2O9PA

Beta-glucosidase b from paenibacillus polymyxa
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
445
structure length
445
Chain Sequence
b'NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase B
publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 167
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9pA00
1WZKA 1EOKA 1TMQA 3DYOA 4MNLA 7CGTA 4PTXA 9CGTA 3AIQA 1H4PA 4AZHA 2NW0A 1PBGA 3ZR5A 3PBGA 2IXVA 4F9DA 3BAYA 2F8QA 1UD6A 4AXNA 1R87A 1ISXA 3RM4A 4HPGA 1TVNA 1E0XA 6TAAA 1ITCA 1B0IA 1CXHA 3CHFA 5GPRA 3ZOAA 1M04A 1CGVA 2XG9A 3T2PA 3WQ4A 4P7OA 1EHNA 2WW5A 2V3EA 4Z2KA 4NSBA 2F2HA 3PTMA 1UD3A 1KQZA 3T09A 3PZTA 4LGXA 2DT1A 3S6TA 2DEPA 4ZFMA 5A2CA 4JFUA 3OLIA 5JBDA 1JDDA 1VEPA 5I2UA 4GZEA 3VGFA 3CUGA 4AEFA 1FHLA 3ZJ7A 1MYRA 3K46A 1LJYA 1OGGA 4WKHA 3N15A 3VVGA 3VDCA 1PX4A 2XVNA 4BQ5A 5ABEA 1L8NA 2VI0A 1N82A 2X2YA 1SR0A 1W2PA 3SCOA 4EK7A 1HJQA 1RP9A 3SCTA 1XYFA 2XHYA 3I3BA 1PX3A 1CENA 3PZQA 2YIHA 8A3HA 3AMKA 2C0HA 1JI1A 4B9YA 4MTVA 1UH3A 3AISA 1QNSA 3ZSTA 5HNNA 5BXTA 3HMCA 1MW1A 4UNIA 5CGMA 1DWIM 2Z1KA 3VIPA 1CLVA 3CUIA 5A6SA 2FHBA 3WF2A 1VENA 2WAGA 4HOXA 3AROA 2ZUNA 1KCLA 1GQJA 2BVDA 2ZWZA 1QHOA 1E71M 4M81A 3WMCA 1HP4A 3VX0A 4XZWA 2VX7A 3GXMA 3VILA 4KH2A 3WDPP 5HPOA 1MXDA 2CEQA 4UQCA 1GQLA 3AJ7A 3M46A 4PMYA 3LPFA 4U33A 1JFXA 2W61A 5D9OA 3SCUA 3SCQA 3AZRA 4U5KA 1R8LA 1ODUA 1JYWA 1A47A 4HA1A 2G41A 3GH7A 1OM0A 2Y8KA 2EQDA 4AD0A 3GH5A 1WDRA 1W9BM 2EJ1A 4NI3A 1PIGA 1GQIA 1FA2A 1QBBA 4C7FA 3WELA 4YN5A 1US2A 1JIBA 1Z32X 3SUTA 3EDEA 4PTVA 1E0VA 3T08A 3NSNA 5GQBA 1HKIA 1RP8A 3WH9A 1JNDA 4W7UA 4IPNB 1B90A 2RGMA 3L4XA 4AD3A 3SCRA 3BMVA 4LQ1A 3AICA 4RE3A 4P7NA 4HZ7A 1V6WA 2B31A 1L0PA 1G9HA 1MFUA 4D72A 1WPCA 3F5KA 4U5IA 4KRUA 3L4YA 2XFFA 1UR1A 1G0CA 3AIRA 3U7BA 2TAAA 4MAZA 3ARYA 1K9FA 3BC9A 1W9DM 3ARTA 4AISA 2JEPA 4PMUA 4P8WA 2J7BA 4MB5A 1H5VA 1K9DA 4W8LA 5A69A 4PMNA 2GJPA 1XCXA 3W81A 1E6ZA 1C8XA 5KEZA 2PC8A 4TTGA 1KR0A 4UQDA 2DT2A 3UEQA 1E4LA 4AZGA 3SUSA 1XSIA 4J3WA 2VZVA 4KWUA 4XX6A 2YL5A 2D0HA 1B2YA 3VD4A 1HJUA 3CO4A 1B3XA 3WDHA 4U3AA 4AWEA 1FFRA 3KE0A 1O7AA 2VJXA 3VINA 3MUAA 3T2QA 3PZ9A 3UETA 5JBEA 1ESWA 2CPUA 3BAWA 1D2KA 5TD4A 3W25A 5BCAA 3LPPA 1ZBKA 1JAEA 4UQ9A 3WDQA 3W4RA 3OGSA 3M07A 1V3MA 3K8MA 4AD5A 2WHJA 2CHNA 1XGZA 4PMDA 1FP8A 1GOWA 3O6AA 3LMYA 3VIGA 2Z1SA 5M3WA 3WD0A 1MQPA 4AZCB 4BCEA 1DWJM 1OD8A 1DTUA 1VIWA 1ZS2A 2EPNA 2BY3A 1E43A 1J10A 1E6PA 4NZCA 4AZCA 2BY2A 4MDPA 1E1EA 2RGLA 3OA5A 1WDSA 1JG9A 3WF4A 6A3HA 2GVYA 1BVNP 2W92A 5FOOA 2OSYA 1HX0A 1XD0A 3TTQA 4PUDA 4DUXA 3AMLA 1JF6A 3MV11 1JD9A 1UH4A 1WZMA 3QHMA 2XSBA 4V28A 2ESCA 1JI2A 2D20A 4PTMA 2VX5A 1JF5A 4OOZA 2WKLA 4BZYA 2BS9A 5KZ6A 2WMGA 4QCFA 4X9YA 2WZEA 3BAIA 1WB0A 2DT3A 4PMVA 3UG4A 4LYRA 3WF1A 1C8QA 3WENA 2NT0A 4UQEA 5I23A 3CTTA 3CPUA 5CPTA 4LYPA 3AMGA 1VFUA 2E0PA 5IFTA 1TG7A 1V3IA 4AD4A 1PPIA 3VM7A 3RILA 4E8DA 1AQHA 2GJXB 2WHLA 3A3HA 2Q8XA 5CGTA 1OD0A 1QPKA 2XM1A 4CD6A 2D1ZA 2XWDA 1PZ3A 2EEXA 4PEEA 4PMZA 3T0BA 4W89A 1UKSA 1TUXA 1W32A 3BMWA 2GJXA 3UR7A 2YLAA 1E6XM 1OINA 3AIVA 3POCA 3AYRA 4QCEA 5ECUA 1UR4A 3FHAA 1HT6A 4JCLA 4PUEA 2D24A 1DWHM 4GO9A 2F61A 1GHRA 4AD1A 1B3ZA 5HBFA 3VM5A 2Y2WA 2XSAA 2J8GA 2ZWYA 1S46A 3BCDA 3AHTA 2QLYA 3QHOA 4PMXA 4H41A 1UR9A 2XIIA 1CGUA 2XFRA 4HMEA 2XVPA 2DIJA 4B15A 3AXHA 3ALFA 2FHCA 3WH5A 1KCKA 4WSJA 4HTYA 2UY4A 2CETA 1DWGM 1KXVA 3WL0A 1CZ1A 1H2JA 1UQZA 3RO8A 3U57A 2WXDM 2WCSA 2Y24A 1H49A 4P8VA 4AZ5A 2YL9A 2YDQA 3FHQA 1BF2A 1H0IA 1ISZA 3WF0A 3GZAA 3QR3A 2DGAA 1E3ZA 5HDRA 4HPHA 1OGSA 1LF1A 4AC1X 2WSKA 2V3GA 2J75A 4MAVA 1EA9C 4CD8A 5FL1A 2ZX8A 4GQQA 2VTFA 3AIUA 4M56A 4BS0A 1J11A 3OGRA 3WY1A 2GJRA 4CUCA 2V3FA 5AY7A 2WVVB 1D3CA 3EDFA 2VZOA 1E73M 3BAKA 3EMCA 1LL6A 2XTKA 5CPSA 3GNRA 3PN8A 5I78A 5D9PA 4CN6A 3AOFA 2WMFA 3WDRA 5IHSA 1JL8A 2WVVA 2ZOXA 1UZ4A 1FH7A 3NUKA 2VURA 2CNCA 2AMGA 3IAQA 1TVPA 4LPCA 2D0FA 1JYXA 1OT2A 3EMZA 4GINA 1RH9A 2PWHA 1KR1A 3OIHA 1J18A 1SMAA 4GI9A 5I79A 2DSVA 1UG6A 1GJWA 5LYRA 1DWFM 3WF3A 2O9OA 4DUWA 3I3EA 2O9RA 3CMGA 4UFLA 1EDTA 2ZUWA 2EXOA 1UWTA 1JDCA 1IV8A 4Z2JA 3CUHA 