2O9PA

Beta-glucosidase b from paenibacillus polymyxa
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
445
structure length
445
Chain Sequence
b'NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase B
molecule tags Hydrolase
source organism Paenibacillus polymyxa
publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
total genus 167
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9pA00
2CPUA 1RP9A 3L4XA 1W3JA 4CCEA 5M5DA 1E6XM 3CBWA 4JCLA 1UKSA 3IAPA 1B3WA 3CZEA 2GK1A 2X05A 4W89A 1AQMA 5I0DA 3RJXA 1EO7A 2VVNA 3RJYA 1CXLA 3GXFA 3GNRA 3NUKA 3CUJA 5DF0A 5C8BB 2BHYA 3WEOA 3WDPP 4PYSA 1PPIA 3FY1A 2WLYA 5M17A 1QI4A 1JF6A 4P8VA 2HISA 1LG1A 1UD4A 3W6LA 5D8ZA 2WMFA 1US3A 1JZ4A 2GFTA 3BAWA 2O9RA 3IANA 3WL0A 3VD7A 1UWUA 1UD6A 4JFSA 2ZUSA 3AXHA 4MDPA 3VIIA 3K4AA 2DDXA 1OBAA 3SIMA 3AHYA 4AZIA 3ZSTA 2A3EA 1CGVA 2WCAA 2CXGA 3UCQA 1SYTA 3OBAA 2WMIB 3PTKA 5CPTA 2UWFA 3TTOA 4TVDA 1ZBKA 2D2OA 3VGBA 4ACYA 3VGHA 1TFVA 4H2CA 3FHQA 3N13A 1E1FA 1JYVA 5I3DA 5HPOA 4HZ8A 2UY3A 2CITA 2VZUA 1XH1A 4GXPA 1W9XA 3N12A 4HA3A 4QLLA 4NRSA 3OB8A 5JIWA 1UR2A 5BXRA 1S46A 3VMPA 1CYGA 4UFLA 2V3GA 3PZGA 2VX4A 2XIIA 1LWJA 1LG2A 2VQTA 5IHSA 3VGEA 3K46A 2V5CA 2NT0A 2CBVA 4D72A 5CLTA 4TVUA 1JG9A 2CKRA 1VAHA 1V3KA 2GJRA 2QHAA 3AIBA 3RPMA 1WP6A 4J3VA 2D3LA 1GUVA 1RH9A 3U5UA 4X0NA 5DEZA 1R87A 3NSMA 5LYRA 4PUEA 3NSNA 3WQVA 4ZFMA 2A3CA 1WZKA 3HN3A 3AYRA 2FH6A 4ZXOA 2W66A 3VILA 3W29A 4Z2JA 4AC1X 2WMHA 1JNDA 4M81A 4HOWA 3S2CA 2VJXA 3WDQA 5C70A 3CZLA 2CERA 2WBKA 1H49A 3PZOA 3BLPX 3A4AA 3BCDA 3M46A 4WK9A 2XFFA 3L4VA 1OIFA 3WUBA 1H5VA 1J01A 4FF5A 4PMUA 4UOZA 1KGWA 1G0CA 5BRQA 2W5FA 4QP0A 1UR1A 3MMWA 3L2MA 4CD4A 1ZBWA 3CHFA 1GNXA 4ML4A 5CQ1A 1D3CA 1UD8A 1RPKA 3VDBA 1V02A 4GZJA 3WH9A 4JFUA 1AMYA 5FCZA 4GIAA 4CVWA 5DT7A 2J25A 3MUAA 3MO4A 5BXSA 3E1F1 1C91A 5D4YA 4URIA 2WLZA 1E3ZA 1UD2A 1NWUA 3UG5A 5E0CA 4CN1A 4RL3A 2Y24A 1XGZA 1KR1A 3OG2A 4GQRA 2YL8A 1CPUA 3VUPA 1X6LA 3ARRA 2QMJA 4UFIA 1WB0A 3VINA 1UQZA 2OSYA 1QNSA 2DSWA 3WKZA 4GI8A 3WDJA 3CUGA 1VF8A 1BTCA 1NWSA 1PBGA 2F2HA 1HP4A 2WMKA 5JBDA 4MB5A 1BG4A 1WE5A 2XWDA 4PEEA 4MB3A 3W6MA 2W63A 1QW8A 2WANA 1C8YA 3WDHA 3QOKA 4PTVA 4C7GA 1EH9A 3ZR5A 4PMQA 1BYBA 5I78A 1LF1A 3RIKA 4E8DA 1UA7A 1J0JA 3K8MA 3MKKA 3PZNA 2BNJA 4DUVA 3KE0A 1BF2A 2ZOXA 2Z1SA 3SUVA 3RMEA 3RM9A 5CPSA 4FLQA 1VJSA 5D9NA 3SEPA 1E6RA 3CZGA 3ZQ9A 5M3WA 1EHNA 3N04A 4ACZB 4IM4A 5D8WA 3GXIA 4WF7A 1UWTA 2ZE0A 3WNOA 1QNPA 1BVNP 2OSXA 2ZUWA 2XVPA 4L4OA 4CD8A 2C8NA 3OA5A 3WN6A 1NP0A 3VO0A 4EAMA 2QLYA 1DWFM 3POCA 2VTFA 3AMDA 4PMDA 4AD2A 1BAGA 3GXMA 2E8YA 3A47A 3OIHA 1CNVA 2W62A 2BFGA 1QNOA 4ATDA 3TTYA 1PEZA 2VC9A 3WEMA 2OWWA 3AFBA 3WNMA 1VFMA 1DEDA 1HIZA 1Q6FA 1XHGA 4CD7A 4PUDA 1WDRA 1FFRA 4CU7A 5A95A 3BGAA 1AQHA 3UEQA 2ZICA 1W9UA 1FP9A 5FOOA 2CNCA 4D6CA 4H8VA 4CCDA 1US2A 1ISZA 4U5IA 3ARQA 1DWGM 4M82A 3ARWA 1KWKA 1JDAA 1UWIA 4RE2A 1FFQA 4AD1A 2PB1A 3AS1A 1G01A 1EDGA 1E4MM 3CZKA 1B30A 4W7WA 5BROA 3AMGA 2JEPA 4PMYA 3BAXA 1PX3A 3FW6A 3AICA 3BAKA 1GOWA 5ABEA 1BQCA 4PBGA 5A2AA 5A2CA 5IDIA 1MQRA 4P8WA 2PWFA 4HMDA 5GPRA 1ZJAA 4J7RA 2JALA 3N9KA 4W85A 1E5JA 1HJUA 1CENA 3UR7A 4LXFA 5A8MA 1MFUA 3WF1A 4D6IA 1OGSA 4IPLA 2OYKA 1GQIA 3CUIA 1J0KA 2OWCA 2J7FA 1JFHA 3NSXA 1W32A 1JL8A 1E40A 4P7NA 3OLDA 1PIFA 4HA4A 5BWFA 1PZ3A 1TMQA 4Z2GA 4DM1A 5A6AA 1JXJA 1X1NA 3THCA 5A6BA 4HMCA 2J62A 1H2JA 2BVDA 1ITCA 1NOFA 2CBUA 4M29A 3AIVA 4WKHA 1HL8A 2MANA 1FP8A 1VEOA 2VCAA 3ECQA 3TTSA 3VM7A 1UH2A 1GPFA 1R8LA 4MPKA 3DC0A 3G6LA 3AJ7A 4ATLA 1HVQA 2J7CA 3W53A 2FGZA 3PBGA 2WKLA 5CSUA 1HJSA 5AYBA 3ARVA 3BH4A 1XSKA 1E3XA 3SCOA 4ATWA 4GKLA 5HPCA 1CGUA 2XG9A 2W91A 2C7FA 3A4WA 2E40A 1Z32X 4AMCA 4P8UA 1LJYA 3AZRA 2Y8KA 1V6UA 3G6MA 1EOMA 5EB8A 4PMOA 5I5RA 2ZX6A 3EBVA 1TVPA 4W5ZA 1V0KA 1JZ5A 3AMLA 1E0VA 4BZYA 4CD5A 3F5LA 4OOUA 2XHYA 2A3BA 1V6VA 2BVTA 3ZT7A 4QLKA 2PF0A 3VIHA 4ZXLA 4EANA 3T08A 4ZENA 1MVYA 3WFLA 1KB3A 3M07A 2YDSA 2DIJA 1NOUA 1JZ6A 1JGIA 1H0IA 5GNZA 4HZ6A 1L8NA 6A3HA 4MDOA 1NH6A 1CGWA 3CHDA 1CXKA 3NJ3A 3VKKA 2WHJA 4J3SA 2WSPA 4AW7A 3W26A 1LL4A 1BYDA 4D6DA 4W8BA 3W24A 4X9YA 4UQBA 4OOZA 3U5YA 1C8QA 2NW0A 4AZ7A 3BLKA 1W1YA 1LLOA 2WSKA 2HVMA 3NCOA 1UKQA 2F61A 4DUWA 3CZJA 4DWSB 4JL1A 4HU0A 4AD5A 1G1YA 4RE4A 3LPPA 3RO8A 3M7SA 4UZSA 1W3KA 5CSYA 3SCNA 5ABHA 5C71A 4PMVA 2JIEA 3CTTA 3D5HA 3B9AA 1GOQA 3U57A 2Q8XA 3MV11 3ARTA 3OLEA 4MTVA 4HA1A 4E8CA 1G94A 2YDRA 4D6FA 4PTMA 2WW5A 1C90A 1H1NA 3BAYA 4D6GA 3SUUA 3W4RA 1B90A 2WHKA 2Y8VA 1OCQA 2WHMA 4NZCA 2VX6A 2VRQA 2DSKA 3K8LA 4V2XA 1VEMA 4P7LA 1CECA 2DGAA 2XGIA 5JBFA 3BMVA 2B31A 2EJ1A 4D71A 4KRTA 2NSXA 5CXPA 1UD5A 1KGXA 5TD4A 3AIWA 3W38A 4CN4A 3PZIA 1E72M 2WBGA 2UY4A 4B9YA 1E0XA 3WDIA 3MANA 1ISXA 5A94A 1BSIA 4GI9A 1Q6DA 3MSDA 4AZHA 2J74A 3WH5A 5A6BD 1EXPA 5E0FA 4KGLA 1PX8A 2VNCA 2YBTA 1FH9A 1UOKA 2J75A 2OSWA 2E8ZA 3D3AA 2ZUNA 3SCWA 4JL2A 2YA2A 3GNPA 3ZJKA 1HKIA 2J7EA 4UQAA 4Y7EA 3CZ8A 3AIEA 2RGMA 2XJ7A 3VMOA 1MXDA 1IZJA 2XSBA 2YL5A 4M24A 2GDUA 1QI0A 1LL6A 2PBOA 4EE9A 1QHOA 2WVSA 7TAAA 3AS3A 2XVGA 4P7RA 4Z2HA 3EMQA 4TVCA 1CLVA 3JUGA 1ZS2A 1U2YA 1E73M 1FH8A 