2O9PA

Beta-glucosidase b from paenibacillus polymyxa
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta-glucosidase B
total genus 167
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9pA00
3QOKA 3ARPA 3K1DA 4PSRA 1ZBKA 2PBOA 4M24A 1OCQA 1GOWA 1W1VA 3WMBA 2PC8A 2DGAA 1H4PA 2DSZA 3W82A 1GHRA 4D72A 3ARRA 2XHYA 4JFWA 2CXGA 6TAAA 4E8DA 3N04A 2WCGA 4P7OA 2V5DA 3RIKA 1QHOA 2ZX5A 1E72M 3M7SA 1MFUA 1JD9A 1EOMA 5HXMA 1H1NA 4Z2HA 5A6SA 5BRQA 5BROA 2WSPA 1VEOA 3VM5A 4MADA 1E3ZA 1CLXA 1JXKA 3WSUA 2EJ1A 1QOXA 2ZUUA 3L4WA 1BGAA 2BVYA 1CEOA 4UQCA 1E5NA 3OLEA 3DYMA 3WF3A 1V6YA 5LA0A 1MVYA 4AZ7A 1XH2A 5HBFA 4HMEA 4HZ6A 1QBBA 2BXYA 2GVYA 3WF0A 3CZJA 2ZX6A 1GOMA 2BXZA 3SCRA 1OWQA 4MPKA 3ZSTA 4NZCA 1EHAA 3UR8A 2V5CA 4OKDA 4PSPA 3WUEA 1UKPA 2NSXA 1M7XA 4FLRA 1V03A 2X0YA 4JL1A 4PMYA 2Y4SA 4IISA 7CGTA 3WUGA 5D8WA 2PB1A 1E0VA 1EH9A 1UQYA 1WE5A 2EPNA 1QNPA 2VRQA 4DUVA 1OM0A 1TVNA 2D0GA 4LPCA 4ATWA 4L4OA 4U31A 2XJ7A 2RGLA 3BSGA 1MQQA 2OWCA 4AZHA 4D6EA 1E3XA 2WBGA 1PEZA 1W1TA 1CGXA 1OINA 2A3HA 1ZBCA 3VGEA 3WDIA 1YQ2A 3VD9A 1VIWA 2J7BA 2J79A 2YOCA 4QCFA 3UG4A 1GHSA 1KR0A 4ZENA 3JUGA 3VVGA 1B3XA 4QLJA 4Z2JA 4M1RA 3ARWA 1C7TA 1PIFA 4LYRA 3SIMA 4BS0A 1C8YA 1XH1A 1W1YA 2Y24A 1JZ3A 5I0DA 1OGSA 4TXEA 1XCXA 1EO7A 3AIWA 4H04A 3NDYA 2VRKA 3CUHA 5A6JA 3ZO9A 2WZEA 1CPUA 1J0HA 1HJSA 3WBAA 5D9MA 2WMJA 1ITXA 3MSDA 1W91A 3PHAA 2ZXDA 1EGZA 1PBGA 2D0HA 1J18A 1UR9A 3N12A 3VIIA 4B3KA 1GNXA 2WHLA 4HU0A 5HOSA 1GVIA 4GI8A 4DWSA 1KCKA 1UKTA 3AIUA 1HP4A 2VR5A 3L4ZA 4W7UA 2PWDA 4R27A 2VL4A 4ATLA 4JCMA 1ISXA 2XFFA 4HU8A 2VCAA 2UY5A 3VDHA 4H7VA 2IXUA 1CXHA 1U30A 5CGTA 3II1A 1PZ2A 3L4TA 4MDOA 3AYRA 4AZBA 3ZOAA 4EE9A 4HZ7A 1NOWA 2WHMA 1KR1A 1W9UA 5A6LA 1WDQA 4OOUA 1CWYA 3ALFA 4YHEA 1B3YA 2W62A 4BZYA 3PTMA 3CIVA 3TTOA 1TA3B 3AMDA 1E4NA 3SCWA 2G3IA 2XWDA 4FLQA 2F61A 3A4WA 1GW1A 3W4RA 5CLTA 3N17A 1PX4A 1PZ3A 4UQ9A 3ECQA 3QR3A 1AQMA 1FOBA 1E5JA 3BAJA 1C8QA 4D71A 1I1WA 1C7SA 3OB8A 3T0DA 3DHUA 1UWIA 5I79A 1LG2A 1GQIA 3AROA 1V0MA 1W2PA 1W2VA 2CBIA 1LL4A 4AWEA 2EPLX 3I3BA 1W3JA 1EDTA 2E9MA 1XC6A 3W81A 3OBAA 3WF2A 5A1AA 4BQ3A 3GYCA 3WQ8A 5M03A 1V3MA 1D3CA 1GOOA 1E6XM 3IK2A 4DWSC 2GJRA 2D20A 1H49A 3AXIA 4GI6A 1KGWA 1PAMA 1BSIA 3AHTA 1HJQA 4BF7A 2EPOA 2WYSA 3PTQA 4IM4A 3ARUA 4N0RA 4TVDA 3WNOA 4LXFA 3QHNA 1FHLA 2O92A 4OIFA 1CXLA 2DDXA 4AD2A 3ARYA 1VJZA 2FHBA 4W87A 4H2CA 1JAKA 3VDBA 3HMCA 2ZX7A 4UTFA 5IHSA 4GO8A 4J7RA 3AS1A 3W24A 5AYIA 4TVCA 4YPJA 3SURA 3U5YA 2A3AA 4AD5A 1QI3A 3VKKA 2TAAA 1X6LA 1B0IA 1UWRA 1XSJA 5I6SA 4UOZA 4AYSA 1WO2A 1TZ7A 2C7FA 4UNIA 4DM1A 4TX8A 4GQRA 2QPUA 1E6SM 3N18A 3RJXA 1KCLA 2JF7A 2W91A 2XIIA 3CTTA 4EKJA 2YLAA 2X05A 4W88A 3A47A 5GNXA 1J0IA 1E9LA 2VR4A 1MYRA 1QW9A 2ZUNA 1JIBA 5I3DA 3ZIZA 3TTQA 3AMKA 4HP5A 2YDQA 1ESWA 5IHRA 3K4DA 3AXXA 3AS3A 3WH8A 3W29A 1UA7A 3WENA 4PMQA 1C92A 1LQ0A 1FH7A 2A3BA 3VIMA 3RM4A 1ZU8A 4AZ6A 2J75A 1KGXA 2WCSA 2C8NA 1WZKA 1HP5A 3N1AA 1MXGA 4HA3A 1FH9A 1O6IA 3HU7A 3MV01 5A6KA 1ODUA 1EHNA 1TUXA 1V3JA 4AZCB 3KEHA 3UCQA 2W4XA 2VCCA 2YL6A 3BC9A 3MKKA 5FL0A 3U7VA 5CPTA 3DC0A 3OGRA 4TTGA 2PWEA 5GNYA 1YHTA 5HDRA 4OBRA 3T0BA 1TR1A 1W9PA 4WKFA 4MJ2A 4QCEA 1E6RA 3RDKA 2BNJA 3AMLA 4CD7A 1D2KA 3RCNA 4JCLA 2J8FA 3F4VA 2GJPA 4HMCA 4D1JA 1G01A 4Y7EA 2UWFA 1KGUA 1VFOA 1U2YA 4FMVA 4AC1X 1LWJA 5FKYA 4JKKA 2JIEA 2WANA 4XZBA 1CLVA 3QGVA 5FIPA 5FL1A 1C90A 2BHYA 3BAIA 3N9KA 2DPEA 4UFLA 1ODZA 2ZXBA 3WF4A 3WQWA 1AMYA 2D24A 3MMWA 1O7AA 4GZJA 3WMCA 1HNYA 4HOWA 3N11A 4TOQA 4M81A 1NARA 2CBUA 3BAXA 3EBVA 5A2CA 1KXTA 3AZRA 2VQUA 3VMNA 1BYBA 1ZBVA 2WSKA 2AMGA 2CKSA 5E0CA 5F7UA 3VIPA 3PZTA 3M07A 1XSIA 1ISWA 1B3ZA 1D7FA 1MW0A 3UESA 3EMQA 4HPHA 4IUGA 4JHZA 2F2HA 1UD5A 3IANA 2ZUSA 3IJ8A 4MB4A 3VDAA 3OZPA 4CD4A 5A6AA 4PUEA 1HL8A 4UZSA 2X0HA 3B9AA 3WKZA 1EQCA 3BAKA 4KRTA 4CD5A 1BG9A 3THDA 5I77A 5AYBA 1SFSA 1ECEA 1BHGA 4KH2A 4CVUA 5D4YA 2GJXA 4F8XA 5ABFB 3KL5A 1KFWA 2J47A 1E70M 5EBAA 1GQKA 4MB1A 2WMGA 5A2BA 4W93A 3VX1A 3VGBA 1MW2A 2VX5A 1JYXA 3AIEA 2CETA 4DWSB 1UR4A 1CGUA 3L4YA 1V0LA 4AD1A 2EXOA 4H41A 4AIUA 4AY1A 4W8AA 5BWFA 1EXPA 1CGWA 2WMIB 1CZ1A 1EO5A 2VZUA 3WD0A 4GIAA 2JIWA 1GORA 1QI2A 1UH2A 1BLIA 3GZAA 1JZ8A 1QI0A 4XUYA 4KMQA 3MUAA 2VX7A 4GKLA 1JDCA 3WH7A 3SUSA 2CIPA 5CSYA 4XB3A 1DWAM 2VI0A 2WPGA 3WDQA 1KBKA 2J78A 3VMPA 1E4IA 2XM1A 1CTNA 2UY3A 1TA3A 2ZUTA 4GI9A 4JAWA 4NF7A 3W25A 3ZT5A 4MNLA 5BCAA 4U3AA 1MFVA 2ZUVA 1VAHA 4MB3A 3O9NA 1VEMA 2EPMX 1UR1A 3ZJ7A 4BCEA 1UD3A 4ZEPA 3BCDA 3A3HA 4D6CA 2J77A 2BVTA 4KRUA 3MUY1 2ZIDA 2A3CA 5E0FA 1J0JA 1JFXA 1GJUA 3G6LA 4IPLA 5LA2A 1JI2A 4GZIA 3KZSA 1Z32X 2CKRA 4UZUA 1AQHA 1XD1A 3UEQA 1QW8A 2XPKA 1DP0A 4U2YA 1LL7A 3FAWA 2VO5A 4ZXOA 1BVNP 2J7HA 3NSMA 1UOKA 4M80A 2EQDA 4OZOA 5ABHA 2QF8A 1RP8A 1GQJA 4XV0A 1UWSA 1V6XA 3GH4A 3NCOA 5I23A 1GPFA 1GOQA 1HKJA 2XSBA 4W7WA 2O9RA 2WAGA 4H8UA 5HNNA 3AZTA 1Q6GA 2Y2WA 4UQBA 3AXHA 1UKSA 2D22A 4AD3A 4C7DA 1Y7VA 1DHKA 4UFHA 5CSUA 1TCMA 3WDRA 2WW5A 1XYZA 1V02E 3VIJA 3NSXA 2YA1A 3VIGA 3GTNA 2QMKA 3VGFA 1QNOA 1CXIA 2FDMA 3CMJA 3MS8A 4Z2KA 2XG9A 2PWFA 4AISA 2CEQA 2DT2A 1G94A 