4JFVA 4WKAA 4UR9A 3SCNA 4D6HA 4FLQA 4JFSA 1UR2A 3OLDA 2XVKA 5E0FA 1NOWA 4AZ7A 3KL5A 1B9ZA 5AYBA 1C90A 3VGEA 1FOBA 3D3AA 5A3HA 4A3YA 4D6JA 1GQKA 1V0LA 4M24A 3SIMA 4OKDA 4URIA 3CZKA 1MW3A 1JYNA 1ZB5A 5CQ1A 2BNJA 3GXDA 5AC5A 5BXSA 1KWGA 3AMDA 2BXYA 1V0MA 1IZJA 3TONA 4UCFA 3OZPA 3MU7A 2J4GA 5AC4A 1UD4A 1SFSA 3CHDA 1CTNA 4UFJA 1BYDA 1UD2A 4XV0A 3CZEA 4PYSA 4UFKA 2E9MA 3II1A 1MWOA 1MXGA 3OG2A 2ZUSA 1E4MM 1HNYA 2D22A 2VX6A 3MUY1 1UHVA 4JKMA 1J01A 1KWKA 1G1YA 1G94A 2E4TA 2HISA 1QW9A 1VJSA 2XPKA 4D6DA 2ZX7A 4P8XA 2YLLA 2CKSA 4ATLA 4KMQA 1KGWA 2ZX6A 3A4AA 1GPFA 1QHZA 4A4AA 1TCMA 4QLLA 5BYWA 3N18A 2PI6A 5BRQA 4IISA 1V3KA 3EYPA 3WN6A 1W1PA 1E55A 2AAAA 1LG1A 3GDBA 2QV4A 1V6YA 1MFVA 3NJ3A 1J0IA 5FL0A 4MJ2A 2VZSA 3ARVA 3GBDA 2VR5A 3ALGA 1P6WA 2DT0A 3JUGA 4QAWA 4D6IA 2V38A 4PMQA 1HF6A 7TAAA 1JZ8A 4PCTA 1Y7VA 1EO5A 3W6LA 4UZSA 4M80A 1SMDA 2BV9A 1ISWA 2X0HA 3BSHA 4WSKA 2PF0A 5HXMA 1E9LA 2D2OA 3UR8A 2OYLA 1QI4A 4MADA 3F5JA 4CU7A 1V6UA 1GJUA 4ATDA 4IPLA 4ATWA 4MJ4A 5A8OA 1OWQA 4KRTA 1NP2A 1HL8A 2ZE0A 2CYGA 5E6YA 2G3NA 1H41A 4MB4A 1GZJA 2G4FA 1EQCA 1OIFA 2X8RA 2WLYA 2VCAA 1E3XA 4BQ3A 5HPCA 1BTCA 1AVAA 3HN3A 2PWFA 2HVMA 2PBGA 1OSEA 1G01A 2PWGA 4JZ5A 3VNYA 1UKQA 4F79A 4K68A 1HVQA 1XSJA 1PZ2A 3BLKA 3OB8A 2DDXA 3WUGA 2PWEA 2PB1A 1XH2A 3SURA 3ZO9A 4XB3A 1UZ1A 1W1YA 3AIBA 2Y5EA 2BFGA 4DWSD 4AY1A 1C7SA 1J0KA 1XCWA 3GBEA 4JCMA 3SEPA 1BPLB 1DP0A 1XH0A 4U31A 4E2OA 1BFNA 1X6NA 5JIWA 1BVZA 1GOQA 1I75A 1DWAM 3VDBA 5BXRA 5E6ZA 3QOMA 4TX8A 1B1YA 4CKQA 4IUGA 1W1TA 1E56A 4HZ8A 1CXKA 1M7XA 3SUWA 3WQ5A 3IANA 1ITXA 1LL4A 1QVBA 1UA3A 4AIEA 4S3JA 5M5DA 3AHVA 2VOTA 3AXXA 3TOPA 1E15A 5CSUA 1VF8A 4UQBA 1UD5A 3SCPA 3RM8A 2XM2A 3DHPA 3CUJA 5LA1A 3ZT7A 2VUYA 1ZU8A 5JUVA 3UESA 4D71A 1R7AA 4BQ2A 8CGTA 3PZUA 4D6GA 2EBNA 5A6BD 1J0JA 1BGGA 3AI0A 1VBUA 2MANA 1JGIA 1GOKA 2BVYA 1HKKA 1UA7A 5JBFA 3OBAA 3AS0A 1AMYA 3T0DA 1W2VA 1UYQA 1QHPA 3GXFA 2DSUA 3MMUA 4BQ4A 4UFMA 4EKJA 2JE8A 1LWJA 3WQ8A 4F9JA 1JDAA 3VIOA 3ZT6A 1UWSA 4CU6A 2FGZA 4MPKA 4W85A 4OZOA 1MQRA 3D5HA 2BY0A 3VD5A 2VCCA 1JD7A 5BRPA 3U5YA 3SUUA 1ISYA 3HU7A 3IJ7A 5C70A 5DEZA 1CLXA 4OUEA 4H8HA 1ZBWA 1E4IA 2OWWA 1TA3B 2A3CA 2E9BA 3WDJA 1E4NA 1KBKA 1YHTA 1JXJA 2XIBA 3VUPA 1W3LA 3FY1A 4L4OA 1Q6CA 1XV8A 4DM2A 5E0CA 1TA3A 2WMHA 3W24A 2VL4A 5A94A 2J62A 1KB3A 3PZMA 2ZXBA 3G6MA 3VU2A 3WBAA 3WFLA 1NM9A 2QHAA 1W9VA 1NQ6A 2J7DA 1CXEA 2VVSA 4QLJA 2J78A 4TOQA 1VFOA 2WMIB 4L4PA 3ZR6A 4DWSB 2VO5A 1I1WA 1OB0A 2VCBA 3N11A 5ABGA 4S3KA 1QI3A 4JKKA 1J12A 4N42A 5IXEA 1XSKA 1XHGA 2C7FA 2WMIA 4PTWA 3RJYA 4DWSA 2ZXDA 4EAMA 1QNQA 5IDIA 2ZUTA 1WZAA 2EPOA 2OSXA 1W91A 4QFUA 1MVYA 3W26A 1BAGA 3WIJA 3QOKA 4CD7A 4V2XA 4CCEA 2YOCA 1I1XA 4GO8A 3ZSSA 3VIIA 1V02E 2CERA 2J25A 1WAWA 1LQ0A 1CPUA 4HOZA 3RJXA 4ACYA 4PMRA 1JZ7A 1E5JA 1DEDA 3L4VA 5E09A 1UKOA 4D1IA 1R86A 3RPMA 3IJ9A 5EB8A 4GKLA 1VEMA 4AW7A 3NIYA 4D1JA 4WF7A 2CITA 5C8BB 1V6VA 2J7GA 3VIFA 1WO2A 4UOJA 3PTQA 4HMCA 3WUEA 1FH8A 4Q22A 2FHFA 2BHUA 1UUQA 2WMJA 3MKKA 5A6BA 1OT1A 2DSWA 1OBAA 4C7GA 1E40A 1Q6FA 4TUFA 3B9DA 2E40A 4HMDA 2YDSA 4GPNA 1CGWA 1HP5A 4M8UA 2J7HA 4PSPA 5IFPA 2EPLX 3A4XA 4M1RA 4C7DA 2EO7A 1BYBA 5CXPA 3VNZA 1SYTA 3UG3A 2ZUVA 1JZ3A 3BAJA 4FK9A 1UR8A 3FNDA 3SCSA 4CD5A 3DECA 4PCSA 4PRWA 5HOSA 2YJQA 3FW6A 1KGUA 2UWFA 3GYCA 2J7EA 3WH6A 5EMYA 3THDA 5DT5A 3QGVA 1EO7A 2VRJA 2QF8A 1R7OA 1HJWA 2FDMA 3W29A 3W38A 3LPGA 1V3HA 3WD4A 1GOOA 1HXJA 4W8BA 2QMKA 3MANA 5BWFA 3WNOA 3AHZA 4YHEA 2DH2A 2A3HA 3K8LA 4UOZA 1BHGA 4H2CA 2OSWA 1E6RA 3CZ8A 2X1IA 4W8AA 1U30A 2ZICA 3OGVA 1V0KA 1GONA 2V5CA 3AZTA 1E1FA 3L2MA 3KL3A 2WZIA 1CXFA 3NDYA 4J3SA 4TXEA 4JFTA 3TTSA 5LA2A 3VIJA 4Z2IA 3BAXA 4CU8A 1E6QM 5ABHA 4QLKA 1K9EA 1XC6A 2CBIA 1W3JA 5GNZA 3OZOA 2WC4A 2XGBA 2J8FA 4W93A 4HZ6A 1M03A 4J28A 1F4AA 4FLRA 3CZGA 1OIMA 4GZJA 2W67A 4OIFA 1JZ5A 3DHUA 3O2LA 2JALA 5A95A 1MW0A 1PAMA 2VMFA 2DPEA 3HJEA 1HKJA 1BYAA 3MSGA 1QW8A 3W53A 1X1NA 3RCNA 5EFFA 5A8NA 2WCGA 3GXIA 5D8WA 3WNNA 3NYDA 2YA2A 3AS2A 2VQUA 4GI6A 3GNPA 2FGLA 2WCAA 3FXYA 3VGDA 1HN1A 1EIBA 2YL6A 2QMJA 1QI5A 4UZUA 1W9UA 4PSRA 4FMVA 4JAWA 