2O9PA

Beta-glucosidase b from paenibacillus polymyxa
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase B
publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 167
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9pA00
1HJVA 2BS9A 1G01A 5HPOA 1V0MA 3D5HA 4MDOA 3W28A 1UKQA 3AMCA 3OG2A 4QFUA 3SCSA 1JZ4A 3NSMA 4Z2JA 4X0NA 1HJWA 1EOMA 3NUKA 1E15A 3QHOA 3BAJA 2EPLX 4MAZA 4QP0A 1NARA 1E6SM 1V3JA 4PCTA 2WAGA 1HL8A 5DFAA 3WY1A 2VQUA 5A2BA 1KXVA 1GCYA 1JI1A 1NOFA 4D1IA 2YJQA 3HN3A 5A6SA 4HPGA 4CVUA 4KGLA 1W3HA 4W86A 5A6BD 4QLKA 4AEFA 4CN6A 4JCMA 1X6NA 1SR0A 5DT7A 1W9XA 1H2JA 5CLTA 5JBEA 2XVKA 3SCUA 4OBSA 3WQVA 1QW9A 3KL5A 3WQ4A 1UWTA 4IPNB 1EO7A 1GW1A 2XGIA 3NSNA 1B0IA 4UZSA 4BF7A 2WWCA 1ZU8A 2NW0A 2NT1A 4CKQA 2J7CA 2VZSA 3BSGA 3AIQA 1KXQA 3G6MA 2FHCA 1GPFA 4E8CA 1DWJM 1BYAA 4ACZA 1GVIA 2JF6A 2EQDA 5ECUA 1BYCA 1E9LA 2VRJA 3BMVA 1X6LA 3CUFA 3AIVA 3TTQA 4LYRA 3A4WA 1H41A 2DT3A 4TXEA 2F2HA 2OSWA 4UOZA 2O9OA 2XM2A 3KEHA 1V3HA 1JFHA 1BPLB 2TAAA 1GQJA 2C0HA 2J8FA 2VX6A 4Z2LA 3VUPA 1WP6A 4BQ4A 4HU0A 3RPMA 1OT1A 2BVYA 3UG5A 1L0PA 2GDUA 4N0RA 3CZJA 3ARZA 1AQ0A 2QMJA 4IUGA 3ARRA 1UWQA 1WE5A 6TAAA 4HZ8A 2WSPA 1QNPA 1GORA 4MB1A 3GNOA 4PMNA 3ARVA 1JYWA 1XHGA 1DWGM 2Y8VA 2QPSA 3MSDA 4FLRA 4D6GA 1H11A 1B2YA 2VR4A 2ZUMA 4KRUA 3OA5A 5I78A 3KWXA 3WQWA 4AZIA 4AISA 3BCDA 1G0CA 1E1EA 1FHLA 1E56A 2WM0A 1CGTA 1CGXA 1QNSA 5AYIA 2XFRA 3K46A 4DUWA 3WN6A 3AYSA 1JI2A 5HOSA 4C7FA 1GNXA 2W61A 1CDGA 5BCAA 1HNYA 3U7VA 3AMGA 5HDRA 4CD4A 4HOWA 1DWHM 2YBTA 1PX4A 3S2CA 3RO8A 2MANA 1VF8A 3ZM8A 2DQXA 2WZIA 4ATWA 5M03A 4DWSA 1PIFA 2X8RA 4PEEA 3FAWA 5HNNA 3IAQA 1AQHA 5LA1A 3IJ9A 5JBDA 4NF7A 1WAWA 4U33A 3WL1A 5I3DA 1NP0A 1ESWA 1LWJA 2XVLA 3CMGA 4Z2GA 4CN1A 3CHFA 2Q8XA 2J7HA 3WH9A 3WF2A 5I5RA 4BZYA 1W9PA 2WB5A 1UR4A 2DIJA 2J7GA 4AMCA 3TTYA 1EOKA 2WKGA 1CXKA 4MNJA 4P7OA 2D20A 1UZ1A 1E72M 2JEQA 2WVVB 2EPNA 2Y2WA 2W62A 3DYOA 3OGSA 3A4AA 5D9MA 1PZ2A 4MJ4A 1CYGA 1UD2A 4W5UA 4W7VA 3W82A 4UCFA 1NOWA 2AOSA 3F5JA 1TG7A 2ZXBA 3K4DA 1E5JA 2WCAA 4AY1A 3U57A 2BXYA 2WMGA 3RM4A 3LPOA 4JAWA 2VVNA 3WNMA 5M5DA 1LL7A 4XB3A 1B3ZA 2VZOA 3SCOA 1EDTA 1ECEA 4UFMA 1MVYA 4W89A 4Z2IA 4JKMA 5CQ1A 1UWSA 1Q6FA 5FL1A 4W84A 1H0IA 3WQ6A 3CZKA 1G94A 1ZL1A 3MMDA 3VGHA 4D6FA 4W5ZA 3ALGA 3AZTA 1XCWA 3WMCA 2O92A 4TVUA 4OUEA 4LPCA 1TUXA 5ABGA 3VIKA 3T08A 1VFUA 3RIKA 4LXFA 2XIIA 1M53A 1HXJA 1DWIM 1E40A 4W93A 3NYDA 4AIUA 2OSYA 2O9TA 4HZ6A 3W26A 4GIAA 4Z2KA 5A8MA 1OCQA 3DYMA 4F8XA 1NWUA 3O6AA 5E70A 3K8LA 5A95A 3AOFA 4FLOA 3J7HA 1OGSA 4LQ1A 4DM2A 2YLLA 4BQ2A 4OOZA 1BGGA 1KGUA 4EK7A 3W4RA 3AISA 1E6XM 2NT0A 2EEXA 3K4AA 5TD4A 3VILA 4MAVA 1FP9A 1CECA 2WHMA 2JIEA 3O2LA 4JFVA 4HMEA 1QI5A 2DH2A 5EBAA 2ZX6A 3A47A 4W85A 3VDAA 1OGBA 2OWWA 1DHKA 1GVYA 7A3HA 1P6WA 1BG9A 4FF5A 1QI3A 3T0BA 2Y24A 1XD1A 4AIOA 3AHXA 2J25A 1OWQA 3AS2A 1V6YA 3PTQA 1ZBWA 1S46A 3A6OA 3OLGA 2CYGA 1CGVA 2VQTA 3BXWA 1KWGA 2J7DA 4PSRA 3W38A 3M46A 1LF1A 4NSBA 5A8NA 1ZS2A 2BHUA 1CNVA 5C70A 3VX0A 3WF3A 3ALFA 1WZAA 2CPUA 4AWEA 3M07A 1K6AA 1JZ6A 4PUEA 5CLWA 3PTMA 2V3EA 4B3LA 1WDQA 1FFRA 2EJ1A 3M7SA 4W87A 3WFZA 3VIGA 1GQLA 2DT2A 2V3GA 3VD9A 1GOMA 5A3HA 4AC1X 3EMQA 4UOQA 1QVBA 4BQ3A 3OZPA 2VMFA 3WH7A 2V5DA 1BFNA 1E43A 3SCRA 1E5NA 2JEPA 2W91A 1U30A 3WDHA 2XWDA 5D4YA 4MADA 3ARSA 3VX1A 3WKZA 2OYLA 3GDBA 4P7LA 3UG3A 4ZXLA 2ZOXA 1YHTA 3QHMA 5EMYA 3T2PA 2GSJA 2XFYA 2VX4A 4GI9A 4PTMA 1DEDA 4UOJA 5E0CA 5I23A 4PYSA 1C7SA 1GZJA 1VFMA 5A69A 3AROA 3AMKA 1GOQA 1W1YA 3AHVA 3I3DA 4E2OA 3WUBA 1C93A 3PZ9A 1CXIA 3BGAA 5A8PA 2O9PA 3L4WA 4M82A 4JIEA 3ZR5A 4GO9A 2CBJA 4WJXA 2D3NA 4PMRA 2RGMA 3W53A 1XRVA 1ZJBA 1H3GA 2EPOA 1ZBCA 5CJ5A 1WDRA 1B3VA 1CXEA 2XPKA 3QGVA 1B3WA 2A3HA 2GJRA 3KL0A 1Q6GA 1SMDA 1YQ2A 3E1F1 3OLEA 4CD5A 2VJXA 1CLVA 1UA7A 1R7OA 1OSEA 3WDIA 4W7WA 1J11A 1HN1A 1G1YA 2ZIDA 2DDXA 1DWAM 4X9YA 1G9HA 2UY3A 4NRRA 5D8WA 4D6DA 3VIHA 4AD1A 3ARWA 4JCLA 2Z1SA 5ABFA 1RH9A 2XG9A 5E6ZA 4MB4A 4UR9A 5D9OA 2E3ZA 1CXFA 4WKAA 1KQYA 2PBGA 1JIBA 1W9VA 1XGZA 3IJ7A 1WPCA 1V02E 1V6WA 2YDSA 1QBBA 1KFWA 2DT1A 4IM4A 2Z1KA 4Z2HA 3I3BA 3AICA 1KGWA 2FHBA 2VZUA 5FD0A 4UQDA 2YA2A 4J27A 4P7QA 5CZKA 1B3YA 3HU7A 4HTYA 4PN2A 1IV8A 1GHRA 1MW1A 4W7UA 4V28A 1QNQA 2WNWA 4U31A 1GHSA 1UD3A 4AD5A 4EKJA 5D9NA 2J47A 3WQ5A 4P7NA 5FIPA 4U2ZA 2GJXA 4ACYA 2WCGA 1C3FA 2UY5A 1ZBVA 1US3A 1UKPA 3VGEA 4V2XA 2CKSA 1XSIA 3GNRA 4RL3A 2WC4A 2WMFA 3WD2A 4H8UA 1WZMA 3WF0A 4ZEPA 1M01A 2A3CA 3WDRA 3GXDA 2JE8A 2VUYA 4W8AA 1EQCA 1ISVA 1NM9A 4B15A 3MUIA 4XV0A 5DO8A 4MNLA 1TA3B 5GQBA 3UR7A 3F5LA 1V03A 3W25A 3N13A 4K68A 1C92A 1J0IA 3GBEA 3PBGA 1WZKA 2UY4A 4URIA 7CGTA 1IZJA 4KRTA 3FN9A 1VJZA 2X0HA 3VPLA 2D1ZA 1LG2A 5A6BA 1K9TA 3WD1A 4HA1A 4H8VA 5CPSA 1M03A 4TOQA 1JZ3A 2ZUVA 4PMQA 4AD0A 5BRPA 1FHDA 4RE4A 3DYPA 3VINA 5JIWA 2ZUUA 1JZ8A 3IAPA 3MV01 1R86A 1W9BM 4EE9A 1EHNA 3ARQA 4UFLA 2ESCA 4W8BA 5DF0A 5AC4A 1HJUA 4D6CA 3EDEA 2J77A 3WEMA 4WKHA 3F4VA 3UESA 3AIWA 1WZLA 1BLIA 5ABEA 4MDPA 3AS3A 3OBAA 3VDHA 4S3JA 4ZENA 2JIWA 1BAGA 3PZIA 2YDRA 2PC8A 1JL8A 1QNRA 1PAMA 3FNDA 3MKKA 2BXZA 2GK1B 3OZOA 1UWIA 3EDJA 