2O9KA

Wdr5 in complex with dimethylated h3k4 peptide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Molecular Recognition and Presentation of Histone H3 by Wdr5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords WD repeat protein 5
total genus 97
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2o9kA00
3IJ0A 3RN1D 2B5NA 2I0TA 3HFQA 4E54B 5I5MA 4XEIC 1NR0A 4E5ZB 3UKUC 4ZOVA 3AFCA 4U7AA 5AFU3 3V7DB 3RN0D 2CN3A 2OK4A 5HE3B 2W18A 4X61B 2YNNA 5EAMA 2XL3A 5FKQA 3KRXB 2XYIA 3SXTD 1MG2A 2IWKA 3N0DA 4U1EI 3OTTA 4GQ1A 4JSXC 4XYIA 2H13A 3ZWLB 4LG8A 4PSXB 5GMKn 4J81A 2P9SC 2IAAA 4L1QD 2Z2OA 4O9DA 4LG9A 3N0EA 3UVKA 4EWRA 1OMWB 3SBPA 4FA9D 4G56B 5EAPA 4O1QD 1XIPA 2PM9A 3PSCB 3FM0A 5AMSA 3SMRA 4ERZA 3SLED 4FA1D 1XKSA 5IGOA 4A09B 4LGNA 2P9LC 3AL9A 3I7NA 2AGLA 3F3FA 2O9KA 5H14A 2PBIB 2YMUA 4FB1D 3AL8A 4GM8A 2UZYB 5CXCB 5EARA 2Z2NA 4GGAA 3EI4B 3K27A 4FWWA 3EI1B 5IGQA 4X3EA 2IURA 4A0AB 4XYHA 4FA4D 1PEVA 1MDAH 1SQ9A 1U4CA 1JMZB 2I3TA 2BCJB 5FA5B 1YFQA 3PXTD 4JSNC 2H9LA 5FKRA 4K3JB 3PVWB 4AOWA 5I5JA 5GXIA 4ESGA 3PE7A 5HQGA 2CN2A 2OVRB 4GQBB 4J82A 4JXMA 1NEXB 3C5MA 5HE0B 4A08B 5B4WA 2QC5A 3C75H 4CC9A 3AH8B 4BL0A 2UZXB 3OL2B 3UVMA 3IJ1A 3W15A 1K8KC 2P9PC 2YB8B 5TDHB 5HYNB 3UVOA 3EI2A 1N6DA 5FQDA 4CI1A 1SQJA 1GOTB 3VA6A 3I8EA 5FKSA 4A0BA 2HYEA 3UR4A 4L3GD 5AJAA 1K32A 3RRMC 4CZYA 4HDJA 3SVWD 5IJ7E 5TEFA 3IJCA 2YNPA 3OKYA 3E0CA 4J0XA 4NSXA 4A09A 4BUJC 3MZLA 5FLXg 4J0WA 4PC0A 1RI6A 4A7JA 3MZKA 3P4FA 4GMBA 4GGDA 2B5MA 4IMMA 5EMLB 3SJLD 2GNQA 3UVNA 3NVQA 4R7AB 1B9XA 3PXSD 5EM2A 3BG1A 1QNIA 5H1MA 5C2VB 1R5MA 3J81g 4J73A 4K3ID 2I0RA 3CFSB 4BH6A 3EMHA 3EI2B 2H9NA 2AQ5A 3L4MD 4AEZA 3PXWD 2CO0C 1Q47A 5TEEA 3DSMA 5CYKA 1VYHC 5HE1B 3IIYA 2HKRA 4A08A 4E54A 4IA9A 2H3XA 1XHMA 3SBRA 2H6QA 3JPXA 4A11B 4L9OA 2H6NA 3I7LA 3OL2A 3SCYA 5K1CC 3SHFA 2H68A 1U2VC 4ES0A 2HJBA 4O3UB 4OWRA 3J80g 2HKMA 3RFGA 3VH0A 3JB9L 3EI3A 5I5IA 2XU7A 3I2NA 1L0QA 1GP2B 3AL8B 2P9IC 5THAA 5JWZA 4PBYA 1A0RB 1PI6A 4A11A 3NVXA 4FAND 2BBKH 4PXWA 2IUVA 2AH0A 4PSWB 4Y7RA 2YNOA 3OKWA 5CYKB 3RLMD 3EWEA 2H14A 3V9FA 4CY1A 2QXVA 4CY3A 3KRWB 2IWFA 2H9MA 4JT6C 5TF2A 3K26A 4PBZA 4X63B 2AGZA 4J79A 2P9NC 1GXRA 2HESX 5K19A 1B9YA 4FAVD 3SFZA 4A2LA 3FGBA 4TZ4A 2IUQA 3I7HA 1OLZA 2YBAA 3MKQA 2TRCB 2CE9A 4UI9R 4A2MA 4CY5A 4D0KA 2CO0A 4KFMB 2EBSA 3ODTA 4CY2A 3SBQA 2J55H 3C9CA 4A0BB 4CI2A 4GM3A 3B7FA 3C99A 3IIWA 4JT5C 4ZOYA 2HJ4A 5FXYA 4J8BA 3OW8A 3MXXA 1MG3A 2OIZA 4QL1A 2Q7QA 2PM9B 4OZUA 3IKOA 4GZ8A 2Z2PA 3JZGA 3FRXA 5GSAA 3DM0A 2AGYA 3PVUB 4JSVC 5EMKB 4J8GA 3RSEC 3I89A 2XL2A 2J57G 2G99A 3EG6A 3EI3B 4PNKB 4CI8A 2H6KA 3JROA 1N6FA 2I0SA 4CZXA 3CFVA 4ZOXA 2AGWA 2AH1A 3UVLA 1P22A 2HXCA 5IC7A 3SWSD 5EMMB 3F3PA 1JJUB 3RMZD 1GG2B 4QRJA 1PBYB 4JD2C 2PM7B 5IT9g 2H9PA 3EU7A 5EM2B 3I8CA 2OJYA 4O45A 2IUPA 5C2WB 3L4OD 5GXHA 5H17A 3V5WB 3EI1A 3NVNA 4CZVA 3OKTA 3GREA 4H5JA 5C9ZB 5CXBB 3MMYA 4L3HD 2CNXA 4ERYA 2MTAH 2OVPB 2OVQB 5CXCA 3ORVD 1TYQC 2I3SA 5IJ8E 3MKSB 4QQEA 2B5LA 2B4EA 4FA5D 3RFHA 1JMXB 3UKRC 2PM6B 4X60B 4Y5RD 1FWXA 3U4YA 4J87A 4I79A 4YVDA 3BG0A 2P9UC 3PSLA 3DXMC 5CXBA 4O3TB 5EALA 4A0AA 4GQ2P 3BWSA 4J77A 1ERJA 1SHYB 2G9AA 3JRPA 3VGZA 3SN6B 3I7PA 2OK6A 4QT8A 5EMJB 4FHLA 3I7OA 4J78A 5SXMA 4MK0B 1PGUA 5HE2B 4Z8LA 4J86A 3JAMg 2AGXA 1JOFA 1TBGA 2J56H 3A0FA 4D6VA 4GM9A 2GC7A 1S4UX 2H47A 3I7KA 3JZHA 4CI3A 4JSPC 5FKTA 2P9KC 4E5ZA 3GFCA 3EI4A 1N6EA 5KDOB 4ZN4A 5A2Qg 3OKYB 2CE8A 3JZNA 4N14A 3DXKC 4ERQA 3F3GA 4ZOZA 4H5IA 4GGCA 4J84A 2GC4A 3DWLC 3CIKB 3ULEC