1KWGA 4UFJA 2EO7A 2YKKA 1OD0A 3AICA 4YN5A 1JZ4A 3NUKA 5A6BA 2XGBA 4C7FA 1ZL1A 3ARZA 1UUQA 4X0NA 3ZR6A 3OIHA 3B9DA 3O2LA 1H3GA 5A6MA 1Q6EA 4GZEA 4JFUA 1F4AA 3WNPA 2D3LA 2Q8XA 4NI3A 4CD8A 4D6DA 4N42A 3WDHA 1F4HA 5JBDA 5I5RA 2WK2A 3GNRA 5DT5A 1R86A 3UETA 2WLYA 1HJWA 1E1EA 1PPIA 1R7OA 3U7BA 1UZ4A 4PRWA 1EDQA 1Q6CA 3VIFA 4CCCA 1J12A 1MQRA 4PTMA 3MO4A 1B3VA 2CPUA 3VD3A 1E73M 4DWSD 1Q6FA 1GOKA 3EDJA 3SCQA 1BAGA 1JNEA 3SCPA 1RPKA 2ZICA 1K9EA 1UH4A 4WLCA 1BYDA 3WDJA 1HKMA 4HZ8A 1HL9A 4PTVA 2WVVB 2V3FA 3WD3A 4NRRA 1DWHM 2UY2A 3AYSA 1LLOA 4UOQA 3ZM8A 2VOTA 1E43A 4PEEA 1N82A 1B31A 3VIHA 3CUGA 2Z1SA 2JFEX 4WK9A 2DSUA 1XGZA 1HJXA 3VPLA 2XWEA 1E6QM 4MDPA 2PF0A 4D6JA 4PMXA 5JIWA 4PMZA 2OLHA 2YDSA 4ZFMA 1ISYA 1HF6A 2DIJA 4AIOA 4W85A 2G8ZA 2BY1A 1LL6A 3FXYA 4QP0A 2WZHA 4HPGA 3O6AA 2WVVA 4OOZA 5E70A 4UFIA 1WZLA 2WMKA 1B1YA 4KGLA 1CGTA 1S46A 5A94A 1LF1A 5E9AA 6CGTA 2XTKA 3CMGA 1C8XA 1QNRA 2YL8A 3CUIA 3BSHA 1V3KA 4CVWA 4H8HA 1E40A 4MJ4A 1IZKA 1V3LA 1H0GA 4PMRA 5M3WA 3WNLA 2ZXQA 1UH3A 4F9JA 3SUTA 1W3KA 1WCGA 2VX4A 4LX4A 4IPNB 3VNZA 3QHMA 1JDDA 3UG5A 4ZE5A 3ALGA 5KZ6A 4JFVA 2X09A 2WVSA 5I78A 1MQPA 3PZGA 4V28A 4A3YA 3GXDA 2CYGA 4U3CA 3CHDA 1E6ZA 3W6MA 1CECA 4PMOA 3A4AA 1AQ0A 4TX6A 1X6NA 2FHCA 1U33A 3BAYA 4MAZA 1FH8A 2E8ZA 2E3ZA 5DO8A 1FFQA 2VZVA 1NWSA 3OZOA 1Q6DA 2WBKA 1G9HA 4PTWA 3ZJ6A 1BTCA 2E40A 5I2UA 1E71M 4URIA 1LG1A 1JD7A 4ML4A 1UHVA 4UQEA 5A8PA 4P7LA 4PMDA 3AIQA 5BXRA 5A6BD 1QBAA 3OA5A 1R87A 1C91A 5E6YA 1DWJM 3M46A 4KGJA 4DUWA 3AISA 1OIMA 4CUCA 1J0YA 2O9PA 1SYTA 3EDKA 3VDCA 5CPSA 3BGAA 4F79A 4M29A 3NIYA 2VRJA 3ZSSA 4F66A 2J7GA 3T09A 3RM8A 4MAVA 4BQ5A 1H2JA 4FK9A 2WHJA 3PZNA 4D1IA 3CPUA 2YL5A 2DQXA 4S3JA 2JF6A 4M82A 4HMDA 5A8OA 2WCAA 3OGVA 2DH3A 3AIRA 2XIBA 4CCDA 3CUFA 3CHFA 4EAMA 1V6WA 1WNOA 5BXPA 4WSKA 2YBUA 1VB9A 4PCSA 3G6MA 3CZEA 1MW1A 2G4FA 5GPRA 2EBNA 1QNQA 3FHAA 4D6GA 4R5EA 3BMWA 4QLLA 1E56A 3RM9A 3EYPA 1OGBA 2B31A 1NWUA 1KQYA 1V0NA 3ARSA 4WJXA 1BVZA 5CQ1A 1E4LA 2MANA 2GK1B 1GOIA 4PMUA 3VTRA 4P7QA 3WBEA 3KL0A 1GCYA 3CZLA 3HN3A 2XGIA 3VIOA 1G5AA 4H8VA 1GZJA 5GNZA 2WVTA 2O9OA 4WSJA 1OGGA 3NYDA 5A69A 4FLSA 3EMCA 5DT7A 2DT0A 1E0WA 1VFFA 3WELA 4NSBA 2FGLA 2BFGA 2OYLA 2WKLA 3S6TA 3WL1A 4AD4A 3MSGA 2ZX8A 2OWXA 2V3GA 4B16A 1NH6A 4U2ZA 1E4MM 4U33A 2RGMA 3SCNA 4A4AA 1BYAA 2BY3A 2E9LA 4E2OA 4JKLA 1NWTA 3SCSA 4P7RA 4GO9A 3L4XA 2DSWA 4J3UA 4D6HA 4A3HA 2XFRA 1DEDA 1B90A 3TONA 1JZ5A 2X2YA 1DWFM 2IXVA 5A8MA 4Q22A 4W84A 1MWOA 3WL0A 3L4UA 5A3HA 1NQ6A 1TVPA 4X0VA 2FH8A 3BCFA 4ACYA 5CLWA 3WMSA 3SUUA 1HN1A 1LWHA 3AOFA 5CXPA 1ISZA 3VD4A 3RPMA 2J62A 3CZ8A 3VGDA 1CENA 3WUFA 1VJSA 3T2QA 1UWTA 5FD0A 1DTUA 2E4TA 1J0KA 5CJ5A 2V38A 3EMZA 2QMJA 2ZXAA 3APGA 3GBEA 5LYRA 4CCEA 2X1IA 5ABGA 1BGGA 4ACZA 3TTSA 3CHEA 3L4VA 5EMYA 1FP9A 5HPCA 3I3EA 3WEZA 3W28A 4J28A 1VBUA 1WDRA 5JIPA 3UG3A 1XCWA 4CU6A 1C93A 2WC3A 1JGIA 1MXDA 3ZT7A 1WKYA 2VMFA 4U5IA 3WQVA 2D23A 8CGTA 3ARXA 4J3TA 3WNMA 4J3WA 3UERA 1VEPA 3VGGA 4Z2IA 4P8VA 4W8BA 2J74A 4QAWA 3WQ5A 3WQ6A 3K8KA 3ARQA 4K68A 4UOJA 1UD4A 1E1FA 1VRXA 1J9YA 3VM7A 2J7FA 2Y8KA 4Z2GA 4PYSA 1IT0A 1VFUA 2GSJA 1ISVA 3GH7A 2WKGA 4D6FA 1K6AA 2ZOXA 1TG7A 4PCTA 3EDDA 5ECUA 4AZ5A 3AIVA 3FAXA 3QOMA 1CIUA 2VURA 4P8XA 3WEMA 3VIKA 2FHFA 2WMFA 1JZ6A 1LJYA 1QI4A 1W1PA 1JI1A 2VX6A 1UR0A 2ZE0A 1NWRA 2ESCA 2XVPA 2J7EA 1ZJBA 3ZJ8A 1QVBA 3LPGA 4W86A 2WM0A 3WDPP 2WB5A 3GH5A 3RO8A 1UR8A 3LPOA 4WIWA 2G3MA 2J25A 2VJXA 2PI6A 4V27A 3GXFA 2CHNA 3WNKA 1CDGA 3M6DA 1UR2A 3W37A 2GFTA 5DMYA 5AY7A 4MNJA 4CN1A 1BFNA 3CO4A 3WY1A 5A8NA 7TAAA 3NDZA 4PBGA 1BQCA 2XSAA 1G1YA 1UWQA 5ABEA 4ATDA 1UYQA 3CZGA 1RH9A 1PX3A 1A47A 1XSKA 1E6NA 2VZTA 1JL8A 2VUYA 5TD4A 4M8UA 1JAEA 5EFDA 2VCBA 1UG6A 1WZMA 4JHOA 1KXQA 4BQ4A 3OGSA 1DWGM 4MNKA 3MMDA 1WB0A 5HPOA 1J10A 4D6IA 1FFRA 2JEQA 2OSWA 1HKIA 2J4GA 1J01A 5D9PA 5EFFA 5M17A 3OLGA 5E09A 2EEXA 1KXVA 3EDEA 2VVSA 1M03A 3WF1A 5I24A 4CGTA 1VF8A 4ZE4A 3MUZ1 3D3AA 4J3XA 1L8NA 3T08A 1P6WA 3AQUA 3N15A 4JIEA 2G41A 2DIEA 4UFKA 5BXSA 3T2OA 3OLDA 4ZXLA 1M04A 2WVUA 5ABFA 3GNOA 2ZWZA 1RP9A 4QDMA 3CZKA 3PZOA 3POCA 2VC9A 5D8ZA 2G3JA 1CGYA 4B3LA 5C71A 1QPKA 2FGZA 1TMQA 3VILA 2BY0A 3BMVA 1K9TA 3DHPA 4QFUA 3ARVA 5D9NA 1WZAA 3ZJKA 1HT6A 1ZBWA 2E9BA 1V08A 3PZVA 3GXMA 2W61A 4JKMA 2UY4A 1EOKA 1GVYA 3WUBA 1WPCA 2EPKX 4NRSA 4BQ2A 3ZQ9A 2Y8VA 5C70A 3B8SA 2C0HA 4PUDA 4GINA 4EK7A 2ZUMA 4S3KA 3W53A 3FNDA 2OYMA 3TP4A 4J27A 2W63A 3ZT6A 4OBSA 4AMCA 3IAQA 1NOFA 3AI0A 4DM2A 2CITA 4FLOA 1QHPA 3EDFA 5C8BB 1JYNA 1NM9A 1R8LA 2ZX9A 3VO0A 3E1F1 3FHQA 5JUVA 2GK1A 2CCRA 1FP8A 3VINA 1QHZA 1JNDA 1UZ1A 2IUZA 3LPFA 2W67A 3VD7A 1JDAA 2J7CA 1JF5A 4UFMA 4U5KA 1IZJA 5CG0A 1W32A 4WF7A 3W38A 3AS2A 3TTYA 3WFZA 5JBEA 3SEPA 4XX6A 4AZGA 5BRPA 1OT1A 2YIHA 3VOCA 2GUYA 5DEZA 3GNPA 3MV11 2BY2A 1XRVA 3AIBA 2VZSA 1M53A 3WD4A 3AHVA 1R7AA 1ZS2A 3OLIA 4JFTA 5BYWA 4M56A 4LGXA 3W27A 1NOUA 1WP6A 3AS0A 3PZIA 2DEPA 1EQPA 4MTVA 3WH5A 2YL9A 4X9YA 1WDSA 1W3HA 3A6OA 1I1XA 2AOSA 1V3IA 3UR7A 1W9XA 3HJEA 1KWKA 3DYOA 2BHZA 3CGTA 3NJ3A 1IV8A 4B9YA 2OYKA 1SMDA 2VT0A 3FW6A 2CBJA 4GPNA 3KE0A 2DT3A 