3TA9A 2FH8A 3L4TA 2W5FA 5ABFB 3EMQA 4Y7EA 2YA1A 3K4DA 2IXUA 4GQRA 3PZIA 4R27A 1EQPA 1HL9A 3MV01 1CXLA 1OGBA 1JZ4A 4YPJA 3ARXA 3VD9A 2WB5A 3VMOA 3WD1A 2YBTA 1V3LA 1HJSA 4FLSA 4U2YA 2X05A 2AOSA 3OLEA 3W28A 1Q6GA 2VR4A 3NSMA 5GNYA 3WDIA 2WHKA 3WMSA 3CH9A 2QPUA 4ZE5A 2D23A 3QHNA 2E3ZA 4HU0A 1LL7A 1YQ2A 3WD3A 4HP5A 1KQYA 2WK2A 3L4UA 5D9MA 2GDVA 3CZJA 1ISVA 2XJ7A 2NSXA 4U3CA 2J7CA 1QNOA 3K4AA 2FH6A 3AHYA 3S2CA 2PBOA 4P8UA 5D9NA 1H1NA 3VX1A 3WL1A 2BVTA 1K9TA 5A8MA 4CN1A 3DYMA 4W87A 4P7QA 5DF0A 1O6IA 4H7VA 5CPQA 3ARSA 1PX8A 3MS8A 3J7HA 5CLWA 1US3A 1GUVA 4GZIA 4JL2A 2A3EA 1E0WA 2DH3A 3CHEA 2JF6A 2O9TA 4P7RA 1QI2A 3WKZA 3ZQ9A 3L4ZA 1IT0A 2O9PA 2E9LA 3AHXA 4A3HA 3N1AA 3POHA 4AEEA 1PJ9A 4D6CA 3TP4A 4CCDA 4BA0A 4GXPA 1V02A 2WVSA 2G3IA 3KZSA 4X0NA 2XYLA 4UQAA 4OBSA 3L2LA 1B3WA 4XUYA 2WSPA 3BLPX 1KGXA 1FFQA 1UKTA 1B31A 3AZSA 4KGLA 3VIHA 3G6LA 4WK9A 5DO8A 1PIFA 4TVDA 2WNWA 5JIPA 3SUVA 5FCZA 1E6SM 1BYCA 2VT0A 3O9NA 4OOUA 2JIWA 3EDJA 4ACZB 6CGTA 1M53A 4QDMA 1VJZA 3PZNA 3APGA 4ZENA 5D8ZA 4D6FA 2WVUA 2PWDA 3ARQA 2VX4A 4DUVA 1W3HA 4ACZA 1XH1A 2CBUA 3A47A 2WHMA 5DT7A 5A8PA 2OLHA 2DSZA 5FD0A 1JZ2A 3CUFA 3T2OA 1A3HA 1XRVA 4WIWA 4JL1A 3WSUA 4J3VA 1NH6A 1H0GA 2CIPA 3A6OA 3FAWA 2CKRA 1V08A 2G3JA 4IM4A 2XFYA 3F5LA 4FLOA 3PZVA 1C8YA 1JNEA 1NOFA 2OYMA 3B9EA 4M82A 4CVWA 5I3DA 1ZJAA 4PBGA 2WMKA 1FHDA 4W86A 2E8YA 4ML4A 1V3JA 1EHAA 5FIPA 1NARA 1C3FA 3WH7A 2CESA 2W66A 2BHYA 1WP6A 2ZIDA 4JFWA 3MMDA 3WNPA 3WNMA 3WEMA 4HU8A 4CD4A 3ARPA 2VC9A 1JAKA 3RIKA 4CVUA 4RL3A 2J77A 3VTRA 3ZJKA 1EOMA 1E72M 2WC3A 2ZX5A 4AZIA 2VVNA 1GNXA 4J7RA 1ZBCA 3PTKA 5FKYA 1AQ0A 2W63A 3FN9A 4UFHA 1EDQA 1PEZA 1GOIA 5I0DA 1CDGA 1BQCA 3KEHA 1BLIA 2X0YA 1NWTA 5CSYA 1FP9A 1TE1A 3W82A 4WJXA 2EPKX 3AXIA 3U5UA 5CJ5A 3BCFA 3WQVA 1TFVA 3WUBA 4EE9A 4Z2HA 3EDDA 1J0YA 3AYSA 4AZBA 2ZXAA 2OYKA 1CBGA 3NDZA 3AFBA 1TZ7A 2IUZA 2BHZA 1CNVA 3ARRA 2DIEA 1UWUA 1UH2A 3SCVA 5D4YA 3U7VA 1EDGA 3IK2A 4AYSA 2XVGA 1EGZA 1ZL1A 4B16A 4W7VA 1HIZA 1XD1A 1LWHA 1GCYA 1G5AA 3T0AA 5I77A 1QBAA 4CCCA 4CN4A 1VAHA 3CIVA 2NT1A 1NWRA 5I24A 1BGAA 1WDQA 3AS1A 1UOKA 1VBRA 3F4VA 3EDKA 4AIUA 2EPMX 4XZBA 2YL8A 3MUIA 1VRXA 4MNMA 2JF7A 1CYGA 1WNOA 2GK1B 4H8UA 3VMPA 1VFMA 2YA0A 3WH8A 3WQWA 1EH9A 4OJYA 2WKGA 4B3KA 2VQTA 2ZUMA 2GK1A 2O92A 2WBKA 3ARUA 2OWXA 3W6MA 1UD8A 4EANA 1E5NA 2G8ZA 5IHRA 3ECQA 4J3UA 2WPGA 1H11A 1KXTA 5CLTA 5M03A 1WKYA 2WANA 3VD3A 1B3YA 4E8CA 3WEZA 3TTYA 2J79A 2Y8VA 3I3DA 3MO4A 2WYSA 3UG5A 1WE5A 1H3GA 1NOUA 4JHOA 3IJ8A 1E6NA 4H8VA 2DSKA 3B9AA 3ZMRA 4CGTA 1GW1A 5A2BA 2ZX9A 3A4WA 4Z2GA 1ZBVA 4PN2A 1WZLA 2DQXA 4ZEPA 2VRQA 3PZOA 4U2ZA 4JKLA 2YBUA 2GSJA 2CBJA 3VDAA 4DM1A 2J74A 4W5UA 1GOMA 2CXGA 4J3TA 2WWCA 1KBBA 2JFEX 2UY5A 3W37A 5I5RA 1BSIA 4ZXLA 4J27A 4Z2LA 2ZUUA 2G3MA 2Y4SA 1VEOA 4B3LA 4N0RA 1VFFA 5DMYA 1JYVA 4BF7A 2BY1A 4F66A 3RM9A 4HOWA 1KXQA 3GNOA 1J0HA 2E8ZA 4HA3A 1Q4NX 1CXIA 4GIAA 3KL0A 4D6EA 1GHSA 1JZ6A 1NWUA 3N9KA 1M01A 1C93A 4WKFA 3BH4A 3DC0A 3CGTA 3DYPA 1Q6EA 4TTUA 2YDRA 5I6SA 2XUCA 4WLCA 2D3LA 3BXWA 2WBGA 4LX4A 1K6AA 4W7WA 2A3AA 3VDHA 4FF5A 1VB9A 1UKPA 4MNKA 1QI0A 1B30A 3GM8A 3M7SA 1BG4A 5A6AA 4NRRA 4Q7NA 1EXPA 2QPSA 2D0GA 5E9AA 2CBVA 1ZJBA 3ZT5A 4OBRA 3WNLA 2GFTA 2WC7A 4W84A 1QOXA 3VOCA 3VGGA 1W1VA 1KXHA 3VIMA 5BROA 1CGYA 1W3KA 4V27A 4YHGA 1XYZA 1OCQA 1C7TA 5M17A 4AZ6A 1IZKA 1V6XA 3W27A 3N13A 3IAPA 3KWXA 4UFIA 2OWCA 5C71A 2D3NA 1NP0A 4JIEA 1H09A 1HKMA 1MQQA 3WD2A 2J7FA 4E4PA 1CWYA 1CIUA 4LXFA 1DHKA 4NRSA 2W4XA 3AQUA 5A6LA 4QP0A 2WVTA 1D7FA 3K8KA 1LLOA 3VGHA 5AYIA 3UERA 4RE2A 3N04A 1HVXA 1UWIA 3OLGA 1KFWA 1C91A 3VPLA 1FH9A 4HA4A 4JHZA 1ECEA 3CLWA 5A8QA 2WM0A 1WDPA 3VKKA 2WLZA 3VD7A 1QNPA 1MW2A 4H04A 3N12A 1V0NA 3AMCA 4DWSC 1CGXA 3WEOA 5CG0A 4M29A 3FAXA 5A6MA 3MMWA 1Q6DA 2YKKA 1E70M 3WQ6A 5EFDA 5EBAA 2GDUA 3M6DA 3W0KA 2V5DA 5BXPA 1JFHA 5GNXA 5LA0A 2UY3A 4ZXOA 3GH4A 1X6LA 1CEOA 2W91A 3SCWA 2XWEA 5DFAA 1RD6A 2JEQA 3WNKA 3PHAA 3GTNA 3AS3A 2ZXQA 2CCRA 3WMBA 5A6KA 3WBEA 3TTOA 4AD2A 3K1DA 4TVCA 1AQMA 4TVUA 4UTFA 1UR0A 2VRKA 1CECA 2VZUA 4TX6A 3VGBA 3EBVA 4RE4A 1JXKA 5CZKA 1UWQA 1W9PA 