chains in the Genus database with same CATH superfamily
1E8MA 3IJ0A 3O4JA 3RN1D 2B5NA 2I0TA 3HFQA 4E54B 5I5MA 4XEIC 4QAMA 1NR0A 4E5ZB 3UKUC 4Z7OA 4ZOVA 3AFCA 4U7AA 4AX4A 5AFU3 3V7DB 2EIBA 3RN0D 2CN3A 2OK4A 5HE3B 2W18A 4NAAA 4X61B 2YNNA 5EAMA 2XL3A 4BCDA 5FKQA 3KRXB 2VZ3A 2XYIA 1GOHA 3SXTD 1MG2A 2IWKA 3N0DA 4U1EI 3OTTA 4GQ1A 4JSXC 4XYIA 2H13A 3ZWLB 4LG8A 4PSXB 5GMKn 3EQ8A 4J81A 3VI4A 2P9SC 2IAAA 4L1QD 4BP9A 2HU5A 2Z2OA 5E6RA 4O9DA 4LG9A 3N0EA 3UVKA 4EWRA 1OMWB 3DDUA 3SBPA 5HDBA 4G56B 4FA9D 5EAPA 3IJEA 4O1QD 3O4HA 1XIPA 2PM9A 3PSCB 3FM0A 4Z7QA 5AMSA 3SMRA 4ERZA 3SLED 1UOQA 4FA1D 1XKSA 5IGOA 4A09B 4LGNA 2EIEA 2P9LC 3AL9A 3I7NA 2AGLA 3F3FA 4BP8A 3K6SA 2O9KA 5H14A 2PBIB 2YMUA 4FB1D 5M5SA 3GC3B 3AL8A 3NIGA 1JV2A 4GM8A 2UZYB 5FFOA 5CXCB 3EQ9A 2BKLA 5EARA 1YR2A 2Z2NA 4GGAA 3EI4B 3K27A 4FWWA 3EI1B 5IGQA 1UOPA 1VZ3A 4X3EA 2IURA 4MMZA 4A0AB 4XYHA 4FA4D 1PEVA 1MDAH 1SQ9A 4G1EA 1U4CA 1JMZB 1U8CA 2I3TA 2BCJB 5FA5B 1L5GA 1YFQA 2EICA 3PXTD 1GOGA 3IUNA 3MUNA 4JSNC 4BCCA 2H9LA 5FKRA 4K3JB 3PVWB 4AOWA 5I5JA 5GXIA 4ESGA 3PE7A 5HQGA 2CN2A 2OVRB 4GQBB 4J82A 4JXMA 1NEXB 3C5MA 5HE0B 1QFMA 5B4WA 2QC5A 3FCSA 5M5RA 4A08B 1UOOA 3C75H 4WK4A 4CC9A 3AH8B 1H2ZA 4BL0A 1TYEA 2UZXB 3OL2B 3O4GA 3UVMA 4AN0A 3IJ1A 3W15A 4D9SA 1K8KC 3ZDYA 2P9PC 2YB8B 5TDHB 5HYNB 3UVOA 3EI2A 1N6DA 5FQDA 1T2XA 3FCUA 1SQJA 4CI1A 1GOTB 3VA6A 3I8EA 5FKSA 4A0BA 2HYEA 3UR4A 4L3GD 5AJAA 1K32A 3RRMC 4CZYA 4HDJA 3SVWD 4JHNA 5IJ7E 3ZDZA 5TEFA 3IJCA 5M5TA 2YNPA 3OKYA 3E0CA 4J0XA 4NSXA 3IVMA 4A09A 4BUJC 3MZLA 5C92A 4WJKA 5FLXg 4J0WA 4PC0A 1RI6A 2XE4A 4A7JA 3MZKA 4AMZA 3P4FA 4GMBA 4GGDA 2B5MA 3K72A 4IMMA 5EMLB 3SJLD 1VZ2A 2GNQA 3UVNA 3NVQA 4R7AB 1B9XA 3IUQA 3PXSD 5EM2A 3BG1A 1QNIA 5H1MA 5C2VB 1R5MA 3J81g 1H2XA 4J73A 3VI3A 4K3ID 2I0RA 3CFSB 3O4IA 2XDWA 4BH6A 3EMHA 2HU7A 3EI2B 2H9NA 2AQ5A 3L4MD 2EIDA 4AEZA 3EQ7A 3PXWD 1QFSA 1VE7A 2CO0C 1Q47A 5TEEA 3DSMA 5CYKA 1VYHC 5HE1B 3ULEC 3IIYA 1A12A 2HKRA 2QZPA 4A08A 4E54A 4IA9A 2H3XA 1XHMA 3SBRA 2H6QA 3JPXA 4A11B 4L9OA 2H6NA 4WK2A 3I7LA 3OL2A 3SCYA 5K1CC 3SHFA 1H2WA 2H68A 4IRZA 1U2VC 4ES0A 2HJBA 4O3UB 4RE6A 4OWRA 5M61A 3J80g 2HKMA 3RFGA 3VH0A 4NC4A 3EI3A 5I5IA 3JB9L 2XU7A 3I2NA 1L0QA 2VDMA 1GP2B 3AL8B 2P9IC 5THAA 5JWZA 4PBYA 1A0RB 1PI6A 4A11A 3NVXA 4FAND 1E8NA 2BBKH 4PXWA 2IUVA 2VDOA 2AH0A 2WQ8A 4PSWB 4Y7RA 3MUOA 2YNOA 3KCIA 3OKWA 5CYKB 2VZ1A 3RLMD 3EWEA 2H14A 3V9FA 4CY1A 2QXVA 4CY3A 1JTDB 3KRWB 2IWFA 2H9MA 4JT6C 5TF2A 4UM9A 3K26A 4NBMA 4G55A 4PBZA 4X63B 2AGZA 4J79A 2P9NC 1GXRA 2HESX 5K19A 1B9YA 4FAVD 4DNVA 3SFZA 5E6SA 4A2LA 4Z7NA 3FGBA 4TZ4A 2IUQA 3I7HA 1OLZA 2YBAA 3MKQA 2TRCB 2CE9A 4UI9R 3IUMA 4A2MA 4CY5A 4D0KA 5M5VA 4BCBA 2CO0A 4KFMB 2EBSA 3ODTA 4AMYA 2VDQA 4CY2A 3SBQA 2J55H 3C9CA 4A0BB 4CI2A 4GM3A 3B7FA 3C99A 3IIWA 4JT5C 4ZOYA 2HJ4A 5FXYA 1O6FA 4J8BA 3OW8A 1I2MB 3MXXA 1MG3A 5M5UA 2OIZA 4QL1A 2Q7QA 2PM9B 4OZUA 4WK0A 3IKOA 3IURA 2VDLA 4GZ8A 2Z2PA 3JZGA 3QI0A 3FRXA 5GSAA 2VDRA 3V4VA 3DM0A 2AGYA 3PVUB 4JSVC 5EMKB 4J8GA 4O2WA 3OF7A 3RSEC 3I89A 2XL2A 2J57G 2G99A 3EG6A 4JHPC 1BPOA 3EI3B 4PNKB 1E5TA 5FFGA 4CI8A 2H6KA 1UTCA 3JROA 1N6FA 2I0SA 4CZXA 3CFVA 4ZOXA 2AGWA 2AH1A 3ZE2A 3UVLA 1P22A 2HXCA 5IC7A 3SWSD 5EMMB 3F3PA 1JJUB 3RMZD 1GG2B 4QRJA 1PBYB 4JD2C 3NIFA 