4QLJA 3WUEA 1R86A 4AZ6A 4F79A 2A3HA 1XRVA 1E4IA 4GI6A 1QVBA 3MU7A 2CBJA 1KQZA 2VO5A 1W91A 4UQEA 1X6NA 3AIRA 5M03A 3N18A 3WMBA 3THDA 1JD9A 6CGTA 1HKJA 2D23A 1HXJA 4AIEA 1BHGA 3AZSA 1E6NA 1LQ0A 2X0YA 1ODUA 3NDZA 3GNOA 2YIHA 3DYPA 2VCBA 1ZU8A 4AD3A 1WZMA 1GOIA 4KRUA 5CGMA 1K6AA 4BQ4A 3WH6A 1WDPA 1UWRA 3BC9A 1B31A 3KEHA 4W7UA 5I23A 2BHUA 4XZWA 1DWJM 2RGLA 4B9ZA 1E6QM 2WZHA 3QOMA 5D9PA 1JAKA 1QPKA 2CETA 3VD5A 2F8QA 4WKAA 2OWXA 1GOOA 2BV9A 1OM0A 3GBEA 3PZQA 3CIVA 1DHKA 4BA0A 4F9JA 1SR0A 3ARPA 3PZMA 1JDDA 3SCRA 1OT2A 1KCLA 5IHRA 1V3IA 1ESWA 3WF0A 3SCUA 1G5AA 4NF7A 5CPQA 2JFEX 4JHOA 2IUZA 2PC8A 2AAAA 2DT1A 1OD0A 3AHXA 3ARZA 1OGGA 3QHOA 2GSJA 3U7VA 4YHGA 4EK7A 2ZX8A 1MWOA 1TUXA 1BG9A 3B9EA 1C8XA 3CHEA 3F5JA 2CIPA 2EPNA 1OINA 2WWCA 3VIOA 3BAIA 4N42A 4U33A 3WNKA 4JZ5A 1E6PA 2OLHA 1E6SM 5I6SA 1E55A 1OIMA 4CU8A 4BS0A 5AYIA 3VIGA 1VFOA 3N15A 2FH8A 4GINA 1JYXA 2AOSA 4AISA 1J0ZA 1HX0A 5D9MA 2VMFA 3AXXA 1W1TA 1FH7A 1VRXA 4J3UA 3OGRA 3F4VA 2WNWA 5CJ5A 5A69A 4AEEA 4WLCA 2DSUA 4HP5A 2BY0A 4WSJA 3WUGA 4AEFA 1V0MA 3WQWA 1KXHA 1E0WA 5CZKA 1P6WA 3W82A 2XYLA 3GM8A 4QAWA 5EBAA 2G41A 4TOQA 2CHOA 4P7QA 1AQ0A 3W37A 2CESA 1F4AA 1WDSA 3W27A 1K9EA 4GPNA 2WVVB 2UY5A 2VOTA 2X8RA 4W87A 2VURA 3QHNA 3WQ6A 7A3HA 2YA1A 5E6YA 1GW1A 3N17A 2WYSA 2QMKA 1D2KA 4XX6A 1JYWA 1J0YA 2OYMA 1GOMA 2V3FA 1UA3A 2ZX5A 4BQ3A 1DWAM 1V3JA 4E2OA 2VZOA 3WY1A 2W92A 3F5KA 3AMKA 4UCFA 2ZXAA 3MSGA 3SUTA 2E0PA 3AHZA 4HTYA 5CLWA 3VD9A 3VIJA 2GVYA 1KWGA 4HOXA 4H8UA 2D0FA 4ZE5A 2DIEA 3MV01 1EQPA 1R7OA 5BXPA 1L0PA 3DECA 3AZTA 3VDHA 3UERA 3WF3A 3SCTA 2J8GA 2WC4A 2CYGA 1XH0A 1BVZA 1GORA 2WC7A 4B3LA 2WMJA 3L2LA 1U33A 1WCGA 3BXWA 3WDRA 3CUFA 3OZOA 5E70A 1EIBA 1UH4A 3AISA 2C0HA 3WMCA 4H8HA 2QPSA 1EGZA 1BFNA 2GJXA 2X1IA 1XD0A 3EMZA 1ZB5A 1BPLB 4BQ2A 1OD8A 5BCAA 1I1WA 2ZIDA 2GUYA 3VOCA 1VB9A 4PRWA 1UWQA 1I1XA 3S6TA 3VNZA 3WL1A 2V3EA 4KMQA 3IJ8A 2BY1A 2VL4A 3WH8A 4V28A 1B2YA 3CLWA 3TP4A 1MW3A 1J9YA 2D20A 1BLIA 1MXGA 3HU7A 8A3HA 3PTMA 3B9DA 3WBEA 3AI0A 4JCMA 2XTKA 2ZUMA 4HPHA 4TUFA 4WSKA 4TTUA 2IXUA 4MB1A 4LX4A 3MUY1 1K9TA 5GQBA 4CN6A 4UFMA 3AIUA 4GZIA 2ZXBA 3WQ4A 3GZAA 3PZ9A 3AOFA 1QNRA 2CHNA 4HMEA 1CDGA 1M7XA 1CXFA 2EPLX 4A3HA 9CGTA 4GZEA 1WZAA 1NP2A 1H09A 5LA2A 2E9BA 3VM5A 3PHAA 2QF8A 4Z2KA 1V03A 5KEZA 4M80A 3ZJ8A 1UR4A 4C7DA 2UY2A 3NDYA 1M04A 1GHRA 1IZKA 1ISWA 3DHUA 4PMRA 4R27A 3LPGA 4MNLA 4P7OA 1V08A 4PTWA 1JF5A 2FHFA 3WNNA 2XUCA 4W84A 4JHZA 3AS0A 4JIEA 1V6YA 4JFWA 4U31A 5A6MA 1NQ6A 2O92A 1J10A 3II1A 4ZE4A 2J4GA 2ZUTA 3VMNA 3VDAA 5D9OA 1TR1A 3ZJ6A 2EPOA 2WHLA 2X2YA 6TAAA 3WD1A 4NRRA 3GTNA 2WMGA 3ARUA 3EYPA 1G9HA 3IJ7A 1VFUA 5A1AA 1QNQA 1C7SA 2YOCA 4U3CA 2VRJA 1K9DA 1Q6EA 1XSJA 1WZLA 3AIQA 1CGXA 5ABFB 4AY1A 3WFZA 2GJPA 4IPNB 2DT0A 4F66A 1FHDA 4S3JA 4PTXA 1JZ2A 2VZVA 2XGBA 1CLXA 1UKOA 1PAMA 2WAGA 1W2PA 4PMZA 4B15A 1UWSA 3CGTA 3W25A 1FOBA 2XVLA 1SMDA 2FGLA 2FHBA 1ITXA 1E43A 4MNKA 1CIUA 3UG4A 4W5UA 2WZIA 1J0IA 2QPUA 1EDQA 3W0KA 4UOJA 1FA2A 4AIOA 3FHAA 1H3GA 2CCRA 2ZXQA 1XCXA 2FHCA 2YBUA 4U2ZA 5JUVA 1E4NA 1W3HA 2Y4SA 2V3DA 2NT1A 3O6AA 4N0RA 4J3TA 5E6ZA 3CO4A 5FL0A 3GH7A 2XFRA 2PWHA 4UNIA 1ISYA 1VFFA 1WAWA 2BXZA 2D0GA 1JZ3A 4DWSC 4J28A 2YLAA 1UHVA 1ECEA 1GVIA 3OZPA 1H4PA 1UUQA 4Q22A 4MAVA 1ZBVA 3WELA 1NM9A 1WDQA 3ZIZA 2XM2A 1E4LA 5FL1A 3ZSSA 1GCYA 2J7DA 3VIFA 2D24A 3SCPA 3PZTA 4AD0A 3O2LA 3WD0A 1UKPA 4E4PA 1QHZA 1ZJBA 4BCEA 4JKLA 1PJ9A 1KXQA 2PI6A 1B3ZA 3OLGA 1UH3A 1W1VA 5KZ6A 1ZBCA 1JFXA 4BQ5A 1E6ZA 4M56A 1C92A 3O9NA 1BYAA 3DYMA 3HMCA 3AQUA 1VIWA 4U2YA 2WZEA 1QI5A 3UETA 2XIBA 1TVNA 1W9VA 2EPKX 1CGTA 3MUZ1 4LPCA 2PWGA 2VR5A 1GONA 4PCSA 4JAWA 3CMGA 3I3EA 2GK1B 3MS8A 1JAEA 4X0VA 3L4YA 3WNPA 4UR9A 2WK2A 4ZEPA 2G3NA 4TX6A 4HU8A 1WPCA 1HNYA 2QV4A 3VGGA 4AZ5A 4EKJA 1SFSA 4H04A 1JDCA 5A8QA 1KR0A 1EA9C 4XZBA 5AY7A 2XPKA 2AMGA 3WMSA 1JZ7A 4CVUA 4PMXA 2E4TA 1OT1A 1RD6A 2EQDA 3VD3A 5GNYA 4PN2A 1MQQA 4H41A 4QCEA 1QI3A 1VEPA 2DQXA 4FLSA 3ARXA 5ECUA 1XYZA 4NSBA 2WVVA 1BYCA 3RM4A 3VD4A 3AROA 3WF2A 1QBAA 1JZ8A 4DM2A 3KL0A 1KXTA 4MNMA 3SCQA 5A8OA 4IISA 1MFVA 3WBAA 1WO2A 3BSGA 3LPOA 1VBRA 4OJYA 1BGAA 1V3MA 4KGJA 3WEZA 3FN9A 1M01A 2BHZA 4HPGA 4JKMA 2CKSA 3T2QA 3UR8A 1GOKA 2ZWYA 2DEPA 1UKTA 4PCTA 4DWSA 1EHAA 4XB3A 2DH2A 1XSIA 4LQ1A 1W9DM 1CGYA 2J47A 1K9FA 3VIMA 1W2VA 4P8XA 2EPMX 1H0GA 2E9MA 1UD3A 2A3AA 5JIPA 4FLOA 2VZTA 1NWRA 2J8FA 3VPLA 1HN1A 1HJXA 3ARSA 5A3HA 1V3LA 3DYOA 3LMYA 1WNOA 1HKKA 3ARYA 3T2OA 3SURA 2PWDA 1OGBA 4PMNA 1HJWA 3EDDA 2WC3A 5A2BA 3PN8A 2VRKA 1GJUA 4W7VA 1HVXA 4K68A 2OYLA 1HJVA 4HOZA 1EOKA 1TCMA 1XCWA 3N11A 1XV8A 5AC5A 1DP0A 1KBBA 3T2PA 1B9ZA 1JI1A 2XVKA 3W81A 3J7HA 1HF6A 2XM1A 8CGTA 1F4HA 2VCCA 3QHMA 3KL5A 1N82A 5HXMA 3AMCA 3AS2A 4OBRA 4L4PA 3ZT6A 2DSZA 1KGUA 1XD1A 5ABFA 4JFVA 2DT3A 4LYPA 1E71M 1UYQA 4R5EA 2XSAA 1B3VA 2WKGA 4MADA 3LPFA 3GH5A 4XV0A 4CGTA 4UQCA 3OGVA 3KL3A 1CXIA 2VT0A 1R7AA 4WJXA 1HT6A 3T09A 2JF6A 1HJQA 4W86A 4UFJA 2E9LA 2G3IA 1J18A 2GDVA 1IV8A 3VIKA 2BY3A 5A6KA 2EXOA 1GQJA 4QDMA 1QHPA 5F7UA 3TOPA 4AIUA 1E1EA 2Y2WA 1GQKA 1CXHA 5JBEA 2G8ZA 3WQ5A 2EBNA 3ZO9A 3DHPA 1CTNA 4AZCA 4M8UA 1B0IA 