2O9PA

Beta-glucosidase b from paenibacillus polymyxa
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta-glucosidase B
total genus 167
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9pA00
1JYNA 2YDRA 3CZLA 1C91A 3ARVA 3WH5A 3I3EA 2WC3A 3TOPA 2JFEX 7CGTA 1Q6CA 3EMCA 1D7FA 4ATLA 5M5DA 4X0VA 2WC7A 2XGBA 4AXNA 5ABFB 2YBTA 4E4PA 1JFXA 2WCSA 3SCOA 3EBVA 4W8BA 1DWGM 4CN4A 4GI9A 2V3GA 2PWEA 3S2CA 4HOWA 4H8VA 1C92A 3B9AA 4N0RA 4QDMA 1JZ7A 3WNNA 2D22A 4HA1A 3M6DA 2BVTA 1WO2A 4ZEPA 2ZWZA 2VZVA 4EE9A 2VX4A 3UG3A 3I3BA 4GZEA 4HPHA 3ZSSA 1A47A 4PCSA 5EFFA 1XSIA 4U31A 2J8GA 1QBBA 3ZQ9A 1J0YA 3WDJA 4AY1A 2B31A 3RM8A 1MYRA 2DEPA 1UHVA 5C70A 3GYCA 3AQUA 1UKSA 4RE3A 4Z2LA 2V3DA 2J77A 1ZB5A 3WD2A 5IDIA 2WHJA 5JIPA 3CIVA 4E8CA 1VFMA 1NOFA 3G6MA 3ARTA 5C8BB 2BHUA 4JHOA 4ZXOA 1PIFA 4IISA 4A3YA 5KEZA 3AHZA 2J74A 1K6AA 1GHRA 1UD4A 3VIFA 5HBFA 2F8QA 1CGYA 1BLIA 1C3FA 2E9LA 2ZOXA 2WCAA 2NT1A 4AZ6A 5E0CA 1WZAA 2XM2A 3B9EA 4CU7A 3AZTA 3QHMA 1BGGA 4D6IA 3TONA 4WSJA 3U7BA 4MB1A 2ZX6A 1E6QM 2OSXA 1QHZA 3NDYA 1BYBA 3MV11 1FH7A 1KXHA 1EDTA 1LLOA 1H4PA 1UZ4A 2WB5A 3QGVA 1V08A 1H0IA 3VGBA 4Y7EA 2OYMA 1NOUA 4JFVA 4M56A 3T08A 3UR7A 4MNJA 2J7GA 4M29A 3AISA 1C7SA 5C71A 2ZX7A 3RJXA 2ZWYA 3K1DA 3OGSA 2XWDA 1UWRA 2J47A 1UWQA 4W88A 1US3A 1CTNA 1ZBWA 3RO8A 1VEOA 1JDCA 3QOMA 4F79A 2CBUA 2J75A 3AZSA 1W9BM 3RDKA 5IFTA 2XUCA 1VJSA 1J11A 1HJSA 1UOKA 4DWSD 1ISWA 3MSDA 4BF7A 2W63A 3ECQA 2EPMX 1EIBA 2X1IA 3D5HA 3PZ9A 4W86A 1W1VA 4PTXA 3PZNA 3AMDA 2HVMA 3CGTA 1WPCA 3OG2A 3ARRA 3WQVA 5I6SA 5LA0A 3N11A 1KQZA 1GOIA 3A3HA 3EDFA 1A3HA 4AZIA 1VEPA 4CCDA 3VM5A 4UCFA 1UR8A 5AC4A 1JDAA 4XX6A 2CBIA 5M17A 3TA9A 1TFVA 1VFFA 1NWTA 3NYDA 4UQAA 2ZXDA 3ZJ7A 2QHAA 2XSAA 2W66A 1IV8A 1WKYA 2JALA 1TA3B 3FY1A 3HMCA 3SUWA 3VIMA 3W24A 5EB8A 3ZIZA 2DT2A 1K9TA 2VT0A 1AQ0A 1DEDA 3GNOA 4PN2A 4PTMA 3AS0A 4WF7A 3MUY1 5DT7A 1GOKA 1F4AA 3VDCA 2WMFA 1HP4A 2PB1A 1QNQA 1ESWA 1MFUA 2W91A 3WNLA 3TTSA 4GIAA 4X9YA 1ZS2A 3UEQA 4FMVA 1ZL1A 2EQDA 3VGEA 3IJ9A 4WJXA 4JAWA 3KL5A 1YHTA 4TUFA 3PTMA 1DWFM 2BHZA 4QFUA 3AXIA 1MW0A 3VU2A 4ACYA 3M07A 1J0JA 3DYMA 1EQPA 3BGAA 1AQHA 3CH9A 3O2LA 3WD0A 1CXEA 3AHTA 3N17A 4XZWA 1HJUA 2W62A 4NZCA 2VZUA 1W2PA 2A3AA 1MXDA 4JFWA 2XJ7A 3GNRA 2FH8A 2XM1A 3AICA 2NW0A 3RMEA 2WC4A 2G3JA 3MSGA 3PTQA 5ABGA 4UQEA 2ZX9A 1RD6A 4OOZA 2CBVA 5A6BD 1UD2A 4L4OA 4GO8A 2OWCA 1W3JA 3A6OA 1LF1A 1O7AA 2WXDM 3MMWA 4H2CA 1L0PA 3SCPA 4GKLA 2WZEA 3O9NA 4OJYA 1UD5A 3WBEA 3NSMA 1QNOA 4TTUA 2E8ZA 1BTCA 1HKKA 1H11A 3WD3A 3CUFA 1H09A 2D1ZA 4AIOA 2WPGA 2IUZA 1ITCA 3F5KA 1CXKA 2HISA 1GONA 1EH9A 3BAYA 4PTVA 1FA2A 4WKAA 2FH6A 1CWYA 3WEZA 4BA0A 1M01A 1UH3A 3VMPA 3ALGA 1EOMA 1WDSA 3ARPA 3ZJ8A 1E55A 4H8UA 1R7AA 1G01A 1CLXA 2Y4SA 3N13A 1E6RA 1D2KA 4IUGA 2VTFA 3ALFA 1FHDA 4U3CA 3UERA 1H0GA 9CGTA 2BV9A 1NARA 1QW8A 4EKJA 1WZKA 1JFHA 4C7DA 3A4WA 3GTNA 4GQQA 2YIHA 1SFSA 1WDRA 1UZ1A 1GJWA 2ZUSA 2JE8A 2J62A 3M46A 4AISA 1F4HA 1QI2A 4QCFA 4MJ2A 4QCEA 4ZXLA 2FHFA 4KRTA 1VB9A 3GBDA 3F4VA 1B30A 3ARUA 4DM1A 3VDHA 4AC1X 1V6XA 2QF8A 1E1EA 4D6FA 1EXPA 5I5RA 1V03A 4YPJA 3CZKA 5CQ1A 4HMCA 4MAZA 2BY1A 3ARSA 3EDJA 1WAWA 2D3NA 2WVVA 3WQ4A 1UR2A 2VR4A 1M53A 3EDDA 2V5DA 4QP0A 3ARQA 2G41A 3ZT7A 1W9XA 3BH4A 1CGUA 3POCA 3VIKA 3VO0A 2V5CA 3T0AA 3DYOA 2ZUWA 1E6NA 2QPUA 5A6KA 3WNOA 5HXMA 2MANA 1B2YA 1KXTA 4HPGA 4FLOA 4ACZB 5DO8A 4PEEA 4U5IA 2CPUA 3MUIA 5JBEA 3GZAA 4QAWA 2Y8KA 2A3CA 1GQLA 3FN9A 2NSXA 1CGVA 1HIZA 2GJXA 2WCGA 1UA7A 2EPNA 1KWKA 4JL2A 3IJ7A 3VDBA 1FH8A 3GNPA 2DIJA 4W87A 3K8KA 1CLVA 3L4XA 2A3BA 1HVXA 1JAEA 3FHAA 2DDXA 2OSWA 3WSUA 1JZ8A 4B3LA 2DT1A 1BGAA 1ITXA 2V3EA 4MAVA 4AZBA 5CXPA 2J7FA 2OLHA 4UFLA 4PMXA 5A69A 7TAAA 4JFSA 2DQXA 1UH4A 3JUGA 3BMVA 4OIFA 2PWHA 1B3VA 4UQ9A 1ZJAA 5CGMA 1Q6DA 3VNYA 4D6EA 1E5JA 1V6WA 1UR9A 4J3UA 1QNSA 2QMKA 4AZCA 4MJ4A 1V0KA 3RM9A 1BHGA 3ARYA 3W6LA 2ZUVA 1OCQA 3VDAA 2DPEA 3WNPA 3WFZA 3VD4A 4D6GA 1V6VA 3L4TA 1GOMA 1OB0A 4D71A 4H04A 2W4XA 1OIMA 4Z2JA 2F61A 3ARWA 4V2XA 3SCQA 3U57A 1R87A 1CXLA 1GZJA 4FLSA 4OOUA 2C8NA 4WKHA 3WH9A 3KL0A 3KE0A 3IK2A 5CG0A 2WSKA 1K9EA 2QLYA 3BAIA 3BXWA 2VX7A 4BQ3A 4S3JA 1JNEA 4P7LA 2XWEA 3VIJA 5AYIA 1TR1A 2O9TA 1NWRA 3FNDA 1HT6A 1W2VA 3N15A 3O6AA 1OD0A 4NRSA 5D8ZA 3VOCA 4TTGA 4PMYA 4F9DA 4TXEA 2OWXA 3FW6A 4W89A 2YA1A 4D6DA 1VIWA 4AD5A 1AQMA 2WHLA 4S3KA 3WELA 1QNRA 4CU8A 4UOZA 1GORA 1KQYA 5IXEA 1BPLB 2YL6A 1R85A 3GM8A 4AIUA 1XV8A 1E70M 4CU6A 3ZO9A 3D3AA 1SMDA 3EMZA 1HJWA 1XD0A 2WKGA 3CZ8A 1J10A 4ML4A 1OWQA 2XFFA 2X09A 1UWIA 2VMFA 4BQ4A 2BVYA 1QOXA 3II1A 1VEMA 3PTKA 2GK1A 4TX8A 2XGIA 2DSWA 2ZIDA 4YHEA 3FAXA 3T2OA 2EPOA 3VIPA 1JI1A 1GHSA 2YA0A 1QI0A 4W7WA 3WFLA 4LGXA 4DWSB 3ZMRA 4P7OA 1TE1A 1PIGA 1JAKA 3BAKA 1EA9C 1JXKA 3AHXA 3M7SA 2A3EA 4HZ6A 1FHLA 2OWWA 3SCUA 3WUBA 4CN1A 3UCQA 2FHBA 3G6LA 1UD3A 2G3IA 2PWDA 2EO7A 2XHYA 3WD4A 4MNLA 1V3KA 3VILA 2X0HA 4ATDA 2WMIA 2J7HA 2WWCA 1ZBVA 2D0GA 2QV4A 1JYWA 2CKRA 5A2BA 3TTYA 4FLRA 2EBNA 1J18A 1FFRA 1WZMA 1XYFA 5CZKA 3ZSTA 4M1RA 4M80A 2WZIA 4W7VA 3W6MA 5A6SA 5JBFA 2WYSA 4CN6A 3ZR6A 1V3IA 3AIEA 1UWSA 1BVZA 1OBAA 