2PM7B 5IT9g 2H9PA 1VE6A 3ZDXA 3EU7A 5EM2B 3I8CA 2OJYA 4O45A 2IUPA 5C2WB 3L4OD 5GXHA 3IULA 5H17A 3V5WB 3EI1A 3NVNA 4CZVA 3OKTA 1GOFA 3GREA 4H5JA 5C9ZB 4DNWA 3V4PA 4L1MA 5CXBB 3MMYA 4L3HD 2CNXA 4ERYA 2MTAH 2OVPB 2HU8A 2OVQB 2QR5A 3K71A 5CXCA 3ORVD 1TYQC 2I3SA 5IJ8E 3MKSB 4QQEA 2B5LA 2B4EA 4FA5D 3RFHA 1JMXB 3UKRC 2PM6B 4X60B 4Y5RD 1FWXA 3NIDA 3U4YA 4J87A 1M1XA 4I79A 4YVDA 3ZE0A 3BG0A 2P9UC 3PSLA 2VC2A 1C9LA 3DXMC 4O3TB 5CXBA 5EALA 4A0AA 3T3MA 4UM8A 4MMYA 4GQ2P 3BWSA 4J77A 1ERJA 1SHYB 2G9AA 3JRPA 3VGZA 3SN6B 3I7PA 2OK6A 4QT8A 2XZGA 5EMJB 4G1MA 4FHLA 3I7OA 4J78A 2VDNA 2VDPA 3ZE1A 5SXMA 1O6GA 4MK0B 1PGUA 5HE2B 4RE5A 4AN1A 4Z8LA 4J86A 3JAMg 4NENA 2AGXA 4DNUA 1JOFA 1TBGA 2VDKA 2J56H 2JKXA 1K3IA 3A0FA 5C86A 4D6VA 4GM9A 3GD1I 2GC7A 1S4UX 3JZHA 2H47A 3I7KA 4CI3A 4JSPC 5FKTA 2P9KC 4E5ZA 3T3PA 3GFCA 3EI4A 1N6EA 3QHYB 5KDOB 4ZN4A 4O02A 3MVDK 5A2Qg 3OKYB 2CE8A 3IUJA 3JZNA 4N14A 3DXKC 4ERQA 3F3GA 4ZOZA 4H5IA 4GGCA 4J84A 5E6UA 1H2YA 3DWLC 2GC4A 3CIKB 4MMXA 1C9IA
chains in the Genus database with same CATH topology
3IJ0A 3RN1D 2B5NA 2I0TA 3HFQA 4E54B 5I5MA 4XEIC 1NR0A 4E5ZB 3UKUC 4ZOVA 3AFCA 4U7AA 5AFU3 3V7DB 3RN0D 2CN3A 2OK4A 5HE3B 2W18A 4X61B 2YNNA 5EAMA 2XL3A 5FKQA 3KRXB 2XYIA 3SXTD 1MG2A 2IWKA 3N0DA 4U1EI 3OTTA 4GQ1A 4JSXC 4XYIA 2H13A 3ZWLB 4LG8A 4PSXB 5GMKn 4J81A 2P9SC 2IAAA 4L1QD 2Z2OA 4O9DA 4LG9A 3N0EA 3UVKA 4EWRA 1OMWB 3SBPA 4FA9D 4G56B 5EAPA 4O1QD 1XIPA 2PM9A 3PSCB 3FM0A 5AMSA 3SMRA 4ERZA 3SLED 4FA1D 1XKSA 5IGOA 4A09B 4LGNA 2P9LC 3AL9A 3I7NA 2AGLA 3F3FA 2O9KA 5H14A 2PBIB 2YMUA 4FB1D 3AL8A 4GM8A 2UZYB 5CXCB 5EARA 2Z2NA 4GGAA 3EI4B 3K27A 4FWWA 3EI1B 5IGQA 4X3EA 2IURA 4A0AB 4XYHA 4FA4D 1PEVA 1MDAH 1SQ9A 1U4CA 1JMZB 2I3TA 2BCJB 5FA5B 1YFQA 3PXTD 4JSNC 2H9LA 5FKRA 4K3JB 3PVWB 4AOWA 5I5JA 5GXIA 4ESGA 3PE7A 5HQGA 2CN2A 2OVRB 4GQBB 4J82A 4JXMA 1NEXB 3C5MA 5HE0B 4A08B 5B4WA 2QC5A 3C75H 4CC9A 3AH8B 4BL0A 2UZXB 3OL2B 3UVMA 3IJ1A 3W15A 1K8KC 2P9PC 2YB8B 5TDHB 5HYNB 3UVOA 3EI2A 1N6DA 5FQDA 4CI1A 1SQJA 1GOTB 3VA6A 3I8EA 5FKSA 4A0BA 2HYEA 3UR4A 4L3GD 5AJAA 1K32A 3RRMC 4CZYA 4HDJA 3SVWD 5IJ7E 5TEFA 3IJCA 2YNPA 3OKYA 3E0CA 4J0XA 4NSXA 4A09A 4BUJC 3MZLA 5FLXg 4J0WA 4PC0A 1RI6A 4A7JA 3MZKA 3P4FA 4GMBA 4GGDA 2B5MA 4IMMA 5EMLB 3SJLD 2GNQA 3UVNA 3NVQA 4R7AB 1B9XA 3PXSD 5EM2A 3BG1A 1QNIA 5H1MA 5C2VB 1R5MA 3J81g 4J73A 4K3ID 2I0RA 3CFSB 4BH6A 3EMHA 3EI2B 2H9NA 2AQ5A 3L4MD 4AEZA 3PXWD 2CO0C 1Q47A 5TEEA 3DSMA 5CYKA 1VYHC 5HE1B 3IIYA 2HKRA 4A08A 4E54A 4IA9A 2H3XA 1XHMA 3SBRA 2H6QA 3JPXA 4A11B 4L9OA 2H6NA 3I7LA 3OL2A 3SCYA 5K1CC 3SHFA 2H68A 1U2VC 4ES0A 2HJBA 4O3UB 4OWRA 3J80g 2HKMA 3RFGA 3VH0A 3JB9L 3EI3A 5I5IA 2XU7A 3I2NA 1L0QA 1GP2B 3AL8B 2P9IC 5THAA 5JWZA 4PBYA 1A0RB 1PI6A 4A11A 3NVXA 4FAND 2BBKH 4PXWA 2IUVA 2AH0A 4PSWB 4Y7RA 2YNOA 3OKWA 5CYKB 3RLMD 3EWEA 2H14A 3V9FA 4CY1A 2QXVA 4CY3A 3KRWB 2IWFA 2H9MA 4JT6C 5TF2A 3K26A 4PBZA 4X63B 2AGZA 4J79A 2P9NC 1GXRA 2HESX 5K19A 1B9YA 4FAVD 3SFZA 4A2LA 3FGBA 4TZ4A 2IUQA 3I7HA 1OLZA 2YBAA 3MKQA 2TRCB 2CE9A 4UI9R 4A2MA 4CY5A 4D0KA 2CO0A 4KFMB 2EBSA 3ODTA 4CY2A 3SBQA 2J55H 3C9CA 4A0BB 4CI2A 4GM3A 3B7FA 3C99A 3IIWA 4JT5C 4ZOYA 2HJ4A 5FXYA 4J8BA 3OW8A 3MXXA 1MG3A 2OIZA 4QL1A 2Q7QA 2PM9B 4OZUA 3IKOA 4GZ8A 2Z2PA 3JZGA 3FRXA 5GSAA 3DM0A 2AGYA 3PVUB 4JSVC 5EMKB 4J8GA 3RSEC 3I89A 2XL2A 2J57G 2G99A 3EG6A 3EI3B 4PNKB 4CI8A 2H6KA 3JROA 1N6FA 2I0SA 4CZXA 