1RP8A 2CNCA 3ZT6A 1EHAA 5GNXA 3A4XA 2GDVA 1PBGA 3EBVA 2BHYA 3U5YA 3WD3A 3WELA 3NJ3A 4AZ7A 2EO7A 2NSXA 1LWHA 3CUHA 1CXHA 4CCEA 2XVGA 1JAEA 1FA2A 1HKIA 3AHTA 5FL0A 2EPMX 3PZUA 4LGXA 5I79A 2VL4A 3M6DA 4J3VA 4CGTA 1CWYA 2OWCA 2WMJA 4M1RA 4L4OA 3CBWA 3AIBA 4RE3A 1A47A 2XFFA 1ZBKA 3UERA 4CD8A 1BF2A 4U5KA 1LL6A 2CBIA 1CBGA 3N18A 1W32A 1MXGA 3K8MA 3CHDA 4UQ9A 2VRQA 1WDSA 3BCFA 1PEZA 1QBAA 3ZSTA 3EMCA 2D0HA 2D2OA 1V6VA 1HJSA 1UH3A 2VRKA 2XJ7A 2WVVA 1W1PA 1XCXA 2XSAA 4N42A 2VCBA 3SUTA 3TTOA 1V3IA 5A1AA 3WF1A 2BVDA 1V0LA 3BMWA 3MUY1 5JUVA 2YL5A 4PMUA 2WC7A 2WMHA 3BLPX 3EDDA 1V08A 4U2YA 3VIIA 4ZE4A 5C71A 1OB0A 4DWSD 3BAWA 1UKOA 3FY1A 1W3KA 4UQBA 1DWFM 1GOKA 1WCGA 4JL1A 3VM7A 4HU8A 1AQMA 4HZ7A 5AC5A 3SURA 3BH4A 3TP4A 3SEPA 1JD9A 1OIMA 3ZJ6A 3VD7A 5AY7A 4M80A 1PPIA 3ZR6A 8A3HA 3PTKA 3T0AA 2WPGA 3MUZ1 4ML4A 2DPEA 1MYRA 4WSKA 2JF7A 5IFPA 1XSJA 4PMOA 1I75A 2DT0A 3VKKA 2IXUA 1OGGA 3II1A 1H4PA 3OGRA 2YKKA 5FCZA 2CIPA 1C8XA 4H41A 4U3AA 2DGAA 1F4AA 3AXIA 1E0XA 4P8UA 3WIJA 1CPUA 3VGGA 2WC3A 4F79A 2V3DA 3WDJA 1J9YA 2XYLA 2DH3A 2VTFA 1ISXA 3L2MA 1QI2A 5E9AA 1HF6A 2WVSA 3FXYA 1ISWA 2J7BA 3AZRA 3L2LA 4GZIA 2J74A 3L4ZA 2OSXA 3MMWA 4DWSB 4CD6A 4CU7A 1E4IA 1LL4A 1CTNA 3WNLA 2XTKA 3CMJA 3FW6A 3THDA 3VU2A 2Y5EA 1IT0A 1X1NA 1LJYA 1R85A 1BSIA 3WMSA 2J62A 1E3ZA 4B16A 3OGVA 3APGA 4B9ZA 1ITXA 5IDIA 3IJ8A 3PN8A 2ZX7A 3T0DA 4FMVA 2VT0A 1C7TA 5CGMA 4D1JA 3CHCA 1KB3A 4KMQA 9CGTA 1QHZA 4ATLA 3D3AA 3B8SA 1HP5A 1PX8A 4D6JA 1EA9C 5M17A 2WBKA 1HIZA 1WO2A 4M81A 1TZ7A 4TUFA 1VFFA 1E6ZA 4HMDA 3OIHA 3FAXA 2PWGA 4QLJA 5AYBA 3WBAA 1OBAA 3TONA 3OLDA 1J0KA 2WHLA 1HKKA 1PJ9A 1NOUA 3GXMA 2CCRA 4HP5A 1K9DA 5EB8A 3AYRA 1UG6A 1JDCA 5JIPA 2BY2A 3BLKA 1VEMA 3B9AA 3VIFA 4PTVA 3MSGA 3THCA 2WHKA 5F7UA 2CHNA 3ARTA 2G41A 4DWSC 4A3HA 1DP0A 1VFOA 1KBKA 1JNEA 4C7GA 2V3FA 3SCTA 2J79A 3U5UA 2ZX9A 3CLWA 3WFLA 2W92A 3WNOA 3VNZA 3I3EA 5I6SA 1LQ0A 2ZXDA 4EAMA 1U33A 2WSKA 4ZFMA 1JDDA 1FFQA 1UH2A 3SCQA 4UFHA 4XUYA 5BWFA 1A3HA 3A3HA 4W8LA 3TOPA 4E8DA 3ARYA 5E09A 3BAYA 2WMIB 1ODUA 3ZSSA 1UQZA 1GONA 4HOZA 5A8OA 2VCCA 1TVNA 4D6HA 5A6MA 3BAXA 1KR0A 4YHGA 3AIUA 5FOOA 1NWSA 1KQZA 1UKTA 4PMDA 1B9ZA 1V6UA 2ZUNA 2X09A 2FH6A 4NI3A 3WUGA 1CIUA 5I24A 4WSJA 1VEPA 3IANA 1RPKA 4AZCA 1JFXA 1FOBA 4MJ2A 3GZAA 4UNIA 3GBDA 3VD4A 1JZ5A 3W81A 1JNDA 4UQAA 4J7RA 2CITA 4DUVA 3AMLA 1B3XA 1UKSA 8CGTA 4A4AA 3SUUA 3HMCA 2WZEA 2XSBA 3WEZA 2D0FA 4HMCA 5M3WA 3AS0A 3VGBA 2E8YA 1BQCA 1SMAA 4D72A 1VIWA 1J01A 3PZGA 2F8QA 1E55A 2DSKA 1WDPA 2J75A 1LLOA 4OIFA 4PMYA 2FH8A 1QNOA 5A6LA 4BQ5A 3ZOAA 4CCDA 3ZO9A 1OT2A 4UFJA 3VM5A 5E0FA 1NH6A 1ISYA 2GJPA 2WLYA 3GXFA 1EDQA 2PB1A 3RDKA 4MTVA 2ZUWA 5HPCA 1UD8A 4F9DA 3DC0A 4IISA 3N12A 1CEOA 3WUFA 1Z32X 1SYTA 4Y7EA 4BCEA 4X0VA 3GYCA 2PI6A 3L4XA 1W2PA 1W9DM 2QHAA 1W1TA 1JYXA 3BAIA 4W88A 1CZ1A 3WH6A 1H1NA 4AIEA 2QPUA 1XC6A 1HX0A 3AIRA 1AVAA 3AFBA 3S6TA 1XV8A 4XX6A 3ARPA 4JKLA 4A3YA 3ARXA 2AAAA 3GH5A 2E40A 1XSKA 2JFEX 1CGUA 3UR8A 1R7AA 2J78A 3CUGA 4UQCA 4TX8A 3CIVA 1GOIA 3RJYA 1I1XA 3QOMA 4F9JA 1KXTA 2CHOA 2HISA 2F61A 2GFTA 3BC9A 1UR2A 6CGTA 3L4UA 2J4GA 3W6LA 2D24A 4FLSA 3SIMA 3W27A 1HJQA 4CN4A 4PTWA 1UR0A 5CG0A 4PBGA 1QI4A 3B9DA 1VJSA 3VNYA 2VR5A 1UD6A 1XYFA 4JZ5A 1E6QM 5GPRA 5I2UA 2W5FA 3VTRA 2GVYA 5KZ6A 1TA3A 3BAKA 4FK9A 1HKMA 1F4HA 4J28A 2X1IA 3WSUA 1Q6DA 2X2YA 2E9BA 3CZGA 2B31A 1UA3A 1V0KA 4L4PA 4S3KA 1PX3A 1SFSA 2XM1A 4P8WA 3N11A 2IXVA 1QHOA 2PWEA 1IZKA 2A3AA 3U7BA 3GNPA 6A3HA 4H2CA 3MMUA 1UR1A 1B31A 2WZHA 4LX4A 2PBOA 5DEZA 1Q6CA 3WNKA 3RCNA 4OZOA 1GQKA 3N17A 1VBRA 3VD3A 1JF6A 3CZ8A 3DECA 2C7FA 1W91A 1UWUA 2A3EA 3WL0A 3WD0A 3ECQA 1H5VA 3WQ8A 3OB8A 2WANA 5JBFA 1W9UA 1EH9A 1E70M 3O9NA 1KCKA 5BXTA 4GQRA 3RMEA 3GH7A 5BRQA 4M29A 1EO5A 1C8YA 4MPKA 1MW3A 3B9EA 2GK1A 2D23A 2PWFA 4UFIA 1BVNP 3JUGA 4YPJA 5CPTA 1D2KA 3G6LA 2G3MA 3FHQA 2G3IA 1QW8A 5BXPA 1BYBA 1XD0A 1HVQA 1OIFA 4B3KA 5CSUA 1O7AA 1XH2A 3NDZA 3CZEA 4AZGA 2VX5A 2CETA 1KXHA 2UY2A 2W66A 3NCOA 4J3XA 4GZJA 4QAWA 5A6KA 2GJXB 4QCFA 1E0WA 1RP9A 4CVWA 2CXGA 1MW2A 3AMDA 2GUYA 4C7DA 4CU6A 4GPNA 2VVSA 2ZWYA 3DHUA 4AD2A 3NSXA 1UUQA 2W63A 5EFDA 3TTSA 3RJXA 1ZJAA 4D71A 3GTNA 3VIMA 5EFFA 1XYZA 1FH7A 4H7VA 2VI0A 1VB9A 2EPKX 4J3TA 1PIGA 2BV9A 5I0DA 4RE2A 1GUVA 1TR1A 3ZQ9A 1J10A 1XH0A 1OINA 2C8NA 2D22A 2YA1A 1MFUA 3MS8A 3RILA 1K9EA 4GQQA 2VC9A 2DEPA 3GXIA 4AZBA 4J3UA 1MFVA 4U5IA 4M8UA 1W1VA 1WB0A 2XWEA 3NIYA 1EDGA 3RM9A 2ZX8A 1JG9A 3N9KA 4EANA 1JXJA 2D3LA 4TX6A 1TMQA 4JHZA 3MU7A 3WNPA 1NWTA 3WDPP 1MW0A 2OWXA 5ABHA 1VAHA 1UWRA 5HBFA 1OD8A 4WIWA 3SCWA 2VURA 5CPQA 4UTFA 1CLXA 1EGZA 4AZHA 5BXSA 2YL9A 1UHVA 2WCSA 2QV4A 5LA2A 4NRSA 3QHNA 1KCLA 1JAKA 1N82A 4DUXA 4ACZB 2E9MA 2PWDA 4QDMA 1UR8A 2VNCA 4TTGA 2YA0A 2XVNA 1J0ZA 1VRXA 4PTXA 4JFSA 4AD4A 4HA4A 4UZUA 5GNYA 4ZXOA 1FH8A 1FP8A 1V3LA 3IK2A 2JALA 2W4XA 4GI8A 2YBUA 4H04A 1E4LA 1JGIA 5BYWA 1JYNA 5CGTA 3T2QA 1GOWA 4WLCA 1GQIA 1MWOA 5A94A 1OD0A 2WKLA 1KBBA 4GINA 2RGLA 3AZSA 2G4FA 4P7RA 3W0KA 2XGBA 4R27A 3N1AA 4TVCA 4BS0A 1J18A 1KR1A 2QLYA 2PWHA 1H49A 1JF5A 3DHPA 3AIEA 2VOTA 4J3SA 1M04A 4Q7NA 3CTTA 