2BXYA 4CCEA 5E0FA 7A3HA 1W9VA 4GPNA 1LG1A 2UY3A 3IAPA 2XVNA 3BC9A 4W8LA 3AXHA 5HOSA 1J0HA 4UR9A 3BAWA 1OD8A 4HMEA 2WK2A 1XSKA 4CUCA 4LX4A 3ZR5A 1E43A 3DHUA 2XFYA 2O9RA 1E4IA 3L4WA 3NCOA 1TMQA 2ZXBA 1HNYA 1EO5A 1JI2A 1DWJM 3KWXA 3LPGA 3ZT6A 2AAAA 5A3HA 1GQKA 2D24A 1QI4A 2WHMA 2O9PA 5E70A 2X2YA 2JEPA 3BSGA 5FKYA 1IZJA 3VTRA 4E2OA 1CYGA 4AZ5A 1DWIM 1B3ZA 1NOWA 2DSZA 3FXYA 2VJXA 1B0IA 3GXDA 1PX3A 3PZOA 4KWUA 3J7HA 4AD0A 2BFGA 4AZGA 1B90A 3S6TA 1B3XA 5LA1A 1WDPA 1SMAA 1UH2A 3AZRA 4AIEA 2Y5EA 4HMDA 3L4ZA 3TP4A 4H8HA 2BS9A 2GFTA 2Z1KA 1LWHA 3T09A 2VZOA 1QI3A 1XGZA 1R7OA 4DUVA 2VZTA 2XIIA 5FL1A 1US2A 3VD5A 4HP5A 4GI6A 1JD7A 2D3LA 5AY7A 3GXMA 1HVQA 1KCKA 3BMWA 3MMDA 1MWOA 2BNJA 1DHKA 1UKOA 1PJ9A 1E40A 1XSJA 3RIKA 3AMLA 4J3XA 2CITA 2XG9A 3ARZA 3MKKA 4GO9A 8A3HA 2E8YA 4AD2A 4X0NA 1E1FA 1ISYA 1OGGA 2CBJA 3VPLA 4JCMA 1E0VA 1V3LA 5EFDA 3QHNA 1ZU8A 4C7GA 1UD8A 3K4DA 2VVSA 3AROA 3ZT5A 4RE4A 1EOKA 5I24A 2FDMA 1BFNA 3WQ5A 4JIEA 3WF4A 5BXPA 3WMSA 1LWJA 2WMKA 3WF0A 4A4AA 1LL6A 4UQBA 1E72M 3NSXA 4C7FA 4Z2KA 2WBGA 2J4GA 2WANA 1U2YA 1LL4A 3WEOA 3BCDA 1HKJA 3W28A 4OBRA 4BS0A 4M24A 2WMHA 5F7UA 2EEXA 3WDRA 1XCXA 1H3GA 4PSPA 3OZOA 3NSNA 5DF0A 4L4PA 3LPPA 2VUYA 1UG6A 4KH2A 1QBAA 3CUJA 1Z32X 3VMOA 2TAAA 1UKPA 1UR4A 2UY2A 3QR3A 1KR1A 3VIOA 1DP0A 1JZ2A 1GOWA 4UFJA 1WCGA 3THDA 2WVUA 1GVYA 3AIRA 1JDDA 1NM9A 1PEZA 3THCA 4GI8A 1CZ1A 3PZVA 3N18A 2E0PA 1XH1A 1W1TA 4AYSA 3TTOA 1H41A 3VGDA 1JYVA 1EHNA 4J27A 1FH9A 5DFAA 1HN1A 4JHZA 3HJEA 3NDZA 2AOSA 1E56A 4PMZA 5CLTA 3MS8A 1PBGA 1CGXA 1E6XM 3F5LA 1MXGA 3GBEA 1HJXA 1DWAM 4Q22A 3W82A 1KBKA 3WQWA 3WL1A 1I1XA 1VBUA 1ECEA 1EHAA 2VVNA 4MNMA 4HZ7A 2CXGA 3CMGA 4QLKA 4MB5A 5A6AA 1KFWA 1V0LA 2VR5A 1E3ZA 5EMYA 3GH4A 3PZMA 2C7FA 2WZHA 2FGLA 2BVDA 2Y2WA 4AZCB 4K68A 4W93A 1E6ZA 5I3DA 1KGUA 3MMUA 3W29A 5A95A 1X6NA 4CD6A 1QI5A 4DWSC 4J3TA 5I78A 1W3LA 5LA2A 5D4YA 4FLQA 4CD8A 1KXVA 4D6CA 5HPOA 3ZOAA 1NP0A 3AIBA 5BXSA 5LYRA 2E9BA 1XHGA 2X8RA 3DECA 5CSYA 2D20A 2CKSA 5A1AA 1PX4A 3GXFA 1QHPA 1GVIA 1QHOA 3VD7A 3CBWA 3IJ8A 2E9MA 2WWDA 3U7VA 2WSPA 2XVLA 2YL9A 4HU8A 4FK9A 4YHGA 3SCVA 2YLLA 3K46A 2Z1SA 1CECA 1GJUA 1W3HA 3BAXA 5D8WA 1BSIA 2JIEA 3KEHA 3UETA 1CGTA 2PC8A 4F66A 1ISVA 1HF6A 1EGZA 3A47A 1LG2A 1V0MA 4XV0A 1W9UA 2GSJA 1G0CA 4UNIA 3CUGA 4AD4A 5BYWA 4XZBA 5D9OA 3AJ7A 4UQDA 3AMCA 1EO7A 1IZKA 3WBAA 3N1AA 3UG4A 4LYRA 2VQUA 4JKLA 3L2LA 3MV01 4H41A 1KXQA 3KL3A 3AMKA 4HOZA 1GCYA 4PMDA 4UQCA 3SCWA 2D0FA 2ZXQA 1B31A 2ZXAA 1VRXA 5CPQA 3UG5A 4BQ5A 1VFOA 3VD3A 5CPSA 3UESA 5FIPA 5CJ5A 1V6UA 2E4TA 2GJXB 4MADA 3I3DA 6A3HA 3SCTA 3AYRA 3SUSA 1XH2A 4AMCA 1J0KA 1BVNP 4B15A 2VCCA 1TVNA 1KR0A 2DT3A 5GNXA 1BF2A 3AS3A 4HOXA 1W3KA 2XIBA 3W26A 3HN3A 3PBGA 4DM2A 1C8XA 4OKDA 3RPMA 2GJPA 1B9ZA 3L2MA 2EXOA 4P7QA 3L4UA 1YQ2A 2V3FA 3POHA 3PN8A 4B9ZA 4MB3A 3AHYA 4P8VA 2VCBA 2YA2A 4PYSA 1W1PA 1LL7A 2VRJA 1RPKA 1UQZA 2VO5A 4U5KA 3RJYA 2PBOA 5FCZA 4F8XA 1JG9A 4DUWA 1J12A 2JF6A 3PHAA 3EMQA 3EYPA 2VX5A 4FF5A 1E0XA 2ZX5A 3CUHA 4P8XA 1SYTA 2DGAA 1JGIA 3T0DA 1BYDA 1GOQA 1PX8A 2A3HA 5E09A 4CGTA 2ZUTA 2UY5A 4WSKA 4EAMA 1HP5A 1OGBA 3WDIA 4A3HA 1FP8A 1QW9A 3DHPA 4MB4A 1E4MM 1QPKA 3AIVA 4WLCA 3VMNA 1HL9A 4PMNA 3BSHA 4MDPA 1LJYA 3VVGA 2OYKA 3N04A 1H2JA 1E4NA 1Q4NX 2YJQA 1KB3A 1OGSA 1CGWA 1V3HA 2CYGA 3K4AA 2YL5A 4JKKA 1PAMA 1BG4A 2DH3A 2BY2A 4CD4A 1JZ5A 3AMGA 5JUVA 3WENA 3PZQA 1WP6A 3N9KA 1W9DM 4J28A 2ZE0A 4R27A 2ZICA 4PMUA 4NRRA 2J8FA 3RCNA 3SUVA 1M04A 2CHOA 3GH7A 5ECUA 3AHVA 3VM7A 5I0DA 2WMIB 2X05A 3A4AA 3CPUA 5BCAA 4PMOA 1U30A 4OUEA 3OLEA 5E6YA 4JZ5A 1DWHM 4U3AA 2CESA 2BY3A 4JFUA 3VX0A 4HZ8A 4JKMA 4W84A 1ISXA 2XTKA 4GINA 5A8PA 2QMJA 5AYBA 5GNZA 5I77A 3CZJA 4AEEA 4V27A 5A2AA 3WDQA 1MFVA 4W7UA 4DWSA 1TUXA 3BLKA 2JIWA 1UWUA 1WB0A 2XVKA 1M7XA 2Y24A 1H1NA 3QOKA 1CIUA 4ZE4A 3RILA 4W5ZA 1JF5A 1E4LA 3CHFA 5A6BA 1X6LA 1VFUA 4UZSA 5A6LA 3DC0A 3WKZA 1QVBA 2GDVA 4J7RA 3SUUA 1GUVA 3WF1A 1KGXA 4AZHA 2CEQA 4HA4A 4QLJA 5HPCA 4XUYA 1XD1A 4HTYA 4BQ2A 3UR8A 2VURA 4V28A 4D6JA 4OBSA 4AZ7A 4PMQA 3WY1A 1CENA 1V0NA 3OBAA 2W92A 2J7BA 2J7EA 5A6JA 4PMRA 4AW7A 3WH7A 5IHSA 4QLLA 2DIEA 2XVPA 2ZUUA 3WH8A 3WUFA 3CHDA 2X0YA 4MTVA 3OB8A 1B1YA 1CNVA 2GK1B 4EK7A 1UUQA 3FAWA 4IPLA 2WBKA 1UKTA 1E0WA 4U2ZA 1XH0A 4W8AA 2DH2A 5I79A 1DTUA 4YN5A 4PTWA 3OLIA 4D72A 1JYXA 2WMGA 4EANA 2E40A 1MW2A 4CCCA 2ESCA 2G8ZA 3IAQA 1IT0A 3WEMA 1ZBKA 5A2CA 1CXIA 4CVUA 1GPFA 2WMJA 3CMJA 1J9YA 1RH9A 3WNKA 1UWTA 2EPLX 1W91A 4P8WA 1NWUA 4HA3A 4MNKA 4PSRA 2CHNA 2QPSA 4Q7NA 1GQIA 4W85A 1UR1A 4PCTA 4WK9A 5TD4A 5A6MA 1RP9A 1AVAA 2GVYA 5ABEA 4UOQA 1WNOA 1J01A 5DMYA 3WF2A 3CUIA 3OIHA 1OM0A 3DYPA 1E6SM 1V3JA 2WM0A 4LYPA 4BZYA 4ACZA 4P7NA 5D9PA 4URIA 3A4XA 3U5YA 1MQRA 1B3WA 4GZIA 4B16A 1HKIA 1KWGA 1CXHA 2DSVA 1XYZA 4AD3A 3RM4A 1UD6A 3CO4A 4ZENA 1C7TA 1C8YA 2VL4A 4PBGA 1HJQA 1HJVA 4CVWA 1HL8A 4ZE5A 1C93A 3CLWA 5A8NA 1UQYA 4BCEA 1VF8A 1JXJA 2EPKX 4IM4A 1UKQA 4H7VA 2G3MA 5GNYA 2WLYA 2D23A 1UA3A 5A8QA 2W61A 3SCRA 4D6HA 1HX0A 1PZ3A 3PZIA 1V3MA 2WNWA 1JD9A 3SURA 2PI6A 4JFTA 2WAGA 2WLZA 2JF7A 4IPNB 1G9HA 3K8MA 4NSBA 4UTFA 2YLAA 