A;  3SHF A;  3DWL C;  4AOW A;  2H9M A;  5IGQ A;  2P9P C;  4MK0 B;  4R7A B;  2TRC B;  2P9K C;  3FGB A;  4PXW A;  4XYH A;  4CY2 A;  4A09 B;  2QC5 A;  2H68 A;  3PE7 A;  5C9Z B;  5TEE A;  4L9O A;  4BH6 A;  1JJU B;  3F3G A;  4J82 A;  5FKR A;  4L3G D;  3SN6 B;  4O9D A;  5SXM A;  4CZY A;  2HES X;  4E54 A;  5GXH A;  2J57 G;  3AH8 B;  5CXB B;  1RI6 A;  2I3T A;  3UR4 A;  2W18 A;  2HJ4 A;  4PNK B;  2OK6 A;  3VH0 A;  2AGZ A;  3SBR A;  5EML B;  3C75 H;  4GM9 A;  1JMZ B;  1OLZ A;  3OTT A;  1SQ9 A;  3N0E A;  5C2V B;  4H5I A;  4J8B A;  4JSV C;  2B5M A;  3JRO A;  3RSE C;  2OVQ B;  4FA9 D;  3I7N A;  5IJ8 E;  4QT8 A;  5IGO A;  3I7L A;  3OKW A;  3SWS D;  4Y7R A;  4FHL A;  3W15 A;  5K1C C;  1U2V C;  4N14 A;  4ZOX A;  3CIK B;  2H13 A;  5CYK A;  3HFQ A;  2IWK A;  3VGZ A;  4YVD A;  4EWR A;  3SXT D;  1XKS A;  1JOF A;  4Y5R D;  1B9Y A;  3C99 A;  4J87 A;  3BG1 A;  3ODT A;  3KRX B;  2B5L A;  4CY5 A;  4Z8L A;  2HKM A;  4IMM A;  2I0T A;  4J8G A;  3UVL A;  4A08 A;  4X60 B;  4D6V A;  3SLE D;  4BL0 A;  2H47 A;  5TEF A;  5HQG A;  2AGW A;  4J81 A;  4ZN4 A;  3EI1 A;  2AGX A;  3N0D A;  4JT6 C;  3CFS B;  2PBI B;  4UI9 R;  3ZWL B;  5EAR A;  2Z2O A;  4CY1 A;  3PSL A;  1L0Q A;  3J80 g;  5EAM A;  4J86 A;  4QRJ A;  5FKQ A;  3UKR C;  5CYK B;  3PXS D;  1QNI A;  4J0X A;  2P9L C;  5JWZ A;  2OVP B;  3L4M D;  4PSW B;  4GZ8 A;  2UZX B;  4QQE A;  3UVN A;  2YBA A;  4FA4 D;  4G56 B;  1A0R B;  4JD2 C;  3JB9 L;  2IWF A;  2IAA A;  3B7F A;  5HE3 B;  4GGD A;  4A7J A;  4A0A A;  2G99 A;  3RN1 D;  3EWE A;  3RN0 D;  4A08 B;  2O9K A;  1B9X A;  4KFM B;  1K32 A;  3EI1 B;  2H6N A;  3MXX A;  4J73 A;  3NVN A;  5AMS A;  4J77 A;  2P9I C;  1MG2 A;  5EMK B;  5GSA A;  4PBZ A;  4LG9 A;  2PM9 A;  2IUV A;  4X3E A;  2YNN A;  4J79 A;  2PM6 B;  4A2L A;  4U1E I;  5FKS A;  5EAP A;  3EU7 A;  2HKR A;  4E5Z A;  5I5I A;  3K27 A;  4NSX A;  4CI3 A;  4A0A B;  4ERZ A;  5IC7 A;  4LG8 A;  5FA5 B;  3FRX A;  3RRM C;  4CC9 A;  2GC4 A;  3PSC B;  1N6D A;  5GMK n;  2GC7 A;  3MMY A;  3OW8 A;  4ES0 A;  2AQ5 A;  1PI6 A;  5FKT A;  3C5M A;  4IA9 A;  1ERJ A;  4O3U B;  4CY3 A;  2HXC A;  5THA A;  3I8E A;  4GQ1 A;  4XEI C;  1R5M A;  4ZOY A;  5FLX g;  4CZX A;  2J56 H;  3SBP A;  2PM9 B;  2Q7Q A;  3UVK A;  3ORV D;  