1OM0A 1ISZA 2CKRA 3SUVA 4KGJA 4CU8A 2XUCA 2YLAA 3CPUA 3VD5A 3AHYA 1E71M 3L4VA 2BNJA 1UYQA 4R5EA 1PZ3A 4E4PA 1TCMA 7TAAA 5DMYA 2WWDA 1LG1A 3TA9A 2YIHA 1B90A 2J8GA 2G3JA 1QI0A 1Q4NX 4YHEA 3POHA 3UEQA 1V6XA 4PMVA 1J0HA 4HPHA 3KZSA 3ZJKA 3VMPA 4YN5A 3WF4A 4GKLA 1V02A 2FGZA 1CXLA 2BHZA 3T09A 3ARUA 3SCPA 1VBUA 3AHZA 1E1FA 2BY3A 3W29A 3WENA 3VVGA 1TVPA 2V5CA 4XZBA 2E8ZA 2OLHA 3CH9A 2ZUTA 1ZB5A 3PZMA 5D9PA 3PHAA 2XIBA 1CGWA 1UH4A 4D6EA 2E0PA 4OBRA 1V3MA 5KEZA 4AEEA 2Y4SA 4GI6A 2BVTA 1AMYA 5LYRA 1B1YA 5LA0A 3EDKA 3F5KA 1Q6EA 3W6MA 4PRWA 4HA3A 4JFTA 1TE1A 2PF0A 1WNOA 4WK9A 1JZ7A 3EMZA 1C90A 4PSPA 2J7FA 5IFTA 4PMXA 1MQRA 3VIOA 2DSUA 2WMIA 1JZ2A 2YOCA 1JXKA 3LPGA 1EQPA 1QPKA 3N15A 4GXPA 5BROA 2FGLA 1H09A 1L8NA 4MB3A 5I77A 1E6RA 2FHFA 2V38A 2BY1A 1W3LA 3CUJA 1ODZA 2FDMA 2G8ZA 3W37A 2BFGA 4XZWA 3SCVA 4CD7A 4WKFA 2WW5A 2XHYA 2J7EA 1C8QA 2QF8A 3AS1A 3PZOA 3WH5A 4PCSA 4JL2A 1UZ4A 4P8VA 1E3XA 3EDFA 1KWKA 3VOCA 3MANA 3WMBA 2VZVA 3AXHA 3CZLA 1UR9A 1J12A 3NDYA 1HL9A 4BA0A 1V3KA 2IUZA 3VDCA 1UOKA 1US2A 3W24A 1E6NA 3RM8A 1JDAA 1BG4A 5HXMA 2DSVA 2DIEA 1VENA 4NZCA 1GJUA 1D7FA 2G3NA 1BHGA 3SUSA 2HVMA 1MQQA 1E73M 2VO5A 3L4TA 3VO0A 3POCA 3WDQA 2AMGA 1D3CA 5IHSA 4CCCA 3AI0A 3L4YA 4UQEA 3VGFA 1JYVA 4AD3A 1E6PA 1QHPA 4QCEA 4OOUA 3MO4A 2WYSA 5GNZA 4J3WA 1CGYA 4AZ5A 2X0YA 2OYKA 4M24A 1UD4A 3CGTA 5IXEA 2WXDM 1W2VA 3K1DA 1DTUA 1BVZA 1NQ6A 3SUWA 3LMYA 1E0VA 3WBEA 3GH4A 1EIBA 4WF7A 1M7XA 5CXPA 1BGAA 1HJXA 3UETA 2YL8A 5A6AA 1Y7VA 2BY0A 1H0GA 1O6IA 3VDBA 5A2CA 4TTUA 3KE0A 1C91A 3HJEA 4UFKA 3MUAA 4ATDA 3PZTA 3KL3A 3ZIZA 3ZJ8A 3SCNA 2A3BA 5FKYA 4MB5A 2OYMA 5DT5A 2WVTA 1I1WA 2Y8KA 3WD4A 1G5AA 4TVDA 2CERA 2ZE0A 4PMZA 3GM8A 4DM1A 2ZXAA 3WUEA 3FHAA 3AXXA 1FH9A 4AZ6A 3WEOA 3AJ7A 3ZJ7A 1R8LA 4JFUA 4D6IA 4FLQA 4JKKA 3BSHA 3OLIA 5E6YA 2D0GA 3VGDA 2WMKA 4AZCB 3ZT5A 2WVUA 4GZEA 4OKDA 1BTCA 1E4NA 5IHRA 3PZNA 3LPPA 1U2YA 3ZMRA 5CSYA 2ZX5A 1HP4A 2CBUA 1NP2A 4JHOA 5C8BB 1EXPA 3T2OA 1HVXA 1RD6A 3UCQA 1HKJA 4AXNA 3CUIA 2WLZA 2WK2A 3WH8A 1TFVA 2ZXQA 4F66A 2E9LA 3QOKA 4U3CA 5A2AA 5A6JA 1K9FA 3LPFA 3UG4A 4IPLA 4V27A 2CBVA 2ZWZA 4QLLA 2ZICA 3QR3A 1VEOA 4KWUA 1CENA 3PZQA 2W67A 1HT6A 1NWRA 1QOXA 5BXRA 1V0NA 5A8QA 2VCAA 4P8XA 1R87A 4MNKA 2XVPA 3CO4A 1UQYA 1J0JA 1ITCA 2DSWA 4B9YA 4JFWA 2CESA 4LYQA 1MXDA 1B30A 2WHJA 3VIJA 2UWFA 4AW7A 2EXOA 1XH1A 3PZVA 4PUDA 4H8HA 3AQUA 2VZTA 2CEQA 2YL6A 4ZE5A 3MV11 3WNNA 3N04A 3VMOA 1W3JA 2WBGA 3K8KA 4LYPA 2ZUSA 1BYDA 2E4TA 2VX7A 4MNMA 1J0YA 1KGXA 1MQPA 2DSZA 4AYSA 4CUCA 2YDQA 3EYPA 4HOXA 4KH2A 5D8ZA 2X05A 1JD7A 2EBNA 3VIPA 4Q22A 3CHEA 1GOOA 1UD5A 4OJYA 4M56A 4GO8A 3VMNA 2QMKA 1WKYA 3ZT7A 1GJWA 1E4MM 5ABFB 2O9RA
chains in the Genus database with same CATH superfamily
3QY7A 1HJVA 3APYA 3RUBL 2J88A 1UKQA 4DJFD 3OG2A 4KW2A 4XAZA 1EOMA 3BAJA 1SO5A 4X2RA 2AAMA 3S9ZA 3EPMA 3P93A 2EPLX 1Q5MA 1NJJA 2R1PA 5EYWA 1P0KA 3TYBA 2WAGA 3B9OA 4DI9A 5AHIA 1DL3A 4N4PA 4KEUA 2IKGA 1GTEA 3LRMA 4XKYA 4HPGA 4IQLA 4NASA 4TMCA 4W86A 3W2KA 5U7SA 4ZMGA 5DT7A 3STEA 3EEZA 1X7FA 3QV7A 3G22A 1H2JA 4B4HA 2XVKA 3SRHA 2DJXA 3SCUA 1RY8A 3HQPA 3O3RA 4Q8QA 3P8JA 5AOUA 3NSNA 1XDJA 1B0IA 3MVIA 1MNSA 1OVDA 2E6AA 1ZU8A 4NNBA 2V9DA 3G2GA 4RR4A 5G1TA 3VKBA 5HMFA 4Q32A 4H9MA 2VZSA 1DIDA 4L65A 4LVBA 3G6MA 4A6GA 5K9DA 5KINA 3B8TA 1GPFA 2EKCA 1BYAA 2JF6A 5LXEA 1E9LA 2VRJA 1Y65A 3IACA 3CUFA 2Y7DA 3NZGA 1JCYA 2X30A 3P5ZA 1R0MA 3IVTA 3IJLA 3MI6A 2DT3A 2OSWA 1V3HA 5LGZA 1GQJA 1YIXA 2C0HA 3A21A 1PIIA 1WP6A 2DVTA 3EKZA 5IBXA 4BQ4A 2TYSA 2VDGA 5FF3A 2BVYA 2VWTA 3WQPA 3ARZA 1NU5A 4ZGYA 1VLIA 1GYLA 3LZ5A 1SZFA 4OWGA 1VR6A 6TAAA 4L56A 4PMNA 4HNCA 1XHGA 4XZIA 2P50A 3IV3A 1FWWA 2R14A 2PMQA 3A9BA 3IIVA 2ZUMA 4O4WA 3OA5A 5DN1A 4ILSA 3GE7A 4Q4MA 3WQWA 4CCZA 3BCDA 1E1EA 1Q6QA 2BTMA 3NPVA 1GQNA 2IQDA 5AYIA 4K1GA 2XFRA 5LHFA 1JI2A 3S0CA 3WLPA 4NXSA 3GSMA 1HNYA 4CD4A 1JEZA 5FEPA 2O7QA 1E9ZB 2PF8A 2MANA 2R1MA 2GDQA 1ADOA 4AMAA 3N6QA 3FAWA 3C0JA 1AD1A 1KW1A 1JVNA 2XSXA 3GDKA 3IJ9A 3WJYA 1WAWA 1ESWA 3O7UA 4Y9OA 1LWJA 5GJPA 3BGGA 1XPYA 3GB6A 3MC5A 3LTPA 4QG8A 3MJYA 1IR1A 5C9WA 4LAKA 1T6MA 1EOKA 2WKGA 1CXKA 3L0NA 2D20A 1UZ1A 3VXGA 4PH6A 2WVVB 4MJ4A 4CEXC 1TTJA 3A3WA 4UCFA 1DOSA 2YGYA 1XFBA 2AOSA 3F5JA 3G5EA 3NXFA 4C65A 3F4NA 3K4DA 2WCAA 2Z2UA 4CQDA 1FTXA 3LPOA 4G7EB 4ADSA 1LOQA 4IT1A 2FJKA 1LL7A 2OX1A 5C55A 3GIQA 1WBJA 5LNVA 1EDTA 4PB4A 4W89A 3PC0A 2P8BA 3QTGA 4JKMA 5CQ1A 5FL1A 1DE6A 3BCJA 3CZKA 1M41A 3IWPA 3GR4A 4W5ZA 1JCLA 4O19A 2PDPA 2C15A 1TUXA 1VFUA 1QO2A 4LXFA 2XIIA 1M53A 2ICSA 1OC7A 3CT7A 2PP0A 1GT8A 1JQXA 3YPIA 4AYGA 3NYDA 4C6CA 4AIUA 2OSYA 3AO0A 3IIZA 1SJAA 2O9TA 4HZ6A 1ZSXA 4GIAA 3CT2A 2DZUA 1HKWA 4Z2KA 4FNSA 5A8MA 1EEXA 3DYMA 3UZJA 3O6AA 3I7QA 2H9AA 5E70A 1X1ZA 3P61A 2FZ8A 5A95A 3C2VA 3CQIA 3FKKA 3D0CA 2YLLA 4IMDA 4GISA 4OOZA 4ZTXA 4YJ5A 2P3ZA 1FUYA 2NT0A 4JHMA 3H2AA 2GPTA 5TD4A 4UWMA 4MAVA 3F03K 3V3WA 3UFYA 3RR1A 3OQ8A 2Y88A 1KC7A 4HMEA 4PR4A 2DH2A 4LUSB 5EBAA 3NZQA 4E3VA 3A47A 3VDAA 1OGBA 4MKSA 1DHKA 4NU7A 4EPKA 1W37A 1QI3A 2Y24A 4AIOA 3E02A 1XBZA 5HNTA 3C6CA 3HFYA 4IP7A 2XINA 3A6OA 1M6JA 