3CFVA 4ZOXA 2AGWA 2AH1A 3UVLA 1P22A 2HXCA 5IC7A 3SWSD 5EMMB 3F3PA 1JJUB 3RMZD 1GG2B 4QRJA 1PBYB 4JD2C 2PM7B 5IT9g 2H9PA 3EU7A 5EM2B 3I8CA 2OJYA 4O45A 2IUPA 5C2WB 3L4OD 5GXHA 5H17A 3V5WB 3EI1A 3NVNA 4CZVA 3OKTA 3GREA 4H5JA 5C9ZB 5CXBB 3MMYA 4L3HD 2CNXA 4ERYA 2MTAH 2OVPB 2OVQB 5CXCA 3ORVD 1TYQC 2I3SA 5IJ8E 3MKSB 4QQEA 2B5LA 2B4EA 4FA5D 3RFHA 1JMXB 3UKRC 2PM6B 4X60B 4Y5RD 1FWXA 3U4YA 4J87A 4I79A 4YVDA 3BG0A 2P9UC 3PSLA 3DXMC 5CXBA 4O3TB 5EALA 4A0AA 4GQ2P 3BWSA 4J77A 1ERJA 1SHYB 2G9AA 3JRPA 3VGZA 3SN6B 3I7PA 2OK6A 4QT8A 5EMJB 4FHLA 3I7OA 4J78A 5SXMA 4MK0B 1PGUA 5HE2B 4Z8LA 4J86A 3JAMg 2AGXA 1JOFA 1TBGA 2J56H 3A0FA 4D6VA 4GM9A 2GC7A 1S4UX 2H47A 3I7KA 3JZHA 4CI3A 4JSPC 5FKTA 2P9KC 4E5ZA 3GFCA 3EI4A 1N6EA 5KDOB 4ZN4A 5A2Qg 3OKYB 2CE8A 3JZNA 4N14A 3DXKC 4ERQA 3F3GA 4ZOZA 4H5IA 4GGCA 4J84A 2GC4A 3DWLC 3CIKB 3ULEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ0 A;  3RN1 D;  2B5N A;  2I0T A;  3HFQ A;  4E54 B;  5I5M A;  4XEI C;  1NR0 A;  4E5Z B;  3UKU C;  4ZOV A;  3AFC A;  4U7A A;  5AFU 3;  3V7D B;  3RN0 D;  2CN3 A;  2OK4 A;  5HE3 B;  2W18 A;  4X61 B;  2YNN A;  5EAM A;  2XL3 A;  5FKQ A;  3KRX B;  2XYI A;  3SXT D;  1MG2 A;  2IWK A;  3N0D A;  4U1E I;  3OTT A;  4GQ1 A;  4JSX C;  4XYI A;  2H13 A;  3ZWL B;  4LG8 A;  4PSX B;  5GMK n;  4J81 A;  2P9S C;  2IAA A;  4L1Q D;  2Z2O A;  4O9D A;  4LG9 A;  3N0E A;  3UVK A;  4EWR A;  1OMW B;  3SBP A;  4FA9 D;  4G56 B;  5EAP A;  4O1Q D;  1XIP A;  2PM9 A;  3PSC B;  3FM0 A;  5AMS A;  3SMR A;  4ERZ A;  3SLE D;  4FA1 D;  1XKS A;  5IGO A;  4A09 B;  4LGN A;  2P9L C;  3AL9 A;  3I7N A;  2AGL A;  3F3F A;  2O9K A;  5H14 A;  2PBI B;  2YMU A;  4FB1 D;  3AL8 A;  4GM8 A;  2UZY B;  5CXC B;  5EAR A;  2Z2N A;  4GGA A;  3EI4 B;  3K27 A;  4FWW A;  3EI1 B;  5IGQ A;  4X3E A;  2IUR A;  4A0A B;  4XYH A;  4FA4 D;  1PEV A;  1MDA H;  1SQ9 A;  1U4C A;  1JMZ B;  2I3T A;  2BCJ B;  5FA5 B;  1YFQ A;  3PXT D;  4JSN C;  2H9L A;  5FKR A;  4K3J B;  3PVW B;  4AOW A;  5I5J A;  5GXI A;  4ESG A;  3PE7 A;  5HQG A;  2CN2 A;  2OVR B;  4GQB B;  4J82 A;  4JXM A;  1NEX B;  3C5M A;  5HE0 B;  4A08 B;  5B4W A;  2QC5 A;  3C75 H;  4CC9 A;  3AH8 B;  4BL0 A;  2UZX B;  3OL2 B;  3UVM A;  3IJ1 A;  3W15 A;  1K8K C;  2P9P C;  2YB8 B;  5TDH B;  5HYN B;  3UVO A;  3EI2 A;  1N6D A;  5FQD A;  4CI1 A;  1SQJ A;  1GOT B;  3VA6 A;  3I8E A;  5FKS A;  4A0B A;  2HYE A;  3UR4 A;  4L3G D;  5AJA A;  1K32 A;  3RRM C;  4CZY A;  4HDJ A;  3SVW D;  5IJ7 E;  5TEF A;  3IJC A;  2YNP A;  3OKY A;  3E0C A;  4J0X A;  4NSX A;  4A09 A;  4BUJ C;  3MZL A;  5FLX g;  4J0W A;  4PC0 A;  1RI6 A;  4A7J A;  3MZK A;  3P4F A;  4GMB A;  4GGD A;  2B5M A;  4IMM A;  5EML B;  3SJL D;  2GNQ A;  3UVN A;  3NVQ A;  4R7A B;  1B9X A;  3PXS D;  5EM2 A;  3BG1 A;  1QNI A;  5H1M A;  5C2V B;  1R5M A;  3J81 g;  4J73 A;  4K3I D;  2I0R A;  3CFS B;  4BH6 A;  3EMH A;  3EI2 B;  2H9N A;  2AQ5 A;  3L4M D;  4AEZ A;  3PXW D;  2CO0 C;  1Q47 A;  5TEE A;  3DSM A;  5CYK A;  1VYH C;  5HE1 B;  3IIY A;  2HKR A;  4A08 A;  4E54 A;  4IA9 A;  2H3X A;  1XHM A;  3SBR A;  2H6Q A;  3JPX A;  4A11 B;  4L9O A;  2H6N A;  3I7L A;  3OL2 A;  3SCY A;  5K1C C;  3SHF A;  2H68 A;  1U2V C;  4ES0 A;  2HJB A;  4O3U B;  4OWR A;  3J80 g;  2HKM A;  3RFG A;  3VH0 A;  3JB9 L;  3EI3 A;  5I5I A;  2XU7 A;  3I2N A;  1L0Q A;  1GP2 B;  3AL8 B;  2P9I C;  5THA A;  5JWZ A;  4PBY A;  