3VX0A 4DUXA 2XVLA 1US2A 3CBWA 3VNYA 1B30A 1ZB5A 4CU7A 2ZWYA 3PZ9A 1ZJAA 2HVMA 4TTUA 4P8UA 1SR0A 2VZOA 4ACZB 1GONA 4AD0A 1BF2A 8A3HA 4EANA 4W5ZA 1V3HA 3TA9A 1KQZA 3PZQA 4HA4A 1HXJA 4XZWA 3RJYA 4AEEA 3CHCA 1GUVA 1B2YA 3AHXA 2PWGA 2XVKA 4V2XA 1B9ZA 2OWWA 4AZIA 5AC5A 1PJ9A 3WIJA 2WMIA 4PN2A 2Y5EA 5AC4A 1BYCA 1W9VA 3SCOA 1TFVA 3OG2A 4PMVA 3MU7A 2FH6A 3T2PA 1W9DM 3K8LA 3WD2A 3ZMRA 1CXKA 3WNNA 4PTXA 5IXEA 1WAWA 3WD1A 1V6VA 2E8YA 1GQLA 1E15A 2WC4A 2WMHA 5JBFA 1I75A 1JF6A 2D3NA 4J3VA 4UR9A 2V3EA 4B9ZA 2YA0A 1SMAA 2VVNA 3CH9A 5DF0A 2YDRA 4CD6A 2XFYA 2A3EA 1V0KA 4L4PA 4MB5A 5D9OA 1CXFA 7A3HA 1UWUA 3U57A 1WDPA 1E0XA 2XYLA 3W0KA 3LPPA 2WWDA 1CNVA 1QNSA 4TUFA 4CN4A 1E55A 3TOPA 1G0CA 4J3SA 1VBRA 3PTKA 3GBDA 5IFTA 3GDBA 1JFHA 2DT1A 5M5DA 3CLWA 3KL3A 3LMYA 3L2LA 4W5UA 4E8CA 1UD2A 2AAAA 1KB3A 4YHGA 3WQ4A 3SCTA 4HA1A 3U5UA 1JZ7A 1KXHA 1MW3A 3BLPX 3A4XA 1VFMA 3AMGA 1EIBA 2D2OA 4AXNA 9CGTA 2BHUA 1HVQA 1EA9C 4AEFA 1PIGA 3PN8A 1AVAA 4P7NA 3PZMA 1EDGA 5FOOA 1Q4NX 3BLKA 1XD0A 2DSKA 1CGVA 3K46A 1FHDA 3IJ7A 4RE4A 1NP0A 4MNMA 3AJ7A 4FF5A 1GJWA 4HTYA 3AZSA 1H0IA 5GQBA 4HOZA 4AW7A 2HISA 3ARTA 2DH2A 3AHYA 4RE2A 2BS9A 3VU2A 3K8MA 2E0PA 1OT2A 3GM8A 2YJQA 5CGMA 2J8GA 3SUVA 1H09A 4CKQA 1V6UA 1JG9A 2W92A 3L2MA 1R85A 3THCA 1HJVA 1K9DA 1PX8A 3I3DA 1H41A 2BV9A 2WLZA 4RL3A 1UD8A 4E4PA 5BXTA 2WNWA 3FY1A 2JEPA 2PWHA 4UCFA 3BAWA 1OIFA 1UQZA 1V02A 1A3HA 2W66A 2WC7A 5E6ZA 5IDIA 2XM2A 5CZKA 3IJ9A 2GDVA 4AZCA 2QHAA 4GQQA 1UKOA 4OUEA 5FCZA 4WKHA 2BVDA 3VGHA 3BXWA 4W89A 3N13A 1XHGA 3IAPA 1X1NA 4QLKA 1JZ2A 3F5KA 2CHOA 1CXEA 2VQTA 2D1ZA 4F9DA 3W26A 1UKQA 1BG4A 2ZUWA 2DSVA 5DFAA 4OJYA 1TE1A 1K9FA 4Z2LA 3DECA 3F5LA 4PMNA 4BA0A 1M01A 2JALA 3BH4A 2VNCA 5A95A 1JYWA 3PBGA 1HKKA 4UQDA 1OD8A 1UA3A 3SCUA 2X8RA 2OSYA 1XYFA 3VMOA 1HVXA 1DWIM 3VD5A 2V3DA 3WEOA 3DYPA 1VENA 1H11A 3MUIA 3RMEA 2Z1KA 1CYGA 4TVUA 3T0AA 4Q7NA 4LYPA 1HIZA 2PBGA 3B9EA 1OBAA 2WZIA 1RD6A 1XH0A 3NSNA 2F8QA 2JE8A 4GXPA 3W6LA 1OB0A 3FN9A 4CN6A 1H5VA 2D0FA 1US3A 2O9TA 3QHOA 4JFSA 3F5JA 3D5HA 4UQAA 4RE3A 4CU8A 3GXIA 4W8LA 3VUPA 3K4AA 3RILA 4LYQA 2WWCA 1XV8A 4KWUA 3CUJA 2NT1A 5A2AA 2J7DA 3AFBA 2YBTA 3SUWA 2YA2A 3MMUA 3AHZA 2XVNA 1KBBA 4AIEA 1UD6A 2YLLA 3SCVA 2GDUA 3WH9A 1BPLB 1CBGA 1J11A 1HJUA 5CPQA 2WXDM 2CESA 4JL2A 3WN6A 2QV4A 4JZ5A 5EB8A 1C3FA 4C7GA 4P8WA 1JXJA 1OSEA 2CBVA 4W7VA 3WFLA 5IFPA 1W9BM 3MANA 1FA2A 5KEZA 2VTFA 4B15A 3KWXA 3AMCA 1JYVA 2OSXA 4HOXA 2GJXB 1J0ZA 2G3NA 2CNCA 6A3HA 2CERA 3PZUA 1HX0A 2W5FA 2XVGA 2NW0A 1ITCA 1L0PA 1QI5A 2QPSA 3ZR5A 4LQ1A 2QLYA 5A8QA 3S2CA 3J7HA 1E6PA 1NP2A 1W3LA 3POHA 5LA1A 1B3WA 2WHKA 4WKAA 3WH6A 2NT0A 2XUCA
chains in the Genus database with same CATH superfamily
1FWWA 4O8RA 3SFWA 3QOKA 1SFJA 3ARPA 4FO4A 2GDQA 3MP3A 1TMHA 2PC8A 2DGAA 1H4PA 3TU9A 3ARRA 4M6VA 1TIMA 4ZQRA 1QATA 3BZGA 3UPMA 2XHYA 4JFWA 2CXGA 3SR7A 2WSYA 1NVMA 3HGSA 4RNHA 5AHFA 3RIKA 1SW3A 2QCHA 1WAUA 2ZX5A 3K30A 4LEQA 3P3BA 5H1WA 1K4HA 4JYEA 4WDTA 4C6MA 2PGWA 1D9EA 4RCXA 1O66A 3W87A 4UCGA 5BROA 1F2JA 1MI3A 1RHCA 2O7QA 1E3ZA 2E7FA 2F9RA 1RK5A 4QG8A 1QOXA 2ZUUA 5LHEA 3B4YA 4E2VA 2BVYA 4IPIA 3OLEA 5HINA 1Q45A 1OC7A 5LA0A 3OVPA 4HMEA 4K36A 1EGMA 2RDUA 3U2OA 3ENLA 2QCDB 1B5TA 2BXYA 3DBNA 4HNNA 3V18A 1UP0A 3WBXA 2GGEA 4JD4A 2ZX6A 1GOMA 3EA3A 3KBWA 4MPKA 2XSXA 3UR8A 4PC8A 2BMBA 4NZ3A 3EA1A 4K1GA 4QBXA 1DVJA 1Q6QA 2X0YA 5DMMA 5BZAA 2Y4SA 4OGZA 3NGJA 4A3UA 1TPWA 1H62A 3KW3A 1YBQB 2WZMA 1UQYA 3CV6A 4HN8A 3APTA 1TVNA 3GHSA 4LPCA 1AUSL 1Y5WA 2XJ7A 2RGLA 3R11A 1Z7AA 4A3RA 1PKMA 2WBGA 1CGXA 4C6KA 1OINA 2A0NA 2C15A 3VC6A 2DP3A 2PS2A 2J7BA 4ZENA 4KFPA 1B3XA 2CZDA 3AJXA 4M1RA 2GQ3A 4TU1A 3NPWA 1XIBA 3ATZA 4LCQA 1W1YA 1EJUC 1OZQA 3S1XA 1EYEA 3GR7A 1R3WA 2V5BA 4H04A 4GYPC 4WGXA 3WBAA 1I60A 3LB0A 3NG3A 1ITXA 3MSDA 3AXMA 3PHAA 4H2HA 3XINA 2ZXDA 2E6DA 1ZLPA 1A0CA 2D0HA 4DZHA 1SO4A 3OP2A 3QQ1A 2WHLA 3HG3A 4AQLA 5HOSA 4HA0A 1A80A 4WJEA 4GI8A 3GSMA 1KCKA 3TYAA 4JHMA 1ISXA 3LCLA 5LNUA 2H6RA 3W2LA 1FDZA 3LXBA 5CGTA 2CLFA 2Y7GA 1BVWA 3SJ3A 4AZBA 2O55A 4EE9A 1KRBC 2NSOA 2WHMA 4DYKA 1GW9A 2ZZ4A 5A6LA 1WDQA 3E96A 3TEVA 3UYIA 3SCWA 3AMDA 3BURA 4FLQA 2F61A 5FSEC 4M5PA 3TQKA 2XDFA 1R3SA 1PZ3A 4PCFA 2WOQA 4UQ9A 3E74A 4Q8WA 1W3TA 4C6CA 4C5YA 4DNHA 1VD6A 3NWRA 3NQCA 4S38A 1I1WA 1RK6A 3IACA 3UWWA 1C7SA 4DF0A 1UWIA 2QPXA 1XIHA 1W2PA 1W2VA 2CWXA 1MMFA 3I3BA 2E9MA 7REQB 5EBUA 3W81A 3WF2A 5DBTA 4HYVA 3GYCA 4US5D 3KDOA 1R9XA 1YYAA 5M03A 3I4EA 1D3CA 3NO1A 1LORA 3KOFA 3VCRA 3AXIA 1KGWA 4F0HA 4BF7A 3N25A 4PB4A 4N0RA 1M68A 1EIXA 4EWJA 4JR5A 4CQ9A 2ZKMX 1O1HA 4P5UA 1SZNA 2PLJA 3WK3A 2FHBA 4H2CA 3VDBA 3H8AA 3EWYA 2ZX7A 4IJRA 5IHSA 4J7RA 1LRNA 2PDNA 4XVDA 1POKA 5RUBA 3NZRA 3STGA 3LV6A 3S2MA 3S1GA 1SFLA 3WLNA 1FWRA 2R1NA 2V2DA 4WR3A 1X6LA 5AHNA 1XSJA 1EGVA 4AYSA 3EWUA 1TZ7A 4UNIA 4DN1A 1IR1A 2OODA 3VZXA 5T91A 1ZSXA 5LIWX 2ZA2A 3N18A 3RJXA 3GKAA 1I4NA 3LCIA 2W91A 5JVLA 3DGRA 3CTTA 4EKJA 4N9DA 2X05A 2PTYA 2DY3A 4NZJA 2VR4A 1QW9A 2HSAA 4GLEA 5G4HC 5D32A 3ZIZA 4GXWA 2TYSA 5AVNA 4JICA 2YCKX 3WH8A 3UNDA 1SJCA 2B7PA 4GFIA 3VIMA 1N8FA 1XF0A 1OFPA 