2VNCA 3VMNA 3L4WA 1TR1A 3VIKA 4W88A 1CGTA 3MUZ1 3NSXA 4MB3A 2GUYA 1QNRA 5E70A 4W5ZA 4X0VA 4LYQA 2WZHA 2VZTA 4UOQA 1UQYA 3B8SA 1BG9A 2WWDA 3ZJ8A 2X09A 1GORA 2C8NA 3N17A 1W9XA 3VO0A 3AIWA 4MB1A 1U33A 1U2YA 4J3XA 1C92A 1J0ZA 3NCOA 4P7LA 3RDKA 5F7UA 4B9ZA 3BSGA 2BXZA 5ABFA 1F4HA 2CHOA 3ZJ6A 1HJVA 3CHCA 5A1AA 3MSDA 1GVYA 1GVIA 5A6JA 2A3BA 7A3HA 2J47A 3ZM8A 3BGAA 3WFZA 3UCQA 1RPKA 4GI8A 3CMJA 3E1F1 4AIOA 3CBWA 2XGIA 1NWSA 1V03A 2W62A 3CZLA 3AIEA 3THCA 3ZIZA 4F8XA 1WCGA 1B3VA 2JIEA 3PZGA 4ZE4A 3LPOA 1HJXA 2UY2A 1R85A 3ARWA 4MNJA 4PMOA 3WUFA 4KGJA 1J9YA 1UWRA 1LG2A 4AMCA 1ODZA 4MDOA 4R5EA 3ARZA 2V3DA 3RMEA 5A2AA 4NF7A 2XVLA
chains in the Genus database with same CATH superfamily
3DBPA 3CYJA 1WZKA 4ZFCA 1TMQA 1OFAA 3A4JA 2VGIA 4JQAA 5I07A 4MNLA 2EG6A 2QCDA 7CGTA 9CGTA 3GLCA 4JTRA 4XSMA 3BQ6A 4F9DA 3H26A 1ISXA 3HQ1A 2ZZ3A 4HMNA 1TVNA 2ZA3A 1B0IA 1CXHA 3BO9A 1WQ5A 5HMEA 1M7OA 3T2PA 3WQ4A 1VBHA 3VNDA 1UD3A 1KQZA 3JZEA 3GHRA 2ZC8A 3G8EA 3GU2A 4L61A 2QCEA 3G22A 5EMKA 1JDDA 1VEPA 4GZEA 3TSMA 1FHLA 3ZJ7A 5HQEA 1S38A 3N15A 3VVGA 1PX4A 5ABEA 1L8NA 4PUMA 3NL5A 4MYXA 2X2YA 3NFUA 3SCOA 1EJTC 3SCTA 4JIHA 1CENA 1JPKA 4MTVA 3QQWA 3TC7A 1XINA 3UJFA 2RJHA 5C55A 1QNSA 2ASHA 3C0SA 4XSLA 2FDSA 5AZ1A 3RYSA 4O4VA 3ATZA 3ID7A 3HMCA 3IWPA 1BWKA 2Z1KA 4MKSA 3VIPA 9XIAA 5MF5A 3LCIA 1CLVA 3IGXA 3LTYA 2PDYA 4ERGA 3HPSA 4FNUA 4RZBA 3CS2A 4HOXA 1AMKA 1KFLA 4RCXA 9XIMA 3AROA 3DUGA 3W71A 4MFEA 2ZUNA 3NPWA 2YFNA 3HFYA 4DB7A 1C29A 1VJIA 1IXQA 3EOOA 5KSWA 3M16A 3GXMA 2FVKA 5DRCA 3ABSA 3EWZA 4RNFA 2WSQA 1GQLA 1XQLA 3AJ7A 1A4LA 4UR7A 3SCUA 1HKVA 3AZRA 2E28A 2Y70A 4S3CA 4U5KA 2F38A 4UMBA 5E93A 3MVTA 3KOXA 3GH7A 1OM0A 1RVGA 3S9YA 4E3VA 1JPMA 2YR1A 4Q7IA 4MOZA 1GQIA 2IQDA 2RDWA 2E25A 4DNMA 3EDEA 4E5TA 2GUBA 5GQBA 5I3HA 1ZAIA 1RP8A 4KWSA 4W7UA 5I3GA 4JTTA 3SCRA 2PDWA 1GTHA 4CNNA 3H54A 1WKEA 2EGZA 1G9HA 4RNHA 2WJDA 4U5IA 4KRUA 2XFFA 1C8VA 4XIMA 2TAAA 2W27A 2F7FA 4DJDC 1S2WA 3STPA 4AMAA 5IOBA 4ZSTA 3EKLA 1VYRA 4PMUA 3CMFA 1XBZA 3RK8A 5G4HC 3B40A 4PMNA 2ZDSA 4GGBA 1EJRC 4US5D 4UQDA 3PS7A 3UEQA 3SUSA 1XSIA 4IXHA 3UZJA 2VZVA 4XX6A 3C8NA 4XD5A 4L5ZA 4RDYA 4IPPA 3LGDA 3VD4A 3MP3A 2A6LA 3CO4A 3KRBA 3WDHA 2OTDA 4AWEA 4S3GA 1RQHA 1J93A 3NO1A 3VINA 1ESWA 2YYUA 4GVIA 2CPUA 5K4ZA 5BCAA 3CQHA 3M07A 1XRFA 1NVMA 2CHNA 1FP8A 4RPPA 3O6AA 4K7YA 4HT3A 3HGJA 4C1NB 3WD0A 1A3XA 1MQPA 1JCJA 4GY7A 3SRKA 2A7NA 1V8EA 2FFCA 1SPQA 2VP8A 2EPNA 3FKRA 2WV8A 1XLGA 4MDPA 3CPRA 4UR8A 1FWSA 3RPTA 1JG9A 6A3HA 2FZDA 1GYNA 3USBA 1IIGA 3UJSA 3AMLA 2Z2BA 2A4AA 3UF9A 1K77A 2IQTA 2ESCA 4GC3A 1R0MA 4QROA 1F3XA 2BBFA 2VX5A 4WCJA 4LBRA 2BS9A 5KZ6A 5DQPA 4QCFA 3TQPA 4YCOA 1XYBA 2XISA 3T9PA 3M5VA 3UG4A 4LYRA 3MB9A 1TPB1 4IT1A 1AJZA 1C8QA 4ZQPA 4RW3A 2ZTJA 2GGEA 5I23A 3CTTA 3F4DA 3CPUA 5EL1A 4ADUA 4LYPA 1VFUA 3L67A 2E0PA 5IFTA 4GE8A 4JY8A 2D1ZA 1XIDA 4JOMA 1QATA 4W89A 1AUSL 1W32A 1SZRA 2GJXA 3UR7A 1GW9A 1OINA 3PTDA 4R7OA 3FHAA 3LBOA 1I2PA 1UUOA 4PUEA 3R7MA 1I60A 2D24A 1DWHM 4FXRA 3GW0A 2QJHA 3VM5A 2HJPA 1F9CA 4ZTXA 3UZWA 2DZXA 1AJ2A 3OVGA 2ICSA 3LZ3A 2Z24A 3NPXA 4GYFA 2XFRA 2DIJA 3C4UA 4WSJA 4QJ1A 3MCNA 2J6XA 3K13A 2WXDM 4IQLA 3T42A 3UNDA 2CXEA 4Z1BA 3FHQA 1H0IA 1ISZA 3NXLA 5EMMA 3ZVHA 3QH2A 4GZ7A 2V9DA 4AVNA 1UW9A 2HTMA 4IIFA 1EA9C 4F2BA 5HWJA 4GUIA 2VTFA 4L56A 4MF4A 4BS0A 3UWZA 4ICCX 3WY1A 4ZZ9A 1GGOA 4B2DA 5D09A 4L7ZA 5AY7A 2WVVB 3MBFA 1OABA 3EDFA 5IBXC 1KRAC 1WXJA 5CPSA 3KLKA 5I78A 3WQFA 2H3DA 3KBSA 3R12A 1WDWA 3EZ4A 3S6OA 4K37A 3W7RA 5K4XA 1RSCA 2Z6IA 1LOSA 1RQBA 4AY8A 3TAOA 2ATMA 3P61A 3B4YA 3OIHA 3H2EA 1H60A 1QO2A 1YDYA 5AHEA 3KP1A 1J18A 1SMAA 2TMDA 5I79A 3WLNA 2O9OA 1QUMA 4DUWA 1EDTA 2P88A 4ILSA 1NFGA 5CGQA 1IV8A 3QR0A 4WY0B 4KWVA 2WJFA 3E74A 1QPRA 2C6QA 1OC5A 3VFLA 1DIKA 4GNJA 5HR7A 1B9ZA 1JPDX 1ME8A 5AKQA 1KBLA 5J8LA 1NAL1 3KTSA 1ONXA 7PTDA 3GXDA 4GD0A 3S1GA 1KWGA 3QEZA 4H7CA 2CFFA 4XAFA 1V0MA 3GQYA 4NZ4A 1LYXA 4O54A 1MUMA 3OZPA 1E9ZB 4O17A 3MZNA 2PTZA 4GI4A 1CTNA 1QO5A 1BYDA 1MWOA 2ZUSA 2VX6A 4JKMA 2YW4A 4B5TA 4D6DA 4P8XA 4KMQA 1KGWA 5GVJA 1GPFA 2P5NA 4GBDA 3MCMA 5BYWA 3G1AA 