4RV8A 1KRCC 4DZAA 5CBIA 2VQTA 5DCBA 1V93A 2J7DA 2Q09A 4PSRA 3W38A 3M46A 4DJEC 1EX5A 1MUCA 5A8NA 3TQPA 3RLGA 3EWCA 1CNVA 3WF3A 4PUJA 2CPUA 1BRLB 4PC8A 3LY0A 1JZ6A 4Z1DA 3PTMA 4REQB 2V3EA 2VWSA 5HK4A 1FFRA 4W87A 2V3GA 4MIMA 1AA1B 1QVBA 3FEMA 4YWSA 3TCEA 3NZRA 3WJSA 3OZPA 4BQ3A 4KIEA 4C6PA 2V5DA 2GVLA 1F3EA 4O52A 1E43A 2GWNA 4KF1A 3E74A 4L7ZA 4FX8A 1NSJA 3WDHA 2XWDA 1UW9A 4HNUA 2OYLA 3TJIA 3GDBA 1MZHA 4OHQA 3QH2A 1LBFA 4ICMA 3ELFA 3T2PA 1A5OC 2VX4A 4NHVA 2QIIA 1I9CB 3XINA 1C7SA 2TPSA 3QN3A 3AROA 3AMKA 1GOQA 4UR8A 4PUNA 4AUBA 2R91A 1XRTA 4IIEA 4O1BA 1S5WA 4K37A 8XIAA 3EWYA 3PZ9A 3WJZA 3KRBA 2GGIA 3FOKA 1QK2A 1KFBA 4IFKA 1L6SA 4DUOA 1S2CA 5AKQA 4ZB2A 1XRVA 1SGJA 1H3GA 3VUSA 1ZBCA 1B3VA 1ZHAA 4ECLA 1B3WA 1MDRA 1EJSC 2A3HA 4KT2A 4C90A 1XC4A 5JVLA 1SMDA 1YQ2A 4IXHA 3OLEA 4CD5A 1CLVA 3TYUA 1R7OA 1OSEA 1DXIA 3VA8A 1HN1A 1B57A 2F2KA 3UZWA 5DXYA 1Q7QA 4WJ8A 4FS9A 4QS5A 3W7DA 2OQYA 1DWAM 4WRHA 4DF1A 5D8WA 4D6DA 5BU6A 3ARWA 5C5YA 1QJWA 2E3ZA 4WKAA 4FP1A 3O6DA 1WPCA 1L6YA 1V02E 2YDSA 3ITCA 2RAGA 5TBOA 4AF0A 4EF9A 1KFWA 1KFJA 4IM4A 5E5CA 3N2BA 3I3BA 3VDGA 2BOEX 3TIMA 1KGWA 3PUDA 2FHBA 3QMTA 2HXTA 3T4CA 4J35A 4RK8A 4UC5A 3WQCA 3ITOA 1YW1A 4YL2A 4YVXA 1Z9AA 3KBJA 1XLCA 4GQGA 4U31A 5G4HC 3JS3A 4XTDA 4P7NA 3C4UA 2YCLA 4ACYA 1US3A 3GQYA 2CKSA 3GNRA 1P5BA 2WMFA 3E3HA 1QFEA 3WD2A 4H8UA 4M6QA 1VZWA 4JQ3A 3KXQA 1EQCA 3IEBA 2CLKA 1NM9A 3TNBA 4B15A 5DO8A 2BZNA 1KRMA 4HPXA 1FRBA 1C92A 2YXGA 1J0IA 4JTTA 2UY4A 7CGTA 3GS6A 4WUIA 5HWMA 4IIGA 3FN9A 1VJZA 4HTBA 4KESA 3URAA 2D1ZA 3S1XA 2E5CA 3GYEA 1FCVA 3S3GA 1O5QA 2W9MA 4MWAD 1JZ3A 2C0AA 3M16A 3H24A 1WV2A 5E0KA 5CZTA 2QJMA 3QM3A 5BRPA 4RE4A 2ZUUA 2E28A 1R86A 3WLJA 4UFLA 5DF0A 5AC4A 1PTGA 1HJUA 2OO6A 3KOYA 3WEMA 4WKHA 1WYIA 4PBEA 1BLIA 4MDPA 3AS3A 1H1ZA 3VDHA 4S3JA 4NJJA 2JIWA 4LEFA 3PZIA 1UUMA 2YDRA 2PC8A 2QR6A 3MKKA 2SFPA 3UNDA 2Y6ZA 1KCZA 4B5UA 1UWIA 2RFGA 3EDJA 2CNCA 1XGDA 1V6TA 4R3UA 2QVHA 4LUYA 2GLKA 5AYXA 3MUCA 4RKAA 4RV3A 1LWHA 1H63A 1CXHA 3CUHA 2NSXA 4CCEA 3U4FA 4C6LA 2XVGA 4XD6A 1FA2A 1XLKA 3LHWA 1TJ2A 4CGTA 1CWYA 3GAKA 3ABOA 3F2DA 3CBWA 3AIBA 4PRTA 4CD8A 1SJDA 4U5KA 4XSMA 1W32A 4ZODA 4GUIA 1WDSA 1EP1A 5G1MA 4UTJA 1KO0A 4XZLX 3ZSTA 4E5TA 3LBMA 2PDUA 3ENLA 2FYMA 1HJSA 1UH3A 3TROA 4DBEA 2WVVA 2XSAA 4N42A 4UTTC 3M0IA 1A5LC 1X98A 2BVDA 4ORIA 3H4GA 2NWSA 1K70A 2O4QA 3LRLA 1SM9A 3DN5A 1EJVC 4G7EA 1V08A 1HQTA 3E0LA 3VC5A 1GYNA 5C71A 4DWSD 3BAWA 4L4MA 1J8VA 1GOKA 1BXCA 1YTKA 2XN1A 3URQA 4UTLA 3BH4A 3UXKA 1DJGA 3SEPA 1YPIA 1OIMA 4IHCA 1VH7A 3BARA 3CQJA 5LHEA 4ML4A 3DKLA 4WSKA 2A6LA 4RZ4A 2QDDA 4LV4A 4PMOA 1MSSA 3P0WA 1XIJA 2IXUA 4WCJA 2PDLA 3II1A 3P74A 1X6UA 2VC7A 2YKKA 2PCEA 2CIPA 3UPBA 4U3AA 3QTPA 4G1NA 4F79A 3W3OA 2V3DA 4AY8A 2DJLA 3ABSA 2VTFA 3EKGA 1QI2A 3LYEA 4UTMA 1SJCA 3AZRA 2J74A 3RX3A 4YTUA 1AZ2A 3N2XA 5IBXC 4WY0B 2OZ8A 4CU7A 2AL2B 2PGEA 4UMCA 3W88A 1XLFA 3AU2A 3THDA 1X1NA 1R38A 1R85A 1BSIA 3W7LA 2J62A 3QPYA 4O1CA 4C6IA 4YXGA 2YZ5A 1RQBA 4GXMA 4TQTA 1C8VA 1ITXA 4LUSA 4YVVA 3TOYA 2QCFA 1Q6LA 2ZX7A 3IJ8A 5REQB 2JBMA 4IPIA 5AHNA 2VT0A 4D1JA 2IPFA 3CHCA 3EZ4A 1KB3A 2HV5A 3BANA 4PB3A 2FGBA 1QHZA 3ORWA 1R3QA 1K02A 5ABTA 2VEPA 1UMYA 4QNWA 4D6JA 1A0CA 2A21A 3TX9A 1WO2A 4M81A 5FESA 1J93A 3FSUA 2EF9A 5C2CA 3QKEA 1IEVA 3ZVHA 2Y5JA 3TONA 3OLDA 1J0KA 3IVSA 1EJTC 1HKKA 1XYAA 4WDTA 4AHPA 4HP5A 3G1SA 5EB8A 4X22A 3AYRA 5CC6A 3UT0A 3E2RA 1XKJA 3QGKC 1VEMA 5FJOA 3OPSA 2CHNA 1KBKA 1JNEA 2UZ9A 2V3FA 4LVGA 4REQA 4DZHA 3WFLA 3VNZA 1MEHA 4EAMA 3S5YA 2WSKA 1NDVA 1UOZA 2ALRA 4XUYA 2ZRYA 3TOPA 2WNQA 3B0YA 3GG1A 3O0KA 4GYPA 2OEJA 1MXSA 3SRKA 2FDSA 3AWNA 4ZO8A 4HOZA 1GZGA 3W7PA 5FEWA 2REQB 1U5HA 3UZXA 1I6NA 7ODCA 1E9IA 1KQZA 4RLIA 5C9XA 1G69A 2QDHA 4FX6M 1HZYA 3W22A 4ZB0A 3M6YA 3EAUA 1Q8JA 1RPKA 3CIWA 3QC0A 5C0QA 3ERPA 3SIZA 5FF0A 3VD4A 1HGWA 4B5WA 4C6DA 3I10A 1JNDA 4UQAA 3F1QA 1H61A 2P1FA 2CZEA 2CITA 1AG1O 5L6UA 4A4AA 3IGSA 4DELA 2G97A 2WZEA 3LGDA 5CEWA 3WEZA 2YFOA 3QPZA 4HMCA 3NPWA 3K2GA 3VGBA 2E8YA 1BQCA 3DHFA 3AXMA 4JICA 3T8LA 4XKMA 4F0LA 3W83A 2DUAA 4HU4A 3PBWA 2GUUA 5CGQA 5ECVA 3UZ5A 3P3BA 2QJIA 5A6LA 3ZOAA 3OP2A 2HBVA 4NG3A 1UUOA 1OT2A 3VM5A 3W6YA 3N4FA 1NH6A 2V68A 2CLLA 1O5KA 1EP2A 3GIYA 1EDQA 3VNLA 4ENLA 4MTVA 2CHRA 4F9DA 5D05A 1S5VA 2OR2A 3DFHA 3GYCA 1TRDA 2WJZA 5CPOA 1YDNA 4RNIA 3WLNA 4U4MA 3ABRA 1NDWA 3UY8A 4P61A 1W54A 3TKFA 2QPUA 1IEWA 6XIMA 3WLOA 1SVDA 3AIRA 4DO4A 3TXZA 3VNMA 2FMOA 5AZ1A 4XX6A 3ARPA 4JKLA 4G2DA 4LNCA 4QXIA 3PS7A 4Y9MA 4GGBA 4JNYA 3UR8A 1AZ1A 1R7AA 1G4SA 3CUGA 4UQCA 1CT5A 4TX8A 3RFAA 3IPWA 1TE6A 3KVJA 3RJYA 1I1XA 4LS1A 5TF0A 1OF8A 1OG0A 3LLXA 1JPKA 1XIBA 4G6CA 3M43A 4JTKA 6CGTA 3LXAA 3L4UA 2J4GA 4Q4QA 4FLSA 3ATZA 1HJQA 5C9RA 1TZZA 4PBGA 2GJLA 5BMXA 4AH7A 4LYKA 5I2UA 5GPRA 2GVYA 1LLWA 4LOCA 2TSYA 3KVLA 1A80A 5CZJA 3CZGA 2E9BA 1ZAJA 3IVUA 1SFSA 2XM1A 4L1XA 4P8WA 1U83A 4O1EA 3N11A 2IXVA 1IZKA 5EU9A 1PV8A 3REQB 4FNPA 6A3HA 3SRFA 2PTZA 1VGAA 1UR1A 3BWWA 3KCLA 3NPUA 4O12A 2YYUA 3BLLA 2PBOA 4DBDA 4HK6A 2HCVA 3G8RA 4HNLA 3RCNA 1GQKA 5JXQA 1J79A 1JF6A 3R0UA 5KMYA 5D03A 4OV9A 1UWUA 