3PZTA 1FOBA 1CBGA 1EDGA 4UFMA 1K9FA 3NIYA 4TVUA 3BAJA 2GDUA 6TAAA 2WVSA 3U5UA 2XSBA 3WDPP 1D3CA 2UWFA 4AEFA 1R8LA 2CIPA 1N82A 1V6YA 3W81A 5HNNA 2WKLA 3MANA 1EQCA 4TOQA 5FL0A 3PZUA 2AMGA 2OSYA 2J25A 5A8MA 6CGTA 1NWSA 3WH6A 1Q6GA 3VD9A 5FD0A 3WNMA 3MO4A 1ODZA 5ABHA 3AS2A 3APGA 4J3SA 4GZJA 2DT0A 5M03A 3GXIA 3CHCA 2CETA 1CDGA 5EBAA 2XFRA 4PUEA 4J3WA 3NUKA 4J3VA 4M8UA 3VGFA 1CEOA 4JCLA 1UYQA 3LPOA 2DSKA 4TVDA 4TX6A 3WD1A 3W0KA 1JL8A 2EJ1A 2J78A 1B3YA 3SUTA 5E6ZA 2UY4A 4D1IA 3SEPA 4CKQA 1BAGA 3ZJKA 5GPRA 2G3NA 5CSUA 4CD7A 3QHOA 4UZUA 4W5UA 3SCNA 4RL3A 2VI0A 3OA5A 1C90A 3AI0A 5BXRA 3VNZA 5GQBA 3OLDA 1KGWA 4GXPA 5ABFA 2VX6A 4TVCA 1NP2A 3W38A 5CLWA 2BHYA 2YDSA 3VINA 5M3WA 3MU7A 3ZM8A 1XCWA 3WUGA 1TVPA 4WIWA 1JF6A 3OGVA 3OLGA 2J7DA 5FOOA 4P7RA 1XC6A 4NF7A 2VC9A 1GOOA 5KZ6A 4UFHA 2PF0A 1FP9A 2IXUA 1OT2A 2CERA 4WKFA 1OT1A 1AMYA 3L4VA 1PZ2A 2E3ZA 1O6IA 4GQRA 3T2QA 2BXZA 5BRQA 2GUYA 1RP8A 2C0HA 1JIBA 5AC5A 1HKMA 4PUDA 3WQ6A 3AXXA 3WN6A 1ODUA 2W67A 2NT0A 5BWFA 1G1YA 3AFBA 5BXTA 1LQ0A 4M81A 2PWFA 2JEQA 4LQ1A 3OGRA 3VGGA 1GQJA 2OYLA 3LPFA 4AD1A 1VAHA 2CNCA 3ARXA 1M03A 5HDRA 1J0IA 3MUAA 3WL0A 1VJZA 3W37A 3WMBA 1V02A 4UOJA 5A94A 2O9OA 4RE2A 2PBGA 3SCSA 1CXFA 2VNCA 3AIUA 4M82A 4F9JA 4AWEA 1MQQA 3BLPX 4NI3A 1WE5A 1HXJA 2YKKA 3VUPA 1TZ7A 1I75A 1EDQA 1OSEA 3CZGA 4E8DA 3EDKA 2WHKA 3AIWA 5BRPA 4Z2HA 1OIFA 3OZPA 2RGLA 8CGTA 3W27A 1E5NA 3VIHA 4Z2IA 1WZLA 1OINA 4LXFA 3NJ3A 3AIQA 2XPKA 3WF3A 4ATWA 1TA3A 2VZSA 1J0ZA 1BG9A 3ZJ6A 3N12A 3IANA 4KGJA 3AYSA 2YOCA 2Q8XA 1BQCA 1Q6EA 3VGHA 4R5EA 4KMQA 1E71M 1W32A 5I2UA 4Z2GA 1NH6A 2XYLA 1ISZA 4UFIA 2WVVB 1CPUA 1E3XA 1G94A 2O92A 3WIJA 4P8UA 3PZGA 1UR0A 2G4FA 2W5FA 1C8QA 1QNPA 1WDQA 2ZUNA 4JL1A 3WQ8A 4OZOA 1JZ6A 2VOTA 3W25A 4D1JA 2GJRA 1H5VA 4LYQA 5IFPA 3T0BA 2ZX8A 1JZ3A 3T2PA 5DT5A 1W1YA 5BROA 5D9MA 3SIMA 5JIWA 1MW1A 4KRUA 2WVTA 4CD5A 3TTQA 2V38A 3VKKA 5A8OA 1L8NA 1KCLA 2YL8A 3HU7A 3KZSA 1V02E 2IXVA 4B9YA 1P6WA 2D2OA 1VBRA 3LMYA 4B3KA 5I23A 1JNDA 3L4YA 2YBUA 4KGLA 1H49A 2J79A 2FGZA 2J7CA 3FHQA 1X1NA 3B9DA 5E9AA 1BYAA 1Y7VA 2CCRA 5JBDA 5DEZA 4PMVA 1MVYA 5IHRA 1K9DA 1ZJBA 1FFQA 1TG7A 1W9PA 1E73M 4N42A 5D9NA 4LPCA 2RGMA 4U33A 1PPIA 4MDOA 3AOFA 3VIIA 1E6PA 1XRVA 2ZUMA 1JZ4A 3CTTA 1ZBCA 1GNXA 2XVGA 1VENA 2Y8VA 1BYCA 2D0HA 2VRQA 3WDHA 3GDBA 1I1WA 2BY0A 3VX1A 5CGTA 1Q6FA 2F2HA 4MPKA 3CZEA 2VRKA 3W53A 1NQ6A 2FHCA 4DUXA 5CPTA 1MQPA 1GW1A 3BCFA 1E15A 3AS1A 1TCMA 2VQTA 3CHEA 3WMCA 1SR0A 2VCAA 1S46A 4ZFMA 3E1F1 4U2YA 1MW3A 2YDQA 3F5JA 3W4RA 4UFKA 3WUEA 3B8SA 1U33A 3EDEA 3MUZ1 3VIGA 3K8LA 4PRWA 2WW5A 1KBBA 4HU0A 3GH5A 1E9LA 1R86A 1G5AA 2DSUA 2PWGA 4XB3A
chains in the Genus database with same CATH superfamily
1XPYA 5LSMA 2C71A 4B3ZA 3HQPA 4ZB2A 2GQ8A 1OFBA 1YDVA 3K4WA 4XBJA 4XD5A 3P14A 3NEVA 2XGBA 4AXNA 5ABFB 3ZLFA 4MHBA 3GSMA 1IWPA 1DWGM 3EGJA 2V3GA 2PWEA 3LCLA 4REQA 5IOBA 3S2CA 4H8VA 1C92A 3W6YA 1YW1A 2QV5A 3M6DA 2BVTA 4C65A 4LEQA 1OFEA 3A22A 1GTEA 1TJ0A 1RPXA 1SQ7A 3NZGA 2F2KA 4JICA 4H9YA 5EFFA 1GYNA 3ONBA 3QV8A 1XSIA 4U31A 3W2MA 1OYAA 4ZOCA 5DBTA 2ANUA 3FK4A 1N8FA 3RM8A 1IEVA 4ZQNA 1KCXA 1Q63A 4RE3A 4Z2LA 2V3DA 3FJ4A 1KFCA 4IICA 1GYMA 2WHJA 3GG7A 4ERIA 4PE8A 4JTGA 3T4CA 4E8CA 3E0LA 3UPWA 5LKYA 1XW8A 4JIRA 2E7FA 3M0KA 3AHZA 3G77A 1K6AA 1GHRA 4E5TA 3VIFA 2R8WA 4AZ6A 1WZAA 3M16A 4A2SA 3VNIA 1BGGA 2QUMA 5HNUA 3TONA 3PBMA 4PULA 4WSJA 3EX6A 3U7BA 4MB1A 2ZX6A 1E6QM 2OSXA 3NDYA 3SW6A 1XLBA 2Q01A 5G5IA 1YPIA 1V08A 5ECVA 1WV2A 5I3KA 2OYMA 1NOUA 4JFVA 3UJ2A 2P0OA 3UR7A 4MNJA 4N4PA 2ZX7A 3W2NA 3WG6A 1SW0A 2R24A 1JUEA 1C9DA 3QN3A 4Y9PA 2CWXA 4NG3A 1GTHA 4F79A 3AZSA 1W9BM 3RDKA 4QNEA 1VJSA 4GZ7A 1UOKA 1UUMA 1ISWA 4EPBC 3R43A 2ZDRA 4AWSA 1EIBA 4Q4OA 2XH4A 2AKZA 1R30A 1WPCA 3LXCA 3ARRA 3RLGA 2VC5A 5LA0A 3A3HA 3EDFA 4UBPC 1O1ZA 3LZ5A 3TA9A 1NWTA 3NYDA 1U5HA 2QHAA 2XSAA 3QZ6A 3V36A 1WKYA 1O5XA 3GTFA 2JALA 3W24A 5EB8A 1W3IA 5AZ0A 3N4AA 4GNJA 1VYPX 5JMUA 2QXWA 1SZNA 3MUY1 4DJFD 3RGTA 4GH3A 3VDCA 4YVVA 1HP4A 3OZMA 1LDCA 5E9XA 5HMEA 1MFUA 1KLZA 2W91A 3TTSA 2H90A 4X9YA 3KDOA 3M0JA 1XLEA 4FMVA 1EJ7L 1EF3A 4WJXA 2VELA 3UZWA 3DENA 4Q4MA 2BHZA 3AXIA 1MW0A 3M07A 4ZR8A 1J0JA 2E6FA 1OYBA 4IL2A 2QIIA 3O2LA 1CXEA 4XZWA 2W62A 4KFOA 5FJUA 5IBXC 1MXDA 4DPQA 3S1WA 2FH8A 4P61A 4FIRA 4H9VA 5TF0A 2HJPA 3RMEA 2P88A 3MSGA 5ABGA 3URAA 4UQEA 2FPVA 2DZXA 3HURA 4EWND 2NQ9A 2ZX9A 4OOZA 3S9ZA 1FKXA 4L4OA 1J93A 4XZLX 4PUUA 3EOEA 4LBRA 2Z7KA 4H2CA 1GWJA 1G4SA 1GVEA 3SRDA 3SCPA 2YCEA 4QJ4B 4UTTA 5HMSA 5HWJA 3O9NA 1XL9A 3TLQA 3NSMA 4ZOBA 3RYSA 1U5JA 3R4IA 1ADDA 1AH0A 5H8MA 1XQLA 3UVAA 3UCCA 1H09A 2D1ZA 3OJGA 2WPGA 2IUZA 2OG9A 1AW1A 3KZPA 1GONA 3VCCA 1EH9A 2Z4GA 3CYJA 1FA2A 4GC4A 3BQ6A 3GC5A 4QEHA 4I7VA 3KW3A 2V5JA 1M01A 3ZLHA 3VMPA 1WDSA 3ARPA 1XLLA 3ZJ8A 1G01A 4H9ZA 1KRCC 2V6AA 2R14A 2HE5A 3XINA 3LI1A 4IUGA 3ALFA 1FHVA 3C3UA 1H0GA 4JYDA 1SJAA 4EKJA 3VOJA 2BLEA 1ZJHA 4FA3A 3TYBA 3GR7A 4C7DA 3B04A 3A4WA 2YIHA 4MSSA 2Y7GA 2OKOA 3S6DA 1HO4A 3M46A 3VOFA 4AWTA 4JQ3A 4GCXA 4QCEA 4ZXLA 4DBUA 4PB5A 3VC5A 4GJ1A 4KRTA 3E6EA 3F4VA 3EPMA 3NZRA 3VDHA 4Y9AA 