3LCXA 5BRQA 4IISA 1V3KA 3EYPA 1E55A 2KAUC 1BXNA 4K38A 4Z1DA 3TYBA 3NQ8A 3FFSA 2DZTA 2Q6ZA 3NJ3A 2IKJA 3S2NA 4WXYA 1VIZA 3GBDA 2VR5A 2J66A 3JUGA 4QAWA 4D6IA 4DO6A 4BWLA 3QM3A 3PBMA 1BRLA 2FPYA 2IKGA 1WUEA 3VKJA 4PCTA 1EO5A 4HSHA 1OFPA 2ISSA 3NQ2A 2X0HA 3BSHA 2QDGA 4LV9A 1XIFA 2OYLA 3F5JA 5I3JA 4GNKB 1R30A 1ADDA 1VYPX 4C5ZA 3B0UX 3SY1A 1TV5A 1MXSA 4DI9A 1FKXA 1A80A 3TR2A 4MJ4A 5A8OA 3B0PA 2WSYA 1GEQA 3W86A 2ZE0A 1W3IA 2CYGA 5E6YA 2G3NA 1H41A 3G1FA 2DORA 2X8RA 2VCAA 3ABRA 4HNNA 2QVHA 2OMAA 4J5NA 4DJDA 5B7YA 3KCLA 5CBIA 2PBGA 3F4WA 3SAZA 2ZZ1A 2Y7FA 1UKQA 7ENLA 4F79A 3WX7A 1XSJA 1X7FA 3TSDA 3BLKA 3W75A 4CEUC 3WUGA 2PWEA 4X9SA 1XH2A 4QM1A 1W1YA 4FIRA 4J1OA 3AIBA 4L1WA 5E5CA 1XBXA 2Y5EA 4JS3A 2AGKA 3N3TA 1C7SA 4RZ5A 2XDFA 1BPLB 3WJWA 1XH0A 1FBAA 4U31A 1BFNA 1X6NA 1VHCA 4LCRA 3VDBA 4RXGA 6XIMA 4M7TA 4LYKA 1ME7A 2REQB 4CKQA 3STGA 4IUGA 4XZHA 1L6YA 3KBMA 1H5YA 4HZ8A 4DI8A 3IANA 1SO3A 4PB5A 3EB2A 3TK7A 2OT0A 2CZEA 2VOTA 4I3GA 4O50A 5HUOA 5CSUA 1Y0EA 3SCPA 3KP0A 1QK2A 2XM2A 5LA1A 5H8PA 3BLEA 1F8IA 1S2TA 1ZU8A 3Q37A 3TN4A 2YCLB 4G6CA 1R7AA 4BQ2A 1W31A 4FXSA 2W9MA 1OF8A 1J0JA 4PE8A 3QBUA 4PTDA 1VBUA 1XIBA 5CSSA 2RJGA 1JGIA 3OZYA 1UA7A 3L23A 3EPMA 3OBAA 3O3RA 4MUZA 4I7WA 1IIHA 2P8CA 3TV8A 4FAMA 1QHPA 3GXFA 1PS9A 2ADAA 1KM1A 3LTSA 1JDAA 2GQ9A 3CV6A 3VIOA 1UWSA 2FGBA 1QWGA 4QX4A 3CL6A 5CG7A 4O19A 3H8AA 1EUNA 4MPKA 3GVQA 4B91A 4AHPA 2BY0A 1V7AA 3VD5A 1XLAA 4IGNA 4F2UA 2C1HA 4LVFA 4YTUA 1OJXA 2QJJA 1RA0A 2QZRA 3W73A 2A3CA 3P81A 3WDJA 1KBKA 1YHTA 2Q8LA 1FWFC 1YNYA 1TA3A 4IFKA 2WMHA 3FDKA 4KIEA 1K8YA 2QHAA 1F3EA 2J7DA 2VVSA 2PP0A 1CW2A 1UC4A 3PM6A 1LROA 3VZZA 2EHHA 1OEPA 4HQVA 4L4PA 4KIRA 1XIEA 1XDLA 2PEVA 4KEUA 4LFYA 4S3KA 1XSKA 1XHGA 5AVHA 1MSSA 3N9SA 4FNPA 3RJYA 4DWSA 1N7KA 1A0CA 5A6TC 2VFFA 2VEGA 3I7RA 1WZAA 2ZUTA 1CT5A 1TRIA 1T40A 4L1GA 1P6CA 3W26A 4ASTA 3CWHA 2HCVA 1EZ2A 2AL1A 3LMZA 2XFWA 5CJNA 3TJIA 4WUIA 4V2XA 3NWRA 3ITVA 2GPTA 4YTTA 4ML9A 2VFIA 3URNA 5FF4A 3TQ0A 3T05A 4OV9A 4NIRA 3TWAA 3ISIX 2HRWA 1FCUA 4ACYA 1SJDA 5E09A 2DZPA 1OVDA 3LRMA 1UKOA 2DV0A 3IJIA 1F6YA 5EB8A 1VEMA 3W2MA 2CITA 5C8BB 1V6VA 3VIFA 1WO2A 3LGGA 4HMCA 2Q8ZA 4Q22A 2FHFA 3KBVA 2BHUA 2R6OA 5A6BA 3FYPA 1OBAA 1SJCA 3MHUA 4TUFA 3B9DA 4C6QA 4GPNA 1CGWA 2J7HA 4ECLA 5IFPA 3A4XA 4M1RA 5IBXA 3W2JA 1LRTA 3GU9A 2QUNA 1JZ3A 4YTSA 3WLJA 3SCSA 4MY9A 1T96A 4CNPA 4PCSA 4XKMA 3FW6A 4NHVA 2QCCA 3GYCA 4GQBA 3ES7A 4RJEA 1B4KA 4Q32A 4JYEA 4M6UA 4E2DA 5C2XA 1N8WA 3FK4A 1YE6A 3W38A 1G7VA 3GHTA 2Y7GA 4IL0A 1TX2A 3W7HA 4MIMA 1V51A 2I56A 4H2CA 2BP1A 3CZ8A 4RE0A 3U2CA 4TX9A 1V0KA 2V5CA 3AZTA 1E1FA 3KL3A 4XZNX 1SO4A 1Z42A 2WZIA 4TXEA 4Z2IA 5LA2A 4CU8A 4GUGA 4G9PA 3RFAA 6XIAA 4W4QA 4QLKA 4LVGA 1K9EA 1T7LA 1W3JA 3BOLA 1AA1B 1XLMA 5G2IA 4Z1CA 5ENLA 4D8ZA 4DLFA 1JZ5A 3DHUA 2JALA 7TIMA 4OU1A 5E1QA 2DPEA 4UTUA 4UNKA 3MSGA 3THQA 5H6HA 3W7MA 3W53A 1X7IA 3RCNA 3BCJA 4L65A 3HJZA 3GKFA 3FEMA 2QUUA 4C5YA 3W2UA 3WNNA 4M5PA 2E6YA 1I2RA 1X8FA 3S1VA 3VGDA 2OCZA 2DVUA 5EPDA 4YTRA 4UZUA 1NELA 3DH7A 3CWNA 4YL2A 4FMVA 2YCIX 4HPJA 2FH8A 1ZNNA 3TA9A 5HK4A 2Z00A 3N2MA 3EMQA 2H90A 2YA1A 3K4DA 4R85A 1EFZA 1YADA 3B3DA 1TTIA 4ZBCA 1OGBA 3TZFA 4YPJA 4Q8OA 4DJDD 3VD9A 4HB7A 4ZGYA 1PHWA 5CC5A 1XKJA 4FLSA 2X05A 5K7JA 2AOSA 1P4CA 3O7UA 4Z17A 1EX5A 3W28A 5GNYA 3NEHA 3UWQA 3WMSA 4ZE5A 2D23A 2E3ZA 4HU0A 2FZMA 3S8HA 1XJBA 2W0UA 4PL2A 3IUHA 3ZVIA 5F2LA 2WQPA 3CZJA 1GOXA 2XJ7A 4R7WA 2NSXA 2J7CA 4O0ZA 1Z3NA 3M64A 3VXGA 2UBPC 3AHYA 5FF7A 4P8UA 4C6DA 1H62A 3D47A 2ZVRA 4P7QA 1KBIA 3EEGA 1PX8A 5CLWA 1OX6A 4X22A 3AUOA 1NFPA 4NAEB 1UJPA 1E0WA 2DH3A 2JF6A 4LY8A 1WX0A 2OFJA 3CLMA 3L4ZA 1IT0A 1UWAA 2D2HA 2E9LA 2X41A 3AHXA 1R3WA 5I00A 2DQWA 4XO7A 3N1AA 3LA4A 4D6CA 4CCDA 3VUSA 2G3IA 5CPOA 2P8BA 3O6CA 2J88A 3UJ2A 1FFQA 5LIYX 2NVDA 3MI6A 1CX9A 2GGJA 5DO8A 2WNWA 5D2YA 3VC5A 2G50A 1UC5A 2H9AB 3EWWA 1EF2A 2BLEA 3EDJA 4ACZB 6CGTA 1M53A 5K3VA 4QDMA 3LZ5A 3KRZA 3REQB 3KVKA 2WVUA 3U8GA 4JIRA 3CXOA 2PWDA 1I2NA 3DCPA 4GXMA 5G2HA 5BWAA 2D2GA 3QN3A 3JS3A 5HATA 3A47A 2WHMA 5DT7A 1VRDA 3CUFA 3TJXA 1UP0A 3T2OA 1A3HA 3KOYA 1Y5XA 