3WD0A 5CCZA 3M47A 3OB8A 2WANA 2GSEA 3LCHA 3PF3A 4FNRA 1H7WA 2EJAA 4GQRA 2WPBA 1C8YA 1VCFA 4C5YA 2X7VA 1EC7A 4QDPA 3UR2A 2D23A 3NTYA 4KCTA 3N6JA 1VLWA 5AECA 1GPWA 2VP8A 1D2KA 2PLJA 3G6LA 2G3IA 4X9SA 3CV2A 1QW8A 4LUIA 2VUNA 4IX2A 3H2OA 3WQDA 2CETA 4MVAA 4RE0A 4GZJA 3O8AA 3L12A 1E0WA 1VHNA 3QR1A 3W2JA 4D8LA 2PCQA 1RP9A 2RUSA 1U22A 4CVWA 1XLBA 2CXGA 3JR2A 2NVAA 4GPNA 2ZWYA 4B5SA 3DHUA 4LALA 1PSCA 5D37A 1B4EA 3TVAA 3KVMA 3VIMA 5EFFA 1FH7A 4RPPA 4YNGA 4MY1A 3MI3A 4O54A 2VI0A 5KSWA 1F6PA 4J3TA 4RE2A 2P76A 1GUVA 4GNKB 5A8GA 4QTGA 4HPNA 3V0TA 3ES8A 3QSTA 4XIAA 3OVRA 5KTLA 4HJWA 4JDYA 4WJEA 3A23A 3TDFA 1RBOB 4XG1A 1QPNA 1XLMA 4U5IA 5B7YA 1T5AA 2XWEA 4H6QA 1EC8A 3B8UA 1YTDA 4JHZA 2ZQ0A 1K4HA 1NELA 3KBNA 1CLXA 5FI8A 1LRQA 2YL9A 1OFQA 1SJBA 2PD5A 1HO4A 1N82A 4ACZB 2PWDA 4QX4A 9RUBA 3GNNA 3T05A 4MJZA 2XVNA 4JD4A 3CAVA 4HA4A 4EOUA 3U9IA 4ZXOA 4HJFA 1V3LA 4BWLC 4GY1A 1E4LA 4FXJA 5CGTA 1OD0A 4RUBA 1W31A 4XISA 4P7RA 4F2TA 3LCXA 1F6YA 4H2HA 4RJEA 4XZ9A 5CPMA 4IG2B 1TPEA 1N7KA 4TVCA 2QLYA 2O55A 3EPOA 3TXVA 4G9PA 4IXXA 2AL2A 3CPRA 4L9XA 5PTDA 2F84A 5G4WA 4IJRA 1R2RA 3C56A 4CU8A 3SFWA 3AHYA 4EWND 5I06A 2FMNA 3M44A 3KDOA 3UCDA 4H7CA 3PUOA 1TMLA 3IGXA 2WWDA 1E0UA 3OIXA 3QXBA 2I17A 2PA6A 3DFPA 4A8RA 1QI0A 3KRZA 1Q4NX 3POHA 3NQ7A 5DCEA 1RUSA 4DQWA 1AH0A 5J5DA 3WF4A 4YN5A 1W56A 5C7VA 3BW3A 3S46A 3ARUA 3LD5A 1VBUA 3GHSA 5FJJA 3W29A 3VVGA 3ZVIA 1ENUA 3LTSA 1J2BA 1ZB5A 3TC3A 5D9PA 2XIBA 1CGWA 1YLVA 1SPQA 3GDRA 2E0PA 7ENLA 2Y4SA 1RBAA 1FBAA 4GI6A 3OZYA 5LA0A 3F5KA 5EMUA 3WK3A 1Q6EA 2BWGA 4PRWA 3D47A 4RNJA 3RITA 1IGWA 5MHBA 3VNDA 2OLAA 1JZ7A 1SSGA 1C90A 1ZALA 5IFTA 3LLDA 1OEPA 2HS8A 1KM0A 4LWWA 5FAGA 2FVKA 5G2WA 3HOJA 4HPJA 3LSCA 2PTXA 1JXKA 2Q01A 4FZIA 3LPGA 1H62A 4DLMA 1DXFA 2VFIA 1TWSA 2IKJA 4GJJA 4GJIA 5BROA 3OO2A 4XK2A 1H09A 1E6RA 2FHFA 3HA1A 4HT3A 2V5KA 1FCQA 1ODZA 2FDMA 3SCVA 1L6WA 4PEKA 1RALA 5G5IA 5LGXA 2QF8A 2C91A 4K2SA 1J2WA 4JL2A 4H83A 2XZ7A 3EDFA 3R10A 3LBCA 4DB7A 3CZLA 1ZPTA 1UR9A 4EPEC 4A2RA 3LU2A 1RK5A 1JDAA 4WXZA 1QOPA 1QU4A 1OX5A 2DSVA 1TPB1 3M0MA 3WK1A 1GJUA 3FYOA 3HIJA 4TV6A 5HMEA 2HVMA 1W3TA 3TFCA 3L4TA 4S3FA 2ZZ3A 3KOWA 5LZLA 2GVGA 4CCCA 3AI0A 4N9CA 3ZWTA 3GXNA 2PDYA 2Q3RA 2Z7KA 4QCEA 4H9XA 3MO4A 1EKOA 1EWDA 4AZ5A 4U28A 3HF3A 5IXEA 3AWOA 1LZOA 3K1DA 1I2PA 1DTUA 3SUWA 1H7PA 4JTCA 3WBEA 1YNQA 1D7KA 3IUIA 3UA4A 1L2QA 1EUAA 1PTDA 3W87A 2CLIA 1KM1A 3PBUA 4F4RA 4AQLA 5A6AA 5F2MA 4G56A 4B5NA 3NQ2A 8XIMA 3VDBA 5A2CA 2A0NA 7TIMA 4UTWC 3KE0A 1GK8A 1O4UA 3HJEA 4A05A 2Z1WA 5HQLA 1O1HA 1YNPA 4Y9NA 2YBVA 4GBDA 3NDOA 1G5AA 4I7UA 2FZNA 3PWAA 1XFCA 1RA5A 4DBWA 2ZXAA 3WUEA 2CLOA 1XG4A 3WEOA 3AJ7A 1R8LA 1GEHA 2I5GA 4JKKA 3OLIA 2A7PA 3DFTA 2WMKA 4QQ3A 3ZT5A 2V2HA 4GZEA 1LRNA 2P53A 4OKDA 4CQAA 1E4NA 2BLEA 3V1PA 3N3MA 2CBUA 3T2OA 2Y89A 4GXWA 2QDEA 2Z26A 1RD6A 3CUIA 3CLMA 3M64A 1ITUA 1Y5XA 4Q4RA 1TFVA 4O53A 3MSYA 4QM1A 4F66A 3TV8A 3V4BA 3CYJA 1UBPC 4IPLA 4V27A 4F3HA 2ZWZA 2PP3A 1CENA 4Y2WA 2W67A 3W02A 1HT6A 1NWRA 1QOXA 3REQA 3O6YX 2VCAA 4P8XA 2QUVA 3H54A 2OX4A 3MKCA 4ZTYA 3T0TA 1ELSA 3RLVA 3O6CA 2CESA 1MXDA 1B30A 4LAZA 4AW7A 3V7PA 1XH1A 2NXIA 1R9XA 4BKNA 3MV11 3QYSA 4N9EA 3N04A 3VMOA 1D8WA 2VEFA 3CAKA 4MNMA 4XVDA 1KGXA 2DSZA 4JGDA 1AFSA 3EYPA 2X05A 1XQKA 4MFEA 2EBNA 3KW3A 3WO8A 3TQ0A 4Q22A 4OJYA 4M56A 4A8IA 2AMXA 2QMKA 1SO3A 2A1YA 1WKYA 3ZT7A 3ATYA 5ABFB 4R88A 3VNJA 2BS9A 1G01A 3FA5A 4ERIA 1WDDA 4MDOA 3GK0A 3W28A 3NSMA 1Y8BA 3MWCA 5DQPA 2YDAA 4Z17A 2HRWA 2HQAA 1KTBA 1YPFA 1U1UA 2OEKA 1UP3A 1NARA 3G3MA 3MQTA 4QE1A 3GUGA 3MA8A 3G1HA 5A2BA 1AK5A 1JI1A 1YX1A 3EWUA 3HN3A 5A6BD 4QLKA 4AEFA 5I3JA 4PL1A 1XKYA 4IJBA 1OY0A 4EXBA 5CLTA 5JBEA 1XS2A 2VDIA 3WLSA 1V7AA 4MWAA 4OBSA 3VCCA 3N4EA 5AN7A 3CIXA 2PDXA 3KL5A 1GW1A 4PL2A 2XGIA 3OOQA 4DAFA 4UZSA 1C9WA 2NT1A 2J7CA 4I6KA 3E2VA 4GIEA 1T0OA 4R9XA 3E2SA 3EOUA 2GZXA 3MTWA 3N14A 2JGQA 2Z28A 3F4CA 4LTSA 1DWJM 3UZYA 4ACZA 4GIRA 3FA4A 2EQDA 5ECUA 1BYCA 1Y5WA 4O16A 3BMVA 3TTQA 2QAFA 3KFTA 4L1GA 3A4WA 2CLEA 1K4GA 3LCFA 2HE8A 3NM1A 4JYDA 1L6FA 2PDJA 2O9OA 3KEHA 1JFHA 3N2MA 3ZLFA 5JU6A 2YX0A 2VX6A 3VUPA 3ONCA 1X96A 4S2BA 2XZ9A 3S83A 3UVAA 4ASTA 3V5CA 1JPMA 1OX6A 3W7GA 2YZRA 2ANUA 3HFTA 2VEGA 1UWQA 3ARRA 1QNPA 4ERGA 3GNOA 3TCSA 4JTEA 2ZDRA 1SZRA 1UJQA 5I3IA 3PJWA 3TK7A 3MSDA 4XIMA 4E2VA 4DJFC 5F2LA 3QSRA 3KWXA 4C5ZA 4WY0F 2ZA3A 1IHIA 3R58A 4LUJA 2PFHA 4YCOA 1CGXA 2IPWA 1QNSA 3NVDA 4IGMA 3RO6A 3N9SA 4GMEA 4C7FA 1JDFA 5BW6A 5LNRA 2D73A 3NQBA 1DWHM 3S2CA 3HURA 4XZHA 3QZAA 2Y7FA 3ABXA 2XIQA 3S1GA 4ATWA 3PJXA 5M03A 4DWSA 1PIFA 2X8RA 3EGJA 5HNNA 1RLDA 3U2OA 3T6CA 3OODA 1M1BA 4ICNA 3NVTA 1XWYA 4U33A 3WL1A 1JR1A 3EPNA 3CMGA 3K4WA 3PANA 4Z2GA 4IMAA 3CHFA 2Q8XA 2J7HA 3WF2A 1W9PA 2WB5A 3GG0A 1UR4A 2DIJA 2FZMA 3F2CA 4MNJA 3P8IA 4P7OA 1E72M 2O7SA 2W62A 3OGSA 1SSDA 5D9MA 1PZ2A 2OOFA 5C9ZA 4EP8C 5G2HA 4LS0A 6ENLA 1VPQA 5J04A 4A3RA 5DBTA 2V63A 1VIZA 1E5JA 4AY1A 3VZZA 4A29A 4KIRA 2VVNA 3KP1A 3WLKX 1VCGA 1MRAA 3SCOA 1KBLA 1GG1A 3H22A 3KHDA 4Z2IA 4W84A 7XIMA 3DKJA 4QHRA 1G94A 2QJJA 1ZL1A 5TNVA 3W2UA 5CC3A 1RXOB 4IICA 2HPMA 