1A0R B;  1PI6 A;  4A11 A;  3NVX A;  4FAN D;  2BBK H;  4PXW A;  2IUV A;  2AH0 A;  4PSW B;  4Y7R A;  2YNO A;  3OKW A;  5CYK B;  3RLM D;  3EWE A;  2H14 A;  3V9F A;  4CY1 A;  2QXV A;  4CY3 A;  3KRW B;  2IWF A;  2H9M A;  4JT6 C;  5TF2 A;  3K26 A;  4PBZ A;  4X63 B;  2AGZ A;  4J79 A;  2P9N C;  1GXR A;  2HES X;  5K19 A;  1B9Y A;  4FAV D;  3SFZ A;  4A2L A;  3FGB A;  4TZ4 A;  2IUQ A;  3I7H A;  1OLZ A;  2YBA A;  3MKQ A;  2TRC B;  2CE9 A;  4UI9 R;  4A2M A;  4CY5 A;  4D0K A;  2CO0 A;  4KFM B;  2EBS A;  3ODT A;  4CY2 A;  3SBQ A;  2J55 H;  3C9C A;  4A0B B;  4CI2 A;  4GM3 A;  3B7F A;  3C99 A;  3IIW A;  4JT5 C;  4ZOY A;  2HJ4 A;  5FXY A;  4J8B A;  3OW8 A;  3MXX A;  1MG3 A;  2OIZ A;  4QL1 A;  2Q7Q A;  2PM9 B;  4OZU A;  3IKO A;  4GZ8 A;  2Z2P A;  3JZG A;  3FRX A;  5GSA A;  3DM0 A;  2AGY A;  3PVU B;  4JSV C;  5EMK B;  4J8G A;  3RSE C;  3I89 A;  2XL2 A;  2J57 G;  2G99 A;  3EG6 A;  3EI3 B;  4PNK B;  4CI8 A;  2H6K A;  3JRO A;  1N6F A;  2I0S A;  4CZX A;  3CFV A;  4ZOX A;  2AGW A;  2AH1 A;  3UVL A;  1P22 A;  2HXC A;  5IC7 A;  3SWS D;  5EMM B;  3F3P A;  1JJU B;  3RMZ D;  1GG2 B;  4QRJ A;  1PBY B;  4JD2 C;  2PM7 B;  5IT9 g;  2H9P A;  3EU7 A;  5EM2 B;  3I8C A;  2OJY A;  4O45 A;  2IUP A;  5C2W B;  3L4O D;  5GXH A;  5H17 A;  3V5W B;  3EI1 A;  3NVN A;  4CZV A;  3OKT A;  3GRE A;  4H5J A;  5C9Z B;  5CXB B;  3MMY A;  4L3H D;  2CNX A;  4ERY A;  2MTA H;  2OVP B;  2OVQ B;  5CXC A;  3ORV D;  1TYQ C;  2I3S A;  5IJ8 E;  3MKS B;  4QQE A;  2B5L A;  2B4E A;  4FA5 D;  3RFH A;  1JMX B;  3UKR C;  2PM6 B;  4X60 B;  4Y5R D;  1FWX A;  3U4Y A;  4J87 A;  4I79 A;  4YVD A;  3BG0 A;  2P9U C;  3PSL A;  3DXM C;  5CXB A;  4O3T B;  5EAL A;  4A0A A;  4GQ2 P;  3BWS A;  4J77 A;  1ERJ A;  1SHY B;  2G9A A;  3JRP A;  3VGZ A;  3SN6 B;  3I7P A;  2OK6 A;  4QT8 A;  5EMJ B;  4FHL A;  3I7O A;  4J78 A;  5SXM A;  4MK0 B;  1PGU A;  5HE2 B;  4Z8L A;  4J86 A;  3JAM g;  2AGX A;  1JOF A;  1TBG A;  2J56 H;  3A0F A;  4D6V A;  4GM9 A;  2GC7 A;  1S4U X;  2H47 A;  3I7K A;  3JZH A;  4CI3 A;  4JSP C;  5FKT A;  2P9K C;  4E5Z A;  3GFC A;  3EI4 A;  1N6E A;  5KDO B;  4ZN4 A;  5A2Q g;  3OKY B;  2CE8 A;  3JZN A;  4N14 A;  3DXK C;  4ERQ A;  3F3G A;  4ZOZ A;  4H5I A;  4GGC A;  4J84 A;  2GC4 A;  3DWL C;  3CIK B;  3ULE C; 
#chains in the Genus database with same CATH topology
 1E8M A;  3IJ0 A;  3O4J A;  3RN1 D;  2B5N A;  2I0T A;  3HFQ A;  4E54 B;  5I5M A;  4XEI C;  4QAM A;  1NR0 A;  4E5Z B;  3UKU C;  4Z7O A;  4ZOV A;  3AFC A;  4U7A A;  4AX4 A;  5AFU 3;  3V7D B;  2EIB A;  3RN0 D;  2CN3 A;  2OK4 A;  5HE3 B;  2W18 A;  4NAA A;  4X61 B;  2YNN A;  5EAM A;  2XL3 A;  4BCD A;  5FKQ A;  3KRX B;  2VZ3 A;  2XYI A;  1GOH A;  3SXT D;  1MG2 A;  2IWK A;  3N0D A;  4U1E I;  3OTT A;  4GQ1 A;  4JSX C;  4XYI A;  2H13 A;  3ZWL B;  4LG8 A;  4PSX B;  5GMK n;  3EQ8 A;  4J81 A;  3VI4 A;  2P9S C;  2IAA A;  4L1Q D;  4BP9 A;  2HU5 A;  2Z2O A;  5E6R A;  4O9D A;  4LG9 A;  3N0E A;  3UVK A;  4EWR A;  1OMW B;  3DDU A;  3SBP A;  5HDB A;  4G56 B;  4FA9 D;  5EAP A;  3IJE A;  4O1Q D;  3O4H A;  1XIP A;  2PM9 A;  3PSC B;  3FM0 A;  4Z7Q A;  5AMS A;  3SMR A;  4ERZ A;  3SLE D;  1UOQ A;  4FA1 D;  1XKS A;  5IGO A;  4A09 B;  4LGN A;  2EIE A;  2P9L C;  3AL9 A;  3I7N A;  2AGL A;  3F3F A;  4BP8 A;  3K6S A;  2O9K A;  5H14 A;  2PBI B;  2YMU A;  4FB1 D;  5M5S A;  3GC3 B;  3AL8 A;  3NIG A;  