2Y5EA 3FAWA 3CUHA 1W9BM 1A3HA 3EMCA 1V0LA 1OB0A 4TX8A 3HJEA 3KZSA 4OZOA 3VIPA 4UTFA 3T0BA 5EMYA 1MW1A 4DWSD 3EDKA 1UR8A 3WNLA 1FHLA 4Z2IA 5LA0A 2J7HA 1B3YA 4LYQA 7CGTA 3K1DA 3ZR6A 3B8SA 3ZJ7A 4AZGA 4HZ7A 4AWEA 1QOXA 2O9TA 4D1IA 2TAAA 3L4WA 2ZX7A 3WF4A 3QGVA 4KH2A 2WPGA 1CXEA 2BS9A 3GBDA 2VUYA 1TA3B 1CEOA 1KCKA 1VBUA 2VVSA 3VX0A 1CWYA 1H11A 4YPJA 2JIWA 1IT0A 3VX1A 1J11A 3WD4A 2J7GA 2WWDA 4GQQA 4MJ4A 2ZXDA 3ALFA 5AC4A 1U30A 2J78A 3AHTA 1KFWA 2BY2A 2E3ZA 5IFTA 1W1PA 4TTGA 2XWEA 4D6EA 1RP8A 3NIYA 3VGDA 3POHA 1NARA 4MJ2A 5CG0A 2Z1KA 2XFYA 2D22A 1A47A 1KXVA 2IXVA 1EQCA 2YL6A 4W88A 2XVNA 1HP5A 1O6IA 1GZJA 1QI2A 2X09A 3FXYA 5ABGA 3RCNA 4OUEA 1KBKA 1CBGA 1M53A 2JEQA 4JFTA 1TZ7A 5A6SA 3RILA 3NYDA 3OGSA 2ZUUA 1QBBA 2G3JA 3FAXA 1SMAA 5E09A 4CU6A 3BSHA 4CKQA 4OBSA 1E70M 1E9LA 5LA1A 1DWIM 3M6DA 4WKFA 4IUGA 1MW2A 5FKYA 3GYCA 3VVGA 3AYSA 1JIBA 2D0HA 4YHEA 2EO7A 1YQ2A 1PIGA 4M1RA 1ODZA 4OKDA 1DTUA 2VQUA 5HNNA 3IK2A 1HKMA 2CEQA 3K4DA 5HDRA 1E56A 2O9PA 4CUCA 4AZCB 3ZM8A 2PBGA 1JYNA 2VX5A 4LGXA 3RM8A 5GNXA 4UFHA 2VI0A 2YL9A 3CPUA 1TE1A 1UR9A 4TXEA 5I24A 3FNDA 2ESCA 4Z2LA 3BAJA 3SUWA 4GO9A 1ISVA 1JI2A 4C7FA 1GQLA 5DFAA 4D6HA 1NWTA 4UZUA 3WUFA 4MAZA 3I3DA 3ZOAA 5A6LA 4KWUA 1XYFA 5I77A 4D6JA 3T0AA 1UZ4A 3L4UA 2BXYA 3AXIA 1ZL1A 5BYWA 3VU2A 3L4TA 1YHTA 1CZ1A 2YJQA 5BXTA 3RDKA 3WD2A 5I79A 3N1AA 1TA3A 5E9AA 3BCFA 1GHSA 1MW0A 3T0DA 3W28A 1M03A 4NI3A 1D7FA 1WKYA 1JXKA 2VR4A 5IXEA 2WM0A 2CBIA 2WCSA 1V02E 3APGA 1Q6GA 3IJ9A 1E5NA 3WH7A 2G3MA 2ZUVA 1W3LA 2WB5A 2PWEA 5A8PA 2O9OA 4H7VA 4UFKA 2ZX9A 4AD4A 2J79A 1J12A 3VTRA 1LL7A 2W4XA 4GO8A 2W61A 1Q4NX 3IAQA 4A3YA 1UG6A 3VGFA 1GJWA 2WVUA 2V5DA 1VENA 1GVYA 1MYRA 5FD0A 1OWQA 2DT2A 3EDJA 3QR3A 3TONA 4F9DA 2X0HA 4FLRA 1EO5A 4WIWA 3ALGA 4U5KA 4W93A 1EDTA 3SCSA 4BF7A 2WVTA 5DT5A 1V3HA 1Q6CA 2J7BA 1UR0A 3A4XA 4DUXA 4Q7NA 5HOSA 5CGTA 4UQDA 1E15A 3TA9A 1B3XA 2W67A 4OIFA 3WSUA 1JD7A 4J27A 3MUIA 4B16A 4J3WA 4ACZA 2G4FA 3VDCA 3GXDA 1KQYA 4V27A 3WQ8A 4U3AA 5HBFA 1Y7VA 4FMVA 3UESA 4CCCA 3A6OA 2JF7A 3UG3A 1O7AA 2D3NA 2JE8A 2ZWZA 4W8LA 4JKKA 1TG7A 4YN5A 4AYSA 2YKKA 3A3HA 4AZBA 1NOWA 4XUYA 3CHCA 5A8NA 2J77A 1UQYA 3MMUA 1JNEA 1PZ2A 4MNJA 2VX7A 3SUSA 4J3XA 3VNYA 1C7TA 3WIJA 2D1ZA 3KWXA 4LYRA 4PSPA 3PZVA 3L4ZA 2WMIA 4MB4A 5A6JA 5I2UA 2DSVA 2YA0A 1C93A 4UOQA 3EDEA 1I75A 5DO8A 1QW9A 1V0NA 1C3FA 4RE3A 1R85A 3GH4A 2YLLA 4AXNA 1HL9A 1J0HA 3MMDA 5FIPA 5EFFA 1XH2A 4FK9A 4QFUA 1H41A 3PTQA 2DH3A 4B3KA 3SCVA 5BRPA 2V38A 3OLIA 1UZ1A 1B1YA 4PSRA 3EDFA 5IFPA 1MQPA 2GJXB 4D1JA 2WXDM 2WCGA 3TTQA 1V6XA 3ZMRA 2YDQA 3BMWA 1BGGA 2DPEA 1W9PA 3U7BA 3AHVA 3WENA 2VZSA 3CMJA 1DWHM 1OSEA 1VJZA 4W8AA 1LWHA 4S3KA 1AVAA 4UQ9A 1XC6A 5EFDA 2FDMA 3I3BA 4QCFA 2EEXA 1PX4A 4F8XA 3PZUA 3K8KA 4A4AA 3GDBA 3ZT5A 4CD6A 1V6WA 3WD3A 2BVYA 3CH9A 5DMYA
chains in the Genus database with same CATH superfamily
3L4XA 3G24A 1W3JA 5T26A 2OZTA 4R7WA 1KCZA 4DNHA 2ATSA 4JCLA 5HNUA 3FYYA 3CZEA 2GK1A 3MI6A 1AQMA 5AVNA 3KX6A 4O0ZA 3RJXA 3M7WA 3RJYA 3GXFA 1XIDA 3CQHA 1NDZA 5C8BB 3WEOA 3CWHA 1T8QA 1VHNA 1PPIA 5C2GA 1TO3A 2WLYA 3OHIA 1AH4A 1QI4A 3VOIA 4B5WA 4PCFA 1WKFA 1GKRA 1F3XA 1LG1A 4WRHA 3GFYA 3W6LA 5D8ZA 1MZRA 3WJWA 3T42A 1AW5A 3UF9A 1RZMA 3R5EA 4FNUA 1CI1A 1UD6A 4H7ZA 1FWJC 4M7SA 3VIIA 4AZIA 1OBAA 5FJTA 3O05A 2WCAA 2CXGA 3UCQA 1REQA 1A0DA 3OBAA 1WQ5A 3TTOA 2ZBTA 4TVDA 2D2OA 4ACYA 3VGHA 1TB3A 3FHQA 4DJEA 3ABXA 1A49A 3LRMA 3VNKA 2A2IA 2GQ8A 2O4QA 1W1ZA 3R25A 4D9PA 4QLLA 1QOQA 1NFPA 1T6MA 4B91A 4NYUA 1CYGA 2EKGA 3UZXA 3WK2A 4E3TA 1LWJA 3HG4A 4ROQA 3K46A 3DXIA 4X22A 3B0YA 4UTWA 1FWNA 3V1PA 4KCUA 2GPTA 3TYAA 1R87A 3DFYA 3QYQA 5LYRA 2DZAA 3WQVA 2ZZ5A 3EX3A 3BICA 4Q32A 2W66A 2BX7A 2J6VA 3W29A 3HG2A 2WMHA 4I5XA 5I07A 4M1BA 3DG7A 4M81A 4WY0B 4HOWA 3CHVA 3WDQA 8RUCA 5C70A 1NSJA 4XZ9A 1QPNA 4KRZA 2HPMA 3BCDA 2C3ZA 2XFFA 3WUBA 4LY4A 4DWDA 1Q65A 5F4XA 2FVLA 4UOZA 3L23A 2QPXA 3ONBA 3Q2DA 3L2MA 3T8QA 1HL2A 3SDOA 3R2GA 1M9HA 3ZWSA 2QJMA 3KOYA 3GY1A 1GNXA 1JDEA 5HA7A 1DIDA 3R58A 1MDLA 1UD8A 3VDBA 2PTDA 4IXHA 3ZLHA 4AY8A 1DE6A 3PC0A 3BGGA 4CVWA 3GAKA 1OYBA 4P5UA 3MUAA 3PB0A 1C91A 5D4YA 3B04A 1NWUA 4RL3A 1IGWA 3HTWA 1CPUA 3VUPA 4DJFA 1X6LA 4NL1A 2QMJA 3NQGA 1WB0A 4UFIA 2OSYA 1QNSA 3WDJA 3WKZA 1BTCA 2F2HA 1HP4A 5JBDA 1EWDA 1R47A 1KA9F 4PEEA 1WE5A 3FJ6A 3JVAA 1H1ZA 4U10A 1G4PA 4ZO7A 3TZNA 4PTVA 4M5PA 3DERA 1EH9A 1DIEA 4S3GA 5I78A 1IEIA 1UA7A 1J0JA 3K8MA 5H6HA 3MKKA 4OFCA 1RA0A 4FLQA 4CQDA 5CZJA 2ISDA 4KS0A 4ACZB 4WF7A 1XLDA 5T9BG 2WV8A 3WNOA 4DY1A 2OSXA 4MZYA 1YBQA 3STCA 2QVNA 3O1NA 2C91A 3OA5A 4IP4A 3USZA 3UY8A 3W1TA 4EAMA 4GCAA 4PMDA 3UR5A 1GGOA 4EXAA 3GHUA 1BAGA 3TCEA 2E8YA 3A47A 4A22A 2BFGA 4L64A 4QS5A 3TTYA 4KEZA 3TROA 2Q3RA 3M0YA 4WDWA 3AFBA 3B0UX 1X7FA 1PDYA 3QSTA 5DLCA 4CQ9A 1DEDA 1HIZA 1Q6FA 1XHGA 3WLOA 4Q3MA 4GFSA 4CD7A 5FJUA 3VXGA 5A95A 1H51A 1W3IA 5CPNA 1Y65A 3DBNA 3ZVIA 1XIHA 1J4EA 1J5SA 1Z7AA 2REQB 3W88A 2CFFA 1XIGA 1KWKA 4RE2A 1FFQA 2PB1A 3S4TA 3AS1A 5BMXA 1G01A 4J9JA 1EDGA 3CZKA 1B30A 1DYSA 4LT9A 3ZS4A 4W7WA 1ONEA 1J96A 2BBFA 3AMGA 4L80A 1XJBA 1PX3A 3UPMA 3AICA 1BD0A 1RLCL 3DU0A 