3AZTA 4TVUA 1OX4B 4WX2A 5ABGA 5KITA 4YTRA 5DANA 3P81A 3R12A 1MUMA 3PWIA 4DXKA 4IQJA 3V5FA 2H6RA 4ZR8A 1TJ0A 4XUGA 1EJXC 2ZTJA 3PG8A 1K7EA 1I0DA 1I2NA 3A24A 4A21A 1H60A 3AOFA 3J7HA 3RRAA 2Z0IA 1OGSA 4LQ1A 5HWJA 3ITLA 5C7HA 1WXYA 3GC5A 1A53A 3UGRA 4IFOA 1T8QA 4UTKA 1KGUA 4EK7A 1ZCCA 4PCNA 1E6XM 5CAKA 1ONXA 3FYYA 1A5BA 1AQFA 1NF0A 3BJSA 2JIEA 3TC6A 3S1VA 4JFVA 1HKVA 1QI5A 1PCKA 3CO8A 2ZX6A 1ZAHA 1FWCC 7A3HA 3VE9A 3G1VA 3O1NA 3KS5A 4MZYA 3C8FA 1TTQA 1SW3A 2DZAA 1W8GA 2HPIA 4IGHA 4ZZ9A 2P3EA 4S3CA 3RLUA 1GVSA 3KCOA 5U4NA 4XAPA 3AHXA 2QNEA 3NQDA 3L23A 3AS2A 3HG5A 2FVMA 1S3HA 4IMFA 2HMCA 2CYGA 2EG8A 1KWGA 1SW7A 2I1OA 5F4XA 2FPVA 4A2SA 3GZ3A 2FLIA 4Q8OA 1ZS2A 1T40A 2BHUA 4QG9A 2DZSA 3NOYA 4GK8A 2B7OA 4AWEA 3UWZA 1K6AA 2Y5SA 3HG3A 4B3LA 3GO2A 1WDQA 3WFZA 2EJ1A 3VIGA 1RZMA 2PDHA 1GOMA 1A0DA 3EMQA 4V1XA 1JCJA 2DORA 3B8DA 4X3ZA 3P14A 4K8GA 2PTDA 3SCRA 4X2PA 1E5NA 2W91A 4YTQA 5EBUA 3ARSA 1FWRA 3WKZA 3WBWA 3VKJA 4ZXLA 1AH3A 1YHTA 3QHMA 3FIGA 2XFYA 4UOJA 5I23A 1A5NC 4AVFA 3ME3A 4C6MA 3AHVA 1Q63A 3WUBA 4QJ1A 3SFKA 4BY3A 2C16A 3C2EA 4KRZA 1CXIA 4M82A 4JIEA 3ZR5A 4UMBA 2NV1A 4PUUA 4WJXA 5AYZA 2ABBA 1ZJBA 2EPOA 5CJ5A 4ADTA 3ZR4A 1CXEA 3QGVA 2X2GA 2Q02A 5BZAA 1SO6A 2PLCA 3B03A 1X1OA 3BW2A 3TJ4A 4XWUA 3WDIA 3G3DA 4O18A 1G1YA 1LLZA 3R4IA 1PHQA 2DDXA 5BOOA 4X9YA 2CWXA 3FS2A 4WVXA 4AVOA 4Q8WA 3VFCA 3P2VA 4C6OA 3S9IA 3SO7A 4JCLA 2Z1SA 5ABFA 3GAYA 1JGMA 1RH9A 2XG9A 3GU1A 5E6ZA 2PDWA 1ICPA 4MB4A 2ZA1A 4UR9A 1WXJA 5D9OA 1CXFA 2PBGA 2D2GA 1JIBA 1XGZA 1PZ0A 4V1YA 1S39A 3N6HA 3OQEA 3GVGA 4NZ1A 1PYMA 3W1LA 4N6EA 3WCZA 4J27A 4P7QA 4K6AA 3CTLA 5BNKA 4PN2A 1F07A 1IV8A 2I16A 3RLHA 1GHRA 4W7UA 1I2RA 4V28A 3M5VA 5CZ0A 1GHSA 4DLFA 4EKJA 4J2MA 4LVDA 4JTJA 3P6LA 3GU9A 2A3LA 2DW7A 3QV9A 1OADA 2ISDA 2Z1VA 2WCGA 4QGCA 4ZOEA 4V2XA 2GVJA 1NAL1 2QGHA 1XSIA 1WX0A 3GWQA 3I6RA 5HUOA 1WZMA 1IIHA 2A3CA 3WDRA 3KHJA 2VUYA 4W8AA 1R9ZA 1ISVA 4B5VA 3OEXA 1YYAA 5MKGB 2OGJA 3GDTA 1Q7ZA 1PWMA 1OYBA 3QFEA 1BXNA 1VPXA 3KDNA 1HO1A 3V16A 1G4EA 3EB4A 1OZMA 2BGNE 1TKKA 3NWRA 3GBEA 3PBGA 3TUUA 3F7JA 3I68A 4M6UA 3G0XA 4TX9A 4UTHA 1ME8A 1IZJA 3BOXA 2J9YA 1Q8AA 2OOGA 4D8AA 3K1GA 1PO9A 4WSHA 3WD1A 4H8VA 5CPSA 1TQXA 1Z69A 2ZUVA 4LAUA 4PMQA 4AD0A 2Y61A 2VFFA 1EBHA 4UNLA 3MV01 1PS9A 3C0LA 1V4YA 1ADSA 3SQLA 3UESA 3OBAA 4GYKA 3LB0A 4J9JA 5IRPA 2VYOA 1JL8A 2OMAA 1PAMA 3FNDA 4UMAA 2VGIA 3TJXA 1RP8A 1EHAA 3MP3A 2AQOA 4H8NA 3DHDA 4OGZA 2GDVA 3B0VC 4XKYB 2BHYA 3U5YA 3WD3A 1XLJA 3WELA 1FXPA 1UPMB 2A2IA 4GKTA 1AW5A 1PL9A 1V7YA 3PG9A 2WSYA 1JAEA 3Q37A 1I2OA 2HK0A 3PZUA 2ZRVA 4LGXA 4J3VA 3BW4A 3KOXA 1KLYA 3QY6A 3HBLA 4M1RA 5HNUA 4GX9A 5EPDA 1UP0A 1GVOA 1BF2A 4R7OA 4DYJA 1CBGA 3N18A 2CXEA 3DFSA 5AVHA 3K8MA 2NQHA 3EOLA 3ANUA 2VRQA 4H3DA 3BCFA 1M9HA 4D2JA 3L65A 1QBAA 3A5FA 2D0HA 4X60A 1SO4A 4A22A 4LANA 2D2OA 1V6VA 4WOQA 4LAOA 1TWIA 2VRKA 2E7FA 1ZCOA 2XJ7A 3G77A 1XCXA 3ZXWA 1A50A 3MHUA 5A1AA 1BSLA 3WF1A 3FJLA 5BRBA 4CQCA 1V0LA 3BMWA 2OCZA 2O0TA 3GDMA 2WC7A 2IQ0A 3I65A 2WMHA 4PTDA 1ADDA 2QCGA 1NDYA 4O14A 1VFHA 6REQA 4N7QA 1OB0A 3FY1A 3FDGA 4M1BA 1PHWA 2IKHA 4HU8A 4UTIA 4MWAC 4HNNA 1AQMA 1H7XA 4F2BA 3TP4A 4DO7A 4JBRA 3ZJ6A 2C3ZA 5AY7A 4M80A 1PPIA 3ZR6A 4KWOA 3PTKA 2NZLA 2WPGA 2INFA 4RDVA 2DPEA 2ABAA 4PZVA 1OX4A 2JF7A 2C71A 4AHOA 1I75A 2HNHA 2VFDA 4DXXA 1PDZA 3MCMA 3VC6A 4JY8A 3R25A 4IWWA 1OGGA 3NAVA 1FWIC 4PMJA 3SDOA 3OGRA 4JTUA 3WMLA 1PKNA 3AXIA 3BJFA 2OB3A 1ZENA 2WC3A 1ZNNA 1J9YA 2XYLA 4LC6A 1ISXA 4DJEA 4JIRA 3EEGA 2J7BA 2XN2A 4GZIA 1OYCA 2OODA 3L4ZA 2OSXA 3MMWA 3D46A 1ONWA 3HQOA 2CC0A 4GCXA 4Z1YA 1E4IA 2P5NA 3FW6A 2Z24A 4LS2A 2E09A 3LUTA 4B9ZA 1OFOA 3R13A 1FKWA 4GC3A 2ON3A 1C7TA 2ZA2A 4I9AA 2DP3A 1UBSA 3VOFA 2EG6A 4KMQA 1F76A 3OHMB 1QT1A 4KFPA 1N8WA 2TRSA 5F1UA 3B8SA 4ATLA 3R43A 4QBXA 1XBVA 1EA9C 4LBRA 4XTIA 3THAA 1HIZA 1M7JA 1VFFA 4M5PA 1E6ZA 6PTDA 1ICSA 3FAXA 3SAZA 2ZRZA 4QLJA 3WBAA 3FEQA 2XH7A 3BZGA 3RCMA 3HGJA 2J24A 4LB3A 3GXMA 3WBXA 1UG6A 4I5RA 4PTVA 2YSWA 3V0SA 4S3DA 4DWSC 4A3HA 4XAFA 3S6DA 1VFOA 4A8LA 3PULA 1JDEA 3CLWA 1ML1A 3WNOA 3I3EA 1LQ0A 1U33A 1ZAIA 4ZFMA 3SCQA 3UXAA 5K7JA 5DMMA 1AL8A 3T07A 4UFHA 5BWFA 3NEHA 3H8AA 4IMCA 4WR3A 3ARYA 4IFRA 3B0UX 5I09A 3BAYA 5I3HA 3ZSSA 5D2WA 3NR0A 1Q66A 2VCCA 4MOZA 2V30A 3R7MA 1KR0A 3UP8A 1WA3A 3CL6A 3R8HA 4NQ1A 1R2SA 3SQMA 3TSDA 3WUGA 1CIUA 4KCVA 4S1FA 4MG4A 4WSJA 5FJUA 3APTA 2V82A 3DGBA 4KPLA 5LNSA 1TMHA 3EXSA 2GUBA 5EGRA 1XL9A 1FWAC 3UF9A 1A4MA 2QCNA 3CU2A 4L1WA 1IE7C 2OT0A 3SUUA 3TMLA 1Z7AA 1A3XA 2ISWA 3LS9A 3SBFA 3PZGA 2F8QA 3GTIA 2HS6A 2DSKA 1FCUA 1WDPA 2J75A 2X1SA 2ASHA 3FFSA 2YXXA 2AQVA 4I5XA 3ZS4A 4BQ5A 1EGVA 4CCDA 3DIPA 1KA9F 4L80A 4UFJA 4TO8A 1LQAA 3LHUA 5AHLA 5CSRA 3G24A 3WFAA 3HG2A 2NUXA 3CJPA 2H8ZA 3CUXA 2ZUWA 4GNJA 3W00A 1TO3A 3DC0A 3N12A 3AC0A 1E9YB 3WUFA 4JIHA 1X8CA 1SYTA 3CV7A 4X0VA 2PI6A 2WNNA 3L4XA 2QEZA 2QHAA 1W1TA 3BAIA 1CZ1A 3WH6A 2X0SA 5DY3A 2NX3A 5K9XA 1HX0A 3MSRA 1P1XA 1PKLA 3PNZA 3NL6A 1ONEA 3SZ8A 3AAMA 1R46A 4MUPA 2AAAA 4WHBA 3BOFA 3WK2A 2QULA 2JFEX 4OVXA 3SI9A 3LMZA 3QKZA 1BTMA 2E5BA 4I9MA 4K39A 1QCWA 2ZADA 4D9PA 1KXTA 