1JV2 A;  4GM8 A;  2UZY B;  5FFO A;  5CXC B;  3EQ9 A;  2BKL A;  5EAR A;  1YR2 A;  2Z2N A;  4GGA A;  3EI4 B;  3K27 A;  4FWW A;  3EI1 B;  5IGQ A;  1UOP A;  1VZ3 A;  4X3E A;  2IUR A;  4MMZ A;  4A0A B;  4XYH A;  4FA4 D;  1PEV A;  1MDA H;  1SQ9 A;  4G1E A;  1U4C A;  1JMZ B;  1U8C A;  2I3T A;  2BCJ B;  5FA5 B;  1L5G A;  1YFQ A;  2EIC A;  3PXT D;  1GOG A;  3IUN A;  3MUN A;  4JSN C;  4BCC A;  2H9L A;  5FKR A;  4K3J B;  3PVW B;  4AOW A;  5I5J A;  5GXI A;  4ESG A;  3PE7 A;  5HQG A;  2CN2 A;  2OVR B;  4GQB B;  4J82 A;  4JXM A;  1NEX B;  3C5M A;  5HE0 B;  1QFM A;  5B4W A;  2QC5 A;  3FCS A;  5M5R A;  4A08 B;  1UOO A;  3C75 H;  4WK4 A;  4CC9 A;  3AH8 B;  1H2Z A;  4BL0 A;  1TYE A;  2UZX B;  3OL2 B;  3O4G A;  3UVM A;  4AN0 A;  3IJ1 A;  3W15 A;  4D9S A;  1K8K C;  3ZDY A;  2P9P C;  2YB8 B;  5TDH B;  5HYN B;  3UVO A;  3EI2 A;  1N6D A;  5FQD A;  1T2X A;  3FCU A;  1SQJ A;  4CI1 A;  1GOT B;  3VA6 A;  3I8E A;  5FKS A;  4A0B A;  2HYE A;  3UR4 A;  4L3G D;  5AJA A;  1K32 A;  3RRM C;  4CZY A;  4HDJ A;  3SVW D;  4JHN A;  5IJ7 E;  3ZDZ A;  5TEF A;  3IJC A;  5M5T A;  2YNP A;  3OKY A;  3E0C A;  4J0X A;  4NSX A;  3IVM A;  4A09 A;  4BUJ C;  3MZL A;  5C92 A;  4WJK A;  5FLX g;  4J0W A;  4PC0 A;  1RI6 A;  2XE4 A;  4A7J A;  3MZK A;  4AMZ A;  3P4F A;  4GMB A;  4GGD A;  2B5M A;  3K72 A;  4IMM A;  5EML B;  3SJL D;  1VZ2 A;  2GNQ A;  3UVN A;  3NVQ A;  4R7A B;  1B9X A;  3IUQ A;  3PXS D;  5EM2 A;  3BG1 A;  1QNI A;  5H1M A;  5C2V B;  1R5M A;  3J81 g;  1H2X A;  4J73 A;  3VI3 A;  4K3I D;  2I0R A;  3CFS B;  3O4I A;  2XDW A;  4BH6 A;  3EMH A;  2HU7 A;  3EI2 B;  2H9N A;  2AQ5 A;  3L4M D;  2EID A;  4AEZ A;  3EQ7 A;  3PXW D;  1QFS A;  1VE7 A;  2CO0 C;  1Q47 A;  5TEE A;  3DSM A;  5CYK A;  1VYH C;  5HE1 B;  3ULE C;  3IIY A;  1A12 A;  2HKR A;  2QZP A;  4A08 A;  4E54 A;  4IA9 A;  2H3X A;  1XHM A;  3SBR A;  2H6Q A;  3JPX A;  4A11 B;  4L9O A;  2H6N A;  4WK2 A;  3I7L A;  3OL2 A;  3SCY A;  5K1C C;  3SHF A;  1H2W A;  2H68 A;  4IRZ A;  1U2V C;  4ES0 A;  2HJB A;  4O3U B;  4RE6 A;  4OWR A;  5M61 A;  3J80 g;  2HKM A;  3RFG A;  3VH0 A;  4NC4 A;  3EI3 A;  5I5I A;  3JB9 L;  2XU7 A;  3I2N A;  1L0Q A;  2VDM A;  1GP2 B;  3AL8 B;  2P9I C;  5THA A;  5JWZ A;  4PBY A;  1A0R B;  1PI6 A;  4A11 A;  3NVX A;  4FAN D;  1E8N A;  2BBK H;  4PXW A;  2IUV A;  2VDO A;  2AH0 A;  2WQ8 A;  4PSW B;  4Y7R A;  3MUO A;  2YNO A;  3KCI A;  3OKW A;  5CYK B;  2VZ1 A;  3RLM D;  3EWE A;  2H14 A;  3V9F A;  4CY1 A;  2QXV A;  4CY3 A;  1JTD B;  3KRW B;  2IWF A;  2H9M A;  4JT6 C;  5TF2 A;  4UM9 A;  3K26 A;  4NBM A;  4G55 A;  4PBZ A;  4X63 B;  2AGZ A;  4J79 A;  2P9N C;  1GXR A;  2HES X;  5K19 A;  1B9Y A;  4FAV D;  4DNV A;  3SFZ A;  5E6S A;  4A2L A;  4Z7N A;  3FGB A;  4TZ4 A;  2IUQ A;  3I7H A;  1OLZ A;  2YBA A;  3MKQ A;  2TRC B;  2CE9 A;  4UI9 R;  3IUM A;  4A2M A;  4CY5 A;  4D0K A;  5M5V A;  4BCB A;  2CO0 A;  4KFM B;  2EBS A;  3ODT A;  4AMY A;  2VDQ A;  4CY2 A;  3SBQ A;  2J55 H;  3C9C A;  4A0B B;  4CI2 A;  4GM3 A;  3B7F A;  3C99 A;  3IIW A;  4JT5 C;  4ZOY A;  2HJ4 A;  5FXY A;  1O6F A;  4J8B A;  3OW8 A;  1I2M B;  3MXX A;  1MG3 A;  5M5U A;  2OIZ A;  4QL1 A;  2Q7Q A;  2PM9 B;  4OZU A;  4WK0 A;  3IKO A;  3IUR A;  2VDL A;  4GZ8 A;  2Z2P A;  3JZG A;  3QI0 A;  3FRX A;  5GSA A;  2VDR A;  3V4V A;  3DM0 A;  2AGY A;  3PVU B;  4JSV C;  5EMK B;  4J8G A;  4O2W A;  