2J75A 1WZKA 1E1CA 3NQBA 3TC3A 1O6IA 4RK8A 1PCKA 4JBRA 4AZCB 1EXBA 3IS4A 2W4XA 2VCCA 3BC9A 5LNVA 1ZAIA 4GISA 1XUUA 1XUZA 5CPTA 2VGIA 3DC0A 1OFDA 2YX0A 4TTGA 2PWEA 4S2CA 1YHTA 1LDCA 3VNJA 3VUSA 3R1ZA 3RDKA 4QCEA 2VFGA 3BL3A 5G1YA 3VKCA 5D04C 2YYUA 1D2KA 3RCNA 5FF7A 3WO8A 2G97A 1VFOA 3E6EA 3I65A 3NO3A 4FMVA 2ON3A 3SQSA 2ISDA 3T9PA 3LGEA 3NVTA 2ZZ6A 5FAGA 3DZ1A 3UA3A 3CK5A 3B8WA 4XZBA 3QGVA 5FIPA 2YCEA 5FL1A 3LV5A 1C90A 4F4RA 3B03A 4XAYA 1VFLA 1LTDA 2ZXBA 3O0FA 6XIAA 4Z0JA 4DPPA 3MMWA 1HNYA 4HOWA 4TOQA 4GD0A 2X1SA 1NARA 2CBUA 2YFNA 3RX3A 1KXTA 1ZP4A 2J66A 5I3IA 2FYMA 3VMNA 2WSKA 5F7UA 3LM3A 1SW7A 1XIEA 1MW0A 3MDUA 2OX1A 2X1RA 1D8WA 4HPHA 5FAJA 1UD5A 2ZUSA 5MKGA 2YYTA 5LIXX 1PDYA 4CD4A 4PUEA 2OEJA 2F6UA 4NX0A 3LD5A 4NYUA 1BWLA 3NL3A 5BU6A 5AYBA 1AFSA 1SFSA 1ECEA 5D4YA 2GJXA 3HPSA 2XIOA 2O56A 3PULA 1JJKA 4GBUA 4L4LA 1TWWA 3S2LA 3V35A 3AIEA 1LBLA 4QR6A 2VEPA 4XZ9A 3QMTA 1O12A 2YW3A 3UGRA 2V5JA 2XU2A 3OBEA 2YDAA 3PR2A 4I7WA 2V82A 5E9XA 5C9ZA 4XAPA 3WD0A 1ENUA 2JIWA 4YJ5A 1QI2A 1JZ8A 3SO7A 3EX4A 4KMQA 1SM9A 1YTEA 4IQEA 3VE9A 1JDCA 3SUSA 1TRDA 4XB3A 3D3FA 3GIQA 2WPGA 3ICJA 3V75A 4NY2A 3VMPA 4L65A 1NFGA 1CTNA 1VH7A 1GOXA 3FA3A 4HYWA 4NF7A 3W25A 2V68A 3KS5A 4U3AA 4DZIA 1MFVA 4RX0A 3GDRA 2C14A 4GUHA 5T8GA 1VEMA 4MPQA 1DL3A 5L6UA 1U5VA 1JCNA 3BCDA 2QYGA 3A3HA 1DQXA 3UXKA 3GRIA 3W02A 3CYVA 4O4VA 3BWWA 4RW5A 3MUY1 2ZIDA 5LA2A 1FUYA 2W79A 1ITUA 1B54A 3TR9A 5LGXA 1Z32X 1UPPA 2REQB 1A5KC 4Y8EA 2XPKA 4U2YA 3G1VA 4KCVA 2GVEA 4JTUA 1RALA 2VO5A 4BI7A 1BVNP 3R58A 1XLIA 3NSMA 2EQDA 4OZOA 1TIWA 4H01A 1TMLA 2DJLA 3HG5A 3OHMB 3Q94A 4XIAA 1GPFA 3QY6A 1XLHA 1PWLA 1UKSA 4AD3A 2IS7A 2OGJA 2DVXA 4BEUA 1EJSC 3SIZA 3HV9A 1JUKA 1V02E 3H2OA 4DHGA 3H2NA 4UTHA 4ZCWA 4DO6A 2YA1A 3GTNA 1QNOA 3BVJA 1RSCA 3G18A 1RA0A 3KOYA 3L68A 4FB7A 1O1ZA 1OD0A 4IIDA 4C7FA 3I7RA 3ARZA 4X0NA 3ZR6A 3OIHA 2EKCA 3CAQA 3CV2A 3RFAA 4GZEA 2FJUB 3DFPA 5L9FA 4NI3A 4KEMA 3UG8A 3P8JA 3UWQA 3U7BA 1EDQA 3VNMA 1IEQA 4H6EA 5HNUA 3GXPA 2BODX 1BWKA 4GACA 1O5RA 2HNEA 1KNWA 3NTYA 2CPUA 1E73M 4L61A 3N2OA 3SCQA 1BAGA 2OG9A 3SCPA 3O07A 1IGSA 2Y6ZA 1RPKA 2ZICA 1UH4A 1DKWA 2MUCA 3GX9A 3R79A 3WDJA 1HKMA 3QC3A 2ZA3A 2WVVB 3T8LA 3KOZA 4C1KA 3MDWA 4DBEA 3VOFA 1V5XA 1W3IA 2QCFA 4LNCA 5GJNA 2VOTA 4A22A 4D8LA 3VE7A 3VNDA 1B31A 3VIHA 3CUGA 2Z1SA 4XSMA 1XGZA 3TW6A 3H12A 2W9MA 1XDMA 5KSWA 1DJHA 4MDPA 4EXQA 5JIWA 4KW2A 4AIOA 2G8ZA 4NAFB 2OZTA 4UTWA 3L5LA 2QCMA 1LL6A 3LUTA 3W70A 5KZMA 3UJRA 4IQJA 1Z3NA 4C5ZA 3O6AA 4OOZA 2VWTA 2FFIA 4JQ4A 4UFIA 2BTMA 3P60A 3FSUA 3DG3A 3HPAA 1J2BA 2OR2A 2PP3A 1HL2A 3OVGA 3RG6A 1LF1A 1ZRQA 3CMGA 1TV4A 4Q8QA 1YW1A 5GJMA 1QNRA 4GABA 5HUOA 3WLJA 4NJKA 1SJAA 3SN4A 1Z42A 3K4WA 2ZXQA 2QW5A 1J2WA 3QHMA 4ZE5A 3ALGA 3T0CA 5CC5A 1VCVA 1BXNA 5I78A 1S2TA 4L6DA 4U3CA 2X1TA 2EF9A 3CHDA 3BLDA 2GQ9A 4HU3A 4ZA0A 4KWVA 1X6NA 2FHCA 5CZSA 2E8ZA 2Z25A 3M6YA 1NWSA 4PTWA 1G9HA 3AC0A 3UZYA 1ADSA 1KKRA 1VCGA 1KKOA 5BXRA 5A6BD 1QBAA 2C71A 2ONEA 4GY1A 4XD5A 3QZEA 1YXYA 4CUCA 1H1YA 5CZJA 3SRFA 4GOAA 1QPQA 4F79A 4KQNA 4AEOA 4GX8A 4DF2A 3SRHA 2J7GA 1ZHAA 2DUXA 4AY8A 1EF2A 3R2GA 1H2JA 3SW6A 3BARA 4LBRA 1O5XA 4S3JA 1PUDA 4M82A 5HR7A 4HU4A 2WCAA 3N14A 2DH3A 1D7KA 1BD0A 2XIBA 3CHFA 3M47A 4K3ZA 5BXPA 4CNPA 3URQA 4EX4A 1VLIA 3CZEA 1NF0A 3NEHA 1SVDA 2G4FA 2P0OA 2EBNA 3RM9A 4FNSA 2LLEA 1YDNA 3OQEA 3EYPA 1OGBA 2DV0A 4H6KA 1NWUA 2DZSA 1QWKA 4WJXA 4ERGA 5CQ1A 1YX1A 1E4LA 3S9ZA 3R0UA 1GOIA 3KL0A 3LLFA 3ABOA 3EWWA 2Y63A 3C2OA 1GZJA 1A5MC 1UP2A 1OGGA 1PTDA 4L56A 4FLSA 2O4QA 1OZMA 1TQJA 2FGLA 3IIOA 4UTJA 1JEZA 3N29A 3S6TA 1JCXA 4H83A 4CQDA 2OWXA 1NH6A 3EZ4A 1TO3A 3QYSA 1QPNA 2DORA 1BYAA 3RXZA 3RPTA 2E9LA 4P7RA 4S3DA 4IMFA 1L6SA 4OECA 1DEDA 3MCMA 4HCDA 1B90A 3FEQA 1DWFM 1AW2A 2GPTA 5A8MA 4Q22A 4W84A 3WL0A 4LH8A 5A3HA 1NQ6A 4X0VA 3W1QA 2ZZ1A 2VC6A 3SZ8A 1KRMA 5CGQA 3N6QA 3TUUA 3ANVA 3PJUA 3XIMA 3NXLA 3VD4A 3RPMA 2J62A 3VKJA 5HUPA 1TTPA 3CZ8A 3NQFA 1VJSA 1UWTA 1UMYA 3WK2A 4HHLA 3NQDA 4MUZA 3GBEA 1J5TA 4AX7A 4CCEA 5ABGA 2PAJA 4ACZA 3G8EA 2GJLA 1FP9A 2OFJA 4ZB5A 1VBUA 1DJYA 1XCWA 1K4GA 1F76A 2WC3A 3IIZA 3ZT7A 4IJBA 1W5PA 1WKYA 3VNIA 3WQVA 2AKMA 3WNMA 3I7QA 2PZ0A 3K5XA 4IFRA 4W8BA 4O1AA 2JKEA 3ARQA 3K8KA 4ZO8A 4UOJA 1XYMA 2VGBA 3QBUA 4H6QA 5LXEA 1VRXA 2OELA 2J7FA 4I9MA 2V0TA 2WKGA 4D6FA 5D03A 1R38A 4DPQA 4O19A 2Y0FA 5FJUA 2PRMA 5ECUA 4AZ5A 3TYBA 1NDZA 3GDKA 7PTDA 2FJKA 4FXSA 3OVQA 4HPXA 1LJYA 1QI4A 4RNIA 2ZE0A 2ESCA 2J7EA 3DDMA 3ZJ8A 1QVBA 4X2PA 3F1QA 3LPGA 1GZ1A 2CFFA 4D8ZA 3PNZA 3S5SA 3WDPP 2WB5A 1UR8A 4WIWA 2G3MA 5B80A 2PI6A 3GXFA 4MY9A 1CDGA 3M6DA 1UR2A 3ZLFA 4AWSA 4RPPA 5AY7A 1Y0EA 2ZC1A 1PKYA 4CN1A 4QE1A 1BFNA 1Q2RA 2A3LA 3WY1A 2Z2BA 3NZGA 2Y62A 5A8NA 1OFBA 7TAAA 3R4IA 3NDZA 1DBTA 3TJIA 1AH0A 4UWMA 1F05A 1KCZA 2PDQA 1PDZA 3P8IA 4Y2WA 2A1YA 4XAGA 4DXXA 5ABEA 3FEMA 1A47A 3GG7A 3W76A 2VOMA 5TD4A 4Y96A 2A21A 1WZMA 4JHOA 1KXQA 3SY5A 4BQ4A 2OT0A 4U28A 3FGCA 3G0SA 5BOEA 3BOXA 4D6IA 4HNUA 1ML1A 1TREA 2GZXA 4KETA 3EDEA 3HQOA 1TR9A 4JY9A 4R9OA 1M03A 5I24A 1VF8A 4POCA 3QVQA 3T08A 1M7JA 3MI3A 1S1PA 2XH7A 3C86A 