1OFBA 2PAJA 3I6TA 5CH9A 1U1JA 3PP7A 4NYUA 3FAWA 3IUIA 2C13A 4BK9A 2ATSA 2QT3A 2NV1A 3R58A 1E51A 1PHQA 2G3JA 4JDYA 1T99A 1HL2A 3IEBA 2XFYA 3S9ZA 3PZVA 1C8YA 3KHDA 1BVWA 4M82A 2X16A 3AUJA 1GVEA 5DCEA 4CVWA 2WMKA 3O1NA 1FHDA 4W86A 2INEA 2OT1A 2E8YA 2V69A 4ML4A 2OG9A 5HULA 3N29A 3IPWA 2PFHA 1P0DA 4XAGA 3W76A 4JFWA 2AL2A 3WNPA 3WNMA 3WEMA 5EMUA 1TJ1A 1ZJIA 2QVNA 3WZ0E 2QJNA 1IEIA 1QPNA 3ZJKA 2MUCA 1YPFA 5BNKA 2CLLA 2EJAA 1AQ0A 2VELA 5CBBA 1EJSC 3W1PA 4L9YA 3D46A 3LQGA 1BQCA 4IPJA 3KEHA 4NP7A 4GUJA 4C6BA 1TPVA 1FP9A 2AKZA 2EPKX 4IX0A 7REQB 3GAKA 2HE8A 4OTKA 4XAYA 1TFVA 3WLIA 3KVMA 1AFSA 3AYSA 3WYZA 2RUSA 3JW7A 3TJLA 3A12A 1CBGA 5T26A 3FJNA 1CNVA 1KCXA 3ARRA 1EXBA 1R6WA 2RH9A 1UWUA 5AHIA 2AKMA 5GJMA 3FX4A 2CW6A 1EEXA 2Q02A 4AYSA 1ZL1A 4ZB5A 1HIZA 2QIWA 1G5AA 4Y9AA 1EWEA 1FHVA 1VAHA 4PUUA 1ZCOA 3EA2A 1NWRA 1MNSA 1BGAA 1UROA 1WDQA 2OLAA 2ZZ7A 1UOKA 1VBRA 2XZ9A 3G0UA 4AIUA 2EPMX 5BW6A 4MNMA 2A7PA 2GK1B 1E9YB 3VMPA 4JIIX 5F4XA 3WQWA 2XIOA 2DFAA 4S3AA 5BMXA 2VQTA 4JEJA 1ICSA 5KETA 3ARUA 5HJXA 4TQTA 1TJRA 2OOGA 1AK5A 1XW8A 2G8ZA 5IHRA 4F0MA 5LIUX 1H11A 5CLTA 4NJKA 3OEXA 2UZ9A 3VD3A 3WEZA 3WQPA 4DY1A 3S2MA 4NU7A 5EYWA 2Y8VA 3I3DA 2WYSA 2J6VA 4WR3A 1JCYA 1WE5A 4JPGA 5A2BA 3N6HA 4Z2GA 1YYAA 1ZBVA 3BLOA 1WZLA 3VAVA 3WQDA 2DQXA 4HGXA 2YXXA 1HUVA 5FJUA 1PCKA 2GSJA 4W5UA 3QVQA 2IS7A 1J4EA 1XYLA 4AUBA 5I5RA 3FGCB 4PFMA 4UUIA 3OTRA 1V77A 1VEOA 4ZSUA 4B3LA 4F66A 3U4AA 3UY7A 2X1TA 2R1NA 3CQKA 4HOWA 3PB0A 3UZ5A 4RV8A 4BKNA 2PDLA 2ACUA 5U7SA 4PH6A 1TMHA 1GHSA 1YX1A 2PURA 3N9KA 2DW6A 3H7RA 2PPGA 4ZQNA 2PDMA 4H6EA 3PWAA 4L1XA 5CAKA 2YDRA 1PE1A 4WLCA 3QV6A 4PCFA 2WBGA 4J2MA 4LUYA 1QPQA 4LX4A 3G1SA 1K6AA 4JTAA 2YBVA 3HZ3A 4IIHA 3N25A 2A3AA 3NM1A 4MWAD 1EJXC 4JTQA 3N9RA 1UUMA 2JKEA 2Y0FA 2E77A 4MNKA 1T8XA 1A5BA 1B30A 1XLLA 4AF0B 3V1PA 3NR0A 3M7SA 4JN8A 1BG4A 3SN4A 4B4FA 4HNLA 3E2RA 4Q7NA 1EXPA 2ONEA 2D0GA 3M0XA 3PAOA 2E6AA 4RX0A 2I5QA 4G5DA 2XIQA 4ICNA 1A5KC 1WUFA 3P62A 3P8JA 1L8PA 3VIMA 1DQXA 3DHFA 4R9XA 3M5ZA 4F48A 4V27A 3INPA 4QE5A 1S3TC 1RY0A 1KFEA 4ZB2A 3OIXA 1ADSA 3EWDA 4S3DA 1V6XA 1EYEA 3IAPA 3EWUA 1NP0A 4JIEA 3LHUA 1EC7A 4A3QA 3WD2A 3W87A 1UBPC 1KKRA 3L12A 4ZOCA 5FJTA 1VCGA 2W4XA 4HSNA 2WVTA 1BTMA 4NI8A 2FMOA 1NY1A 2DVTA 3K8KA 1RBOB 3VGHA 2Y8UA 5KZDA 1HVXA 1FH9A 4PUJA 2WM0A 3EKZA 2WLZA 4IIDA 3TC6A 1QNPA 2XH4A 1RHCA 2LLEA 3WJZA 3RLGA 5HWNA 5DELA 3TNOA 4JTIA 4YJ5A 1VCFA 3IIZA 1E70M 3WQ6A 5EBAA 3M6DA 1OFQA 3PNZA 4UC5A 5GNXA 2UY3A 4N7QA 1R3YA 2W91A 5DXXA 2OLSA 2VD9A 2XWEA 4LJ3A 5DFAA 4E4UA 3H4WA 3MJYA 3MMTA 4ZL1A 2OZ8A 3PHAA 3WK1A 3GTNA 3AS3A 3FEQA 4O1BA 3VNLA 1PZ1A 5A6KA 3TTOA 1IWAA 3C2YA 3P67A 1POJA 3K1DA 3FKKA 4N9CA 3GKAA 4HPXA 3T78A 2A5HA 4TX6A 4RE4A 2VC6A 1JXKA 1UWQA 1W9PA 3MKVA 2VNCA 4GUHA 1TR1A 1EBGA 3GO2A 4IIEA 2GUYA 3T07A 3S9IA 5E70A 8RUCA 2P10A 4A29A 2VZTA 3ZJ8A 5TIMA 2C8NA 4OFCA 3UXKA 4BEUA 2Y5SA 1C92A 3BZGA 1J0ZA 5M2FX 4N9BA 3N2TA 3OQ8A 3ZJ6A 1HJVA 5H8MA 1FHUA 8XIAA 1GVIA 5TF0A 1LUCB 1KCZA 3IGUA 4E4FA 4AB4A 1PKMA 3ZM8A 3BGAA 4O28A 3WFZA 3SRHA 2F84A 3VNIA 3WK0A 5CEWA 3PPHA 2BWGA 3T8QA 3P82A 4AIOA 1RA5A 1R3VA 1DIDA 1B9BA 1A5OC 3SQLA 4FB7A 2VFEA 2W62A 3ZIZA 3PZGA 1OG0A 1OYAA 2WM1A 4KGJA 3WJXA 1J9YA 4O1DA 3W7CA 1TVLA 3MP5A 3LHVA 4EWJA 3MA8A 3ARZA 2I7GA 2XN2A 2QCDB 4KEVA 1XFBA 5C9WA 3SSZA 5D04C 4NF7A 3C6CA 3LNPA 4L6OA 3SADA 2GVLA 2ZQ0A 3A21A 3DYOA 3VOFA 4PTXA 1REQA 3S2LA 2XN1A 4HU3A 1ITUA 3AIQA 2NW0A 1ZGDA 3DFTA 2IXVA 1XG3A 3I7SA 1UD6A 2VDHA 1SR9A 4LS2A 1R2RA 1R87A 4GOAA 3KM8A 4X60A 4BR1A 4O14A 1DJIA 5C9ZA 1ONRA 6TAAA 5GPRA 2DJXA 2OO6A 4IICA 1CGVA 5H8UA 2XG9A 1EHNA 1DXIA 3CL7A 3WLRA 4NSBA 2F2HA 2E6DA 2HBVA 3TMLA 3CJPA 2DEPA 4JTHA 4ZFMA 5A2CA 3JRKA 1KD0A 1QOPA 4XBKA 5EMJA 4KFPA 4ZO7A 4Q8TA 3UPMA 5AHFA 2X40A 3CUGA 5CZSA 3K46A 1OY0A 1OGGA 3C61A 1L6GA 1WDDA 5DBTA 1I0DA 3VDCA 3DHDA 1DJQA 1DORA 5HNUA 4FS9A 4LOCA 1SR0A 2GWGA 1HJQA 1RP9A 3UD6A 4Z08A 2YIHA 3LX9A 3NZPA 2X7WA 3GE7A 4NZJA 3WQCA 1DJYA 3AISA 5AYYA 3WJSA 4LCQA 3C52A 4YYFA 2AQVA 5BXTA 3KVLA 2QYGA 3H21A 3OG3A 4PBEA 4I7UA 1DWIM 1XGEA 5A6SA 3HPAA 2ZRVA 1L6SA 