5B4W A;  3V7D B;  4E54 B;  2GNQ A;  4PBY A;  4AEZ A;  2P9S C;  4X61 B;  3JRP A;  5GXI A;  5H1M A;  5K19 A;  2XYI A;  3AL9 A;  3F3P A;  3NVX A;  3KRW B;  5KDO B;  2IUQ A;  2IUR A;  2AH0 A;  4HDJ A;  4ERQ A;  4E5Z B;  3DXK C;  1VYH C;  2J55 H;  3K26 A;  3CFV A;  5AFU 3;  3U4Y A;  4ZOZ A;  2UZY B;  2H6K A;  3I7P A;  4FB1 D;  4ERY A;  2YNP A;  3MKQ A;  5FXY A;  5H17 A;  1TBG A;  2H3X A;  4CI2 A;  4L1Q D;  4ZOV A;  5I5M A;  1SQJ A;  3EMH A;  3RFG A;  3A0F A;  3V5W B;  2HYE A;  4H5J A;  2H9P A;  4OWR A;  3SJL D;  4CI1 A;  3GFC A;  2XL3 A;  2AGY A;  2BCJ B;  4A11 A;  3EI3 A;  3MKS B;  3PXT D;  2CN3 A;  1PEV A;  1GOT B;  1N6F A;  3RLM D;  5HYN B;  2CO0 C;  3AL8 A;  3IIY A;  3I89 A;  3JZH A;  4GQB B;  3PVU B;  1MDA H;  2G9A A;  5FQD A;  3VA6 A;  3EI4 A;  4O3T B;  1GXR A;  5CXB A;  1PGU A;  3E0C A;  1OMW B;  2YNO A;  1FWX A;  4K3I D;  2XU7 A;  4U7A A;  5IJ7 E;  5CXC A;  2CN2 A;  2XL2 A;  4X63 B;  1NR0 A;  3BWS A;  3RFH A;  4JT5 C;  3SBQ A;  3UVO A;  2CE9 A;  4JSN C;  3OKT A;  4I79 A;  3GRE A;  4GM3 A;  2H6Q A;  1MG3 A;  1YFQ A;  5AJA A;  2OK4 A;  3DSM A;  4FA1 D;  1NEX B;  2B5N A;  2OVR B;  5EM2 A;  2PM7 B;  3EI2 A;  3IJ0 A;  4GQ2 P;  4QL1 A;  2QXV A;  5TDH B;  5IT9 g;  3I7K A;  2BBK H;  1K8K C;  4A0B A;  4JSP C;  1PBY B;  4A11 B;  3EI3 B;  5HE0 B;  3NVQ A;  4TZ4 A;  3SFZ A;  1GG2 B;  3IKO A;  3DXM C;  4BUJ C;  4J84 A;  4CZV A;  1GP2 B;  2Z2N A;  3AL8 B;  2EBS A;  3ULE C;  1XHM A;  1XIP A;  3RMZ D;  3JPX A;  2CE8 A;  3I7O A;  4GM8 A;  3EI4 B;  2H14 A;  3OKY A;  5I5J A;  5HE1 B;  3MZL A;  3IJC A;  5CXC B;  4GMB A;  4CI8 A;  3FM0 A;  3IIW A;  3IJ1 A;  4FAV D;  4J78 A;  4FWW A;  3I2N A;  4PC0 A;  3BG0 A;  3I7H A;  2HJB A;  3SMR A;  5EM2 B;  2P9N C;  3EI2 B;  4O45 A;  2CO0 A;  3OL2 A;  4FA5 D;  2B4E A;  5C2W B;  4A0B B;  4GGC A;  4LGN A;  3JAM g;  3PVW B;  2OJY A;  2P9U C;  3JZG A;  3PXW D;  2I0S A;  5HE2 B;  1N6E A;  1Q47 A;  2YB8 B;  5H14 A;  3V9F A;  3OKY B;  2I0R A;  3DM0 A;  2Z2P A;  3SCY A;  2CNX A;  4A09 A;  2I3S A;  5EAL A;  2AH1 A;  1S4U X;  2H9N A;  3P4F A;  1U4C A;  4JXM A;  2YMU A;  5EMJ B;  4J0W A;  1P22 A;  3I8C A;  4PSX B;  3JZN A;  3MZK A;  4OZU A;  2AGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...