3IJLA 4UFKA 1LM1A 2AKZA 3OLDA 3R5EA 1J93A 1ECQA 3T8QA 2WVUA 1OYBA 1H7WA 3IV8A 3GNOA 4RNJA 1D3HA 4QDMA 4H9MA 3DKLA 3IIXA 4B3LA 1QPKA 2R24A 1TMQA 2BY0A 4D9PA 3FYPA 3CWHA 1ZBWA 3MMTA 1E9ZB 3AO0A 1RY8A 3PZVA 3ITYA 1SPQA 1XRFA 2YB1A 5I3GA 2ZUMA 2I5GA 3QF0A 4C90A 2Y5SA 1X8FA 5U7SA 3NURA 2W63A 3ZT6A 3IVTA 4AMCA 1NOFA 4JXCA 5FF2A 1FWAC 3AI0A 4DM2A 2JGQA 3SFKA 3U9IA 5FJIA 4HBKA 4XBKA 3EDFA 1JYNA 3E1F1 3TSDA 2JKPA 5I3FA 2QDEA 3GZ3A 2CCRA 1DTNA 3M0IA 1YE4A 4C6JA 1XXXA 2IMRA 1MEIA 1JNDA 4O8AA 2W67A 4LUTB 3C2FA 1JF5A 3G24A 1KFBA 3PC0A 4B2DA 4YVXA 4NAEB 5JBEA 3SEPA 4ZO9A 3AYVA 4X60A 1Q66A 4AZGA 4ONVA 1DV7A 1QOPA 4AWUA 4Y8FA 2VZSA 3CWOX 2PSNA 3WD4A 3M5ZA 1GG0A 1ZS2A 2B4GA 3AHVA 4G6CA 2P53A 3W1PA 4LGXA 3PAJA 3UNTA 4JTFA 4Y9MA 3W27A 1E9YB 3AS0A 2NUWA 1H50A 4QX4A 1EZWA 4MTVA 4JQAA 2Z27A 3A6OA 2AOSA 3P62A 3LA4A 3W7LA 3HJEA 2PGRA 7XIMA 2BOFX 1FWBC 4HIBA 1VJIA 4XKYB 1SMDA 3LRLA 2VT0A 1XLJA 3LCXA 3MVTA 2DT3A 1RAKA 1US2A 3QRHA 1RJRA 1B30A 2WNNA 4GQGA 4CU7A 1XLDA 2W3ZA 4JX4A 4S3BA 4TTUA 1SR0A 3ITXA 1IWPA 1BF2A 1DJZA 4I5XA 4W5ZA 1V3HA 3TA9A 4C60A 1KQZA 4HA4A 1Z44A 3TA6A 4XZWA 4AEEA 1B2YA 2AGTA 4IP7A 2XVKA 4CCZA 3R89A 4J40A 2QCNA 7ODCA 1BYCA 4EF8A 3LZ5A 3HF3A 4HTBA 4PMVA 2OPJA 3MU7A 2FH6A 4BFAA 2GVGA 3GIYA 1W9DM 1IEWA 1UIPA 3WD2A 5CPNA 1CXKA 9RUBA 4PTXA 4L5ZA 1WAWA 4DO7A 1M5WA 1V6VA 4KEUA 2QJJA 4Q4QA 1Q8JA 2R82A 4J3VA 4UR9A 5CG7A 3AUOA 1OC5A 2VVNA 3FFSA 2FTYA 2R1MA 2YDRA 1EBHA 3QLLA 1RJQA 3QJAA 3C8FA 1F7BA 3U57A 5AOUA 1TX2A 3GVRA 3ZVHA 2CW6A 2WWDA 1CNVA 1QNSA 4TUFA 4RW3A 5IFTA 5AN7A 3IJIA 3WG6A 4C1NB 3UFYA 4C6NA 3PVFA 4E8CA 2AAAA 3WQ4A 3EPOA 2E5DA 4ZTYA 4HA1A 1VFMA 3TLQA 3AMGA 9CGTA 4GXMA 3G2GA 1H51A 2J13A 4TMBA 3GY1A 4FXFA 5MKGB 1EDGA 4JYDA 4Z1CA 4KPLA 4AVOA 4ALDA 5SWUA 1CGVA 3QTPA 2C1GA 3BW3A 1FHDA 5D05A 3ES7A 3TNOA 3AJ7A 3NFUA 3L65A 1XW8A 4HTYA 3E0LA 1H0IA 5JMUA 4NL1A 3VU2A 4V15A 3NQ6A 1A5NC 2IPGA 3N3MA 4BI5A 3BLIA 3CASA 1PTAA 6REQB 1KA9F 1K9DA 1Y5VA 4H1ZA 2ZRXA 4ZO7A 4RDYA 3I3DA 2C1IA 2WJZA 2BV9A 2WLZA 5I3HA 1XP3A 3OVRA 3ORWA 1WYIA 4RL3A 3PFRA 3LDVA 2WNWA 3E12A 2BB0A 2VEMA 3F2DA 4ICMA 2XGZA 4DVOA 1A3HA 3KUMA 1SSDA 3LZ3A 3VNKA 4MKSA 2RJGA 3IJ9A 2GL5A 4C6FA 3W2MA 3G1HA 5FEZA 2HE5A 4V1XA 4LUYA 4XKMA 4RUBA 3DN5A 1G4PA 1TVLA 3MBFA 3VGHA 1OFRA 3BXWA 5C5YA 4S1FA 2F84A 4UTKA 3LBCA 2IKIA 2CHOA 4QNEA 3TCEA 4Y9AA 4MJMA 1CLKA 1QXLA 2B7NA 3DECA 4PMNA 4BA0A 1M01A 3HB9A 1HKKA 2PDKA 3SCUA 1UA3A 3S5ZA 2OSYA 2YZRA 3VMOA 3DYPA 4ZQCA 1H11A 3MUIA 3VKDA 4QISA 3T0AA 3B9EA 2XZ9A 4JTIA 2OXNA 1Q3NA 4AH7A 4MZYA 1K7FA 1M9HA 2FVLA 3W6LA 2ODOA 5ENLA 4M7SA 1L2UA 2F2KA 3O6CA 4CN6A 1ONWA 3UT0A 2D0FA 4MF4A 3QHOA 4JFSA 4UQAA 4LVFA 4W8LA 1OX4B 3VUPA 4E3TA 1WBJA 2QJNA 6ALDA 1KBBA 3TXVA 2YLLA 4Q6XA 3SCVA 1V8EA 4AVNA 1CBGA 1PKLA 1HJUA 1HZYA 2DZWA 5CC6A 2J88A 3KCLA 1A50A 1W8GA 3HOJA 1FX6A 1C3FA 2Y70A 1AJ2A 4C7GA 3L12A 1POJA 4W7VA 3WFLA 5AB3A 1FA2A 5KEZA 3B97A 3FYYA 1Z9AA 2DZUA 4FNQA 1RXOB 3PZUA 2W5FA 5HR6A 2NW0A 4AB4A 1ITCA 1QI5A 3DG6A 4K37A 3RHGA 1E6PA 1W3LA 3POHA 3V1PA 1XBXA 2QR6A 1D8CA 1X98A 3IRDA 1LCOA 3WMLA 5J8LA 3S1UA 3SGGA 3K1DA 1AZ1A 1GOWA 2PDGA 1W1VA 3WMBA 4YLWA 2J9ZA 4E3VA 2DSZA 3W82A 5F2IA 3O6DA 2NV2A 3H21A 6TAAA 3N04A 2WCGA 3T81A 2Q8LA 2V2HA 4O18A 2INFA 1OYCA 4GJJA 4XVEA 4MHBA 1TWSA 5HXMA 4IQDA 3C56A 4LUSA 4PCPA 5BRQA 1K02A 5AECA 5D09A 3A64A 4MADA 4XIMA 1M6JA 1JXKA 2A7PA 3T44A 4JIRA 4ERIA 5GVJA 1JULA 2E6YA 4MUPA 1CEOA 5IRPA 4UQCA 3PG8A 4WXYA 1KFKA 3LM7A 4IP5A 3GS6A 4RDVA 4O0KA 5G2IA 1GG1A 1MVYA 4H19A 4L1XA 4DYEA 4KIRA 5KETA 1VP5A 3UU0A 4HZ6A 1QBBA 2GVYA 3R25A 3WLPA 3WF0A 3NQMA 3CZJA 2QS8A 4B5UA 3BW2A 2NXHA 3TC6A 1GGOA 4OKDA 3P0XA 4MMWA 1RD5A 3OA3A 5DELA 1E51A 1V03A 4IISA 2GSEA 3MO7A 4IL0A 4LYKA 1A3WA 1ME9A 4C1LA 3WUGA 4JIQA 1AODA 1EH9A 2PTXA 3LCGA 1BRLA 1WE5A 2VRQA 1QNPA 4DUVA 3CQIA 1Z89A 3IIPA 2D0GA 1ZGDA 2X16A 2ZTKA 4U31A 4IGSA 1WDWA 1SJBA 3A5VA 1E3XA 1P5BA 2Z1BA 1Q7QA 1W1TA 4QTGA 1ZBCA 1W1A1 1YQ2A 3VD9A 3C3UA 4QCFA 5EPDA 4QLJA 4IQLA 1A49A 2NX3A 1C7TA 4LYRA 3SIMA 1XH1A 1XCXA 3QY8A 3H22A 2VRKA 5A6JA 1J0HA 3H4WA 1XM3A 4XKYA 3L5MA 4HKPA 4ZB0A 2BGNE 1EGZA 1PBGA 4FF7A 1J18A 3VIIA 3N12A 3NDOA 4MLRA 3IVUA 5FJTA 1GNXA 4WDXA 1VKFA 4HU0A 1VBGA 1GVIA 1H7NA 4DWSA 1VYRA 3NZQA 1UKTA 3UWUA 3AIUA 2VR5A 3L4ZA 4GYJA 1HKVA 4JIIX 4HU8A 2VCAA 1B9BA 5LNSA 1MXSA 3P82A 6REQA 4H7VA 1U30A 3JRKA 2ZBTA 4PBFA 5C7VA 1PZ2A 1P7TA 5AHMA 3RNDA 2C1HA 4NJJA 1W9UA 4LAZA 1CWYA 4R33A 3TTOA 1E4NA 2G3IA 3A4WA 3W4RA 5CLTA 3EEZA 4UNKA 1PX4A 1EKOA 2Z4GA 2BOEX 2IPFA 3P74A 1YXCA 2NQLA 3QR3A 1E5JA 1C8QA 3D46A 2HXTA 1K8XA 4JY8A 5C2GA 3VKAA 1C29A 2FKPA 3DHUA 4NJIA 3LI1A 5I79A 5AZ1A 2QNEA 2CBIA 4AWEA 5C2CA 2EPLX 1W3JA 4DB7A 2OMAA 2R14A 3U3HA 1E0TA 1TE6A 2RDWA 1QRQA 4BQ3A 3BGGA 3PBUA 5IM51 3GQYA 4QS6A 1E6XM 5D30A 4Q8TA 3TAOA 1H49A 3BG5A 2YXOA 3TSBA 5AC7A 4AFYA 3E0FA 3AHTA 1HJQA 1TTJA 2EPOA 3PTQA 3UGVA 3V0TA 1G7VA 3BDKA 3WNOA 3QHNA 4E0CA 4AG0A 2B0MA 4AD2A 2GGJA 2NX1A 4M1BA 4DBSA 3NVDA 4ZOEA 4W87A 2UBPC 4H7CA 1PVNA 1R5YA 3L9CA 3VKKA 2ACUA 1XG4A 3E02A 1DYSA 1UWRA 3BLOA 4RPQA 3TAKA 1GKPA 4UOZA 5I6SA 