4YWIA 2CXEA 3SECA 3XISA 3A4JA 4M3PA 1ADOA 1MQRA 5GPRA 4HMDA 4IP7A 4J7RA 4R34A 3BE7A 3UT0A 1E5JA 3CNYA 1OGSA 4CEXC 3DG3A 2E7FA 3GXTA 4BF5A 3FEQA 2FPYA 1JL8A 1MEWA 4UTWC 3C56A 1TPEA 1TMQA 3TX9A 4H6RA 1XLAA 1X98A 3C2RA 2BVDA 1ITCA 5D02A 1TPUA 2VOMA 2XZ7A 4DPQA 5HQEA 1NOFA 4XSMA 3LRLA 2MANA 1TJ1A 3TTSA 4AU0A 3VM7A 3N9RA 1GPFA 4JEJA 4Y8FA 5ABTA 1R8LA 4ZB0A 3AJ7A 3EXTA 4M19A 1F9CA 1HQTA 2FGZA 4XZHA 5CSUA 2E1WA 2R1NA 5D04C 5AYBA 2R1MA 1XRFA 5KTLA 1KW1A 3BH4A 1KTBA 3SCOA 3L5AA 3CQJA 3LQLA 1H5YA 1EF3A 4GACA 2XG9A 3KCJA 1KNWA 2C7FA 3VOHA 1XIBA 3DI1A 1LJYA 1A5OC 4KEMA 2Y8KA 1V6UA 2ON3A 3SM0A 2NXIA 1G67A 1MEIA 2OT1A 3SY1A 4W5ZA 4G7EA 4MGGA 1I9CB 4QROA 4CD5A 1RQHA 1OHLA 3BPWA 5DXYA 2BVTA 3ZT7A 2PF0A 4ZXLA 4A8NA 1R3WA 1MVYA 3M07A 1A50A 3IVUA 3CV7A 2Q8LA 1JZ6A 5GNZA 2J66A 3FYOA 2Y7DA 3NJ3A 1IXOA 2WHJA 4J3SA 4QEEA 9XIMA 2WSPA 5I3JA 3S3GA 4AW7A 3W26A 1IT7A 4E2BA 4D6DA 4W8BA 3W24A 4X9YA 4UQBA 3U0HA 3FCPA 3U5YA 2FGBA 4AZ7A 1W1YA 2XISA 4GNVA 1LLOA 4KEVA 1XGDA 5CPOA 4A2RA 1YE4A 4DUWA 3MJMA 1XKYA 4G7FA 4JIIX 5H91A 4JL1A 4AD5A 4F4RA 3SRDA 1KM3A 4UZSA 3GHTA 5KZDA 1F07A 5CSYA 1H7PA 4HNVA 1MZHA 4IFKB 1U1HA 3QV9A 2PUZA 3U57A 4LJ3A 3OLEA 1VFHA 4PTNA 2YDRA 2YXXA 2HBVA 2WW5A 4B4FA 1H1NA 4D6GA 1OCQA 2VX6A 1ZTVA 2RJHA 5G4EA 3ITCA 4LRSA 2XGIA 4C5YA 1EJWC 4NKCA 1U5JA 1KGXA 5TD4A 3YPIA 1IYXA 1FCUA 2I16A 4LS1A 1NELA 3MANA 3KHJA 1ISXA 4CNNA 4GI9A 2BGSA 3RO6A 4H01A 5DANA 4IIDA 3S5ZA 3TKFA 4AZHA 1YTEA 5A6BD 4IIFA 5AYZA 2YYUA 1PX8A 4ZOAA 1OVDA 3MSYA 3THAA 2OSWA 3B03A 1BEUA 2O56A 4JL2A 1OFAA 3LCLA 3GHRA 3GNPA 3OJGA 5H1WA 5AN7A 1HKIA 5LGXA 2X1SA 3VKDA 1FXPA 3VMOA 1OK4A 2XSBA 1DJHA 2GDUA 3LSBA 4FO4A 4LF1A 1VFSA 3SY8A 4EE9A 3UWVA 2IKHA 1AJ2A 3EMQA 4JIRA 5F1VA 2ISWA 2ASHA 2GQ9A 1ZS2A 5LIWX 4QLJA 3WUEA 3S9IA 4AZ6A 4Q8VA 2HWGA 3LCGA 4XBJA 4IMCA 1XRVA 2JGYA 3IVTA 1E4IA 3UZZA 1AQFA 5AFDA 2VO5A 2F84A 4W4QA 3N18A 2RKXA 5FACA 3THDA 1DJGA 2P8CA 4S3CA 3N25A 3PP7A 1TWIA 2VCBA 3W73A 5CGMA 3WH6A 5DCDA 4Z1BA 1P43A 4O19A 3WLSA 2G97A 3V0TA 3BC9A 3EZ4A 2RGLA 4B9ZA 4E4FA 1E6QM 1JAKA 4S1FA 4DZAA 1QPKA 2CETA 4WUIA 1O94A 2FTPA 2F8QA 4WKAA 2OWXA 2YW4A 2BV9A 3GTXA 5CAKA 1MRQA 4PFHA 4LVGA 5FF0A 3GBEA 3PZQA 3QBUA 1OYAA 4S3FA 1DHKA 4BA0A 4F9JA 3W7EA 3Q45A 3UXLA 2OEJA 1QWGA 1V7YA 1V7AA 2R6OA 3LHVA 2GJNA 3SQLA 1G5AA 3WK0A 3W2JA 4O17A 4AAJA 1GQNA 3AHXA 4DYKA 3ARZA 3BWWA 3PG8A 2YBVA 4Q4PA 3K5XA 5A6TC 3CS2A 1A0EA 4YHGA 4XAZA 3BV4A 4EK7A 2ZX8A 1V6TA 3L7RA 1EA0A 3Q37A 5C2XA 4PULA 4BKNA 2GGEA 1C8XA 3R8HA 1Q63A 2X41A 1E6PA 2OLHA 1POKA 3ERPA 1E6SM 1JRCA 4IGSA 1FWBC 2E6FA 5BRBA 5AYIA 3N15A 2FH8A 3E2SA 2PDJA 3OVQA 1XBYA 3MP3A 5D9MA 4HD5A 4K1GA 1R9ZA 3STGA 4FOJA 1I0DA 1FWEC 1SFLA 3V7PA 3OGRA 3F4VA 5CJ5A 4WLCA 2DSUA 4UNKA 2QJIA 3HG3A 2FIQA 1P5BA 2F38A 4WSJA 1V0MA 4R53A 3NYZA 1ZJHA 3VDGA 2E5BA 1UOZA 1EBHA 1A0CA 1D3GA 3W82A 5F1UA 4GYJA 3KBNA 2HQAA 2CESA 1F4AA 1K9EA 1YADA 2VURA 4XAGA 3WQ6A 3N3MA 5LNWA 2YA1A 3QPZA 3QKEA 1X7IA 3N17A 2V6AA 3N4AA 3H2EA 1XM3A 4GRSA 1L6FA 4GC3A 1MEHA 2FVMA 2GVEA 1DWAM 1R2SA 2W92A 4UTJA 3SUTA 3T1GA 1VPXA 3AHZA 1XLBA 3VIJA 2P50A 2GVYA 1KWGA 3KDOA 4H8UA 2D0FA 1EYWA 2DIEA 5C9WA 3DECA 2O7QA 5DMNA 4LC6A 3NQMA 2HNEA 1GORA 4LW7A 1I45A 1Z41A 3NQAA 3WMCA 1ZPTA 2V9DA 3QGKC 1BFNA 3GFZA 3TSMA 1TTPA 3ABZA 3EMZA 5T91A 4O57A 3GTHA 1I1WA 3T78A 3GZ3A 2ZIDA 1Q7ZA 1VB9A 4REQB 3S6TA 3CIXA 1RY8A 4KMQA 1OX5A 2BY1A 2VL4A 3W01A 4C91A 4V28A 1K70A 3D6NA 5GJMA 1BLIA 5J5DA 1MMFA 3C86A 1JULA 3UVIA 4WSKA 3CL7A 4TTUA 2IXUA 4QSHA 4MB1A 3MUY1 5G2HA 3O6CA 3PANA 4J40A 3DCPA 1PKNA 3RITA 3WQ4A 1DQWA 3GZAA 1HGYA 1PWLA 2CHNA 2PDQA 2RDTA 3CT2A 1CDGA 1YKWA 3MCMA 3MMTA 3MY9A 3EX6A 1F05A 2E9BA 3S47A 3VM5A 2QF8A 2BOFX 1V03A 4WOZA 3NVTA 3NDYA 3N2MA 3VFLA 3CLMA 4O53A 1RBAA 4CQ8A 3LV5A 4P7OA 4IQDA 1V08A 4JTLA 3TJIA 4W84A 4JHZA 4JIEA 4Q8UA 3FGCB 2I9EA 4A8LA 3II1A 4LNCA 1TX0A 2HE8A 2J4GA 1T40A 2ZUTA 3TNOA 4E8GA 3VDAA 1BXCA 2R1KA 3ZJ6A 2EPOA 3NZQA 2X2YA 3WD1A 3WLNA 3ARUA 3EYPA 3DGRA 1G9HA 4YXGA 5A1AA 1RLDA 1RJPA 2VRJA 3HGRA 2ZVRA 2IKJA 4PR4A 1W3NA 2QUTA 4Q8WA 5ABFB 4LBSA 3CYVA 2GJPA 4KCTA 3T81A 3LHUA 4LAMA 2G50A 4IPNB 2DT0A 4US6A 1FHDA 3TEVA 4S3JA 4YS1A 3GVRA 3WQGA 1PAMA 5HNRA 4PMZA 1RBOB 4GYFA 2H90A 2XVLA 2NVDA 3BOXA 2I57A 3HF3A 1ITXA 5BOOA 4MNKA 3P5ZA 3RCYA 1LRQA 3E0IA 3O07A 4JNYA 2HDJA 3CTLA 5FI8A 4AIOA 4ZOBA 2ZXQA 5AC7A 1XCXA 3RRXA 3DDMA 4BI6A 4JTJA 2UV8G 4B92A 5GJPA 1ITQA 2NT1A 4O0KA 4GOAA 3O6AA 3CO4A 4XISA 1Q66A 3M0ZA 2PGWA 2XFRA 1G7UA 1T41A 2PWHA 1ISYA 1OFBA 3S0CA 1WAWA 3CAWA 2QEZA 1SFJA 4J28A 1MNSA 5CC7A 1JCTA 3COTA 3OZPA 1LOLA 3F2BA 4Q22A 2PDNA 3CT7A 4MAVA 2QCGA 1T0OA 1O66A 1VCVA 1NM9A 5LIYX 3DESA 2AAMA 5FJOA 3UZYA 4DAFA 1GCYA 1S2AA 3RX2A 3VIFA 4EAYA 4L1WA 4MJMA 1EX5A 4QRNA 3GE7A 3O2LA 4B2DD 4WZHA 4H9ZA 2J8TA 3FDGA 1KRMA 5AHLA 4M6UA 2VFFA 2J13A 4MLRA 3OLGA 5M1TA 1JFXA 4M56A 1TZZA 1BYAA 2CWXA 3HMCA 3AJXA 2V0TA 2R24A 2WZEA 7REQA 4LY8A 3VE9A 3MUZ1 4JYEA 1R3SA 2ZRYA 3O7UA 4JAWA 3I3EA 1I0BA 3NA8A 2X16A 3WNPA 1OJXA 1LROA 1PB0A 4TX6A 4RCXA 1NFBA 4QDWA 1HNYA 4PUUA 1AFSA 5A8QA 4H04A 1JDCA 4JICA 4Q8MA 5FESA 1KR0A 4BWLC 1UJPA 3PBUA 