1I4NA 3I7RA 2GFTA 3LX9A 1EB3A 1UR2A 2HE5A 4ZCWA 4YYFA 1DJNA 2D24A 1JUKA 3FLUA 4CN4A 4PTWA 5CG0A 2PU0A 2VR5A 2FZ9A 4JZ5A 2RDTA 2OGYA 3EX2A 2W5FA 3H55A 1VP5A 3WLRA 4IFKB 5KZ6A 1PWLA 3PR2A 4C6JA 3QY8A 1HKMA 5TIMA 3O0FA 1PXGA 4PODA 2B31A 1UA3A 4ZQOA 4L4PA 1AW2A 1PX3A 2QCMA 5DRIA 4HSHA 4DF0A 5JH1A 4ZOAA 1VQTA 1QHOA 4IX0A 2A3AA 2ADAA 4ZSUA 3GTXA 4G1KA 1W3IA 4NJKA 1UC4A 4LX4A 2Y70A 1WXZA 1Q6CA 2H3DA 2NVCA 1Q65A 3VD3A 3NZ1A 1GEQA 1OCNA 3NURA 3CZ8A 2C7FA 2IS7A 2A3EA 1K1DA 1H5VA 3WQ8A 1VCVA 5JBFA 1W9UA 1JULA 1WKFA 3LCLA 3RMEA 3GH7A 5BRQA 3CNYA 4AF0B 2AGKA 5JQ9A 3PPGA 2JKPA 2MNRA 1O68A 2DZBA 4UTTA 2PWFA 2J27A 5FSEC 3JUGA 1RK6A 4YPJA 2G3MA 2PDIA 1KFKA 4MM1A 4UR7A 3ONBA 3M0HA 5BXPA 3C2OA 3H6OA 3R89A 1CCWB 1ZUAX 2VX5A 1KXHA 1XXXA 2Z6IA 2RJHA 2UY2A 4Z0SA 1OYAA 2O56A 2YCLB 1DE5A 4UB9A 2GQ9A 4C7DA 4CU6A 5KZEA 5CG7A 2W63A 5EFDA 4FOJA 4QE5A 3H53A 4HSNA 3RJXA 2ZZ5A 2HTMA 1XYZA 5IM51 2GVEA 1VB9A 3F4DA 5J5RA 1PIGA 2BV9A 5I0DA 3UG8A 1YE4A 1J10A 2BSLA 2C8NA 3W7JA 3M0YA 1MFUA 3UGVA 1K9EA 2G37A 4GQQA 2VFEA 2VC9A 2DEPA 4AZBA 5BWAA 4HN4A 3QW4B 1BQGA 4J3UA 4M8UA 4E4FA 2BOGX 1JG9A 3C8NA 3CB3A 3LDVA 4ZO6A 2D3LA 4I5UA 3RX4A 4IIHA 3MU7A 5ABHA 1GZ1A 5ENLA 1OCJA 1UWRA 1OD8A 5LIWX 4PULA 1A5AA 1IIGA 3H2NA 1ECQA 1LM1A 1MEIA 2XN0A 1EJUC 1XLDA 3QHNA 4DUXA 4HN8A 1UR8A 1GWJA 3OYZA 1TPVA 2YA0A 1VRXA 3LGEA 4JY9A 5GNYA 4DZIA 2PWUA 3PAOA 1FP8A 2W4XA 4LJ3A 3NQMA 4E3TA 4RDYA 3T2QA 3EA1A 2Z00A 4ZQRA 3VYLA 2KAUC 1MWOA 3IUHA 3R79A 1KBBA 2RGLA 4C1NB 1PKYA 1Z6KA 3TSBA 1Z89A 2D2HA 3T44A 4R27A 2OO0A 4M7SA 2VD8A 3T1GA 3FVDA 4QROA 5D33A 1OJXA 5T8GA 1W0MA 5LIKX 3AIEA 5D2YA 4J3SA 3UJRA 1M04A 2XH0A 1CI1A 1OM0A 1RY0A 3WQFA 5E9XA 2CLFA 3SUVA 3LK6A 2YLAA 3CPUA 3VD5A 1XYMA 3L4VA 3B06A 4R5EA 3IRSA 4JIQA 5DMYA 1LG1A 2AQWA 1B90A 3WZ0E 3KX6A 4QG6A 3UEQA 3GW0A 1V6XA 3L21A 1LWIA 4PMVA 1J0HA 1WUFA 5HAOA 1V02A 3VKAA 3ITYA 3EWXA 3N2OA 3WJWA 4CNSA 1GVQA 3ZFHA 3QPEA 3WENA 2WV8A 4O11A 1TVPA 4JXCA 3U2ZA 2QJNA 4XZBA 1ZRQA 3CH9A 2ZUTA 3TAOA 1DORA 3BTNA 2J13A 1UH4A 4D6EA 3LCIA 5KEZA 4H01A 1ALDA 1RPXA 4QE4A 3BLIA 4B2DA 5D2TA 2WO5A 1VC4A 4HVXA 3ID7A 1TV4A 3H7UA 5AB3A 3Q2DA 4ZL1A 4WK9A 3TR2A 4RPQA 3GNDA 1KM3A 2RDWA 3KM8A 2PDNA 3OA3A 2Y62A 5AFDA 4JNMA 2DSUA 2YOCA 1EZWA 1UMLA 2PU1A 2OPJA 3T55A 4WQ6A 2VEIA 3N15A 4GXPA 4ROPA 2DU2A 3M0XA 3I4KA 3TU9A 1L8NA 2CZVA 2V38A 3OU8A 5AYYA 5M1TA 1W3LA 3BUVA 4R9OA 2OG9A 3UWUA 3N73A 3CUJA 1IT8A 2G8ZA 1DQXA 3HGSA 4WKFA 3C2RA 1TJ1A 2RDUA 1UPPA 4DRSA 2J7EA 1C8QA 2IW0A 3GU2A 5EKYA 1UZ4A 4P8VA 1E3XA 1OFBA 1KWKA 3MANA 2NV2A 1NIUA 1LOLA 4IGNA 1I60A 2E25A 3U6WA 3WLTA 1HL9A 1V3KA 3PM6A 3N3TA 1UOKA 3O05A 4HKPA 3RM8A 3TN5A 5HXMA 5C9UA 1GW9A 1W8SA 1LOSA 4NZCA 3MWAA 4KS0A 4LNYA 1D7FA 3DH7A 4AX7A 2BGQA 1E73M 3MJMA 3POCA 4B5TA 2PDGA 2QS8A 2XH4A 3VGFA 1JYVA 4AD3A 4GVHA 3MO7A 4OOUA 4QJ4B 3KOZA 4JQ4A 2WYSA 5GNZA 3ZVHB 4J3ZA 1CGYA 4GG9A 2I5QA 2G3FA 4M24A 1UD4A 3CGTA 4L5ZA 1ZTVA 2YB4A 2WXDM 3WQOA 1NQ6A 1XLAA 3LQLA 1QOQA 4ERAA 1F6KA 1XYCA 3GH4A 4WF7A 3UETA 2YL8A 3BGJA 2BY0A 3ISIX 2EGZA 1GKQA 1YDYA 4FHAA 3M4HA 4WEVX 1C91A 3VOJA 3MUAA 3ZJ8A 4JTQA 3SCNA 1JUBA 3EB2A 4S2CA 2P10A 5DT5A 3UW6A 3H12A 3WD4A 2HK1A 3W72A 4PMZA 3GM8A 4DM1A 4PUWA 2GQ8A 3E0WA 1QPRA 2VHLA 1RJRA 2VGGA 1M7PA 3UXIA 2ISFA 5E6YA 3U4AA 1FHVA 3IV8A 1I8JA 2G50A 5GJNA 1GGOA 4LB4A 3BG5A 4TR9A 1S5NA 1U2YA 5HQEA 2Y7GA 1TV2A 3BL3A 1LP6A 2AL1A 3LOTA 1R3SA 1R47A 1SQ7A 3UCQA 4JQAA 1N2VA 4KERA 1W5NA 4LSBA 2VKZG 2QF7A 2ZXQA 2PS2A 4H9UA 4XO6A 3R8GA 3C5QA 1RJPA 1FWFC 4FR1A 5A6JA 2PURA 1K9FA 4RDZA 3UU0A 4QLLA 4FX7A 3KZPA 3S2NA 1G7VA 1P0NA 3TYEA 3CWOX 4N02A 5A8QA 1BKSA 4MNKA 3A12A 3CO4A 5FJRA 3W7KA 3W74A 1ITCA 2AGTA 4JFWA 4HK5A 4KKXA 4UTUA 4NX0A 1LBMA 2WHJA 4J1OA 2BB0A 2P88A 3U48A 3VIJA 2UWFA 4S3BA 4H8HA 4YYCA 3CXOA 3MP4A 1J4EA 2OU4A 3IK4A 4GZ7A 3VI2A 2V2DA 1W3JA 2OZ3A 4PB5A 5KETA 5A5WA 1BYDA 4QS6A 2VX7A 2WJFA 3S5SA 4HYRA 5D38A 2ODOA 1J0YA 1MQPA 2ACUA 4KH2A 4US6A 2Z1BA 3L5LA 4O4VA 3RGTA 4CNTA 4GO8A 2PRHA 3VMNA 3GY1A 8RUCA 3GR8A 1XDLA 1GJWA 1E4MM 3HMJG 2O9RA 3A4JA 1V0MA 3NXLA 3D5HA 3EWBX 4G7FA 4NAEA 1JZ4A 3AMCA 4QFUA 3SCSA 2HXUA 4Z2JA 3ABQA 3FDKA 3VE7A 5DMLA 5H8UA 3HJZA 1E15A 1POKA 3E38A 1XUUA 3H7VA 2P0IA 1FWBC 1S2TA 2NQZA 3W73A 1V3JA 4PCTA 1HL8A 1W5PA 2C14A 5DFAA 4BWLA 3WY1A 1KXVA 1GCYA 2CZDA 4LV9A 4GX8A 4D1IA 3XISA 5EY5A 3CS2A 4CVUA 4KGLA 4ZSTA 2QCLA 4JCMA 1SR0A 3PBYA 1XLLA 2VENA 3AJXA 2V5JA 1KFCA 3GTFA 3C2YA 3RAOA 3WQVA 3WQ4A 1UWTA 4BF7A 3LNMA 4YVPA 2C19A 4CKQA 1DPMA 4GWEA 3ICJA 3AIQA 1KXQA 1Z8AA 2QIWA 4DIAA 4IIDA 4MYXA 3EOOA 3PSVA 3TLLA 1J96A 4E4UA 1XIGA 2GOUA 3VOIA 4LRTA 3UXLA 1FX6A 3LERA 1EPVA 4H6KA 1P1MA 4PUKA 4HYVA 1H41A 1M7OA 4TXEA 1OF6A 3S5NA 4E2BA 4UOZA 1FWDC 4PCFA 2J8FA 4NYYA 3NYZA 1FQ0A 4A3QA 3SSZA 3MUXA 4C1NA 4HU0A 4JTHA 1OT1A 3KTSA 4XZMX 3UG5A 2GDUA 3MW7A 3GXPA 1AQ0A 2QMJA 3B40A 4B5XA 4ZO9A 2B7PA 4IUGA 1WE5A 2WSPA 2ISVA 4MB1A 4PE8A 1CB7B 1JYWA 2CFFA 1SZGA 3TQVA 4HHPA 3JZUA 1UC5A 1DWGM 2DY3A 4H9TA 2QPSA 5AZ0A 1OQFA 4FLRA 5H2ZA 3CPGA 2ATSA 4D6GA 1H11A 1B2YA 2VR4A 2ZC1A 4ES4A 3LHZA 5I78A 3HZ3A 4AZIA 4AISA 1M68A 