3BUVA 5ABTA 3CWNA 1IEVA 2C7FA 1NIUA 3IRSA 1E6SM 1P6BA 1T40A 3A22A 5I07A 1GKQA 2XIIA 4GGHA 5EL1A 4MZ8A 4HNTA 1J0IA 1E9LA 3F7JA 4GVIA 1YDOA 4LAKA 1JIBA 3U4FA 3L0KA 5I3DA 3EA2A 2XIQA 3TTQA 3BV7A 3PY2A 4HP5A 3NPVA 1M7PA 3HQNA 3RRAA 3AS3A 5C6MA 3V3WA 3FDKA 3WENA 3E38A 1C92A 1L9WA 3F2CA 4G5DA 1ZU8A 1TELA 4AZ6A 2HQAA 3P0WA 2OU4A 2WCSA 3PPHA 4ADTA 1VIZA 1HP5A 3HU7A 4IHCA 1RQBA 3MV01 3KBMA 3KEHA 3MKKA 3U7VA 5D38A 4KEVA 4L7ZA 2I1OA 5GNYA 3CV1A 5HDRA 2QGHA 1RBLA 3EGJA 1MUMA 1IWBA 3QW3A 1A0EA 1W9PA 1E6RA 1EPVA 3F4VA 4ADSA 3AXKA 1KGUA 1N2VA 3S2NA 4QAIA 2C0AA 4AC1X 4JKKA 1S2WA 2JIEA 2OB3A 1GJPA 1YNYA 2BHYA 2IPJA 3WBYA 3BAIA 2DPEA 2P50A 3FKKA 3WQWA 1AMYA 1JCYA 2V8ZA 3WMCA 4GZJA 3T4WA 2ZVIA 4IFOA 4M81A 5HJYA 1W5OA 5MHBA 2BZNA 3BAXA 1PHQA 3GVVA 2QGYA 4I5RA 4A8LA 5A2CA 3AZRA 5HQEA 4JS3A 4ENLA 1ZBVA 4JTDA 4DZAA 3VIPA 3PZTA 3UXIA 3M07A 2D2JA 2ZVRA 3Q37A 4IIHA 4JHZA 2F2HA 1IEXA 4GKTA 4ASTA 3KM8A 2JBMA 4OTKA 1HL8A 1TPH1 4UZSA 4JTEA 3W7CA 5T9BG 3WKZA 3C8NA 5CSRA 4GA8A 4YU1A 1FVPA 3W7HA 5C9RA 2OQHA 1T0OA 2HPMA 1JCMP 1BHGA 2BSLA 3E3HA 1SZRA 4BKNA 4F8XA 3W83A 1MNZA 1KFWA 3NO5A 1NY1A 2Z6JA 4MB1A 4NJHA 4W93A 3FJLA 1AA1B 3GG8A 2CETA 3L4YA 3P81A 3GVGA 1V0LA 4O0ZA 3N2BA 2EXOA 1CI1A 2QAFA 1CZ1A 3W85A 5C9XA 1FWDC 2Y7DA 1UH2A 3GZAA 1QI0A 4Q32A 3A24A 3DFSA 1EJWC 3MUAA 5G4EA 2O7SA 4KWWA 3ME3A 2CIPA 3PB2A 4KFOA 1RUSA 2I56A 1DE5A 1XPYA 3WDQA 4NHVA 5T9CE 1KBKA 2DZVA 3LHUA 1TA3A 3WLSA 2OCZA 1SW0A 3TN5A 2Q02A 3DI1A 3ZT5A 3NL2A 1IZCA 1BKSA 3CJPA 4IX2A 5EMUA 1UR1A 4R34A 4AF0A 3TTEA 4BCEA 3A21A 3L5AA 1RLCL 4X3ZA 4D6CA 2J77A 2DFAA 2BVTA 1A53A 1MNSA 1KFLA 1JFXA 1T99A 1A4MA 2ZRWA 1DJXA 5U4NA 3U4AA 1VC4A 3I6TA 4YS1A 2QT3A 4O57A 3WLQA 1VR6A 1XBZA 3FS2A 4ZXOA 1AK5A 1K6WA 1UOKA 5EMJA 2PTZA 2VFFA 5I00A 4XV0A 1DXIA 1DJWA 3GH4A 1ICQA 3NCOA 1AH4A 5I23A 1TPUA 1J6PA 2WAGA 1Q6GA 2Y2WA 5I09A 3NR0A 2E1WA 1DHKA 2CC0A 2REQA 4UFHA 4UIOA 5LHFA 1GZGA 1XYZA 3PJXA 4JQ1A 1ZENA 3URAA 4Z2KA 3N19B 3BOLA 2XG9A 2PWFA 2CEQA 2DT2A 4UC5A 1G94A 5AYXA 4UFJA 1KWGA 2EO7A 4ROPA 1XIDA 4XK2A 1TPEA 4QRNA 1UUQA 2ISVA 4LV9A 2Q8XA 4CD8A 3NPUA 3WDHA 2HEJA 1F4HA 5JBDA 5DT5A 3RR1A 4P61A 2FDSA 1HJWA 2WLYA 3ATYA 3EAUA 4WDUA 1R7OA 1XLAA 3BJFA 4PRWA 1Q6CA 1S5MA 3R0KA 3R8HA 4NG3A 1SUXA 1MQRA 3GTHA 2PD9A 5CSSA 1B3VA 1AH3A 1GOKA 4BK9A 3EDJA 3HO8A 1K9EA 5CJMA 3QQ0A 3WD3A 2BVWA 4LANA 4Q8MA 1Q7MA 4GJIA 1DWHM 4ORMA 1XIJA 3AYSA 3UJFA 4LCSA 3KTCA 2PDIA 3QW4B 1DXEA 4H9ZA 3VPLA 1E6QM 2PF0A 3PPGA 1EF3A 4PMXA 4ZFMA 1ISYA 3WJYA 3UR5A 2BY1A 1VGAA 2DZXA 4TMCA 1F74A 4QP0A 3TE9A 4A8NA 1QT1A 2Z00A 3FSTA 2YW4A 1S46A 4B4FA 1UC4A 4UUIA 4RR4A 5D2TA 6CGTA 2YZ5A 1XICA 4TIMA 1C8XA 2R9RA 4C1NA 1TWIA 1A4LA 3MCOA 5AHIA 3PWIA 3W7MA 3CUIA 4Y90A 1XBVA 3BSHA 2PRLA 4CVWA 4H8HA 4MJ4A 1V3LA 3DEQA 1OVDA 4B90A 4PMRA 1MRAA 4HNCA 4F9JA 3SUTA 1WCGA 3UWEA 4A21A 4XZLX 1JDDA 4PODA 3KFTA 3UG5A 3W00A 3UVIA 1AQFA 2WVSA 1MQPA 2FZ9A 4MOZA 5CKSA 1A5UA 1J96A 3PZGA 1I6NA 3GXDA 2CYGA 3M64A 3O05A 1XRTA 4OE7A 4XQ6A 4PMOA 4RZ5A 2WNQA 3A4AA 1AQ0A 1U33A 3R0DA 2ADAA 3BAYA 4MAZA 1FH8A 4XO6A 2VZVA 3OZOA 1BTCA 2E40A 3JU2A 1E71M 4DBWA 4ES4A 4UR8A 4US5A 1UHVA 4UQEA 4P7LA 4PMDA 1TPVA 4DBDA 3CAWA 4GUJA 3KBVA 4JDYA 2HVNA 3B04A 2PZNA 3M46A 3BO9A 3QMSA 3B0VC 4LB4A 4DUWA 4F2UA 1K77A 4I90A 1SGJA 3EDKA 3HMJG 3VDCA 5FI8A 1NTHA 4NU7A 3NIYA 1OY0A 3T09A 4MAVA 3TKFA 3PZNA 4FEZA 4QEEA 3CPUA 1SR9A 4QNWA 1EJTC 2JF6A 4HMDA 5GJPA 3AIRA 3CUFA 1E1CB 1TJ2A 1OABA 1KC7A 4WSKA 3M5VA 4PMJA 4IICA 2PLMA 2VDHA 3WLTA 1FRBA 3TWBA 2PTWA 1QNQA 3BG3A 3FHAA 4U10A 4D6GA 4QLLA 1E56A 2F6XA 1VBJA 2BG5A 5KMYA 2AAMA 1KQYA 3ARSA 3GR8A 2MANA 3G1AA 1A0DA 1I0BA 3PNUA 1GCYA 2QCDA 3CZLA 3HN3A 4JN7A 2XGIA 1W8SA 3Q58A 3B8TA 4H8VA 2O9OA 2RFGA 5A69A 5DT7A 2NVCA 2V63A 1Y65A 1GYLA 4H9YA 4NAEA 1N8IA 1ELSA 2BFGA 4WGHA 2VEGA 3AALA 1Q6LA 2ZX8A 1OX4A 4Q4KA 4B16A 1E4MM 2Q8ZA 2RGMA 4F2TA 2HXUA 1RCXB 1NWTA 4M6UA 3CC1A 4J3UA 2BBFA 1GVEA 4A3HA 1V93A 1JZ5A 2IXVA 3NQAA 3N73A 2NLIA 1MWOA 3DFQA 1RZMA 1TVPA 5HNRA 2FH8A 5CC7A 2X0SA 3B0PA 5K9CA 3BCFA 1XLLA 3TV8A 3A3WA 2NVAA 1GVOA 1TB3A 4FNUA 3AOFA 1FDYA 1DQUA 5DBUA 3V0SA 4QROA 1DTUA 4NJGA 1KM4A 3ABZA 1J0KA 3U48A 2QUVA 5HJXA 4LVAA 3ZWTA 4UTTA 3NQVA 4EVZA 4GZ7A 3G3MA 3VOHA 1P4CA 3ZLGA 3UR2A 4MFEA 2Z7GA 4HN4A 4REQB 5EMYA 3B0YA 5HPCA 2XN1A 1I2PA 3EPMA 5EMMA 4IXXA 3W7IA 3G8RA 4J28A 5C55A 5JIPA 3UG3A 4Z1AA 4WHBA 1P0BA 2ISWA 2VMFA 1I2OA 3ARXA 3PS7A 4J3TA 1VEPA 3LQGA 2WJDA 3CYJA 4DO4A 1A5BA 5A8GA 3TYDA 4DAFA 1PYFA 3IJDA 4HSOA 3IGHX 3G3DA 1E1FA 2OZ0A 3G1DA 3H54A 1IT0A 3SECA 3W2KA 1FQ0A 4KESA 3PUOA 4AAJA 4BF9A 4XTDA 5DCEA 4PCTA 1WKEA 3C61A 2XN0A 4ADUA 5REQB 4WDWA 1Q5MA 2VEIA 1GVSA 2Y85A 3CHVA 3KLLA 3VIKA 2FHFA 3BJSA 5KZEA 4PFHA 2IKGA 1GYMA 1UBPC 2WKJA 5E5CA 5FACA 1W1PA 2VX6A 2HPIA 1NWRA 5K9DA 1Q6RA 2XVPA 4M3PA 3ES8A 2CHRA 2NLYA 3MTWA 2WM0A 3LPOA 5K2ZA 1UBSA 4V27A 2CHNA 3CLMA 3HTWA 2GFTA 4MNJA 1LQ2A 1US0A 1EA0A 4S23A 1I8JA 3PG9A 1BQCA 1HW6A 3THAA 3TYCA 2TODA 4FX6M 1G1YA 2ZZ7A 5C2XA 5F1VA 4ATDA 3CZGA 1RH9A 2VZTA 3TK7A 2B7OA 1JL8A 4M8UA 4GVGA 1YNQA 5EFDA 2WNZA 1RY0A 3OGSA 4JTAA 