3H2CA 2WAGA 4KCUA 3QMRA 2NWRA 2O56A 2VWTA 3WCZA 3H55A 3N19B 2ZWZA 3IUDA 3WMCA 1HP4A 3VX0A 1Q63A 4HZMA 4KH2A 3WDPP 5HPOA 4E8GA 2CEQA 3TNBA 1XIJA 5D9OA 3W01A 4JEQA 3QJAA 4UXDA 2BOGX 1ZALA 3ENLA 3HPZA 2E67A 2Y8KA 1LZOA 3N4AA 4KKXA 1H63A 1WDRA 4JIQA 2EJ1A 3ERPA 4NI3A 1PIGA 1K7XA 3DDMA 1QBBA 3Q65A 1TWIA 3WELA 1JIBA 3KOZA 3SUTA 4YVPA 4US6A 2R1LA 4JDBA 3WK2A 1O68A 1YKWA 2XH2A 3A5FA 3RR1A 1JNDA 3FLUA 3MSYA 2PDGA 4FHAA 1XIHA 4IPNB 1B90A 4EACA 3QTPA 3TFXA 3BMVA 3GNNA 3BG5A 4P7NA 1V6WA 4HCLA 3FIGA 1L0PA 2CZFA 5JXQA 1XM3A 2RFGA 4D72A 3FVDA 1XLKA 1IR1A 1UR1A 4LBSA 3U2EA 1K9FA 4WX2A 1W9DM 3ARTA 4P8WA 3OVRA 4MB5A 1H5VA 1K9DA 4JQ1A 4NX0A 3K30A 2GJPA 4Q8WA 3W81A 5LNVA 5KEZA 2PC8A 1OFEA 4IGMA 2DT2A 1D8CA 1E4LA 4AZGA 3HM7A 4FXJA 3GC4A 3DG6A 4HYVA 1SVDA 3PUEA 2HS8A 3LLFA 4CLMA 4U3AA 3M5XA 1MMFA 3RAOA 1FFRA 3KE0A 3H4XA 4LC8A 5FAGA 1QTWA 2C14A 5BZAA 3T2QA 1OK4A 3PZ9A 3UETA 5JBEA 3NVDA 4QQ3A 4Y9NA 3BAWA 4C6LA 2G5WA 1B5TA 4O1FA 3W4RA 3OGSA 3WLTA 2GZXA 1V93A 4PMDA 1GOWA 5LNUA 5M3WA 3MC5A 3UXAA 4BCEA 1AQFA 3E0FA 1PKNA 1ZS2A 3G77A 2V2HA 1IWBA 2P1FA 4H83A 3M5YA 1GQNA 4AZCA 2IQ0A 2QDEA 1WDSA 1GVSA 1UOZA 5I3IA 2DZAA 4DJEC 3N4FA 1AODA 1XD0A 4WDXA 3SGUA 1RCQA 1UH4A 3SQSA 1JDFA 2XSBA 2C15A 3TW9A 2FTPA 2D20A 3BG3A 2OODA 2WKLA 3NZ1A 4QDPA 3S5OA 1PZ0A 2PDBA 4OHQA 4PB4A 1DJHA 3B8VA 5IDZA 1TSIA 3UVIA 3W2KA 2WZMA 3M43A 1LLZA 3I4KA 4C6PA 3UZXA 4DYEA 2HPMA 3VC6A 1OFOA 2Z1BA 4AD4A 1PPIA 3C8FA 1AQHA 2GJXB 2Q8XA 2R1KA 4NAFA 5CGTA 3L65A 2XWDA 4PMZA 4V15A 1TZZA 1TUXA 1JCLA 3U6WA 1Z69A 2QV5A 1TZ9A 4JHMA 1XLIA 3GNXA 3AIVA 3AYRA 1HT6A 1TYGA 4GO9A 4AD1A 3CV1A 4IG2A 2ZWYA 1TPUA 2V5JA 3ITOA 4HK7A 5LNRA 4Z0JA 4PMXA 2ZKMX 1EL3A 3OQEA 3N34A 3ALFA 2FHCA 3G5EA 1M68A 4HTYA 2PZ0A 4FOUA 3V5CA 1Q2RA 1KXVA 2J8TA 4AXKA 1H2JA 5TQLA 3ZVHB 1RJQA 4LALA 3R8RA 4AZ5A 1IEWA 2YL9A 2YDQA 3SGGA 3WF0A 3QR3A 1E3ZA 3IJ6A 5FACA 1R47A 2C1GA 4R53A 3W1TA 2V3GA 4H9ZA 4LC6A 4MAVA 4DPQA 4GQQA 3MDUA 4CUCA 3G8RA 1DYSA 3ABQA 3S1XA 4GRSA 4K36A 3L0GA 4ZODA 1W8SA 1E73M 1LL6A 5AHNA 4W9TA 3GNRA 2E5DA 3EOSA 3PN8A 4CN6A 2ACRA 3E2VA 1OX4A 2GQ3A 5FAJA 2ZOXA 4MGGA 4IJCA 2VYOA 2PDIA 5DXYA 4B5WA 5EMLA 1SZEA 1N8IA 3S4TA 4LPCA 1JRCA 4B3ZA 6PTDA 3WO8A 3PUDA 3QV8A 3SFWA 1G4SA 2GWNA 1RH9A 2HWGA 4U28A 4IP5A 1PYMA 5C2CA 3LD5A 1Q6LA 1BQGA 4JR5A 2Z1WA 4HJFA 4NILA 4GI9A 2DSVA 4EP8C 6REQA 3WF3A 1BWLA 2QUTA 3F03K 1RR2A 4LRTA 3S1WA 3MWAA 4OWGA 1THFD 3GVWA 2EXOA 4XKYA 1FWWA 3SY5A 3N2BA 4IJBA 4JFVA 4JFSA 1UR2A 3EXSA 3ZYZA 4R33A 2XVKA 4LU0A 3KL5A 1WOAA 3SRFA 3VGEA 1VGAA 3D3AA 5A3HA 4WQ6A 3WLSA 2PDCA 3IJLA 3C0JA 1XISA 3TYZA 2EAWA 4M24A 4X61A 3SIMA 3KZPA 1JYNA 2BNJA 4O12A 1HW6A 2A79A 2JQXA 2WSRA 2BXYA 4PRTA 1SO5A 4TO8A 4XD6A 2J4GA 5AC4A 4S3BA 3CHDA 1XLDA 4A21A 4XV0A 5KTLA 4UFKA 3II1A 1E4MM 1HNYA 2D22A 1LM1A 1UHVA 2Z7GA 2ALRA 1KWKA 3CAWA 1G94A 2HISA 1VJSA 2HSAA 1UZDA 3B9OA 1TV4A 2A2IA 4WSHA 2GYIA 3NQBA 3URAA 1ZQ5A 3FJ4A 2F6KA 1UB3A 2A1YA 5T8GA 1BD0A 2QUMA 5HINA 1QHZA 4A4AA 2ZZ6A 1W1PA 3QPYA 2AAAA 1TWSA 1AW2A 3R79A 3W1UA 1Q6QA 1GPWA 1KKOA 1BRLB 5C9RA 3PR2A 4Y8EA 1J2WA 4MJ2A 3ARVA 4XIAA 1P6WA 2DT0A 4PMQA 1HF6A 3M7WA 1JZ8A 4DXVA 2Z1VA 5I3FA 1XDJA 1Y7VA 2O4MA 3R1ZA 3W6LA 4M80A 1SMDA 1W5OA 3IS4A 4WSKA 4M19A 4LAMA 1F5ZA 3QY6A 4MADA 1Q6OA 4CU7A 2G0WA 3DKJA 2FKPA 3EAUA 4IPLA 4ATDA 4AX7A 3HPFA 4UMAA 3G1RA 1DJGA 5H91A 4ZMGA 4RDZA 1HL8A 5G4WA 1P48A 1JJKA 4Q8MA 1GZJA 4V33A 1OIFA 3UCCA 2WLYA 4BF5A 5HPCA 1KFJA 1U22A 1G01A 4L4LA 4JZ5A 1I6NA 5FEXA 1TJ2A 1A5LC 1PZ2A 1YW1A 1TELA 2DDXA 3U4FA 3SURA 4Z1YA 2PTYA 1UZ1A 4HBKA 4V1XA 2BFGA 4AY1A 1J0KA 3SEPA 1DP0A 3IACA 3W72A 5BOFA 1BVZA 1GOQA 1DWAM 4GWEA 3TVAA 3OA3A 5E6ZA 1DPMA 3MYOA 1GJPA 4TX8A 1OC7A 1XI3A 3GG1A 2E1WA 1CXKA 3C3NA 3WQ5A 1ITXA 5FJRA 1QVBA 3AHVA 4K8HA 3GDKA 5C54A 4DHGA 1AG1O 3WG6A 1PCWA 4N9DA 1VF8A 4EOUA 3DHPA 3ZT7A 1LLWA 3HTWA 2PDQA 3UESA 4D71A 1RCOB 1W1A1 3PZUA 2QJIA 3AI0A 3U48A 4FNSA 2MANA 1GYMA 2BVYA 1HKKA 4R34A 3LN3A 3AYTA 2H8ZA 4O8RA 1Q3NA 3AS0A 3TYCA 1IT7A 1AMYA 1W2VA 2NXHA 1JPHA 4EVZA 3MMUA 1KM0A 4DEFA 4JXCA 1LCOA 1NTHA 1Q45A 3MPGA 4DQWA 3WQ8A 4F9JA 4AVFA 