2QR6A 3OPSA 1E1EA 4AHQA 2Z2BA 1K70A 3BJFA 4LW7A 4O15A 3S6OA 3G0SA 3QLLA 1V03A 1AD4A 3L7RA 5CQ1A 2BY1A 3SQMA 2D3NA 2WVVA 2VR4A 3CLMA 4O1BA 4UTWA 3R0UA 5FAGA 1W9XA 1YIXA 1CGUA 2VP8A 3POCA 3VIKA 3VO0A 2HWGA 2Y62A 3DYOA 3OVQA 5A6KA 1WUEA 2XDFA 3WNOA 2MANA 5C7VA 5DO8A 4U5IA 2CPUA 1OG6A 4O4VA 3GZAA 5HR7A 2Y8KA 3RFAA 1HIZA 4HD5A 4PODA 2EPNA 3NG3A 1KWKA 1AODA 1FH8A 2DIJA 2FJKA 1VFLA 1CLVA 3R1ZA 1SGJA 2OSWA 3WSUA 1JZ8A 2GZXA 4B3LA 4HNTA 3HOJA 3HMJG 1BGAA 6ENLA 3PBWA 1FWGC 5U4NA 1RBLA 4OIFA 3CASA 3WLTA 1DJGA 2PWHA 3P6LA 1ZJAA 3H23A 5CGMA 3E5PA 2NX3A 4AC7C 2QMKA 3TIMA 2YXXA 4MJ4A 1V7YA 1M9HA 3ARYA 5K7JA 3I7QA 3VDAA 2H9AB 4BKNA 3WFZA 4DLMA 3VD4A 1AL8A 1VR6A 1YE4A 4D6GA 1V6VA 3L4TA 1DIDA 4KRZA 3QZAA 1QU4A 3P84A 2F61A 1EP3A 4V2XA 3WK0A 4FLSA 5HINA 4ROPA 3TKFA 3L9CA 4J5NA 3W7MA 4RPPA 4WSHA 3WH9A 4UWMA 2IW0A 2DZUA 1E9YB 3TYEA 2QLYA 5EMLA 3WLKX 4BQ3A 3UGRA 1WDWA 3W2LA 3GVQA 1IGWA 2DQWA 2OOGA 1NWRA 3FNDA 4CNTA 1QK2A 3O6AA 3PPFA 1RA0A 3IWPA 1R38A 4TTGA 5LIUX 4F9DA 1MEWA 5LHFA 4W89A 1WQ5A 2YSWA 4ORMA 2WHLA 3WELA 1X38A 1K02A 1XDMA 1GORA 1BPLB 1R85A 1M3UA 4CU6A 4LVFA 3PG8A 3ZO9A 4F2TA 1Q3NA 4ML4A 1OWQA 2XFFA 1ICSA 1QOXA 3GW0A 2YDAA 1BF6A 1VEMA 5RUBA 2ZZ1A 2GK1A 2GVGA 1RUSA 2ZIDA 4YHEA 3T2OA 2JGQA 5H2ZA 5F4XA 3GG8A 1JI1A 1GHSA 4RDWA 1JCTA 1DVJA 5CPMA 3V1PA 3IGXA 3LN3A 4QROA 1OHLA 2H8ZA 2HQAA 1JAKA 3S5SA 1LRTA 1JXKA 2YCJA 3M7SA 1I0BA 3GHUA 1U22A 4K37A 1UD3A 3SSZA 2EO7A 1W1ZA 3IIZA 1UASA 4ATDA 2WMIA 2D0GA 3LSCA 2EBNA 1D3GA 3JRKA 1WZMA 3V0SA 2CLLA 3W7JA 2H6RA 1K77A 3DKLA 1A5UA 3ZR6A 4CN6A 3FYOA 1YBQB 4JIIX 4HJWA 4EX4A 4TV6A 1A5SA 1LCOA 3MJYA 4GPNA 3W7IA 1EJVC 4H9MA 2G95A 2ZQ0A 3H2NA 1VGAA 4O0ZA 3QKZA 4UR9A 1TB3A 3VCRA 1XSKA 2XSXA 4CUCA 4LX4A 3S2JA 3DHUA 3W70A 3PANA 4AHPA 4X9SA 3LM7A 1HNYA 2PU0A 3LM3A 4MUZA 1EO5A 1OADA 3ITVA 1FWBC 1BD0A 3LPGA 4HBKA 5CH9A 3T0TA 3W1QA 3ZT6A 2EG7A 4C6PA 4QQ3A 1GQKA 3SSJA 3WLHA 1XKJA 3QGKC 1KFLA 2O9PA 4ADTA 4NX5A 5E70A 1E0UA 2JEPA 1IZJA 3N25A 1DL3A 4UTHA 4IUOA 1JCYA 2IQ0A 4O10A 5HAOA 3F2CA 1PX3A 3CWNA 1B90A 5T8GA 3B40A 2ZFAA 3TU9A 4PUJA 1IWBA 3LZ3A 4DYEA 2Y5EA 4S23A 3BCJA 3TP4A 2Z1KA 3NM1A 4Q4PA 4YTRA 1QI3A 1XGZA 3GRIA 1LM1A 4DUVA 1QR7A 5DQPA 4LOCA 3T78A 1OG0A 4XD3A 5FL1A 2X7WA 1US2A 3RU6A 1TPVA 1JD7A 5J8LA 4MPQA 1ZALA 3KBMA 4LVGA 4GBUA 2AMXA 1CI1A 1VC4A 3R8RA 3KOWA 3UT0A 4YTSA 3RK8A 1MWOA 1QPNA 4B5VA 1UKOA 1PJ9A 2HBXA 1W6TA 4KS0A 4UNLA 3ZWSA 3RIKA 3AMLA 2V81A 2F84A 3MKKA 1CCWB 8A3HA 2HRWA 4Q8OA 2E8YA 3A5VA 3DBNA 2DW6A 4X0NA 2INZA 1ISYA 1I60A 2CBJA 3DCPA 1V3LA 2IKJA 3OQ8A 4DZIA 4HK6A 5D2XA 4HK7A 4IX0A 2VVSA 3C0QA 3RRAA 5I24A 1BFNA 1PSCA 3WF4A 5BXPA 2WMKA 3WF0A 2YFOA 3APTA 3N9SA 1TV2A 1KV8A 6TIMA 3N2MA 1TREA 3DXIA 1TQXA 2TODA 3N9RA 1FVPA 4Z1BA 2PDFA 3C3NA 1Q6QA 3W28A 1XIBA 1GPWA 1P7TB 2QJHA 1FWRA 4LVDA 3O8AA 4BI7A 5TBOA 2E5DA 3WDRA 4HZMA 3WLRA 1F07A 2FTPA 4DAIA 1GK8A 1CB7B 4Q8QA 3ZYZA 3M0VA 4DJDC 2H3DA 1ZTVA 3VXGA 1UR4A 2EF9A 3QR3A 1WBHA 3C86A 2QCNA 1WCGA 2RAGA 1R9XA 2YFNA 1ONEA 4GI8A 1TPFA 3VE7A 2RHGA 4WCJA 2GQ9A 4RNFA 4HPJA 5FESA 3CWHA 3EB4A 1JYVA 4IL0A 1EHNA 1ICQA 3AXMA 4J27A 4JTTA 1XLFA 5DFAA 3DGBA 3BW2A 4WHBA 3QPZA 1CGXA 1ZAIA 1VCGA 4AIBA 3AYTA 5I00A 1SFTA 1HJXA 2QCMA 1DWAM 1EL3A 3WJXA 3BICA 1TV4A 1I1XA 3HO8A 2VVNA 4MNMA 3DG7A 1G69A 4MB5A 1V0LA 1IZCA 5EMYA 1RHCA 2OEKA 4KW2A 2GOUA 3BO9A 1A50A 2BVDA 2GVJA 2J24A 1I2RA 2QW5A 4YYCA 1E6ZA 5I3DA 3UXAA 3H55A 2FIQA 4LSBA 2DVTA 1QI5A 4ICNA 4INFA 4JN6A 3M0ZA 1KXVA 4D6CA 5I03A 4BEUA 3ZOAA 8TIMA 3GB6A 3NPUA 4QEEA 5BXSA 3G2GA 2PDMA 3GFYA 3TSMA 2YCLB 4XZIA 4KETA 2PP0A 1MI3A 3HB9A 4AVOA 4BHYA 5A1AA 1PX4A 1B57A 3GXFA 4C5ZA 1R46A 2BOFX 4DJEC 2WWDA 3GDLA 1XDJA 4HU8A 4FK9A 1ZNNA 3SCVA 2YLLA 1MNZA 2Z1SA 1K03A 3KEHA 1ISVA 2GSJA 1K8ZA 4PCNA 4A3RA 1O5RA 4LC6A 1OFOA 3CUGA 4AD4A 1VZWA 4O17A 2QCDB 3MKCA 3P2VA 3PB0A 4XZBA 5BYWA 2BP1A 3H24A 1EO7A 3RU8X 3WBAA 3SBFA 3PJTA 4RUBA 4GWEA 1BTMA 5I3HA 3FEQA 4Q7BA 4JKLA 4DI9A 4UNKA 5B80A 4JTLA 4MGGA 3LTSA 1W8SA 3OBKA 4UQCA 3SCWA 3E96A 4GQBA 2ZXAA 1VRXA 1EP1A 3L0KA 5CPNA 3TFXA 5CPSA 4I9JA 4YL2A 3O63A 1VH7A 1H7PA 5CJ5A 4MADA 3I3DA 6A3HA 3SCTA 3A13A 3SUSA 1XH2A 1M6JA 4NIRA 4AMCA 1J0KA 1BVNP 3THAA 4B15A 1GG0A 3VKAA 1BF2A 4DHGA 1W3KA 4IJRA 3P3BA 1PHWA 4Y2WA 1VHCA 3QC3A 4B5TA 4XD6A 4LUTA 4GNVA 1B9ZA 3LQLA 2EXOA 3L4UA 1YQ2A 4L61A 2DIKA 3IGUA 3Q94A 1QWGA 3RXZA 1SZFA 2VCBA 3DG6A 3PBVA 3SN0A 3GNDA 2VRJA 1T8QA 3BG5A 3QMSA 4UB9A 3W87A 2X1UA 3NZQA 3EMQA 2VX5A 1E0XA 2ZX5A 5HANA 2PE4A 1U1HA 1SYTA 5ABTA 3PAJA 1R3WA 1BYDA 3BV4A 4GGBA 4CGTA 3FSTA 4WSKA 3IK4A 1GQNA 2OPJA 1O94A 1HP5A 4A3HA 3W72A 4IFKB 3WQFA 5HJXA 1DORA 2QCFA 3E0VA 1E4MM 4S38A 1DIEA 1T8XA 4C1NA 3N6QA 3TNBA 2PTDA 4MDPA 2V5KA 3STPA 1KFBA 2WOQA 3A64A 3L21A 3FDKA 1E4NA 1ONWA 5C0QA 4HCLA 1PV8A 3VNLA 4EXBA 2J27A 1QTWA 1V3HA 2ZDSA 1HO1A 5BWAA 3HJZA 4JKKA 1TPWA 2DH3A 2C1IA 4CD4A 1X8FA 5FSDC 2FZ9A 4WDUA 4EP8C 3PZQA 4KCVA 2CZFA 1WP6A 3SQLA 2ZICA 4PMUA 4EAYA 3VZXA 3SUVA 3GH7A 2ISFA 3KCOA 4LFYA 3CQIA 3A4AA 4IMDA 4AF0B 5E5CA 5FF4A 1U30A 3W2UA 3OLEA 3PB2A 1DWHM 4LRSA 3WCZA 4ES4A 3NQGA 2BY3A 