2C13A 1WB0A 1DJNA 3FJ4A 3EXRA 3ABRA 1J10A 3TIMA 4BHYA 2ACQA 4DI9A 1T5AA 3BK0A 4GG9A 1W1ZA 1J01A 5M17A 3W73A 1JPMA 1HKWA 3TOYA 2GWNA 2DUAA 4F2BA 4LS1A 3WF1A 4HSHA 3KTSA 3MUZ1 5K4ZA 4TX9A 4QHRA 2X41A 1KTNA 1P6WA 5AYZA 3L7RA 4JN6A 4O1FA 5E0KA 3R43A 3GC4A 5E93A 3CEPA 3MPGA 4DELA 3MI6A 3ITCA 3B4UA 1Q85A 3CZKA 3POCA 2VC9A 4HJFA 1CGYA 3S46A 4IPPA 3GHTA 3BMVA 1K9TA 3DHPA 1DJIA 4QFUA 3ARVA 1WZAA 4LS2A 1FCQA 2W27A 2KX9A 1YPIA 3KAOA 3UPWA 2UY4A 3DFNA 3EX6A 1GVYA 1NU5A 1GPWA 4NRSA 3SBFA 3ZQ9A 3KRBA 4NNAA 3NZPA 3B8SA 2C0HA 4PUDA 4RV8A 4Y9NA 4EK7A 4S3KA 2PEVA 1M1BA 3TN6A 3W53A 3PWAA 3IAQA 3VZZA 5EKYA 2VGFA 1NFPA 3OZYA 2BP1A 1QHPA 4UTWC 1GVFA 1R8LA 1PE1A 2VGGA 7REQA 4KCUA 2GK1A 1FHVA 3VINA 1QHZA 3SN1A 1UZ1A 5A5WA 3LPFA 3LGGA 5D2VA 3VD7A 1JDAA 5DQPA 2J7CA 1IZJA 2L5HA 4HK6A 3GXTA 2DVUA 3IWPA 3W38A 2I16A 2ABBA 1G4EA 3TTYA 1XPGA 2VHLA 3O0KA 2YIHA 3VOCA 4JTSA 2HNHA 1WXYA 3UP8A 2BLEA 3A9BA 3CQJA 1XLBA 3AIBA 4O4WA 5FJOA 1UIOA 3OLIA 2Y1HA 4JFTA 3RO6A 2VDGA 3M0VA 3OEXA 4M56A 1U83A 4DAIA 5I06A 1NOUA 4OT7A 1N8WA 4X9YA 1WDSA 2VD8A 4O12A 3UZXA 2E77A 1I1XA 2YBVA 4R88A 1V3IA 3UR7A 1KWKA 4BR1A 3DYOA 3NJ3A 3PSVA 3TWAA 2OYKA 1X7IA 3FW6A 3GAKA 3P93A 3PUGA 1UOZA 3EPNA 3SAZA 4E2BA 4GPNA 1TUFA 3E2SA 3VFCA 2XVLA 3DC8A 3N4FA 3CBWA 3VNYA 1UCWA 1O95A 1TJ0A 1ZB5A 2ZWYA 3EWBX 3PZ9A 4XTIA 4ACZB 4K8EA 1V7YA 2Q09A 4TO8A 3RJYA 3VNLA 1T8QA 2HRWA 3NNTA 3AWNA 1B9ZA 2OWWA 5AC5A 3HPZA 4TV5A 3WIJA 4PN2A 2Y5EA 1OFQA 4IGHA 4EXBA 3W2JA 3OG2A 4AYGA 3GXNA 2NV9A 2H3BA 1PB0A 4UTMA 3ZMRA 1UPMB 5IXEA 3V4BA 3OTRA 4GRSA 3WD1A 4PFMA 2HCVA 2E8YA 4ROQA 5K4XA 1GQLA 1E15A 4MYAA 4RXFA 2D3NA 2ZRZA 2HK1A 1EX1A 1W37A 1XYCA 3RK8A 4H00A 5DF0A 4JIPA 1RQHA 4LTSA 4L4PA 2VC5A 1CXFA 7A3HA 3PJTA 5IOBA 1FKXA 1WDPA 2XYLA 8XIAA 3O06A 3LPPA 3TOPA 1VBRA 3PTKA 3PPFA 3TX9A 5M5DA 3CLWA 3KL3A 4CQCA 4W5UA 5DXXA 1KB3A 1VPXA 3EOUA 4XAFA 2BXVA 3SCTA 4R7OA 1QAPA 1P6CA 4MGGA 3U5UA 2NWRA 3K1GA 4Q4RA 4B5WA 2OO6A 1IIHA 1QWGA 4C6QA 3I6RA 1XX1A 5CPLA 4AEFA 2EHHA 4I6KA 4A3QA 1S2CA 6ENLA 4E5TA 2FPYA 3S6DA 4P7NA 3VXGA 4IUOA 3M9YA 5CPMA 4DJFC 5FOOA 5F2LA 2E5CA 5G1TA 5XINA 3K46A 4RE4A 2GVLA 5TQLA 3EKZA 3IJ6A 4MNMA 4YVPA 5LSMA 4XG1A 1GJWA 2WJFA 1GTEA 3AZSA 4GVHA 3VC5A 2DH2A 4RE2A 2PDHA 1NDVA 1A5LC 2E0PA 3DFHA 2QEZA 2YJQA 5I3KA 3I68A 2J8GA 3SUVA 4K8GA 1H09A 4AXKA 4IGMA 1V6UA 3PF3A 1P0NA 3THCA 3RGTA 1PX8A 4HHMA 4MWAD 2OOFA 2ALDA 1IXPA 1UD8A 4E4PA 3FY1A 4XAZA 5DMNA 2HJPA 1UQZA 1V02A 3S83A 1DIDA 5E6ZA 2XM2A 5CZKA 1AW1A 2GUBA 3GYEA 5K3VA 4AZCA 4I7UA 4E38A 3QZAA 2QHAA 4RNFA 4OUEA 5FCZA 1EZ2A 2BVDA 4W89A 3N13A 5AC8A 4K7YA 3IAPA 1X1NA 1XGEA 1JZ2A 4MWAC 2VQTA 2D1ZA 3MWCA 3W26A 2ZUWA 1BG4A 3W7GA 5C7HA 4IMCA 2IW0A 1K9FA 3LXCA 2FMOA 3F5LA 4ZB2A 2GQ8A 1JYWA 4UQDA 5CAKA 3LYEA 3ZXWA 2QJHA 1LRTA 1LP6A 4UTLA 1DWIM 3VD5A 2V3DA 1PV8A 3WEOA 4K8HA 2Z1KA 1CYGA 5DCBA 4TVUA 4XUGA 4Q7NA 2R1KA 2PBGA 2V5KA 5PTDA 1DE6A 2WZIA 3GKFA 3V5OA 1XH0A 2JE8A 1Z48A 3JZUA 3FN9A 1JQVA 4A2SA 1ZCCA 3DFTA 2INEA 3SM0A 4Z1BA 4LYQA 2G96A 1XV8A 1XS2A 3Q65A 2J7DA 3RU8X 4DIAA 3SUWA 2YA2A 3S8HA 2XVNA 3RCMA 5LNRA 1VQTA 1QCWA 4WY0B 4AIEA 1KRCC 1J11A 4PUKA 1K1DA 3HZ3A 1XYLA 3TQVA 1GEQA 4OFCA 5CC3A 3KVKA 3NQ8A 1ALDA 1OC6A 5B7YA 4ICNA 4CEXC 1C9WA 4QEHA 1SFTA 1IR2A 1JXJA 4O16A 1BKHA 4G8TA 1UR3M 1W9BM 2VTFA 2R6OA 3TZFA 1JYVA 3V16A 1J0ZA 2G3NA 1KM6A 2CNCA 6A3HA 2CERA 4GMEA 3M0YA 1R6WA 1Q4WA 3ZR5A 2QLYA 5DXYA 4L4MA 2YCLA 3QTGA 4FIQA 2XINA 3KWSA 2P0IA 3ITVA 4PSRA 1ZBKA 3I10A 4YTTA 2OKTA 4FR6A 3N2XA 4O52A 1XDLA 1GHRA 5I7GA 3LS9A 3KP1A 1Z41A 1J6OA 4E8DA 4JIHA 4P7OA 4FSAA 1XFCA 1LZOA 3M7SA 1MFUA 1JD9A 4MKNA 2WSRA 3KHDA 4DJDA 1KTCA 4Z2HA 1EUAA 4HZMA 5A6SA 2OJPA 3SDOA 1K70A 4LVGA 1YIXA 4NAFA 3ZLHA 4DYJA 2EJ1A 3LTPA 3BCJA 3S47A 1BGAA 2B81A 2X40A 4LY4A 1E5NA 3UZZA 5CBBA 2OQYA 5I02A 3DYMA 3WF3A 3RX2A 4AZ7A 2IKJA 1XH2A 4FP1A 2VKZG 5HBFA 4RXGA 3W9ZA 3BTNA 1YTDA 1LYXA 4K1WA 3ABQA 3U8GA 3UXDA 3ZSTA 4NZCA 4JNZA 2V5CA 3GTFA 3WUEA 1UKPA 2NSXA 4HPNA 4DQWA 2FZNA 2Q6ZA 1M7XA 1XDJA 4J5NA 2POZA 4PMYA 1HG3A 7CGTA 4YTRA 5HMDA 5D8WA 3QV6A 2PB1A 3PBWA 4JTHA 4C6PA 3KZPA 4ATWA 4HNOA 3QSRA 4JNYA 3BSGA 4FA3A 1MQQA 3M0JA 5LIKX 4AZHA 2ZQ0A 3MP4A 2QV5A 1PEZA 4HHPA 1XLGA 2D2HA 4XISA 3WDIA 3CIXA 3M0ZA 1VIWA 4CNOA 1AJ0A 2J79A 3UG4A 1YTKA 1KR0A 3VVGA 3ARWA 1YPFA 5DRIA 1PIFA 2A7RA 4BS0A 1C8YA 1YE6A 3FGCB 1JZ3A 5I0DA 4IF2A 1OGSA 4F0MA 3UBPC 4GI4A 3UZ5A 2AGKA 3NDYA 3DAQA 5TF0A 3ZO9A 1CPUA 5FEWA 1HJSA 4LBSA 1TSIA 2V2CA 3CAVA 5D9MA 4PUMA 4DX3A 3G1RA 2WMJA 3G77A 3W7OA 1W91A 4K6AA 5CZ0A 4V33A 3LU2A 1Q8AA 3HGOA 1UR9A 2PCQA 3ONBA 3C3NA 3M5YA 1HP4A 4W7UA 2PWDA 4R27A 3KDNA 4GQ0A 1D3GA 2P76A 1EUNA 2UY5A 3VDHA 4YYFA 1TV3A 4MWAE 2IXUA 1CXHA 2IQTA 4Z08A 3TC7A 1NQKA 1RBOB 4JX5A 4GCAA 4MDOA 3ZOAA 1WDDA 5FJJA 2R94A 4IFKA 1KR1A 3NYZA 4AU0A 4DY1A 5HANA 4OOUA 4YHEA 2VP8A 1Q2SA 3CIVA 1TA3B 5FF0A 2PDUA 3GW0A 4RDZA 4O11A 3W7NA 2E6FA 3N17A 4CLMA 4R7JA 4F0KA 2CLMA 1VYSX 4JTLA 1AQMA 1J4EA 3BAJA 4ZL1A 3WK0A 3L67A 1WXJA 5EA9A 2R91A 3MBDA 1ZZMA 4MLJA 1LG2A 1GQIA 3KX6A 4H9VA 4RE0A 1V6TA 1W31A 5G1MA 2ZZ2A 2XZ7A 4ZO6A 1LL4A 