3WMSA 4B5VA 4J3ZA 2XU2A 5G5IA 4CVUA 2QW5A 1H60A 4IJBA 3FIGA 4HTBA 1QASA 3TW6A 1D8WA 4H41A 4QCEA 4K36A 4G8TA 4GNJA 4TR9A 3FVMA 1EP1A 5BOEA 1XPGA 3LI1A 1S38A 1JZ8A 3NZ1A 1BKSA 2O0TA 3WG6A 3KL0A 2VGIA 1KXTA 3DH7A 4MNMA 2NVCA 4GYPC 3KLLA 3WBAA 3LPOA 1XW8A 3N73A 2JQXA 3QF0A 4KGJA 1GPWA 4HPGA 1WOBA 4C6MA 5JU6A 3SW6A 4JY9A 3UR8A 4PCTA 3S46A 1XSIA 1RJRA 2H8ZA 2PC4A 3CO8A 4KFPA 1K9FA 1W2VA 2QDHA 4AHPA 3UG8A 3H4XA 4E2VA 5A3HA 1HKKA 3ARYA 1FWCC 5HUOA 4OV9A 3EDDA 1EZ2A 2Q09A 3PN8A 4M7TA 5A2BA 5DRCA 4FEZA 1KFJA 4HQVA 1HJVA 1UBPC 1FBAA 3N11A 2A3LA 1JEZA 2VFGA 1JPIA 3B8IA 3W7GA 2NV9A 1JI1A 2XVKA 3M0MA 5LGZA 1HF6A 4LEFA 1VR6A 2VCCA 3B05A 3LD5A 3KL5A 1XL9A 3BW2A 3AS2A 3U4AA 1SQ7A 4OBRA 4MYAA 2CZFA 2X1TA 3ZT6A 2Y8UA 3BGJA 1XD1A 5ABFA 4LYPA 3TMQA 3TWBA 1CT5A 4WHBA 4K6AA 3LPFA 3O6YX 5I3GA 4GBDA 3T09A 2QJNA 3PJTA 1IXPA 3NQ8A 4IX0A 3H2FA 3VIKA 1GQJA 3KRSA 4QDMA 3E12A 5F7UA 4FZIA 4AIUA 2H3DA 4B90A 3CV6A 1CXHA 3ANYA 5CZTA 3ZO9A 2Z4GA 4M8UA 2OO6A 2EAWA 3CUHA 1ZALA 1V0LA 1OB0A 3KZSA 4UTFA 2EPHA 3E5BA 4DRSA 3GHSA 2C79A 3S5OA 3MHGA 4RUBA 5LZLA 5CCZA 1KM6A 1AW2A 2ISFA 3UZWA 2V5JA 3GNDA 3R8RA 7CGTA 4IH3A 3NZGA 2O9TA 2FZNA 1XLGA 2AMXA 4NZJA 3LTPA 4DJFC 3QGVA 4JQ1A 4D2JA 4KH2A 4GQGA 5MKGA 2VUYA 4FPSA 1TA3B 1FHVA 1K77A 3V36A 1LDCA 1H11A 1XF0A 1XKJA 2JIWA 3VOJA 4Y9NA 3C5QA 4DO5A 2C18A 1OC6A 2F6XA 3VZZA 3STFA 2ZXDA 1P1MA 2DZVA 5U4NA 5AC4A 1KFWA 4O14A 1W1PA 4TTGA 2XWEA 2QCHA 3HPZA 5FJPA 3VGDA 5LNVA 4XZLX 3V5CA 2Z1KA 2PGRA 3N2CA 2IXVA 3TSBA 3W00A 1XFCA 1O6IA 1PHWA 4ZO9A 4C5ZA 2X09A 2Z26A 1T7LA 3FXYA 3LCWA 3ANVA 1CBGA 3QFEA 4ZSTA 5JMUA 1TZ7A 2BVWA 4S3BA 2BOEX 3EKGA 1TYGA 3OGSA 4BR1A 1KBIA 3NL2A 4MY8A 1NEYA 4CU6A 3C3NA 1IWPA 3MI3A 1QK2A 4X61A 2EG6A 1DWIM 5B7ZA 3LM7A 3VCCA 1PIGA 3WK3A 3HPXA 1ODZA 2VQUA 4XKYB 5C9XA 1E56A 3N3TA 3ZM8A 4WGHA 3BMXA 1JYNA 4O1DA 4RJEA 2YL9A 1UR9A 3PPGA 4TXEA 5I24A 3FNDA 1P0NA 4KWWA 3GKFA 1AJ0A 4C7FA 1JI2A 1GQLA 4MAZA 3ZOAA 5H8UA 5I77A 2HBXA 1LZOA 2NWSA 2OPJA 3FSUA 2VFHA 3E49A 3VU2A 1YHTA 1RVKA 3NPVA 3RDKA 3WD2A 4C1KA 1TWWA 4PRTA 5I79A 1A80A 3BCFA 3MA8A 3TYUA 1M03A 1JXKA 5IXEA 2WNNA 1B5TA 4UIOA 2O55A 1Q6GA 4Z1AA 1AUSL 4HSHA 3IJ9A 3I6RA 3NOEA 3SGUA 3M5XA 1W3LA 3S83A 5HWJA 2PWEA 4DBWA 1TIWA 4H7VA 4MFEA 1K7XA 1J12A 3A9BA 1RCXB 3LA4A 2YB4A 1LL7A 2Y5SA 4GO8A 2OR2A 2Z1BA 3IAQA 3VGFA 2V5BA 3B9NA 4MIMA 1GJWA 2WVUA 3FV9A 4ZTYA 4RXGA 1EJXC 1YDYA 2LLEA 2E1DA 3R0KA 2VGGA 3TN5A 3TONA 1EO5A 3RYSA 3TE9A 3S1UA 2PCEA 3AYVA 1V3HA 3A4XA 4L9XA 3IIVA 1UUOA 1TV2A 1J5TA 4UQDA 1E15A 3UWQA 2WJDA 3TA9A 1B3XA 2W67A 1I2OA 3SY5A 3AUJA 2QJJA 3MUIA 4YWSA 4J3WA 4ACZA 5IBXC 3VDCA 4C6EA 4V27A 4FMVA 1IWBA 1KM4A 2W9MA 4RR4A 5FJRA 4IMEA 3UZJA 1TRIA 2ALRA 5LKYA 1O7AA 1UPPA 3NNTA 2D3NA 3N2OA 4MYXA 3QZAA 9XIAA 2PTXA 1Z69A 4J3XA 4PSPA 3PZVA 1PDZA 3L4ZA 1UB3A 3BO9A 1NIUA 2Z1WA 3LYEA 3MYOA 2REQA 4RE3A 1R85A 2H9AA 2YLLA 1J0HA 4H9TA 2XH7A 2FJKA 4HT3A 4FHAA 2ADAA 3MC5A 6ALDA 3QZ6A 1UZ1A 4WXYA 1B1YA 4PSRA 3C2FA 3EDFA 4A3RA 3CUXA 2XFWA 4DJED 5CH9A 1YYAA 1VC4A 4GJJA 4GFIA 3N14A 1GYNA 2VD9A 1IWAA 1Z9AA 4A29A 1UMLA 5AC6A 1VJZA 8XIMA 4M6PA 4XO6A 2DW6A 3AWOA 2EEXA 3URQA 1YEYA 3SRHA 4QJ1A 2RHGA 3WJXA 3THUA 4WVXA 4WY0A 3LI0A 3QQ1A 4CD6A 3CH9A 2ACQA 1IZCA 1E6XM 3ITTA 2R9RA 2NX9A 2X05A 3TCSA 4C60A 1S3TC 4XD6A 2X7WA 3C52A 2VVNA 3GNRA 3SGGA 3ENLA 5EMJA 1PL9A 3UPWA 3WDPP 2PDIA 1DV7A 2IPFA 1JPDX 5M17A 3G1DA 4EF9A 3LCFA 3BJSA 1JJKA 3VE7A 1E1CA 2WMFA 1US3A 1JZ4A 1F73A 3NQBA 3AU2A 4JQ4A 2GQ3A 3AXHA 3TYZA 3K4AA 2DDXA 5DY3A 3SIMA 2WNZA 1W5QA 1K1DA 4POCA 5AYXA 2D2JA 1GEQA 5CPTA 3DOPA 4C6BA 4I9TA 1ZBKA 2RJGA 3VGBA 1JCMP 5CPLA 3GNNA 2E68A 2NQJA 4O15A 2HXUA 5KETA 4QR6A 2H6RA 5CZ0A 3TN3A 3UA4A 1W9XA 4B5SA 3EXRA 1M6JA 4KPLA 3LK6A 3QMRA 2C71A 1MDRA 4GUFA 4GIRA 3OB8A 5JIWA 2HEJA 5CKSA 3VFCA 1UR2A 3CMFA 5BXRA 4ADTA 1S46A 3V5OA 4ZA0A 2V3GA 2ZZ6A 1XI3A 1R6WA 3I6EA 4JDYA 4PEKA 1LUCB 2VQTA 5IHSA 5HR7A 3VGEA 2V5CA 1XIIA 2PGFA 1HZYA 3PJUA 4JX5A 3N6QA 4TVUA 1JG9A 4JYFA 2C0AA 4M0XA 1V3KA 1AL7A 3GDTA 2QHAA 3DEQA 4Q8NA 1J6OA 4W9TA 3RPMA 3T9PA 1WP6A 3KS5A 5I02A 5HINA 4X0NA 5DEZA 1BWKA 3ZVHB 4L6DA 4PUEA 1IEVA 2A3CA 1WZKA 1A3WA 3QRHA 3B8VA 1PSCA 3NOYA 1JNDA 3MCOA 5C9RA 1XUZA 3EXSA 2WBKA 1KV8A 3BLPX 4LBRA 5C2CA 4QE5A 1OIFA 1ZAJA 3PPFA 2OGYA 1H5VA 3LHZA 2QULA 5LHFA 5FF7A 3B0XA 4C6QA 1KGWA 1G0CA 3MUXA 1ZCCA 3I68A 1UR1A 4GD0A 2IQ0A 3KRUA 4A3QA 1S5TA 3CHFA 4JOMA 1XBZA 2PDUA 1VYPX 1D3CA 3PY2A 1RPKA 1TTQA 4O18A 5HATA 1FDZA 4JYDA 1TR9A 1KKRA 3RUBL 4LCSA 2NLIA 1ZQ5A 2BTMA 3TWAA 1R3RA 3O63A 3E1F1 4PZVA 1TJ0A 2WLZA 1SM9A 4MKNA 1UD2A 3RLUA 3ZLGA 1XR2A 3E2VA 3OG2A 2J9YA 1BXNA 5I06A 3GTFA 3EOSA 4D8ZA 1FRBA 1WUEA 1K3UA 2DSWA 4ORMA 3CUGA 1S39A 4FX6M 4Z0JA 1PBGA 2V5LA 2ATMA 4Z1CA 2OLAA 1QW8A 5JXQA 1EFZA 1AD1A 1K7FA 3GIPA 1FHUA 4LRTA 3RIKA 4E8DA 3A23A 2VKZG 3DHDA 3PZNA 5G1YA 3F2CA 3KE0A 1BF2A 1JCXA 2ZOXA 3SUVA 3RMEA 1LUCA 3RM9A 5CPSA 1DQXA 3PR2A 3W83A 5D9NA 3SEPA 2QKFA 3BLFA 5D03A 1OX6A 1VQTA 3N04A 3LXAA 4L4OA 3GAYA 3GVQA 3A9IA 4GYPA 3N19B 3AUOA 1DWFM 2VDIA 3GWQA 3N2TA 4AD2A 3NXLA 2WNQA 2E5DA 4AF0A 2OKTA 2VC9A 4F2UA 3WQEA 1VFMA 8XIAA 