3AC0A 1IIHA 4HZ8A 4W84A 1KRBC 3OA3A 1HZYA 5GNZA 3VA8A 5A2AA 4W7UA 4JHMA 2JIWA 3LI0A 3QMTA 3CXOA 3ISIX 2Y24A 1CIUA 2D2GA 5IRPA 2GWGA 1JF5A 4A8RA 3G5EA 3B8IA 1OX6A 4DO7A 1R3VA 5A6BA 2Z25A 4L4LA 4UZSA 5A6LA 3DC0A 3WKZA 1CLKA 1HUVA 2CLKA 3SUUA 2DV0A 1KGXA 2I5GA 5AC6A 2HNHA 4QJ3B 4QLJA 2C18A 2QJGA 4ZCWA 4JX5A 3BLLA 2BGNE 4H6KA 3H2OA 1F3WA 1J5SA 4XD4A 4JNMA 2W92A 2J7EA 4H7CA 3WH7A 5G2HA 3DIPA 4JTQA 3WUFA 2X0YA 4MTVA 4V15A 3S1GA 2VGIA 1CNVA 2GK1B 4ML9A 1TZ9A 2YXOA 4H4IA 4IPLA 2QUNA 1JCMP 4Z0SA 2PZNA 4J2MA 4M6QA 2DH2A 2P5NA 3SAZA 3V3WA 1DTUA 2TYSA 3GTHA 1JYXA 2WMGA 4ADUA 3UQNA 1OF8A 3RLUA 4CCCA 4I8YA 2VENA 4UCGA 1CXIA 5LGZA 1GPFA 1KM1A 2P76A 1J9YA 2YW4A 1F9CA 1VYRA 4HA3A 4PSRA 2ZRZA 2QPSA 3DFOA 1GQIA 1VBGA 4LVBA 3CH0A 4NI8A 4KIRA 4WK9A 1EZ2A 4I7WA 1OFQA 2XN1A 3CAVA 2E77A 3WF2A 3CUIA 3OIHA 3VUSA 1OM0A 4X22A 4NAFB 3NEHA 5CSRA 3R5EA 2WO5A 2QCDA 4GZIA 4B16A 1ELSA 1KWGA 1H7NA 5BU6A 4O0KA 1UCWA 2NQHA 3C4UA 1UD6A 4IOTA 4R88A 3KAOA 3URQA 4YWSA 1HJQA 2Z29A 1HL8A 4P2VA 3CQHA 3N34A 1UQYA 2PDXA 2GGJA 2IPFA 4IM4A 4YCOA 2D23A 1D7KA 3H2CA 3N6HA 5A8QA 1HKWA 4D6HA 5HJLA 1XLHA 1W3TA 3D0CA 4O53A 1JD9A 3P7YA 3W74A 5BZAA 4K2SA 5G4EA 4XZHA 3R25A 2PLJA 3K8MA 3TMLA 4UTFA 3PZTA 1CBGA 1TMHA 3NAVA 1WA3A 3CNYA 1K9FA 2IPWA 1JCJA 3DOPA 3U5UA 1D3CA 4TMBA 2PZ0A 4AEFA 1R8LA 4UXDA 4LCSA 3TYDA 4DNHA 5HNTA 3QBUA 2QKFA 5K9DA 3O07A 3HG3A 3TCSA 1YDNA 3KBJA 3VKCA 1XYLA 5EU9A 2PGWA 1BKSA 5FD0A 3WNMA 3PWAA 3BOLA 5ABHA 3AS2A 4J3SA 3OHIA 1SVDA 3VFCA 3UJRA 3L23A 3LK6A 2V8ZA 3CHCA 2ACRA 3G0XA 3KOYA 2CETA 4MUPA 4GI4A 1SJCA 3UZJA 5E0KA 4O8AA 1S1RA 1XBVA 2QZRA 3NUKA 5G1TA 3I4EA 1EGMA 1G7VA 2WSYA 3T0CA 3KWSA 4QSFA 2OGJA 3DFPA 2WKJA 1XIIA 3NQ8A 3VNKA 1EZWA 5ENLA 2PLKA 4LUTB 1GG1A 2UY4A 4D1IA 4RJEA 4RX0A 2WJFA 5GPRA 1VPXA 4NXKA 5GJPA 4CD7A 4UZUA 4W5UA 3SCNA 5G2IA 2ATSA 4QGCA 3VYLA 3OODA 4Y8EA 1H62A 4EWJA 1DTNA 4L65A 5M1TA 3MU7A 3N2CA 1ZJIA 4AVFA 3WUGA 2XIMA 1XINA 3W7LA 2BMBA 5TIMA 3OLGA 2I16A 4DELA 3OVGA 5FF3A 2HK1A 4NF7A 5C2CA 4A22A 1FP9A 4ZOAA 2IXUA 1OT2A 1D9EA 3GHRA 4C1NB 2E3ZA 1O6IA 2QDDA 4IIBA 2FVKA 2E68A 4WDWA 1VLWA 1FWTA 1RP8A 1O12A 4ZOEA 1JIBA 5AC5A 5TNVA 3UFYA 3WQ6A 4C90A 7PTDA 3AXXA 1YXDA 2W67A 2NT0A 5BWFA 5HWNA 3AFBA 5BXTA 1LQ0A 4M81A 4LQ1A 1F76A 4GY7A 3G0UA 1GQJA 2OYLA 1Z3NA 1OX4A 1BRLA 4B91A 2HROA 2CNCA 3BLDA 3G1VA 3MUAA 2GYIA 3T9PA 3W37A 4I9MA 1A5LC 4B90A 3NYZA 3QFWA 4RE2A 2Z7GA 4B92A 4C6BA 1UMYA 3AIUA 1Z44A 4AUBA 3VZYA 2C1HA 2VEPA 1WE5A 2ISWA 4KEVA 3CV1A 5CZTA 3NQCA 3DZ1A 3GIQA 3EDKA 3PSVA 4DXXA 3AIWA 2GOKA 1QW7A 1H7WA 3EKZA 4LF2A 3OG3A 1M7JA 2RGLA 1MUWA 8CGTA 3W27A 1RLDA 1NELA 2I17A 3VIHA 2PP3A 4E2BA 2Q3OA 3N4FA 1MEIA 3NJ3A 3AIQA 1QOQA 2XPKA 4ATWA 1U5VA 5D04C 5AB3A 3REQA 5CEWA 5EY5A 3FS2A 1QAPA 1BG9A 1F2JA 3CB3A 4XZ9A 2O7QA 1R2SA 1RVGA 2VGGA 4KMQA 2QCEA 1W32A 5I2UA 4Z2GA 1AZ1A 1P0NA 1CPUA 4C6MA 5JU6A 3U8GA 4GBDA 3CU2A 4OECA 1G94A 4XSMA 3LXAA 3WIJA 1Q6RA 2X0SA 4ICMA 4GG9A 1QNPA 1WDQA 3W7OA 2VOTA 2OX1A 2GJRA 2O0TA 3GDKA 3WK1A 3TSDA 3T0BA 2ZX8A 4Q33A 1JZ3A 2Y7FA 4AWUA 3H8AA 5JIWA 3I10A 4KRUA 2WVTA 4OGZA 4PB3A 1MXSA 1SZEA 3KZSA 1V02E 4EOUA 2P3ZA 4ZQCA 3MHUA 3MJMA 5BRBA 3VAVA 4RK8A 4KGLA 4B5SA 2MNRA 3IIVA 1TWIA 1H49A 3HF3A 2FGZA 3Q67A 3S47A 1V7AA 3RX3A 3OYXA 3B9DA 5E9AA 3W83A 4JTAA 1N55A 1R6WA 4PMVA 1MVYA 1K9DA 4WY0B 1TG7A 4Q4SA 1Y65A 4LT9A 4LPCA 4MDOA 2EPHA 4Z0JA 1E6PA 1XRVA 4O12A 6PTDA 1T41A 3TTEA 3CTTA 3C2RA 1ZBCA 3H4XA 1MDRA 1R47A 4O16A 3QGAC 1FWNA 4HB7A 2Y8VA 1GVOA 2PGEA 4LAMA 4WXYA 3T55A 3W76A 2TSYA 4HSNA 5CPTA 1GW1A 2CZ5A 4K36A 2PDJA 2X1TA 1V5XA 2VQTA 3CHEA 3WMCA 4MMWA 3HG4A 2VCAA 3L5AA 1S46A 4S3CA 4ZFMA 4V1XA 3E1F1 1MW3A 5HQEA 1FWHC 4KWWA 1MO0A 3B8SA 4C1LA 1OCJA 4JEQA 4L6OA 4PRWA 3GH5A 3KRZA 3MMTA 3PY2A 1N8IA 2PWGA 4XB3A 4FOKA 1GW9A 5IM51 1JYNA 2YDRA 1F8IA 3MUXA 3WH5A 2WC3A 5DMNA 3TN4A 1Q6CA 3EMCA 1AJ0A 3W1TA 1D7FA 4ATLA 3QRHA 1LORA 5LXXA 4H3DA 1TTQA 1TV8A 1K1DA 1ZZMA 5FEWA 1A0DA 4GYPA 3CT7A 3KVMA 4PC8A 3UXKA 2WCSA 3SCOA 3EBVA 4W8BA 5XIMA 1R5YA 4QDMA 1LUCA 3WNNA 1K3UA 5FF2A 4HA1A 4X2PA 4DZAA 1WO2A 4MFEA 5G1MA 2VZVA 1KNWA 4EE9A 3UG3A 3I3BA 3LB0A 1A47A 1M7OA 3AALA 3ZQ9A 1JPHA 3RG6A 2PEVA 3WDJA 4AY1A 2B31A 3ABQA 2DEPA 1UHVA 3E0WA 5HMFA 5C70A 3GYCA 3MHGA 3AQUA 1UKSA 1ZB5A 2A3LA 3W1XA 1WX0A 3VNMA 2B4GA 2C0AA 1W5NA 3AJXA 1KBJA 3SJNA 4IISA 4Z17A 3FVDA 1TPDA 4Z1CA 4MLJA 2NQ5A 2J74A 2YB1A 1BLIA 4BI5A 2ZOXA 4G56A 2B7NA 2NT1A 4Q4KA 1FCVA 3NQ7A 5E0CA 2ZZ2A 3B9EA 1JPDX 1K8XA 4HNCA 3AZTA 4DXKA 3R11A 4YU1A 1WBJA 2J9XA 4QBXA 1QWKA 1QHZA 3PPCA 1EDTA 1U1JA 1OFAA 1H4PA 1UZ4A 2UBPC 3ABOA 2WB5A 4Y7EA 1ALDA 3QQ0A 3MQTA 3T08A 1F05A 4C6KA 4KFPA 3HG2A 4MM1A 3FJNA 1KCZA 5C71A 4QQUA 4QX4A 3RJXA 5H1WA 2ON3A 2ZWYA 3K1DA 3OGSA 1UWRA 4I8DA 1US3A 1CTNA 4R7OA 3MP5A 4JDYA 5DY3A 1VEOA 1JDCA 3UY7A 3QOMA 2GJLA 2CBUA 4FIQA 1RBAA 5IFTA 4Q8WA 3RNDA 4GHRA 3MSRA 2WJZA 3W7HA 2J88A 2Y7EA 2W63A 2VC6A 4WXZA 3D5HA 3WK3A 4OBTA 1W1VA 3WLPA 4PTXA 3THQA 3PZNA 3CGTA 3PAOA 3M9YA 2O56A 3OG2A 3QQWA 3N11A 3B8WA 4X2RA 3S5OA 1XLCA 1OC7A 3VM5A 3H2AA 4IIGA 2AKMA 4JEJA 4XX6A 4Q8PA 4UMCA 4UQAA 2XGZA 