3OF7 A;  3RSE C;  3I89 A;  2XL2 A;  2J57 G;  2G99 A;  3EG6 A;  4JHP C;  1BPO A;  3EI3 B;  4PNK B;  1E5T A;  5FFG A;  4CI8 A;  2H6K A;  1UTC A;  3JRO A;  1N6F A;  2I0S A;  4CZX A;  3CFV A;  4ZOX A;  2AGW A;  2AH1 A;  3ZE2 A;  3UVL A;  1P22 A;  2HXC A;  5IC7 A;  3SWS D;  5EMM B;  3F3P A;  1JJU B;  3RMZ D;  1GG2 B;  4QRJ A;  1PBY B;  4JD2 C;  3NIF A;  2PM7 B;  5IT9 g;  2H9P A;  1VE6 A;  3ZDX A;  3EU7 A;  5EM2 B;  3I8C A;  2OJY A;  4O45 A;  2IUP A;  5C2W B;  3L4O D;  5GXH A;  3IUL A;  5H17 A;  3V5W B;  3EI1 A;  3NVN A;  4CZV A;  3OKT A;  1GOF A;  3GRE A;  4H5J A;  5C9Z B;  4DNW A;  3V4P A;  4L1M A;  5CXB B;  3MMY A;  4L3H D;  2CNX A;  4ERY A;  2MTA H;  2OVP B;  2HU8 A;  2OVQ B;  2QR5 A;  3K71 A;  5CXC A;  3ORV D;  1TYQ C;  2I3S A;  5IJ8 E;  3MKS B;  4QQE A;  2B5L A;  2B4E A;  4FA5 D;  3RFH A;  1JMX B;  3UKR C;  2PM6 B;  4X60 B;  4Y5R D;  1FWX A;  3NID A;  3U4Y A;  4J87 A;  1M1X A;  4I79 A;  4YVD A;  3ZE0 A;  3BG0 A;  2P9U C;  3PSL A;  2VC2 A;  1C9L A;  3DXM C;  4O3T B;  5CXB A;  5EAL A;  4A0A A;  3T3M A;  4UM8 A;  4MMY A;  4GQ2 P;  3BWS A;  4J77 A;  1ERJ A;  1SHY B;  2G9A A;  3JRP A;  3VGZ A;  3SN6 B;  3I7P A;  2OK6 A;  4QT8 A;  2XZG A;  5EMJ B;  4G1M A;  4FHL A;  3I7O A;  4J78 A;  2VDN A;  2VDP A;  3ZE1 A;  5SXM A;  1O6G A;  4MK0 B;  1PGU A;  5HE2 B;  4RE5 A;  4AN1 A;  4Z8L A;  4J86 A;  3JAM g;  4NEN A;  2AGX A;  4DNU A;  1JOF A;  1TBG A;  2VDK A;  2J56 H;  2JKX A;  1K3I A;  3A0F A;  5C86 A;  4D6V A;  4GM9 A;  3GD1 I;  2GC7 A;  1S4U X;  3JZH A;  2H47 A;  3I7K A;  4CI3 A;  4JSP C;  5FKT A;  2P9K C;  4E5Z A;  3T3P A;  3GFC A;  3EI4 A;  1N6E A;  3QHY B;  5KDO B;  4ZN4 A;  4O02 A;  3MVD K;  5A2Q g;  3OKY B;  2CE8 A;  3IUJ A;  3JZN A;  4N14 A;  3DXK C;  4ERQ A;  3F3G A;  4ZOZ A;  4H5I A;  4GGC A;  4J84 A;  5E6U A;  1H2Y A;  3DWL C;  2GC4 A;  3CIK B;  4MMX A;  1C9I A; 
#chains in the Genus database with same CATH homology
 3IJ0 A;  3RN1 D;  2B5N A;  2I0T A;  3HFQ A;  4E54 B;  5I5M A;  4XEI C;  1NR0 A;  4E5Z B;  3UKU C;  4ZOV A;  3AFC A;  4U7A A;  5AFU 3;  3V7D B;  3RN0 D;  2CN3 A;  2OK4 A;  5HE3 B;  2W18 A;  4X61 B;  2YNN A;  5EAM A;  2XL3 A;  5FKQ A;  3KRX B;  2XYI A;  3SXT D;  1MG2 A;  2IWK A;  3N0D A;  4U1E I;  3OTT A;  4GQ1 A;  4JSX C;  4XYI A;  2H13 A;  3ZWL B;  4LG8 A;  4PSX B;  5GMK n;  4J81 A;  2P9S C;  2IAA A;  4L1Q D;  2Z2O A;  4O9D A;  4LG9 A;  3N0E A;  3UVK A;  4EWR A;  1OMW B;  3SBP A;  4FA9 D;  4G56 B;  5EAP A;  4O1Q D;  1XIP A;  2PM9 A;  3PSC B;  3FM0 A;  5AMS A;  3SMR A;  4ERZ A;  3SLE D;  4FA1 D;  1XKS A;  5IGO A;  4A09 B;  4LGN A;  2P9L C;  3AL9 A;  3I7N A;  2AGL A;  3F3F A;  2O9K A;  5H14 A;  2PBI B;  2YMU A;  4FB1 D;  3AL8 A;  4GM8 A;  2UZY B;  5CXC B;  5EAR A;  2Z2N A;  4GGA A;  3EI4 B;  3K27 A;  4FWW A;  3EI1 B;  5IGQ A;  4X3E A;  2IUR A;  4A0A B;  4XYH A;  4FA4 D;  1PEV A;  1MDA H;  1SQ9 A;  1U4C A;  1JMZ B;  2I3T A;  2BCJ B;  5FA5 B;  1YFQ A;  3PXT D;  4JSN C;  2H9L A;  5FKR A;  4K3J B;  3PVW B;  4AOW A;  5I5J A;  5GXI A;  4ESG A;  3PE7 A;  5HQG A;  2CN2 A;  2OVR B;  4GQB B;  4J82 A;  4JXM A;  1NEX B;  3C5M A;  5HE0 B;  4A08 B;  5B4W A;  2QC5 A;  3C75 H;  4CC9 A;  3AH8 B;  4BL0 A;  2UZX B;  3OL2 B;  3UVM A;  3IJ1 A;  3W15 A;  1K8K C;  2P9P C;  2YB8 B;  5TDH B;  5HYN B;  3UVO A;  3EI2 A;  1N6D A;  5FQD A;  4CI1 A;  1SQJ A;  1GOT