1ICQA 4NZ5A 1FFRA 2E67A 1TREA 5HAOA 1W9UA 1FP9A 4EVZA 2QVHA 4BI7A 3W70A 4ZMGA 5FOOA 3EB3A 3IV3A 7ENLA 1K6WA 4XD4A 3UJFA 2NWRA 1OG6A 4KFOA 1ISZA 3W7MA 2VFIA 4U5IA 1QJWA 1DWGM 3ARWA 1KM1A 4AD1A 2A79A 3C0LA 3H22A 4WCJA 3QGAC 2XN0A 4XKYA 5BROA 4N02A 4GMEA 1WAUA 3PUEA 3TQVA 4DN1A 3PG9A 3TLQA 1W17A 2PP1A 1FWTA 1EB3A 3RXZA 3MVIA 3RNDA 4PBGA 1JRBA 5A2AA 5A2CA 5IDIA 4P8WA 1ZJAA 2BSLA 3G3DA 4TO8A 3LRKA 1SJBA 3C8NA 3WF1A 4LXFA 4N9CA 5A8MA 4D6IA 7XIMA 4GUIA 3CUIA 3RK8A 2J7FA 1FWGC 4J35A 4Q4OA 2V5KA 2TSYA 4TV6A 5C55A 4Y9MA 4P7NA 4UTMA 1SW0A 5BWFA 3LGDA 1KC7A 1PZ3A 3BQ5A 1ZHAA 4DM1A 2VENA 2HPIA 1JXJA 3IS4A 1X1NA 4GY1A 1TZ9A 3R94A 4HMCA 3RU6A 3M0LA 5C7HA 2A1YA 4WKHA 5DX7A 4LB4A 4I9JA 1F8IA 1Q2SA 4S3DA 3DC0A 3GG1A 4YVVA 3PBGA 3H6OA 4JGDA 4UR8A 3U48A 5JVLA 1YXCA 1JPKA 4NU7A 3NGJA 2Y6ZA 3I7QA 2Z6IA 3SGZA 1OX4A 2W91A 5EY5A 3A4WA 2E40A 3W74A 1NQKA 1VD6A 3TTEA 3G6MA 1A5AA 3ONCA 4PMOA 5I5RA 2ZX6A 3QZEA 4FX8A 2PRHA 1V0KA 2PD9A 4BZYA 1IEXA 2VHLA 5LNUA 1AZ1A 1EGVA 4WJ8A 2A3BA 1VPQA 4QLKA 3A21A 4MJZA 4Y9OA 4ZENA 2QZRA 3WFLA 1Q6RA 4FALA 3EWUA 4LVDA 5EMLA 3IGUA 1H0IA 3FJLA 6A3HA 4N9DA 4MDOA 1FWFC 3VKKA 3QMSA 3JW7A 5BNKA 1SJDA 1UR3M 1BYDA 3AO0A 1S5MA 2SFPA 1OCBA 5LXXA 4TU1A 4ORIA 1K02A 4Q4MA 2NQ9A 1X8FA 1K8ZA 3OHMB 3OU8A 2VEFA 5I03A 1QPQA 4QEHA 3VKCA 1LTDA 3GG0A 2WSKA 4KERA 3A3WA 3NCOA 2VGBA 1K7EA 2OOGA 2OJPA 3HMJG 3QFWA 5JH1A 3CZJA 3FFSA 1P6CA 3HV8A 3V0UA 4ZFCA 4HU0A 3UZ5A 4RE4A 3LPPA 3RO8A 1SFTA 5A5WA 1VLIA 1W3KA 4C6LA 3GVWA 5C71A 3UR2A 4GYKA 1F76A 3PUDA 4JTTA 3QY7A 3NQDA 2R91A 1OG0A 4GLEA 3MV11 1YXYA 2HVNA 4HA1A 2YDAA 1G94A 4WQ6A 3NEVA 3PWIA 3PS7A 3KBJA 1JDFA 2POTA 1UIPA 1FX6A 2WHKA 3U6WA 2WHMA 3OW1A 4NZCA 2ISSA 1RPXA 3PJXA 2VELA 3LERA 4K2SA 4V2XA 3F7JA 1VEMA 3EKZA 1RCQA 3H7RA 3BZGA 1TIMA 4P7LA 1TWSA 2CLEA 3BMVA 3Q94A 3O8AA 1D3HA 3EKLA 3F2DA 4GK8A 3AIWA 4NZ3A 3W38A 2Y7FA 4OV4A 2G0WA 2Z27A 2AQVA 4B9YA 1OX4B 2WPBA 5D33A 3S5YA 3G5EA 2AKMA 3R13A 2EF9A 2PWUA 3QMTA 1FKXA 3C2OA 3WH5A 1N55A 3LTSA 1CB2A 3BOFA 4FP1A 3MB9A 3M0IA 4B5XA 3QY8A 1WXJA 4MSSA 1KFKA 3D3AA 1XRTA 4X3ZA 2R94A 4F40A 1DHPA 3AIEA 4ZQMA 4XTDA 4NAEA 1OFPA 3MHUA 1IZJA 3RLGA 2GL5A 4QHRA 4FNRA 3PPHA 1QI0A 1JCLA 2OG9A 3W2UA 5D2TA 5HWNA 2JKAA 3AS3A 4TVCA 3UBPC 3OA3A 5FSEC 1E73M 1FH8A 1ITUA 2VWTA 3NXFA 5FAGA 2PLCA 4F79A 1PKLA 1XFBA 3P84A 1W91A 4UQEA 1X6NA 3AIRA 4Y9PA 4LS2A 4LAZA 3LGEA 3KAOA 1HXJA 3AWNA 4QQ3A 4DJDD 2QYGA 4Y90A 4GX9A 1E6NA 2YCLB 2X0YA 1L9WA 1ODUA 3EOOA 1XUUA 2ONEA 4EWND 2VUNA 1WDPA 4K3ZA 4K8HA 3IIPA 1KM5A 4XG1A 3ID7A 1B4KA 4FS9A 5I23A 2BHUA 1DWJM 3GC2A 3B8DA 3QOMA 2HE5A 2QUMA 4DBUA 3DG6A 1J8VA 2PTWA 3SRFA 4R33A 3S42A 1OM0A 4HJWA 1RY0A 2V30A 1PCKA 2Y89A 1UIOA 4NZFA 3WQFA 3NZRA 3TV8A 3A24A 3KWSA 1XX1A 4NF7A 2QS8A 2IUZA 3QC0A 4JHOA 3PULA 5EBUA 3W02A 1NF0A 4GX8A 1QATA 5I3IA 3B9EA 2QT3A 3E96A 3C2EA 1EGMA 3CHEA 1GZ1A 2VDHA 2EPNA 4REQA 2WWCA 3W23A 3H2NA 3BAIA 3KOXA 4RDYA 4JZ5A 1LBLA 1A3XA 1AJZA 4FOUA 4GQ0A 5I6SA 2X1UA 3QM3A 1ICSA 2Y0FA 3ZYZA 1JCJA 2DZUA 1LLZA 2CHRA 4AISA 3G8RA 1XG4A 2VMFA 1EWEA 3GLCA 4Q8TA 1KLYA 1G7VA 5A69A 1VPYA 4AEEA 3M5YA 2VXNA 1FCQA 2PDLA 4LAUA 2DJLA 3W1QA 1J2WA 4C6NA 1P0EA 2OGJA 4GVIA 1E0WA 1P6WA 3G1SA 3F4WA 2J6XA 5EBAA 1WOAA 1RR2A 4P7QA 3W37A 4LU0A 4HYVA 1D9EA 3W27A 2WVVB 4HSNA 2UY5A 3W85A 4UTUA 3CB3A 4OVXA 3LSCA 4HA0A 1ICPA 5F2GA 2ZZ4A 1GW1A 1ZAIA 2FJUB 2HK0A 4XX6A 4O1BA 1JYWA 4OBTA 3SRKA 1UA3A 3ABQA 3EX4A 4Q33A 4Q4RA 4LUTA 3S2NA 2ZX5A 4L1GA 5BU6A 4BQ3A 4E2OA 3IUHA 1U5HA 3WY1A 2OEKA 3F5KA 4MZ1A 4UCFA 4PE8A 2ZXAA 3E5PA 4OTKA 3MJYA 4KIRA 2GQAA 5AHIA 3NQCA 4ZE5A 1QUMA 3P61A 3CPGA 4QTGA 1EQPA 1WUFA 5BXPA 3SCTA 2J8GA 4A2SA 2GZXA 1BVZA 2WC7A 3BJFA 2WMJA 4B3LA 3L2LA 1U33A 1WCGA 3WDRA 3UPBA 3OZOA 4LTSA 4E5TA 2PCQA 2C0HA 3DFHA 3TJ4A 3HJZA 2GWNA 4NNAA 4BQ2A 2E77A 5BCAA 3W7LA 5G1TA 2GUYA 3WYZA 4X9SA 3B06A 5TNVA 1UWQA 3KLKA 2GGHA 1QR7A 2V3EA 4JTFA 4S2BA 5HJLA 4HHHA 2HCVA 3ZXWA 2Q01A 1MXGA 4LAOA 5AHMA 3PTMA 4XBKA 4YNGA 3AI0A 1VFLA 2ZUMA 4G1KA 5AECA 4TUFA 4DF0A 3FA4A 5C0QA 4L56A 4UFMA 4BI5A 3KOFA 3AIUA 1XLJA 2I1OA 3WQCA 1FQ0A 3B0PA 1QNRA 1MUMA 4IFRA 4QAIA 4GZEA 1KV5A 1NP2A 3A5FA 2GOUA 4HSOA 1DJYA 1LYXA 4Z2KA 2OB3A 5KEZA 4ZODA 4IGMA 3D0CA 5D2WA 3N2XA 1UR4A 4C7DA 3V16A 4NXSA 4R3UA 1U83A 2J24A 3E0VA 5CC5A 3LPGA 4QGCA 3W75A 3MDWA 4PTWA 1JF5A 3R79A 4RZBA 3AS0A 1V6YA 3LLXA 4MFDA 4U31A 3ABRA 5A6MA 1NQ6A 2O92A 1J10A 4Y2WA 5E0KA 1XCFA 3WLJA 2PLMA 4IL2A 5HULA 2WHLA 3M47A 6TAAA 2DZXA 3MT1A 4NRRA 2WMGA 2QCLA 3C0QA 3KVLA 4EP8C 1C9DA 4L5ZA 3MZNA 3BTNA 5D09A 3O0KA 1C7SA 1UP2A 4RV8A 4U3CA 4HHMA 1K9DA 2BP1A 2A5HA 3BLIA 3DFSA 4GUHA 3GIYA 5LIKX 5K9XA 4FXSA 3WFZA 3LOTA 3GDRA 4DLFA 4DZHA 3FDKA 4HK5A 3L65A 5DMMA 1GVEA 1E9YB 5J8LA 3W25A 1FOBA 1QO2A 1PYFA 2FHBA 1E43A 3UG4A 1J0IA 2QPUA 1EDQA 1H7OA 4ENLA 3UXKA 4O50A 1XLHA 4GVGA 1W3HA 2V3DA 1W1B1 4N0RA 4JTQA 4MWAA 5FL0A 2OXNA 1QWKA 4DXVA 1VZWA 4I7UA 4UNIA 2TPSA 2D0GA 1QRQA 5DCEA 4FA3A 3LGGA 4AVFA 1UHVA 3KBMA 2A85A 1H4PA 4XZNX 5F2LA 3CXOA 2YZ5A 2XM2A 5FL1A 4LUSA 2ZA3A 2D24A 2QAPA 3SCPA 4AWUA 4DELA 4L9YA 4YL2A 4PBFA 4E4PA 1M41A 4Q8PA 1ZJBA 1DBTA 1EC7A 4JKLA 