2ZXDA 1DXIA 2AGTA 2W66A 4V33A 1IV8A 3GXNA 3VIMA 3FY1A 3TEVA 3ZIZA 3TX9A 2DT2A 4C6LA 3G8EA 1P0DA 4PTMA 2YCKX 3AS0A 3I65A 4GYJA 1JGMA 2C6QA 1JDFA 4QDPA 3FKKA 5LIXX 1F4AA 5FEXA 3W1MA 1FKWA 2PB1A 1ESWA 3AU6A 4FP1A 4LUJA 1ZS2A 3UEQA 2Y8UA 1J2WA 4NZ1A 4JN7A 1YHTA 2HVNA 1RALA 3PTMA 1DWFM 4QFUA 4H9XA 2DJLA 3GFZA 4NNCA 3A3WA 1RQHA 4LAOA 4KWSA 3WD0A 3CV7A 1QXLA 2VHLA 4Q3MA 1W2PA 2A3AA 2XM1A 3AICA 3S42A 2NW0A 2G3JA 4NXSA 4Y9OA 4E2DA 4PCFA 3W7GA 2G4JA 3A9IA 1SJDA 5A6BD 4MWAE 4GO8A 3ZR4A 1R9ZA 2OWCA 1B5TA 1RZMA 5HQMA 3UXIA 2RJGA 3N2BA 1A5OC 2XIQA 1ZHAA 5KSWA 2PP1A 4NAFA 2QCGA 5AKQA 1A5KC 2JKAA 4GKLA 5EMMA 4KFNA 1FDJA 4OJYA 9RUBA 1UD5A 3WBEA 1IT8A 1QNOA 2E8ZA 3PK7A 3WD3A 4JTDA 3F5KA 5LIKX 3DH7A 1XIFA 1CXKA 3KOXA 5C6MA 3BAYA 4PTVA 1XPGA 3WEZA 4R34A 1TJPA 3D3FA 3BUVA 3P5YA 1UH3A 3ALGA 4ZSTA 2E09A 1E55A 3NTYA 2C15A 2HVOA 1CLXA 5E1QA 4Q7IA 9CGTA 1NARA 1UP2A 3MKVA 3ICJA 1ZSXA 3MWCA 3M44A 4X63A 3GTNA 3GD6A 1SFSA 2PDNA 1UZ1A 1GJWA 3FYYA 5AHEA 4HGXA 2L5HA 1QI2A 4QCFA 1NDWA 4MJ2A 4GYKA 1VB9A 2E25A 1W0MA 3EZ4A 4R53A 1K7EA 4AC1X 1MEHA 2OO6A 4DF0A 5AZ1A 3BLIA 1VFSA 3GXTA 4RZ4A 1AA1B 5M2FX 1QATA 4GRSA 3CAWA 4HKPA 1EXPA 1Q4WA 4Z1YA 3W1AA 2GQAA 1HQTA 3PG9A 3UJEA 1GVQA 4YPJA 3DG3A 1VFTA 4BFAA 4MAZA 4S1FA 2W79A 5C9ZA 4DZ5A 1WAWA 3WQ4A 4ADSA 1M53A 3HTWA 4KWOA 3O16A 3D47A 3K13A 2EHHA 1NQKA 4EACA 4KT2A 3RX2A 3QVQA 4ILSA 1CT5A 2ZA1A 4HPGA 4K8EA 5FJTA 4ACZB 4PEEA 3AUJA 1E9ZB 5C7HA 2F38A 1AH4A 2A3CA 4NZ3A 2NSXA 1KA9F 3C2VA 3W23A 3VDBA 3G24A 5DCDA 3CL6A 3K8KA 1ZAHA 3CV2A 3S83A 3L4XA 2ZCGA 2RDUA 3HGSA 3EEZA 2QUTA 3MDUA 3OEXA 4IG2B 5CZ0A 2DT1A 3LV6A 2V3EA 4MAVA 4PTDA 4AZBA 3MDWA 4JTFA 3SY5A 4RXGA 3GDRA 4PMXA 1NDYA 5A69A 1GVSA 2DQXA 1UH4A 2R6OA 3V7PA 2CZVA 5XINA 3GTXA 4UQ9A 1Q6DA 4WX2A 1V6WA 4AZCA 3HGOA 1Y5WA 3RM9A 3W6LA 2ZUVA 4N2YA 1XI3A 4PTNA 1LLZA 3LLDA 2DPEA 3WNPA 1VFHA 8XIMA 4XVEA 4KCWA 3P61A 4H6QA 2R1LA 3SCQA 1R87A 2C8NA 3VOHA 1RV8A 2J9YA 3EWCA 3UWYA 5H91A 4ERGA 4N9BA 3SJ3A 3KL0A 5CC5A 3KE0A 2PODA 2OMAA 2VX7A 3QSTA 1PB0A 2GGEA 4P7LA 1V8EA 2XWEA 3VIJA 1TR1A 2O9TA 1OD0A 1QMLA 1KTCA 2R1KA 2NXGA 3TQVA 3FW6A 9XIMA 2PRLA 2J9ZA 4D6DA 3FGCA 1AQMA 1QNRA 2G37A 1YTEA 1KQYA 5IXEA 3V5CA 4IP7A 4AIUA 3IVUA 1XV8A 1E70M 5K2ZA 1TO3A 1UBPC 3D3AA 3EMZA 4F0MA 4GVHA 3CZ8A 4O1DA 2ABBA 2ASHA 4IPIA 2X09A 2HMCA 2BVYA 2PD5A 2VXNA 4IP5A 5CKSA 4GLEA 2DSWA 2EPOA 4IQDA 2YA0A 1JULA 1QI0A 2PDYA 3O7UA 3ATYA 4DWSB 3ZMRA 4IMGA 1UIOA 2ZA2A 1TE1A 2OCZA 4AVNA 1W1A1 4NQ1A 5PTDA 3MT1A 4HZ6A 1FHLA 4DF1A 3WUBA 3P62A 4EF8A 3UCQA 4RW5A 4QE1A 1I2PA 2XHYA 3WD4A 1PDYA 3IIOA 3VILA 4K3ZA 2X0HA 2OOFA 2QV4A 2WWCA 4F0RA 2PCQA 4FLRA 3L68A 4LEFA 2NQZA 1J18A 2DU2A 4HHLA 1XYFA 4DPPA 3ZSTA 5AECA 4E0CA 3DDMA 4K38A 3OW1A 4M80A 2JKEA 2WZIA 4FNUA 4UTIA 2WYSA 1V3IA 1Q6OA 3BGJA 1DQUA 2V69A 3V0TA 1F3TA 2PLMA 1OBAA 4QISA 7A3HA 5E0FA 3WLJA 1TWZA 3IAPA 1NJJA 1O66A 4W8LA 5HOSA 1J0HA 1Y0EA 1N8WA 2OLSA 3PSWA 3PPGA 1UP3A 3MCOA 1PKNA 3EXTA 1TMQA 1OFPA 3LHUA 3TQPA 2CXEA 3GY1A 5LNVA 2AAAA 2XH2A 1W1B1 1OFDA 3GVGA 3MHFA 3USZA 2ZZ3A 3TJXA 5CBJA 3K30A 1NVMA 3DEQA 3VTRA 4IQEA 3G3MA 4AZ5A 1V51A 2PCEA 5AOUA 2OZ0A 1RR2A 3P74A 1B0IA 1I6NA 1TQJA 4QS6A 5B7ZA 8XIAA 5D32A 4AD0A 4AQLA 1KFJA 1S5VA 5DMMA 1UJPA 4O1FA 5LA1A 1A49A 4H9UA 4TIMA 4AIEA 1L2UA 1G4PA 3WBYA 5K3VA 3U3HA 4H8HA 2PFHA 4G7EB 4R7WA 4YTQA 4KCUA 5LXEA 3K5XA 3QY6A 1R7OA 2ZRXA 4POCA 2E67A 2FKPA 3GVRA 1RXOB 3I6EA 3NQMA 4RR4A 3GXMA 3TJLA 1HVQA 3BW4A 3Q45A 3UWVA 2ABAA 4YVPA 1TPH1 3UU0A 4PL2A 2J6VA 3RLVA 3EWZA 2RDXA 3LGGA 1B3OA 3R6IA 3BOFA 3VPLA 1OGGA 1X98A 3CQ0A 1LUCB 1ZU8A 2V82A 4C7GA 4LTSA 3IJIA 2HS8A 3KX6A 1H61A 4JIPA 1T40A 4A4AA 1LL6A 1SJBA 4UQBA 3LCGA 3LU2A 4K1WA 2QGHA 4XISA 1E72M 4Z2KA 4QNWA 5AVHA 1U2YA 1LL4A 4Y6GA 3BCDA 4OBRA 6XIAA 1KM2A 3L0NA 4KEMA 2O4MA 4IX2A 4KKXA 4QRNA 1UMLA 3SRFA 4WJ8A 1EB3A 3TC7A 3I6RA 3TH6A 3KXQA 4DJFA 5KETA 2A7NA 4KWVA 3PUGA 2ISSA 3ZFHA 3NSNA 4JQ2A 4L4PA 2W0UA 3BVJA 3G8RA 1UG6A 4KH2A 1DJZA 1QBAA 1Z32X 1TRIA 4PUMA 3O6CA 1BXNA 3C61A 3JR2A 1KR1A 1ME7A 1GOWA 3THDA 2V63A 3AIRA 4XKYA 1DJIA 4L9ZA 2AL2B 3TQKA 4O1AA 2E0PA 3TC3A 2X16A 3TROA 4AYSA 3TTOA 3FV9A 2ZC1A 4DJFC 2ADAA 4JHZA 3NDZA 3UR5A 1C8VA 4GFIA 4IIEA 1WKEA 4PMZA 1E56A 2EKCA 1PXGA 5CLTA 3MS8A 2CLHA 5D02A 1PBGA 4RZ6A 2A21A 1MXGA 3GBEA 4Q22A 3W82A 4V1YA 3E0IA 3WQWA 1E1CB 3W84A 1PKYA 1ECEA 4HZ7A 2CXGA 4QLKA 1YXCA 1E3ZA 3SM0A 2TMDA 1GZGA 3GH4A 2WM1A 2C7FA 3MP3A 4AZCB 4JOMA 4PZVA 2BASA 3O15A 1KGUA 1UC4A 1SZGA 3MMUA 3Q2DA 3W29A 1X6NA 4CD6A 4HT3A 5A95A 3HG5A 4DWDA 2YCLA 2XH0A 1VJIA 2WSQA 4XBSA 3OTRA 2V2HA 3GC4A 1TV3A 1EWEA 5J5DA 1Z42A 3FJ6A 4G9PA 2X8RA 3DECA 2CKSA 1EJSC 2PPGA 4R33A 5A8GA 7ODCA 3CBWA 1XXXA 2YL9A 1X97A 4YHGA 1EP2A 3GZ3A 3K46A 3M0IA 1GJUA 3UETA 1CGTA 1Q5MA 1W37A 1OC5A 3SI9A 3C2FA 1V0MA 1W9UA 3G22A 1JQXA 5I07A 3VCNA 1ENUA 4O19A 1BQGA 1M1BA 1UC5A 3NOYA 4CNOA 4FF7A 3AJ7A 2PGFA 3GU1A 4AXKA 4PRTA 1A4MA 3WK2A 3QY7A 4L1XA 3ES8A 3LERA 4LYRA 3H2EA 3L2LA 1S5NA 3AU2A 1R0MA 4H41A 4PEKA 4PMDA 2ZXQA 1IEXA 3F03K 1W5MA 1VFOA 3VD3A 3UESA 2Q09A 1P4CA 3T8QA 4NT0A 2E4TA 1JDEA 3TJ4A 3KUMA 