B;  3VA6 A;  3I8E A;  5FKS A;  4A0B A;  2HYE A;  3UR4 A;  4L3G D;  5AJA A;  1K32 A;  3RRM C;  4CZY A;  4HDJ A;  3SVW D;  5IJ7 E;  5TEF A;  3IJC A;  2YNP A;  3OKY A;  3E0C A;  4J0X A;  4NSX A;  4A09 A;  4BUJ C;  3MZL A;  5FLX g;  4J0W A;  4PC0 A;  1RI6 A;  4A7J A;  3MZK A;  3P4F A;  4GMB A;  4GGD A;  2B5M A;  4IMM A;  5EML B;  3SJL D;  2GNQ A;  3UVN A;  3NVQ A;  4R7A B;  1B9X A;  3PXS D;  5EM2 A;  3BG1 A;  1QNI A;  5H1M A;  5C2V B;  1R5M A;  3J81 g;  4J73 A;  4K3I D;  2I0R A;  3CFS B;  4BH6 A;  3EMH A;  3EI2 B;  2H9N A;  2AQ5 A;  3L4M D;  4AEZ A;  3PXW D;  2CO0 C;  1Q47 A;  5TEE A;  3DSM A;  5CYK A;  1VYH C;  5HE1 B;  3IIY A;  2HKR A;  4A08 A;  4E54 A;  4IA9 A;  2H3X A;  1XHM A;  3SBR A;  2H6Q A;  3JPX A;  4A11 B;  4L9O A;  2H6N A;  3I7L A;  3OL2 A;  3SCY A;  5K1C C;  3SHF A;  2H68 A;  1U2V C;  4ES0 A;  2HJB A;  4O3U B;  4OWR A;  3J80 g;  2HKM A;  3RFG A;  3VH0 A;  3JB9 L;  3EI3 A;  5I5I A;  2XU7 A;  3I2N A;  1L0Q A;  1GP2 B;  3AL8 B;  2P9I C;  5THA A;  5JWZ A;  4PBY A;  1A0R B;  1PI6 A;  4A11 A;  3NVX A;  4FAN D;  2BBK H;  4PXW A;  2IUV A;  2AH0 A;  4PSW B;  4Y7R A;  2YNO A;  3OKW A;  5CYK B;  3RLM D;  3EWE A;  2H14 A;  3V9F A;  4CY1 A;  2QXV A;  4CY3 A;  3KRW B;  2IWF A;  2H9M A;  4JT6 C;  5TF2 A;  3K26 A;  4PBZ A;  4X63 B;  2AGZ A;  4J79 A;  2P9N C;  1GXR A;  2HES X;  5K19 A;  1B9Y A;  4FAV D;  3SFZ A;  4A2L A;  3FGB A;  4TZ4 A;  2IUQ A;  3I7H A;  1OLZ A;  2YBA A;  3MKQ A;  2TRC B;  2CE9 A;  4UI9 R;  4A2M A;  4CY5 A;  4D0K A;  2CO0 A;  4KFM B;  2EBS A;  3ODT A;  4CY2 A;  3SBQ A;  2J55 H;  3C9C A;  4A0B B;  4CI2 A;  4GM3 A;  3B7F A;  3C99 A;  3IIW A;  4JT5 C;  4ZOY A;  2HJ4 A;  5FXY A;  4J8B A;  3OW8 A;  3MXX A;  1MG3 A;  2OIZ A;  4QL1 A;  2Q7Q A;  2PM9 B;  4OZU A;  3IKO A;  4GZ8 A;  2Z2P A;  3JZG A;  3FRX A;  5GSA A;  3DM0 A;  2AGY A;  3PVU B;  4JSV C;  5EMK B;  4J8G A;  3RSE C;  3I89 A;  2XL2 A;  2J57 G;  2G99 A;  3EG6 A;  3EI3 B;  4PNK B;  4CI8 A;  2H6K A;  3JRO A;  1N6F A;  2I0S A;  4CZX A;  3CFV A;  4ZOX A;  2AGW A;  2AH1 A;  3UVL A;  1P22 A;  2HXC A;  5IC7 A;  3SWS D;  5EMM B;  3F3P A;  1JJU B;  3RMZ D;  1GG2 B;  4QRJ A;  1PBY B;  4JD2 C;  2PM7 B;  5IT9 g;  2H9P A;  3EU7 A;  5EM2 B;  3I8C A;  2OJY A;  4O45 A;  2IUP A;  5C2W B;  3L4O D;  5GXH A;  5H17 A;  3V5W B;  3EI1 A;  3NVN A;  4CZV A;  3OKT A;  3GRE A;  4H5J A;  5C9Z B;  5CXB B;  3MMY A;  4L3H D;  2CNX A;  4ERY A;  2MTA H;  2OVP B;  2OVQ B;  5CXC A;  3ORV D;  1TYQ C;  2I3S A;  5IJ8 E;  3MKS B;  4QQE A;  2B5L A;  2B4E A;  4FA5 D;  3RFH A;  1JMX B;  3UKR C;  2PM6 B;  4X60 B;  4Y5R D;  1FWX A;  3U4Y A;  4J87 A;  4I79 A;  4YVD A;  3BG0 A;  2P9U C;  3PSL A;  3DXM C;  5CXB A;  4O3T B;  5EAL A;  4A0A A;  4GQ2 P;  3BWS A;  4J77 A;  1ERJ A;  1SHY B;  2G9A A;  3JRP A;  3VGZ A;  3SN6 B;  3I7P A;  2OK6 A;  4QT8 A;  5EMJ B;  4FHL A;  3I7O A;  4J78 A;  5SXM A;  4MK0 B;  1PGU A;  5HE2 B;  4Z8L A;  4J86 A;  3JAM g;  2AGX A;  1JOF A;  1TBG A;  2J56 H;  3A0F A;  4D6V A;  4GM9 A;  2GC7 A;  1S4U X;  2H47 A;  3I7K A;  3JZH A;  4CI3 A;  4JSP C;  5FKT A;  2P9K C;  4E5Z A;  3GFC A;  3EI4 A;  1N6E A;  5KDO B;  4ZN4 A;  5A2Q g;  3OKY B;  2CE8 A;  3JZN A;  4N14 A;  3DXK C;  4ERQ A;  3F3G A;  4ZOZ A;  4H5I A;  4GGC A;  4J84 A;  2GC4 A;  3DWL C;  3CIK B;  3ULE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...