4DEFA 4XZHA 1S39A 1EDTA 2GGIA 3H24A 4MY8A 1XC6A 5A1AA 3OBAA 5FJPA 3TMLA 3DU0A 1UZHA 2ASHA 1T8XA 4D2JA 3FK4A 4N2YA 3F4WA 4DJED 4DJDC 3LHWA 2GJRA 2D20A 4C65A 1F3TA 3TYUA 4GY7A 3ARUA 4LXFA 1FHLA 4JTGA 3VABA 3W23A 4M6QA 3DOPA 3OQ8A 1CXLA 3E9AA 2Z29A 5BNKA 1LBFA 2P3EA 3CPGA 1L6FA 3ARYA 3H2CA 1OX6A 3IVSA 1BTMA 3HMCA 3M1ZA 4UTFA 4GO8A 3AS1A 5AYIA 1RVKA 1HQTA 2VD9A 1ZJHA 3RMJA 3G1SA 3U5YA 3GFXA 2TAAA 1H7RA 5HMEA 1RPXA 4CNTA 4Q6JA 4S3GA 2EG6A 2D73A 3PSWA 2EG8A 1FBAA 4JQ2A 4TX8A 4GQRA 2QPUA 2PFHA 2OOGA 3DX5A 4MSSA 1UASA 3S1VA 4KERA 3SJNA 3COTA 4O14A 2GOKA 4W88A 1IWAA 3B8VA 1KM5A 4HQVA 4JTKA 1MYRA 2ZUNA 4N4QA 4M6PA 3SY8A 3EWDA 5D2XA 2WM1A 1XIFA 2TMDA 3QM3A 1VPQA 4YVVA 3GW3A 1QASA 3A12A 1IT7A 1ESWA 3K4DA 3AXXA 5IHRA 2AL1A 1B4KA 1UA7A 2ACSA 3IIVA 1DJQA 5JH1A 2DW7A 2Y8UA 2A3BA 1KGXA 3HGJA 1DIKA 2RH9A 1UMLA 3N1AA 1MXGA 4AHQA 3PWGA 4HA3A 2GQAA 2Q01A 1JVNA 1M65A 1ODUA 1KM3A 1TUXA 5H91A 1V3JA 1QMLA 3UCQA 2ZRYA 2YL6A 5FL0A 3H7UA 3HG4A 1F61A 1EJRC 5KZDA 3MP5A 5IBXC 1TQXA 2DU2A 3FKRA 3ELFA 4OBRA 1P48A 3M0HA 1TR1A 2GGGA 3MY9A 2HBVA 4MJ2A 4I8YA 3B8IA 3SRDA 4CD7A 4LVBA 4JCLA 1W56A 2AL2B 4D1JA 3STCA 3F4CA 3ABXA 3MJYA 1NJJA 3GU9A 1U2YA 1H63A 4B4HA 3HIJA 3L0NA 4GUGA 3GC2A 3O1NA 3EOEA 3P5YA 1TPC1 5FKYA 2WANA 2OX4A 2FQIA 4Q4SA 2Y88A 4PRRA 2CZEA 2UZ9A 3NEVA 4C6BA 3B0UX 1BXBA 3N9KA 1LLZA 1ODZA 3WF4A 1REQA 4IMDA 4L64A 1VHCA 3TQPA 4JTQA 4HT3A 3C2VA 3P2VA 3EBVA 3H23A 2V5LA 4B5NA 1TTQA 1BYBA 2CKSA 3MYOA 4M19A 4ZVJA 1O5QA 1OG0A 1ISWA 1RBAA 1C9DA 4IUGA 1UW9A 3W71A 3IJ8A 3TFCA 2X30A 2R1LA 4MB4A 3WQEA 3WLKX 4ZQMA 3PB0A 3W74A 3JS3A 2Y89A 1U1UA 3GVQA 3VKBA 4PUUA 3AUJA 3M0KA 3B9AA 2ZYFA 1EQCA 3BAKA 3KXQA 4CD5A 1KBLA 1BG9A 4DZ5A 3THDA 2FZMA 4AUBA 2E5BA 4CVUA 4Q8NA 4JTTA 2HWGA 2NXGA 5ABFB 3KL5A 4HYRA 4JGDA 4PGLA 2PDBA 5EBAA 4D8AA 3M16A 2VX5A 2QCGA 1Q13A 2G0WA 4DWSB 1UR4A 1CGUA 1KRAC 5H8UA 3GTIA 2DQWA 4H41A 4AY1A 4UNLA 3O63A 1ZTVA 3QGAC 4O13A 4RKAA 1CGWA 2QULA 1NDYA 4PH6A 1ICSA 1GORA 4PL1A 1BLIA 1X96A 3DERA 2YPIA 2VX7A 4GKLA 4GC3A 3B9OA 5LIYX 4LWWA 2E6AA 5CSYA 5CAHA 2ATMA 2TPSA 2VI0A 3GWQA 4S2BA 2X42A 1E4IA 3BG9A 2XM1A 3EX3A 3T42A 1NDWA 5BCAA 4MB3A 3O9NA 4ORIA 4LNYA 2EPMX 3H26A 3W7JA 3ZJ7A 3LCWA 1VHNA 3NQEA 4ZEPA 3BSMA 2DW6A 4EIVA 4N9CA 3GG0A 3N3TA 3K13A 5E0FA 1GJUA 1ZFJA 3G6LA 2X7WA 1JI2A 1W17A 4GBDA 2PCEA 4I9TA 4H8NA 4UZUA 1AQHA 1XD1A 1TJPA 3QPEA 1DP0A 3TZNA 1SZFA 5A6TC 4QE5A 1YMYA 3CL7A 4J35A 5ABHA 4AY7A 3SGUA 2QF8A 1RP8A 2CZ5A 1UROA 3CMFA 4W7WA 1T7LA 1GOQA 1HKJA 4H8UA 3AZTA 1QFEA 3R10A 4UQBA 4LEFA 3AXHA 2EPHA 4I9AA 1TZZA 4C7DA 1JCLA 1Y7VA 3UWYA 3GC5A 3H2MA 3WDRA 4O28A 3TJLA 3NSXA 4HSNA 3TR2A 3TW7A 3VIGA 4OV9A 3VGFA 4WQ6A 1J79A 2BGQA 1CXIA 1R2RA 2EGZA 3MS8A 4WOQA 4OWGA 1DOSA 1OX5A 4O15A 4AISA 3P6LA 4KT2A 2YKKA 3CUXA 4YN5A 3GNNA 1VFSA 3NUKA 4MYXA 2XGBA 4NI8A 1ZL1A 2QVNA 3B9DA 4K7VA 4JFUA 1F4AA 3O7UA 4D6DA 2V9DA 4N42A 3CB8A 2BDQA 3GNRA 3NM3A 1R86A 3MSYA 4L9XA 2O0TA 1E1EA 1BXCA 1PPIA 4EPDC 1BEUA 1UZ4A 2PMQA 3BW4A 2Y7EA 1J12A 3W7RA 3QC0A 3MO4A 3QR0A 2ACRA 4DWSD 1Q6FA 1TPB1 2QVHA 3URBA 3EXTA 2FZ8A 4WLCA 4HZ8A 2V3FA 4CNSA 4UOQA 1LLOA 5HATA 2G50A 4ZMGA 4JTRA 2C6QA 4EXAA 1PXGA 4PEEA 4DUOA 4BY3A 4WK9A 1HJXA 4GIRA 2XWEA 3ZFHA 4D6JA 1ZCOA 2V81A 2YDSA 2OEMA 4DLFA 1HF6A 3H7RA 2DIJA 3QYQA 4LW7A 5D2WA 3PM6A 1XCFA 5FF4A 2WVVA 5E70A 1WZLA 3W6YA 1N55A 2YCIX 4DI8A 1B1YA 4KGLA 1GQNA 3A13A 3ZS4A 5A94A 5E9AA 2WO5A 2ZRUA 3WLOA 2YL8A 1U1HA 3LHYA 3NAVA 3BQ6A 4EPKA 4BJHA 3G1YA 1H0GA 5D33A 5F4XA 5M3WA 3S5YA 1UH3A 3F4NA 3VOGA 3DI0A 4LX4A 4IPNB 3KVLA 4B5TA 4HD5A 1NFBA 2OKOA 5FJRA 5KZ6A 4JFVA 1AW5A 3ZYZA 3N4EA 4V28A 5CPOA 4E6MA 4G1KA 4IIFA 3RCYA 1E6ZA 5LXXA 1CECA 1S5VA 4TX6A 2OGYA 4ECLA 1ONRA 2QF7A 3QKZA 1W5QA 2E3ZA 5DO8A 4IP4A 2VYOA 4AHOA 3NOEA 2RDXA 1Q6DA 2WBKA 1W5MA 3ZJ6A 4ZOCA 4N6EA 1L2QA 3W1NA 4E4FA 1LG1A 3YPIA 5A8PA 1CB2A 5DMLA 3C0SA 3INPA 1JQXA 4ZBCA 3AIQA 2QCEA 3CQKA 1UWAA 3MHUA 3OA5A 1ZALA 4LF1A 3B8DA 4WCJA 3ERPA 1DWJM 4HK7A 2NX9A 4J9JA 1RA5A 1OIMA 3B40A 3MA8A 1J0YA 1SYTA 1J8VA 1I9CB 1LOQA 3N4AA 1FWCC 5AC6A 3ZSSA 4F66A 4BF5A 3RM8A 4US6A 4FK9A 4D1IA 3BLLA 2PF8A 2YL5A 2DQXA 3OGVA 2CLOA 4QDWA 4EAMA 3XISA 2YBUA 1FWGC 3I7SA 1VB9A 4LAUA 1GTHA 2P88A 3G6MA 4LAOA 5HJLA 1TKKA 4A05A 2E09A 4R5EA 3WLIA 1XI3A 1QPRA 4Z0SA 4O54A 1V0NA 1KW1A 4H7ZA 1BVZA 4FOKA 2J9XA 2GK1B 4LBUA 3RLHA 3WBEA 4P7QA 2H3DA 1QTWA 4AIBA 3VIOA 5C0QA 3UCDA 1TCDA 2WVTA 3PBYA 6XIMA 3NYDA 3EMCA 1JPDX 1OYAA 2DT0A 2PTDA 3WELA 4QQ3A 4Q7IA 1CT5A 3Q2DA 4S3AA 3N2CA 3O3RA 3MUXA 1R3QA 1WKDA 2WKLA 3NOYA 3HJZA 1IXOA 1H61A 2ZA1A 2V3GA 1G7UA 5T26A 4U33A 4GUFA 1H5YA 3SCNA 2BY3A 4IMGA 4E2OA 3EXSA 4JKLA 2EAWA 3SCSA 3ITTA 4GO9A 3SB0A 1EC9A 4D6HA 4S3EA 1IXQA 3TONA 3R13A 5BOOA 2A4AA 3UJEA 2ZADA 3OG3A 9XIAA 1XLKA 2J24A 1Q63A 4DBUA 1AG1O 5CLWA 5J04A 1R30A 1HN1A 2HMCA 1XLFA 1OFEA 3RU6A 1TPDA 3EB2A 5CXPA 1ISZA 1C8VA 3LRMA 2XH0A 2GYIA 4B3ZA 3RF9A 1K3UA 4LRTA 5DRCA 5CJ5A 4HNVA 2V38A 1PL9A 1ZJIA 4BWLC 4PB5A 4XD4A 2QMJA 1XBYA 3ZVIA 3APGA 2X1IA 4NT0A 2GGHA 3C2RA 3L4VA 1ZAHA 1M7OA 2VDIA 3DHDA 3I3EA 4LOCA 1BWVA 1UP3A 1DXFA 1L6YA 3R8GA