1Q3NA 3JRKA 1FHLA 1Y0EA 4GFSA 3RR4A 1CGTA 1F8IA 3HV9A 3K46A 4O8AA 4UNKA 3NG3A 3WN6A 1GNXA 2W61A 1OABA 4NILA 2QCCA 3L67A 5HDRA 2E1WA 1PKMA 2YBTA 1PX4A 4AWSA 4B4FA 3RO8A 3ZM8A 1RQEA 3GFZA 2DQXA 1RJQA 4HMNA 1BF6A 5CPNA 1N8IA 3LENA 4PEEA 1AQHA 2Z2BA 2R1KA 5JBDA 4NF7A 2GQAA 4CNPA 4HK7A 3DBNA 5I3DA 2XVLA 3BDKA 2QCDA 3RYSA 3KAOA 1LDCA 4BZYA 1XYLA 2O4MA 3TTYA 1THFD 4ZOCA 2Y2WA 2EPNA 3DYOA 1QUMA 3IARA 3NQEA 3IIXA 4IP4A 2I9EA 1V5XA 4ORMA 1CYGA 4W7VA 1TX0A 4L9ZA 1PTAA 1NOWA 1FKXA 4NZ3A 1TG7A 3H4WA 3O06A 4ZQCA 2BXYA 2WMGA 1IWPA 4NI8A 5M5DA 1UIOA 4JDBA 4FEZA 4R53A 1ECEA 4XQ6A 4NZ4A 1KKRA 4Q4SA 5B80A 3Q58A 1UWSA 2DV0A 3UWYA 4Z08A 1L9WA 1H0IA 3WQ6A 3N9RA 3MMDA 1ME9A 2HDJA 3ALGA 1XCWA 3LI1A 2O92A 3N2CA 4OECA 3WMCA 4UTWA 5AVNA 3SN0A 3T08A 2ZDSA 1VKFA 1FWNA 3GDLA 1QMLA 3SGZA 3M7WA 4KQNA 2I14A 1HXJA 1H50A 4W93A 2GJNA 2R1LA 3QMRA 1FWTA 1UASA 3P7YA 3W26A 2NV9A 2J66A 1OCQA 3HPFA 4F8XA 2OT1A 3HM7A 4BI6A 3AYTA 3KS6A 3KBSA 4NZFA 4BQ2A 1AUSL 1DJHA 1G4TA 2EEXA 2DVXA 3K4AA 4ZQNA 3USBA 7REQA 1FP9A 2WHMA 1X97A 1RCQA 3O2LA 1XGEA 3W86A 4FAMA 1XP3A 1P7TB 4W85A 2OWWA 1GVYA 1P6WA 4RW3A 1XG3A 2EPHA 3WBYA 2FB3A 3M41A 3DCPA 1OC6A 1Q7MA 4ZQPA 3L5AA 1RR2A 2OQHA 1W5QA 3T0CA 2NWRA 4GUHA 3GHRA 4US5D 3OLGA 1G6CA 1V51A 3O07A 1CGVA 3CQHA 3BXWA 2NVDA 4QJ3B 3M0ZA 1LF1A 4NSBA 1QW7A 1PVNA 5C70A 3VX0A 2NX9A 3ALFA 3CQKA 3UYIA 2JKEA 4PUEA 5CLWA 2KX9A 4HHLA 4FOKA 4QSHA 3NGFA 1GQLA 4N6FA 4RZ5A 3EWDA 4AU0A 4MLRA 5A3HA 4UOQA 2YR1A 3ZLHA 2VMFA 3WH7A 3VFLA 4NYUA 3OZMA 2JEPA 1DQWA 2QVNA 2EKGA 1UR3M 4LBUA 4MADA 3TFXA 1YBQA 1AJZA 1S5MA 3FJNA 4B91A 3NA8A 5EMYA 3STGA 1XLHA 2RDXA 5EMLA 5EMMA 5E0CA 4E6MA 1GZJA 5F4WA 5A69A 1FHUA 1S1PA 1W1YA 1OCBA 4L64A 4Y8EA 4E2OA 3LHTA 3SJ3A 3E0FA 1F9CA 3LHYA 3BGAA 5A8PA 1KTCA 2CBJA 4PMRA 4Q8NA 2RGMA 1K6WA 1QR7A 3TQKA 3U0HA 4IIBA 3AXKA 1G7UA 3IUDA 3K13A 4KETA 2GJRA 3KL0A 3UVIA 1QWGA 3GFYA 1Q6GA 4MPQA 3NL3A 1UWAA 3TYDA 2VJXA 1UA7A 3FJ4A 3EXTA 3IJDA 4Z0JA 1VFSA 2A79A 2ZIDA 3DI1A 5BU9A 1MDLA 3Q94A 4WZHA 4C6FA 3VIHA 4AD1A 1RCXB 5H91A 3TN6A 3QBUA 4OBTA 4JOMA 1TYGA 2I5IA 2Z2AA 1KQYA 1VBGA 1W9VA 3MKVA 3IJ7A 5HJYA 3JZEA 1UCWA 2NQJA 2DT1A 3O16A 2QYGA 1E1CA 2WM1A 3QZEA 2VZUA 3NO1A 4UQDA 2YA2A 4WGXA 1Q13A 5CZKA 1B3YA 3HU7A 4HTYA 1R9YA 1VHCA 2JQXA 2G4JA 4GRSA 1KFLA 1MW1A 4PBFA 1QASA 1QNQA 2WNWA 2NXHA 2CWNA 4NZJA 4WGHA 3DBPA 1UD3A 4MHBA 5D9NA 5T9BG 5D30A 2J47A 4CEUC 2GJXA 3COTA 5FEZA 2V2CA 4Y9PA 3V75A 2Z27A 1ZBVA 1AL7A 3PSWA 4R85A 2B81A 1RVGA 2WC4A 2VC6A 1SFJA 4OU1A 2ZRWA 1EF2A 3I6EA 3HPZA 3R11A 2QV5A 4DJFA 1M01A 1SZEA 2FB2A 3DAQA 3GXDA 2JE8A 1XBYA 2B4GA 4GYFA 1KV8A 3MUIA 3F4WA 4MNLA 1DJIA 1TA3B 3RN6A 5GQBA 5CH9A 3F5LA 4M0XA 3UWQA 3NZPA 3G1RA 1NFBA 3RU6A 5CZSA 2X0HA 4ROQA 4GGHA 1LG2A 4HA1A 1L6GA 1PDYA 4JTAA 4TOQA 4ZVJA 2ZE3A 4K38A 5JH2A 3DFOA 4C6QA 1XRSA 3RMJA 1FHDA 1S2WA 3DYPA 1UZHA 1JZ8A 3IAPA 5F2IA 1W3NA 2J9XA 3ARQA 4W8BA 2LLEA 4D6CA 1H7OA 2WOQA 3TE9A 3EDEA 3ES7A 1F74A 3F4VA 3AIWA 5ABEA 1IXQA 4XBKA 2Q6ZA 3MB9A 1Q4WA 2DFAA 1BAGA 4XVEA 3OVQA 2BXVA 1QNRA 3MP5A 2BXZA 2GK1B 2QCEA 3DDMA 3NOEA 3HGRA 3IIPA 2X16A 3UPMA 1N8FA 5GNXA 2YCKX 1KTNA 3BZJA 3A4XA 3E0VA 5AC7A 2WSQA 1S38A 4CLMA 4JN6A 3ITTA 2J8TA 3OHIA 4KWSA 3S6OA 2ZC8A 5EA9A 4MWAB 2EPMX 5I79A 2VL4A 3M6DA 5FJPA 1ZLPA 2OWCA 3VK5A 3SGGA 4FXFA 3KBWA 4HU3A 3SSJA 1A47A 2XFFA 1ZBKA 2A7RA 2BG5A 3U8GA 1DYSA 1PB0A 2CBIA 1XRFA 3CHDA 1DHPA 1CB2A 5HWNA 2DZPA 1P6CA 1PEZA 3LBOA 3IJQA 3T78A 1EBGA 3RNDA 2PODA 3U3HA 5FF2A 1W1PA 5T9CE 4N9BA 2VCBA 3BICA 3C3UA 2RJGA 3MUY1 5JUVA 4PMUA 2PLKA 3EDDA 3GLCA 3BK0A 2W79A 3CASA 3KTXA 3QV6A 4U2YA 4EIVA 3VIIA 2HSAA 4XO7A 1AD4A 1TR9A 3LA4A 4UQBA 3CV6A 2Z4GA 4JL1A 3VM7A 5C2GA 3PBMA 4O1DA 2P0OA 3EXRA 2YCEA 4S23A 4MY8A 3SURA 1JD9A 3VD7A 4JN7A 3G18A 1MYRA 1NFPA 4Y6GA 1XSJA 2VEKA 4M19A 3P0XA 1K7FA 3NPXA 1XIFA 5AHFA 1LBLA 2GL5A 4GD0A 2PPGA 1C8XA 4H41A 4Q4OA 1F4AA 4NNCA 1CPUA 1DQUA 3VGGA 1DXEA 3MYOA 1RA0A 2ACSA 4L61A 3NO5A 3HGOA 1EXBA 3S5ZA 4S3AA 2WVSA 4QIUA 1HL2A 3L2LA 2RHGA 2HVOA 3RU8X 4DWSB 4CD6A 4HCDA 4FNTA 1KRBC 2NLYA 2FVLA 2XTKA 1NF7A 3VU2A 2Y5EA 1IT0A 1LJYA 2Y0FA 4LUTA 1K77A 4B16A 1B5TA 4LY8A 1P7TA 5IDIA 3T0DA 4GA8A 1WOBA 3M5XA 4FMVA 2MUCA 3S42A 2C79A 3MI2A 3O15A 2POZA 4M3PA 1DJYA 2BX7A 4AC7C 4DJDD 1KFEA 3CWNA 4JYEA 1PX8A 4R7WA 5M17A 2WBKA 5H6HA 4EVZA 4I7WA 3W7HA 4G5DA 5E93A 2Y8UA 4HGXA 1LQ2A 3W7NA 4HMDA 2L5HA 3OIHA 5K4ZA 5AYBA 2I9UA 1OBAA 1SUXA 1LYXA 5LIXX 1S2VA 1PJ9A 3G0SA 1TV7A 1K9DA 1JDCA 2F7FA 5JIPA 3E6EA 1TIWA 3MSGA 2QKFA 2HWGA 5F7UA 4YWIA 4WOZA 3ZWSA 5EMJA 3SADA 4F0RA 1UROA 3GTHA 4DYKA 4DI8A 1SW0A 2W92A 3BV7A 4R33A 2A6NA 1I0BA 1JDDA 1FFQA 1A3HA 4FOUA 5DLCA 1P0EA 3SY5A 2POTA 1VYPX 1QO5A 2YPIA 5DX7A 5BMWA 2GWGA 2WMIB 1ODUA 1Q2RA 5A8OA 1MZRA 1HUVA 4D6HA 5A6MA 4POCA 1TELA 4PUMA 1B9ZA 3INPA 2ZUNA 3LCGA 2FH6A 3QQ0A 2FJUB 1A3WA 4Q7IA 4N9DA 3N19B 3GVWA 3NL2A 3IANA 3WJXA 4NJGA 3T9PA 4AZCA 3A5VA 2WZMA 1JFXA 1P0DA 4H9ZA 1FOBA 3GBDA 1VS1A 3H26A 1JZ5A 3W81A 4GLEA 4J7RA 3L9CA 1UB3A 4DUVA 1YE6A 1UKSA 4F40A 8CGTA 3HMCA 4O1FA 1ZY9A 1AJ0A 5HINA 1XR2A 2Z25A 3AS0A 4YTTA 4NXKA 3SM0A 4RDWA