4F0HA 4QG6A 2DT3A 2H9AA 2HCVA 2ACUA 4HOXA 4GE8A 1P48A 2I5QA 3RPMA 1XFBA 4LB4A 4P7QA 1VLIA 2V3FA 3POHA 3PN8A 4B9ZA 3AHYA 4Y9MA 2YA2A 4RNHA 4XZMX 5LGXA 1LL7A 2VO5A 5FCZA 4WQ6A 4DUWA 4C6IA 1J12A 2CLMA 2P10A 3N29A 3PHAA 5T26A 1EBGA 1H60A 4P8XA 4L80A 3UZYA 3WZ0E 3AO0A 1XWYA 2XIJA 2DGAA 3N73A 1JGIA 3LHWA 1GOQA 4S3EA 2ZUTA 2UY5A 1FX6A 3UWQA 1OGBA 4K7VA 1FP8A 3GNNA 2JGYA 3E3HA 4MB4A 1QPKA 1H7XA 2GVLA 3AIVA 4G1NA 3VMNA 4Z08A 2PA6A 3VVGA 4JBRA 1NF7A 2ZTKA 1IE7C 1PYMA 2D2JA 3C0SA 3HPZA 1VIZA 3F1QA 1TPC1 2NV2A 5D2TA 3QMRA 4DF2A 5L6UA 2CYGA 4IHCA 1UP0A 2AQWA 3B0XA 3K4AA 3R2GA 2YL5A 1BG4A 2BY2A 3AMGA 3WENA 5KMYA 3N9KA 3K1GA 2ZE0A 4R27A 2AQVA 3IJLA 1IIGA 2YPIA 1I9CB 4F4RA 3LD5A 4CQ9A 3AHVA 4C60A 3VM7A 4MZ1A 2WMIB 1LZOA 4ZSUA 2X40A 1TPUA 3ELFA 2W3ZA 1MUCA 1EKOA 5E6YA 3NQVA 1OYCA 3SFWA 2ZVIA 3VX0A 3BANA 1DIOA 4GIEA 4JXCA 3IS4A 2XTKA 2QMJA 1ZAJA 2PRHA 4V27A 2PTWA 4DWSA 1XLJA 3GHTA 1UWUA 4IXHA 2A4AA 4IMEA 1H1NA 3QOKA 4RLIA 4ZE4A 1XR2A 3KDNA 2FTWA 1QASA 1E4LA 3WQEA 3CHFA 5F4WA 4NY2A 4WVXA 5D30A 3UJSA 3BSMA 1KM5A 5CAHA 3B97A 2F7FA 5FSEC 3M64A 1XGDA 4JY9A 4HA4A 1EPXA 3KLKA 4XUYA 4I6VA 5EMKA 1WDDA 3H70A 2QVHA 5TQLA 2DW7A 3QC0A 4UR7A 2ZZ5A 3DHDA 3CJPA 2QCLA 4I9TA 1O5QA 4M6PA 1DXEA 1DOSA 4OBSA 4AZ7A 4PMQA 3OO2A 4YS1A 3OBAA 2J7BA 5A6JA 4AW7A 1RQBA 1E1CA 3RPDA 1QCWA 1XYBA 4EK7A 3P5ZA 2ZC8A 4LWWA 5EYWA 3FAWA 1L9WA 2WBKA 3LCHA 3LRLA 1E0WA 4U2ZA 4W8AA 4LS2A 4YN5A 4PTWA 2QYGA 3OLIA 4NJGA 3H21A 5JQ9A 1MW2A 2ESCA 3WEMA 4JTIA 3F2DA 5A2CA 4Y96A 5HUOA 1FHUA 4CVUA 1EPVA 2PLCA 2WMJA 4L6HA 3T8LA 1RH9A 3HFYA 1WYIA 2EPLX 3SR7A 2PWUA 2Q71A 4P8WA 5JH1A 5HK4A 2QAFA 4IFOA 4DNMA 3O0KA 1MZHA 4DJDA 1IXNA 4KERA 4TV5A 3ABSA 3KTXA 3Q37A 1XYMA 4PCTA 5TD4A 5A6MA 1RP9A 2GVYA 4UOQA 3LHZA 1J01A 5DMYA 1U83A 3MYPA 1JCXA 3GUGA 3DYPA 3QF0A 4GVFA 4QJ1A 4BZYA 4HQVA 3IIXA 2B0MA 3A4XA 1MQRA 1J8VA 2F6KA 3PC0A 3CYVA 4C6JA 1XYZA 1IF2A 4AD3A 5FF0A 5J5RA 4RDVA 1VHNA 3CO4A 5XIAA 3SB0A 1C7TA 1PKMA 5FACA 2Y6ZA 3CLWA 3L2IA 5A8NA 1SFJA 2IPGA 1DPMA 2BB0A 1EYWA 4ZODA 1RJQA 3VKDA 2EPKX 2WLYA 4GFSA 1ZP3A 4FXSA 5GJNA 4M51A 1VCVA 1UA3A 1IXOA 3ZZ1A 2W61A 2V67A 3PZIA 1PO9A 2WNWA 3BURA 2Z00A 2IMRA 2PI6A 1MZRA 2FLIA 4JIHA 4JFTA 3WLIA 4DO4A 3FYPA 2X30A 2JF7A 2KX9A 1G9HA 3M0LA 4NSBA 1SO5A 1ZUAX 3TYZA 3V35A 4UFMA 2OODA 4TVUA 5H8UA 3HPXA 3N3MA 2CIPA 3W22A 4AMAA 2WKLA 3MANA 1EQCA 2PSNA 2NV1A 3PZUA 4XAGA 4L7ZA 2OSYA 5A8MA 6CGTA 2GDQA 3WH6A 1FWWA 3T05A 3A9BA 2F9RA 1NY1A 4CQ8A 3KTSA 3NA8A 2GWNA 1ODZA 3BK0A 1YNYA 3GKFA 3KBNA 3RF9A 5EBAA 3EAUA 3QV6A 4PUEA 4UMAA 5CBBA 4J3WA 3UVIA 3LHVA 4G6CA 1DJNA 2Z1BA 4M8UA 1OX4B 2ZTJA 5I3FA 4JCLA 3LPOA 5D05A 2OT1A 3WD1A 4LUYA 4MF4A 3CC1A 1Q8AA 2V2DA 3W00A 3SUTA 3TZNA 5E6ZA 4ZGYA 3KBSA 1OX5A 3SEPA 4CKQA 5J04A 2G3NA 5CSUA 4OQVA 5D03A 4E2VA 3ITLA 4RL3A 3AI0A 4Q8NA 3OLDA 4Q4QA 1YADA 3B06A 1TVLA 3G1RA 5M3WA 2OGYA 3GG1A 1XCWA 1TVPA 4LANA 1Q66A 3ANYA 4WIWA 1X96A 4IJCA 2X7VA 4E4UA 5KZ6A 4NJJA 1KM6A 2PGRA 5D2WA 2V68A 4RZBA 2VWSA 3M7WA 1AMYA 3QLDA 1PZ2A 6REQB 1T0OA 4GQRA 3T2QA 4ZFCA 3N2OA 5DELA 2YB4A 1NFGA 1TJ1A 3VC6A 4N6EA 3WN6A 1ODUA 2VR2A 3W73A 1AW2A 2JEQA 3OGRA 1EWDA 1DHPA 3LPFA 2HV5A 5JVLA 3ITCA 1TZZA 4A2RA 4AD1A 3ARXA 3GR8A 1V02A 2PF8A 4LU0A 4NNAA 4HNOA 2HDJA 1RY8A 5SWUA 3F2BA 4WOQA 4M82A 3WBXA 4F9JA 3M0MA 3NPWA 2F6XA 3BLPX 2ALDA 1EEPA 3QPYA 3GR4A 1J6OA 1HXJA 3HV8A 4O54A 3GKAA 1EDQA 1OSEA 3CZGA 4E8DA 2VC7A 3KP0A 2WHKA 4P5UA 3GDMA 5BRPA 4Z2HA 1OIFA 3L5LA 3OZPA 4J1OA 1S5WA 4NL1A 4JGDA 1E5NA 3GE7A 4Z2IA 1WZLA 3RX4A 4FB7A 4LXFA 3UYIA 1TA3A 2VZSA 3G1DA 3N12A 4KGJA 2X2GA 3B8VA 3BTNA 1NH6A 1ISZA 2ZRVA 4F0KA 3MCMA 5CCZA 3BZGA 2VKZG 3N2XA 3WMLA 4P8UA 1DE5A 3PZGA 5I06A 1UR0A 2XH7A 1C8QA 1OCNA 2XU2A 3ME3A 1VBHA 1UPPA 3JW7A 3T1GA 4S3DA 4FS9A 5AC7A 4JL1A 4OZOA 2Z26A 4HK5A 4HYRA 4R7JA 5CAKA 2CLFA 4J9JA 3B0PA 4N7QA 1YNQA 5DT5A 1HGWA 5BROA 1W1YA 3IGHX 3QSRA 3SIMA 2VOMA 1MW1A 4CD5A 2V38A 1N7KA 1L8NA 2OJPA 5AYZA 2IXVA 3S0CA 2D2OA 2GL5A 5I09A 3F4DA 1X8CA 1Z48A 2J79A 2AQOA 2J7CA 3FHQA 4GVGA 4HSOA 1BYAA 1Y7VA 2OKTA 4R9XA 1V93A 2POZA 2R94A 1HGYA 2RGMA 4U33A 2OX4A 1JVNA 3C6CA 1ITQA 1MRQA 4J35A 3S8HA 4HYWA 2G5WA 1S2TA 1VENA 3TYCA 2QNEA 2NSOA 3U0HA 3P0XA 2VRQA 3WDHA 3GDBA 3FA3A 4I5XA 3VX1A 2F2HA 1AMKA 3HQ1A 4O0QA 2PMQA 4D8LA 1AK5A 4KIEA 3MPGA 2FHCA 2A1YA 3NURA 4N9DA 3AS1A 3BMXA 2NX1A 1TCMA 1M68A 3E9AA 1XP3A 7ENLA 5DCEA 4U2YA 4DO6A 3W4RA 1I2NA 3WUEA 3H26A 4QE4A 1U33A 3R79A 3UNTA 1KBBA 4HU0A 1E9LA 3DAQA 1R86A 1RJRA 1Z41A 2BBFA 5F1UA 1C91A 3ARVA 3M41A 3TOPA 4OFCA 3QXBA 4FX8A 1XQKA 3MI3A 7CGTA 2QUUA 1SM9A 3E2SA 3TYUA 5LHEA 4JQAA 4KCTA 4X0VA 2X41A 2WC7A 2YBTA 4E4PA 2DUZA 1M7PA 3GK0A 3NXLA 1Y8BA 4UTLA 5G4WA 4HOWA 4N0RA 1JZ7A 3B9AA 1W56A 4LF1A 3PJWA 3O6DA 4ZA0A 3TWAA 3NR0A 4G1KA 2VX4A 1FWIC 4GZEA 4HPHA 1KTNA 2J8GA 1QBBA 3N2TA 1MYRA 4I6KA 1JUKA 2AL2A 2J77A 4GKTA 3WO8A 5IDIA 1VFMA 4LRTA 1NOFA 3G6MA 3REQB 4GUJA 4DUOA 3M0XA 5CJNA 4JHOA 2VFGA 1TELA 4MY1A 3DKJA 4A3YA 2FFCA 2PDGA 1Z8AA 3W1NA 1SSGA 5KEZA 1UD4A 4JTHA 1C3FA 2E9LA 2G97A 3G3DA 4EXQA 1A5MC 4HJFA 4D6IA 1SO6A 1PVNA 1NSJA 2EAWA 3SRKA 