1PJ9A 3BLEA 3E0LA 1B3ZA 1VCFA 1W1VA 3IPWA 4DEFA 3T0CA 3RLHA 3AQUA 4PBEA 3SZ8A 1JQXA 3R89A 4KFNA 3QV7A 4KF1A 2XIBA 1TVNA 1KM0A 3PVFA 4LPCA 2PWGA 2VR5A 1GONA 3QEZA 3TC3A 1GVQA 4Z17A 3MS8A 3PPCA 4B5TA 4K39A 4IOTA 1LM1A 4ZO6A 4MKSA 2WK2A 3D46A 2RDWA 4HU8A 4RNHA 4EWJA 5LHEA 3VGGA 4EKJA 1SFSA 2EJAA 1PXGA 4MG4A 1EA9C 5CPMA 3NURA 2PDWA 2E4TA 4RLIA 4LANA 1RD6A 2EQDA 3VD3A 3PTDA 2Z2AA 1MQQA 3OVPA 4EF8A 5C7VA 3XINA 4N9BA 5H8MA 2VD8A 4PTDA 4WX2A 3RM4A 3VD4A 4NJIA 3CAKA 2ODOA 4DM2A 4HCHA 4NAEB 3H2AA 3HB9A 5F2MA 1SSDA 3NZPA 3BSGA 1VBRA 1BGAA 1V3MA 2XH4A 1TELA 4L7ZA 4MWAC 5D2XA 3WEZA 3FN9A 2BHZA 4JKMA 5CBJA 2YCIX 3UGRA 3T2QA 3W86A 1YIXA 2ZWYA 1GZGA 3LXBA 5HMFA 3R10A 2J47A 3U8GA 3L2IA 3VIMA 1H0GA 2E9MA 3NR0A 5JIPA 4FLOA 2PODA 4LYKA 2ABAA 3DYOA 4LUIA 3RMJA 5AYYA 1TTJA 3FJ4A 3GS6A 1XIFA 2PWDA 4AWTA 2VRKA 1GJUA 4W7VA 4K68A 3O16A 4HOZA 3BL3A 1WV2A 1XCWA 4DBDA 1XV8A 2HNHA 5AC5A 1KBBA 3TUUA 4HZMA 1GOXA 1OZMA 3IIXA 4KEUA 5CEWA 3W81A 4C6OA 3W9ZA 5K4XA 1ADSA 1F4HA 3R43A 4N7QA 1B9BA 4E4UA 4MM1A 4KWOA 3UGVA 5EMKA 4LVAA 2QNEA 7TIMA 3PBWA 3GIQA 4L4PA 2CLKA 4LC8A 1CLKA 1KGUA 1BRLA 2YCKX 4TV5A 3EB2A 2XSAA 1B3VA 2WKGA 4LEQA 4MADA 3GH5A 4UMBA 4Z0SA 4XSLA 1MO0A 1O5RA 2VT0A 4WJXA 4FR1A 4Z42C 3VKAA 3UA3A 2JF6A 1HJQA 3IACA 3RX3A 3DENA 3CIWA 1J18A 1N8FA 2GDVA 5K7JA 2A7RA 3H2OA 2EXOA 3VCRA 1U22A 3MTWA 4Y96A 3TOPA 1E1EA 2BWGA 2B0MA 3TFXA 3GO2A 3WQ5A 1CTNA 3ISIX 2BOGX 3FAWA 3BCJA 1J6PA 3KBWA 3EMCA 4I9MA 3VIPA 3HJEA 4OZOA 3L0GA 3UU0A 4DWSD 3H54A 3EDKA 4GVHA 2C14A 4RK8A 4Z2IA 4C6PA 4LYQA 1DXFA 3QXBA 5MHBA 3ZR6A 3ZJ7A 4ZOEA 4AWEA 1QOXA 1FWSA 3KRBA 2AGKA 2QJHA 3L4WA 5RUBA 5I3KA 2ZX7A 3BVJA 3WF4A 2VEIA 2BS9A 2B7QA 1QFEA 3AYTA 3VI2A 3N29A 5EYWA 3GQYA 4YPJA 2Q8ZA 4LVFA 4R7JA 1BXBA 4H4IA 1NJJA 2VFEA 4MJ4A 5CGQA 2IQTA 4NQ1A 1N8IA 3BARA 2OX1A 4NVTA 2BY2A 3WLIA 5IFTA 3S1WA 3OG3A 1O95A 3NIYA 1OADA 4JNZA 4H9XA 3POHA 1V5XA 3VYLA 3T8LA 5CG0A 2XFYA 3DIPA 4JTRA 1A47A 1O1ZA 1YDOA 2YL6A 4IMFA 3UP8A 4W88A 1PS9A 4S3EA 5BMWA 3LN3A 4GWEA 5ABGA 1RCOB 1KBKA 1M53A 1XGEA 2Z2BA 5F2IA 2ZA1A 4HGXA 3QPYA 3RILA 3UFYA 4YLWA 5H2ZA 3W7KA 2ZUUA 4LOCA 4S3AA 1XLKA 2QUVA 3V4BA 5E09A 4OBSA 1E70M 2VFDA 1E9LA 1XICA 4PUNA 2Q71A 4WKFA 1M65A 1YW1A 1JUKA 3WO8A 2OELA 3G8EA 4MPQA 4RW3A 4IXXA 3M0XA 4OKDA 1VJIA 3FLUA 2NSOA 4L6OA 1KO0A 5D05A 3N9SA 3R0UA 4J2MA 1LBFA 2PZNA 4IIHA 1EKOA 3OZYA 1TE1A 2OMAA 4EPDC 3CASA 3OO2A 2W6RA 4M51A 3TAOA 3TC7A 1W8SA 2ESCA 3NPWA 4K7YA 4YCPA 3SUWA 4I8YA 4GO9A 5DFAA 1NWTA 4UZUA 5T9CE 3WUFA 2V69A 1WKEA 4IQLA 3T0AA 1UZ4A 3W1AA 2BXYA 3ME3A 4ZQPA 4NHVA 3L4TA 4I9AA 2YJQA 4F48A 3QW3A 4LUTB 4GE8A 1VFTA 1GHSA 4DO4A 3EA2A 2Y63A 4NI3A 4H19A 1WKYA 1EP2A 1NTHA 2WQPA 3I7SA 1V02E 2V67A 3APGA 4Q6XA 3G1XA 4HB7A 4GH3A 3A12A 4ADUA 1VLWA 2WB5A 3KTSA 3PWGA 5A8PA 3T44A 3VNMA 4LVBA 4AD4A 2OZ0A 4UTKA 4MY1A 3VTRA 1DKWA 3CPRA 2E09A 3APYA 3EEGA 1OF6A 3HIJA 2NVAA 4O1CA 2INFA 4GY7A 4YTQA 1VENA 1GVYA 4AVOA 5FD0A 3EDJA 2PDCA 3QR3A 3FGCA 4W93A 3SCSA 1Q6CA 5AC8A 3H4GA 3LCXA 1PO9A 5LSMA 4Q7NA 4OIFA 2E25A 3WBXA 1PYMA 3D47A 4LV4A 4KIEA 4FXRA 1XPYA 3OBKA 1KQYA 2JKEA 3JZEA 4IF2A 5HBFA 4JTSA 4CQBA 5HJXA 3UESA 1TQJA 4CCCA 2HS6A 3LB0A 5D37A 4RZ4A 2JE8A 4JKKA 1TG7A 1NF7A 1NOWA 4XUYA 3CHCA 1UQYA 3E9AA 1JNEA 1PZ2A 3NL3A 4HHPA 1PCWA 1GVFA 1C7TA 3WIJA 4LYRA 4CQCA 4C6KA 3GSMA 2CU0A 4NYYA 4MB4A 5I2UA 1F8MA 1QW9A 1V0NA 2FQIA 4MWAD 3L5MA 3GH4A 4GGBA 2OZ8A 1SO6A 5DRIA 4FK9A 4XIAA 1OYCA 4FNPA 3SCVA 3DFNA 1XIJA 3FS2A 4X2PA 3QTGA 4F0KA 4LWWA 1FCBA 1XWYA 4D1JA 3CQIA 4HNTA 1GKQA 3TN6A 3ZMRA 3BMWA 5HR6A 1Z89A 1BGGA 2DPEA 3W7HA 2H8XA 4H7CA 3SJNA 2V63A 4PH6A 4B4HA 1EYEA 3FA3A 5H8PA 2ISVA 4W8AA 2P8BA 4UQ9A 5E9XA 1XLLA 1XC6A 3B8UA 3G77A 2FDMA 5HANA 3TLLA 4F8XA 3UJEA 3K8KA 1TPC1 3ZR4A 4MHBA 2CW6A 3G1HA 3IWPA 3ZT5A 3W7OA 4RKAA 1JQVA 1RK5A 2DZSA 5DMYA 2CPUA 4DAIA 2TRSA 3TFCA 2FB2A 5M5DA 1PTGA 1DJIA 1UKSA 3IAPA 3THQA 1B3WA 4W89A 1LLWA 1J79A 5I0DA 1ZP4A 1EO7A 1EUNA 3NUKA 3M16A 3LCHA 2BHYA 2HZGA 1UZDA 2FMNA 2NUYA 5LNRA 1NDWA 2IKIA 3MUCA 3FY1A 3L0NA 1FDYA 4P8VA 1UD4A 4YIWA 1E0TA 1XDJA 3OYZA 5F4SA 4HNNA 2GFTA 2QCDA 3C4UA 3BAWA 1RD5A 3VD7A 1UWUA 3G0UA 3A5VA 3EOLA 4HKPA 1ZNNA 2ZUSA 4MDPA 3T0TA 2B7OA 4R88A 4G7EB 2A3EA 1CGVA 3VK5A 3P60A 3QQ0A 2X2GA 3BK0A 3MBDA 2UWFA 3DI0A 3QJAA 2AKZA 3IIOA 1ECQA 1TFVA 3CUZA 4H2CA 3N13A 1A5BA 1UCWA 4PCNA 5I3DA 4QISA 5HPOA 4HZ8A 3SSZA 3SQSA 1S2WA 2UBPC 4QBXA 1Z44A 2CITA 1XH1A 4GXPA 4YMZA 3RPDA 1Z6KA 2PPGA 3N12A 4HA3A 4JQ3A 4GA8A 1WA3A 1TRDA 4NI8A 1US0A 4IT1A 1YBQB 1UASA 2VR2A 4AYGA 3GC4A 4UFLA 4IGHA 2XIIA 4CLMA 4C6FA 3MP5A 3V18A 4GI4A 1LG2A 1TQXA 4F2BA 3WLRA 1FWDC 3P0XA 5U7SA 4D72A 5J04A 1X96A 4JIPA 2AQOA 3PBYA 3K2GA 1T99A 2A0NA 3XIMA 1VS1A 3QN3A 4IMGA 3RR1A 2HXTA 2GVJA 4J3VA 4EXQA 4XAPA 2PAJA 3NSMA 1YX1A 4AWSA 3OIXA 2YCJA 3HN3A 3IARA 3AYRA 3IJLA 4RXFA 3VILA 1YDVA 4AC1X 3S2CA 1K4HA 1RALA 3W76A 4IUOA 3CZLA 1H49A 1X1OA 2RUSA 3A4AA 3M46A 3APTA 3L4VA 5EA9A 1SSGA 4JS3A 4HHLA 1J01A 4FF5A 4PMUA 4ILSA 4QP0A 2FYMA 1XG3A 3MMWA 5K9DA 4CD4A 3G0XA 3IRDA 3S1VA 4PL2A 4ML4A 5I7GA 3K13A 3JS3A 4GZJA 3FK4A 3M9YA 3WH9A 4JFUA 4X2RA 1I4NA 5FCZA 4GIAA 1W5MA 3GVVA 2J25A 2PDFA 3WQDA 3NQ2A 3R0DA 5BXSA 2BGQA 3WLMA 4ONVA 3VC5A 1JUEA 5AB3A 4UTTA 3UG5A 1DJWA 4DBSA 2HMCA 4FNQA 1IE7C 2Y24A 3LHWA 4FI4A 4GQRA 2YL8A 3IIZA 1ZLPA 2WM1A 3ARRA 5BU9A 3VINA 4GUGA 4AC7C 1S2TA 2B4GA 1UQZA 3PWAA 4GI8A 3RHGA 3NG3A 2HV5A 2WO5A 3LEPA 1JCNA 5HK4A 3SN4A 2XWDA 3W6MA 2W63A 2WANA 4N4QA 3WDHA 2CLFA 3QOKA 4XQ6A 4IWWA 2FZ9A 1BYBA 2KZHA 1C9WA 2BNJA 1EUAA 4DUVA 1EJRC 2Z1SA 1Z42A 2DQWA 1TMLA 1NAL1 3IGHX 3OBEA 1ZENA 3ZQ9A 5M3WA 1EHNA 2A4AA 1UWTA 1M5WA 4YYFA 1QNPA 1HKWA 3O3RA 2NX1A 4K8EA 1DTNA 5G1MA 2XVPA 1PKMA 5G4WA 4QJ3B 2C8NA 3VO0A 3KRZA 1H62A 1DJNA 3POCA 1P6BA 1K03A 3WLKX 4AXKA 2OFJA 2VTFA 4INFA 3AMDA 1L6GA 2J9ZA 3G2GA 3C0JA 4O8AA 3OIHA 1CNVA 1Q3NA 1QNOA 3UWYA 4ATDA 3N4EA 1G6CA 5AKQA 1OFRA 1PEZA 2FFCA 2OWWA 1I2RA 3WNMA 4BEQA 1P0BA 3A22A 3UXAA 3PK7A 4K1WA 5K9CA 4PUDA 1U1UA 4QM1A 4CU7A 4NZ1A 3BGAA 3UEQA 5HQLA 4MKVA 2CNCA 4D6CA 4H8VA 4CCDA 1US2A 3KUMA 3Q67A 3HPAA 2FPVA 1R3TA 4M82A 2ZDRA 1UWIA 2Z6JA 4BHYA 1DJZA 4FOKA 3L0KA 3KTXA 1TPH1 3G18A 2JEPA 3W2MA 4PMYA 2PDHA 3FW6A 3P93A 1KFLA 4QSFA 3BAKA 5ABEA 1BQCA 2INZA 1TUFA 1UZHA 4NZ4A 1Q13A 1JPHA 2PWFA 2PU0A 2GGJA 3MQTA 2JALA 4W85A 1HJUA 3UR7A 1MFUA 4DJFD 2IW0A 1I2NA 2OYKA 2OWCA 3CB8A 4A35A 4CQAA 4MUZA 3NSXA 1W32A 2E6DA 4IJRA 1PIFA 3MSRA 4HA4A 3HM7A 4ROPA 5C5YA 4ZQNA 1AZ2A 2ZC1A 3W7IA 2FB3A 2ZRZA 3UNDA 5A6BA 3HQNA 2J62A 1H2JA 3PNUA 1FWAC 3PM6A 1ZSXA 2CBUA 4M29A 3AIVA 1HL8A 3IEBA 1FP8A 2J27A 4QNEA 2VCAA 1TV7A 4DQWA 2EGZA 3UWWA 3ECQA 1LOQA 3U3HA 1IR2A 4LV9A 4ATLA 4FNSA 1H50A 1C8VA 1HO4A 1HJSA 3W71A 3GUGA 1XSKA 1E3XA 2BDQA 3ATYA 4ATWA 4DI9A 4GKLA 5HPCA 4DO6A 2VP8A 4HPNA 1M7PA 5CBIA 4F0RA 3E6EA 1Z32X 3NQVA 1FWRA 4XO7A 4AMCA 4GABA 3AZRA 3TSDA 1EOMA 1L6SA 3BG3A 3KHDA 3F03K 3T05A 4O0QA 3SQMA 1P7TA 4AFYA 3M0HA 2XHYA 3AU6A 1V93A 1SPQA 3W7CA 4H3DA 2CZDA 3P74A 1YMYA 4Z08A 1KB3A 1ZP3A 2DIJA 1RUSA 1QTWA 3H53A 3LUTA 6REQB 2YCLA 3I4KA 4PL1A 1NH6A 1N2VA 1R46A 3GKAA 3KS6A 4GXWA 3IV8A 1HFBA 1DJXA 5C9ZA 2C19A 2Y7GA 3R6IA 1TPDA 4LUJA 3RFAA 4R9XA 1TCDA 4ZBCA 3LU2A 2HVMA 1VHCA 4JIHA 3PB2A 1UKQA 2VWSA 4IQJA 2R8WA 3L9CA 4DWSB 3KCLA 1G1YA 3SFKA 4J2PA 3CEUA 4KBXA 2YR1A 3KBVA 1EJ7L 1M1BA 4JX4A 2FTYA 5HMSA 3TDFA 3WFAA 2PU1A 3ZFHA 3CTTA 2XDFA 3E2RA 1IEWA 4IPIA 1GKPA 3E74A 1GOQA 2XZ9A 2Q8XA 3ARTA 4MTVA 3M1ZA 4D6FA 1H7NA 3W6YA 1VGAA 4NASA 3TIMA 3SUUA 3W4RA 2E28A 2H9AB 1B90A 3T7VA 1JUBA 3TYCA 3GDLA 2VRQA 3QH2A 4I3GA 4ZO8A 3IK4A 5MF5A 1TV5A 4GKTA 1SGJA 1CECA 5JBFA 3VC6A 4RE0A 4HNLA 2B31A 2EJ1A 4KRTA 2NSXA 3LM3A 4OWGA 2QF7A 4CN4A 3PZIA 3F4DA 1PE1A 1E0XA 2G3FA 1BSIA 1V51A 1AW1A 1Q6LA 3ITYA 2J74A 4TIMA 1T96A 4FF7A 4XAYA 1EXPA 3PJWA 3HO8A 4KGLA 5E0FA 3H55A 2YBTA 3RR4A 2CZVA 3IJDA 1FH9A 4A8IA 2ACSA 3M5VA 5FAJA 1UOKA 2DW7A 2E8ZA 3HA1A 3U2CA 2YA2A 2BXVA 1G69A 1W5OA 3WMLA 1QU4A 4Y7EA 4WSHA 3SB0A 7PTDA 5CBBA 1EPXA 2Y88A 2PWVA 1LL6A 2PBOA 3C61A 1QHOA 4K38A 3BSMA 7TAAA 2B7NA 2XVGA 4Z2HA 1CLVA 3CJPA 1AMKA 3JUGA 2OO0A 3HQ1A 1U2YA 1MXSA 3DFTA 2A3HA 4GI6A 3MU7A 4DPPA 4XIMA 1KQZA 3W7RA 3WMBA 1JD9A 4IICA 1HKJA 3W72A 4KW2A 1Q7MA 2D23A 3A64A 1BHGA 3R8GA 3GNOA 5E5CA 1OC7A 3QLLA 3DYPA 3UYIA 3UY7A 1ZU8A 4AD3A 1WZMA 4RPPA 3O15A 2C15A 1K6AA 3GR4A 3PFMA 2I7GA 3RAOA 3P3BA 1NFGA 4OU1A 1UWRA 2I9UA 2DZTA 2F9RA 1YPIA 2BLEA 3KEHA 4W7UA 2DVTA 3S5SA 4XZWA 3B8TA 1XINA 5F4WA 3LDVA 4WXZA 2PA6A 5D9PA 1IEQA 1XLFA 1TV8A 1YPXA 3PNZA 2A7NA 2P0OA 3MP4A 4IIEA 5FF4A 1SZNA 4CEUC 1VBHA 4GQBA 1PTDA 5DBTA 4HVXA 1SR0A 3QLDA 1JDDA 1PV8A 3SCRA 1OT2A 2DVUA 3EAUA 4GG9A 4L9ZA 3WF0A 4H83A 4ZOCA 5CPQA 2PC8A 5I09A 4JTKA 2DT1A 1OD0A 4PA8A 3WBYA 4C65A 3TU9A 2P3EA 4UTTC 1OGGA 3QHOA 3W7NA 4WD0A 4RDWA 3U7VA 3LXCA 1FWIC 1YLVA 3TJLA 1MWOA 1XQKA 2FZDA 1TUXA 1BG9A 1F5ZA 2CIPA 3VIOA 3SN1A 3DN5A 1PTAA 4YTUA 1TE6A 2C6QA 5HMEA 2OCZA 1OIMA 1XYAA 4CU8A 1U5VA 1ONWA 4CCZA 3TZFA 2ACRA 3VIGA 1VFOA 3LX9A 1JYXA 2AOSA 1J0ZA 1HX0A 3R1ZA 1W1TA 1FH7A 2NUXA 2WKJA 2WNWA 4MWAB 4N4PA 1S5VA 4HP5A 2FLIA 2BY0A 4O11A 1EF2A 3IVSA 3EB4A 4I5UA 3WUGA 3NQEA 2OKOA 2QIWA 3LTYA 4QAWA 3KCOA 4TOQA 1AQ0A 1WDSA 4GIEA 2PDYA 2KAUC 1Y0EA 1Z3NA 3QHNA 2DZWA 4IGNA 2CLMA 1A5NC 2ZE3A 1L8PA 3LY0A 1Q2RA 4PC8A 4Y6GA 2QMKA 1D2KA 1J0YA 3NO5A 1GTEA 3BDKA 4E0CA 3UYCA 3RX4A 2YYTA 1W1IE 2VZOA 2Y61A 3MHFA 3G1AA 3H24A 3W22A 2E0PA 4GJIA 4HTYA 3VD9A 3QW4B 3Q4DA 1RK6A 4HOXA 2AL1A 3O0FA 1C29A 1KD0A 3MV01 4FXJA 2R1PA 1R7OA 3GD6A 1L0PA 4Q7BA 3VDHA 5XINA 4LALA 1V79A 2CYGA 1NY1A 1DXEA 1F2JA 1QOPA 1UH4A 3AISA 4Q4KA 1EGZA 1XS2A 5FEXA 2GJXA 2X1IA 2XIOA 1ONRA 1ZB5A 2XGZA 1T5AA 1OD8A 4L4MA 3EGJA 3VOCA 4PRWA 2PDGA 3H12A 4NUWA 1I1XA 1QDSA 2WSRA 3WL1A 1DJQA 1OK6A 2NQZA 5FEZA 3OZMA 1F6YA 4J5NA 4DF2A 1Q7QA 3EPMA 1B2YA 3TP4A 4KETA 3G3MA 1BQGA 3B9DA 4V1XA 4JCMA 4I6KA 3N4FA 4JTIA 4DX3A 4LX4A 3WLHA 5GQBA 1JPMA 2TMDA 4FSAA 5LIXX 3RLVA 4GZIA 3KVJA 2ZXBA 3FVDA 3ITLA 3VKJA 1Q8AA 5XIMA 1YE6A 4JTAA 1QXLA 1CXFA 2EPLX 4A3HA 2D2HA 9CGTA 3T4CA 1O68A 1PVNA 4L1XA 1H09A 5LA2A 1OQFA 4AB4A 6ENLA 3TJXA 5DMLA 3TYEA 3PHAA 3TK7A 4JNMA 2UY2A 4XVEA 3ZVHA 2P53A 3L5LA 2VM8A 5REQA 4DYJA 3W2NA 4ICNA 4MNLA 4RPQA 2FHFA 2XUCA 1OFEA 3UXDA 4JFWA 2PF8A 3