1ZY9A 1HTIA 3BLFA 3MC5A 1KXHA 1V4YA 4XAPA 4C6FA 3QGVA 3VOGA 1H0IA 3VGBA 2A0NA 2VEKA 1XLGA 4M56A 2RFGA 4ALDA 1VQTA 3AISA 2HE8A 1C7SA 2GGGA 4CEXC 5LNUA 4U10A 4NYYA 2XWDA 3R7MA 1UWQA 3CUZA 4W88A 3EKGA 1ZBWA 3PPHA 4UUIA 3WJWA 3KBWA 4XVDA 4N9EA 3IVTA 4AAJA 1OEPA 1J11A 4FPSA 2HZGA 3H2FA 2PDKA 3S1XA 2XFWA 3W7EA 3FDGA 2EPMX 3PZ9A 2X1IA 4W86A 3AMDA 3QQ1A 1RQEA 5I6SA 5H8PA 1GOIA 2E5CA 1A3HA 1X7FA 4XTDA 2I9EA 4YLWA 5REQB 4CCDA 1UR8A 5AC4A 1MMFA 3HIJA 2INFA 4O8RA 2QUVA 3M5YA 5M17A 3SO7A 3N14A 3HMCA 1TA3B 3SUWA 1NTHA 1K9TA 1AQ0A 3NQAA 3GNOA 4PN2A 1O68A 4WF7A 3APYA 1GOKA 3T40A 3SN1A 1V79A 4GIAA 3UZXA 3WFAA 1Q2SA 8RUCA 1I2QA 1ZL1A 5C5YA 1Z9AA 2ONEA 3VGEA 3LEPA 4GJIA 1A5AA 4JAWA 3W1LA 4TUFA 1M65A 3C8FA 4LV9A 3H22A 5BW6A 3WJSA 3VU2A 4ACYA 1MDLA 3DYMA 3NFUA 5D37A 2WZMA 1EQPA 3BGAA 3S5YA 2NQJA 4ZO9A 1HJUA 5U7SA 4NZCA 2VZUA 1O95A 5A5WA 4CQCA 2OEJA 4JFWA 1TX0A 4B5UA 4CQDA 4UTWC 3EB3A 4KPLA 2DZVA 2FGBA 3B0UX 3R58A 4HNLA 1TSIA 3QV9A 1S38A 3N3TA 2XN2A 3A6OA 3E49A 1QPRA 1O7AA 3G1AA 7REQA 3O06A 4F40A 1JEZA 1L0PA 3CO8A 3TC6A 3XIMA 3GG0A 1PL9A 3IVSA 2OB3A 3TDFA 3BPWA 1HKKA 3EX4A 3UWUA 4OTKA 3TMQA 1ITCA 3KVLA 1YPXA 2Q3RA 4CEUC 1EX5A 4DBDA 2PWVA 1EYEA 1FY6A 4WD0A 2C16A 3VFLA 4BA0A 4YTUA 4E38A 4GGHA 4FXFA 1FWJC 3B3DA 1FTXA 4GIYA 1E6RA 3FA5A 4EPKA 1SUXA 1FHDA 3UERA 1RVKA 2E6YA 4GCAA 1QW8A 3PVFA 1T6MA 1TYGA 3PF3A 4GQGA 1JFHA 2FYMA 1JJKA 2NQLA 3PR2A 5K9CA 1XJBA 3QR1A 4LNYA 3EWUA 2ZKMX 2ZUSA 4AISA 4XAFA 1F4HA 2WQPA 4ZTYA 2QAPA 1GEQA 3FA4A 3GBDA 3MYOA 4NAEB 4DM1A 1K7FA 1J6PA 2SFPA 2QF8A 4D6FA 2QF7A 1X39A 1R3TA 4H1ZA 3BLEA 1OZMA 1YNPA 3KS5A 1Q85A 3IJ6A 2FVLA 3CZKA 4PBFA 4IGSA 4L56A 1L6WA 4O14A 3EDJA 1LBLA 4LB3A 2HXUA 5AHMA 1UR2A 1YRRA 2ODOA 3EDDA 5B7YA 3ARQA 2G41A 5T9CE 1XF0A 3U6WA 2V5CA 3P67A 4GY1A 3EX1A 1YTKA 4GUHA 2QPUA 4DQWA 1KXTA 4FLOA 4XO7A 4GD0A 5LNRA 4BWLC 3CMFA 3MUIA 1A4LA 1XISA 1CGVA 2GJXA 3DI0A 4ZB5A 3LNMA 4JL2A 5C2GA 3EWYA 4DRSA 1QT1A 2OZTA 3GNPA 4XIAA 4O11A 4W87A 1VRDA 3SRHA 3UBPC 4JPGA 3SIZA 2A3BA 1HVXA 3M5VA 3ONCA 2DDXA 3NO3A 4GA8A 5GJMA 3SQSA 1ITXA 3I68A 1JCNA 5CXPA 2OLHA 3W1PA 2J66A 3KCJA 4BY3A 4GX9A 1KM0A 4JFSA 4DO5A 1UJQA 3JUGA 1B3VA 3VNYA 2BWGA 4KESA 5K9XA 4J3UA 1V0KA 3NQEA 5I3IA 3HM7A 3ABRA 1F74A 1OCQA 2DFAA 1REQB 2LLEA 4IIFA 1GOMA 5BOOA 4D71A 4H04A 2W4XA 1OIMA 4Z2JA 3PWIA 4MY9A 3U57A 1A0EA 4OOUA 3WQOA 1LLWA 5DRIA 3UJFA 4WKHA 4O57A 3W7CA 3OZYA 4DZHA 1SZRA 4IMAA 1VPYA 3VOIA 3ERPA 3IK2A 5CG0A 3DESA 1K9EA 3BAIA 3E02A 1YEYA 3BXWA 1JNEA 1OJXA 5AYIA 3RLHA 1HT6A 4NRSA 5D8ZA 3PTDA 4PMYA 1TTPA 4TXEA 2OWXA 3URNA 1U1UA 2YA1A 2YXGA 4BF5A 1VIWA 4AD5A 4S3KA 4UOZA 4CU8A 3HV9A 3KHJA 3U9IA 2NVAA 2BX7A 1AQFA 3LX9A 1S3HA 1C9WA 2VM8A 4XBKA 2ZVRA 4C6QA 2EGZA 4FR6A 4YIWA 4LC8A 2VMFA 4BQ4A 3TW7A 2TPSA 4YNGA 4JN8A 3C2EA 3PTKA 2BODX 3FAXA 4UTTC 3VIPA 2VGFA 3SY1A 2NV9A 4K39A 3WFLA 3T42A 1ONRA 4LGXA 3QKEA 2A6NA 1NIUA 3BAKA 1TX2A 5CC3A 3E12A 4QG9A 1ADSA 4Y9NA 4HCHA 5DLCA 2X1SA 3SCUA 3S5NA 4C5YA 2FHBA 4UC5A 2G3IA 1QO2A 2PWDA 4GQ0A 4MNLA 4TO8A 1V3KA 2NWSA 5HJYA 3BQ5A 1ZBVA 1JYWA 2CKRA 5A2BA 3N19B 3A4JA 3JS3A 1FFRA 2CZEA 5CZKA 1IEQA 3CUXA 4W7VA 1WKDA 2OZ8A 3W6MA 3O3RA 5A6SA 3AIEA 4LALA 3H53A 3VZZA 4IFKA 4ZO8A 2ISVA 1BVZA 4CLMA 5EMUA 2BXYA 2VDIA 2QJIA 4CCEA 5HATA 2NUXA 1LG1A 2PURA 3BC9A 1JCLA 1RK6A 1F6PA 2BOEX 4UTUA 4IIDA 5AYYA 4HMEA 1VKFA 5JXQA 2WK2A 3OQEA 1A3WA 1ONXA 1ZQ5A 1BEUA 3ZR5A 1E43A 3LNPA 4E6MA 2XFYA 2O9RA 3L4WA 3NCOA 2OT0A 5DXYA 1G4TA 3W7QA 4DJED 3H12A 3UZ5A 1JI2A 4QTGA 2ZZ7A 1ZGDA 1DWJM 5FJJA 1OY0A 3KWXA 1M5WA 1Q8JA 2WHMA 4C1KA 4FI4A 3BSGA 4HMNA 4DLFA 5A6TC 3M1ZA 4E2OA 1CYGA 1XLDA 1F6YA 3ZXWA 4CNUA 3W7PA 5CZJA 4AF0A 1VD6A 1PS9A 4DI8A 3PZOA 2PDQA 2BFGA 4LUIA 4AZGA 4S2BA 3S6TA 4RKAA 4RDZA 1PZ0A 1B3XA 7REQB 3W7DA 1SMAA 1UH2A 3AZRA 3UW6A 1MSSA 4NAEA 4TR9A 3BE7A 4PH6A 2BS9A 2GFTA 3GS6A 4FSAA 3L65A 3ZS4A 4YXGA 3NOEA 1QRQA 3G1XA 2VZTA 4DIAA 4QDWA 1GKRA 1FWFC 1J5TA 3VD5A 4HP5A 1SU5A 4GI6A 2D3LA 5AY7A 4AX7A 1WKFA 2INEA 4DVOA 1DIKA 3BMWA 1J96A 2XISA 3KOFA 4HPNA 4QSHA 3COTA 1XSJA 4IT1A 4J3XA 1MNSA 2CITA 2P0IA 3ITGA 4GO9A 2QJMA 4AD2A 5I3JA 1E1FA 1US0A 4FNTA 1XUZA 4DJDD 1UD8A 3U4AA 1YBQA 3AROA 4RE4A 3WLLA 1T5AA 1EOKA 2FDMA 4F48A 1KBLA 3WQ5A 1PWLA 4IGHA 4ZVJA 3WLMA 3B4UA 7TIMA 4A6GA 4MJZA 3NSXA 4C7FA 2WBGA 3L5MA 2V5LA 2WANA 4B2DD 3FCPA 3DHFA 3KOZA 2O55A 3RHGA 5HULA 3NWRA 4JQ4A 3BJTA 4Q8UA 5T9BG 4OWGA 1H3GA 4WGXA 1VS1A 3DFQA 3THUA 4NJKA 4XKYB 2TAAA 1C29A 4U4MA 1DP0A 4UFJA 1PCKA 5C9UA 1GVYA 3GLCA 1JDDA 1PEZA 2JBMA 3THCA 4DEFA 4UTKA 3PZVA 4MFDA 1S1PA 1UWAA 3NQBA 3IUIA 3IARA 4GUGA 2GGIA 5CBIA 2XN0A 4A3QA 5KTLA 3EOUA 4CQBA 1PE1A 3EWBX 3S2NA 4CQAA 3QW3A 5MKGB 1E6XM 3F5LA 3SY8A 2E6AA 3WL1A 1VBUA 3NQ6A 1EHAA 2TRSA 3BZJA 1KFWA 3G18A 1GVRA 3MW7A 3PZMA 1Z7AA 1TIWA 2WZHA 2FGLA 4K68A 4EIVA 3KRSA 3STEA 1RK5A 2NVDA 4DWSC 1OC6A 2ACSA 4J3TA 3S2LA 1W3LA 3HPFA 4FLQA 4CD8A 4ERAA 5HPOA 1DJWA 4AY8A 4ZBCA 4LUSA 4FXJA 3R89A 2I14A 3TA6A 4ECLA 5CSYA 3PBUA 2D20A 3CQKA 2QDGA 4G7FA 1GVIA 1QHOA 3LRKA 3IJ8A 3GHSA 3U7VA 2WSPA 2CLEA 2XVLA 3IUHA 4HHHA 1WAUA 1XLIA 2JIEA 1XFCA 2QT3A