5HQLA 1POKA 4CQ8A 1D3GA 1RZMA 4W85A 3D3FA 2PCEA 1MQRA 1BXCA 2VEIA 4K2SA 1MZRA 3SUUA 4OUEA 3EOEA 2ALDA 1E4IA 3LXBA 1XPGA 1OYBA 1TA3B 2Y5JA 4IFKB 2OU4A 2E9BA 1E4NA 4L9ZA 4IMCA 3VUPA 1W3LA 3FY1A 1Q6CA 1XV8A 5HANA 2QW5A 2VL4A 1H7PA 2Z4GA 1TPDA 1KB3A 3P0XA 3CASA 3G6MA 3VU2A 4YWSA 2J78A 4TOQA 4F0HA 5DANA 1VFOA 3ABZA 1R3SA 3QTGA 1YE4A 3GUWA 2Q3RA 1BKSA 4DWSB 1W5MA 4N6EA 5XIAA 1OB0A 5HMSA 4WEVX 3OU8A 4XTDA 5ABGA 1QI3A 1J12A 2C7FA 2YDAA 4C6NA 3HV8A 4PTWA 1KM4A 2WJZA 1DJWA 5G4EA 3DI1A 3JR2A 4EAMA 1VFTA 3CT7A 4HK6A 3W70A 2OSXA 4M6QA 4DBDA 4PC8A 2WQDA 1GEHA 1O66A 4EPDC 2WNZA 3G24A 2YOCA 1SM9A 1ALDA 3IVSA 3R89A 2QCLA 1TO3A 4HYRA 2Y88A 1IXOA 3RX4A 3VIIA 1V02E 3RCYA 1KM6A 2CERA 1KRCC 2X30A 2Q09A 1PTGA 1JZ7A 3M0YA 4QNWA 3L4VA 3NG3A 2P0IA 2Z0IA 3GSMA 2OO0A 2NV2A 1GVFA 3NIYA 4D1JA 4PCPA 3UWEA 1VLWA 4UOJA 3PTQA 3MKKA 1E40A 1Q6FA 3G1XA 4DJFA 4XZ9A 1HP5A 4M8UA 2EPLX 1BYBA 4K1GA 3VNZA 3UG3A 3W1AA 3BAJA 4FK9A 3Q4DA 1UR8A 4O13A 2GGGA 4MZ8A 3T0TA 5HOSA 2DIKA 2P3EA 1DJNA 2J7EA 4FSAA 1R5YA 4G7EA 5EMYA 2QF8A 1NF0A 1R7OA 1YNQA 3AO0A 3LPGA 3WD4A 1GOOA 5DMLA 2E5BA 2HMCA 2OZTA 1OADA 2D2JA 3MANA 3P60A 4C6EA 1M3UA 3QMSA 4JX6A 4RKAA 2DH2A 2A3HA 3K8LA 4BFAA 4UOZA 1BHGA 2C3ZA 3E2SA 4O4WA 2X1IA 4KCWA 1U30A 3USZA 3QMTA 3MY9A 1I0BA 1LTDA 3B8WA 2PP1A 1IT8A 4J3SA 3H2OA 2HBXA 3PFRA 2CLMA 3VOJA 2E09A 2QNEA 3OZOA 3TYUA 1XLEA 2YGYA 4M0XA 3CZGA 3QY8A 2W67A 3HG5A 3B8IA 3N4EA 5A95A 2YFOA 1MW0A 3HIJA 3GZ3A 2GQ8A 5T9CE 1MI3A 1O4UA 5EFFA 1DQUA 5A8NA 2WCGA 2ZADA 1PSCA 3NVTA 2PSNA 3NYDA 3H6OA 4OECA 4R7JA 4DELA 5D2VA 2OZ3A 1PIIA 2YA2A 3AS2A 3BW3A 3GNPA 5J5RA 4RXFA 2FGLA 3FXYA 4LH8A 1R2SA 2B7NA 1EIBA 1SSGA 3HGOA 2YL6A 2WNQA 5CJMA 3RLVA 4PSRA 5D05A 3PBWA 1HGWA 2Y89A 3L4TA 5ABFB 4S1FA 4Y7EA 4E3TA 4HJWA 2NX3A 1TTQA 3DXIA 1CXLA 1ZUAX 5IRPA 5H2ZA 3GFXA 3C2RA 4HCHA 3ARXA 1LRNA 4KFNA 4PR4A 2JGQA 3LK6A 3E0VA 3VMOA 4NKCA 3RXZA 1Q6GA 2VR4A 4Q4RA 4J2PA 2QPUA 4A8RA 1LL7A 3LHYA 4I5UA 3L4UA 5D9MA 4G1NA 3W84A 4GVGA 2PGRA 4QBXA 4L4MA 7ODCA 1ISVA 1QCWA 1QNOA 2J9XA 7XIMA 2FH6A 1RLDA 4PZVA 3ORWA 2BDQA 1W37A 3U0HA 2CU0A 5F1UA 2HV5A 5A8MA 3M0HA 3WLPA 4H7VA 9RUBA 5CPQA 5I03A 1M6JA 3J7HA 4ES4A 4LSBA 1GUVA 2PC4A 3CIXA 4XAPA 3IVUA 3ITTA 3CHEA 1Z44A 4P7RA 1QI2A 1PXGA 2O9PA 1VLIA 1RAKA 1FCQA 1BSLA 3G1HA 3DU0A 3TP4A 1S5VA 4GXPA 2NX1A 3I6EA 5CKSA 3KZSA 1ZTVA 4FX7A 4UQAA 3GVGA 4OBSA 3L2LA 2YB4A 1B3WA 4XUYA 5FJPA 2WSPA 1KGXA 3AZSA 4O57A 4KGLA 4TVDA 2F6XA 3W9ZA 4GYJA 2HZGA 1TWWA 4IP7A 1BYCA 4J40A 3UBPC 3W74A 2YSWA 2CLOA 1TPEA 1VJZA 3E2QA 1MDRA 3APGA 4D6FA 1LOQA 1FWAC 4WXZA 3GHUA 2VX4A 3UCDA 5C6MA 4UTIA 4DJED 4S39A 1KV8A 5BOEA 5FD0A 4ORIA 3KUMA 1JZ2A 3W07A 2QXWA 3BG9A 1UASA 3N2CA 1H51A 3GG7A 4J3VA 2ODOA 2R8WA 3LXAA 2F2KA 2PLCA 2MNRA 1V08A 3RHGA 3FJLA 1SSDA 3E5BA 1JNEA 5C7VA 1NOFA 3RX2A 3B9EA 3L2IA 3HA1A 2GL5A 4PBGA 1K3UA 3EX1A 5KMYA 4WOQA 3DGRA 1O12A 3LCLA 1RVKA 4J3ZA 2YCJA 2AL2B 5FIPA 3WH7A 1R2TA 1JRBA 1XBVA 4E2VA 2W66A 4LWWA 5BRBA 2OR2A 2ZIDA 2AMXA 4CNTA 3E0LA 3EWCA 4HU8A 3CUZA 3TQKA 3ARPA 3EWBX 2VC9A 3SQMA 3RIKA 2J77A 3TLLA 4UTWA 1XCFA 3KDOA 4J7RA 1EUAA 3F4CA 4FX6M 1MUWA 3SN0A 1MEWA 1QMLA 1VZWA 3DX5A 1EDQA 2NX9A 2PDFA 1CDGA 2YPIA 3PJTA 3H4GA 5CSYA 1NWTA 4LAZA 4C6MA 3GDRA 4ZQMA 4Q8QA 3VI2A 3ABXA 3WBXA 3AXIA 2Z28A 5CJ5A 4EE9A 3KAOA 4HN8A 5FF2A 1TPC1 1NDZA 3OPSA 4INFA 4IQJA 2FJKA 3RRAA 5MHBA 3GD6A 3A3WA 2FPVA 2DVXA 2PDHA 2IUZA 4O18A 4JYFA 3W02A 3M0IA 3R4IA 3EGJA 4CCZA 2DIEA 4BWLC 2RDUA 2BSLA 3EOLA 4ZQCA 5K2ZA 1AZ1A 1EDGA 3IK2A 3PJXA 1KTNA 4W7VA 3S1UA 4S3FA 2OB3A 3CIVA 2NT1A 5FI8A 1VHNA 3EDKA 3BARA 3STFA 1VH7A 2YCLA 4E2BA 2W3ZA 4DO7A 1VRXA 4L6DA 2JF7A 5F4SA 1CYGA 4H8UA 3DIPA 1VFMA 1V79A 2HROA 4OJYA 4E6MA 3PSVA 1SFTA 2BX7A 1UIPA 2ZUMA 2WBKA 2INZA 3CIWA 3W6MA 1S2UA 3W7JA 1U5JA 5AOUA 4EANA 4RV3A 1XUZA 1PO9A 3ECQA 4C65A 1RPXA 1KXTA 5M03A 1XG4A 4E8CA 2ZRYA 2J79A 3MO4A 1H3GA 1GG1A 1NOUA 1YXCA 1E6NA 4H8VA 3ZMRA 1CLKA 4CGTA 1GW1A 1AL8A 1N8FA 1EP3A 1ZAJA 3A4WA 4PN2A 2TPSA 4UIOA 3R8GA 4ZEPA 2VRQA 3APTA 3KWSA 1A0EA 1X39A 3LY0A 3W23A 4DM1A 4FR1A 4J3TA 1KBBA 4GISA 1KBJA 2PODA 3FYYA 3HG4A 4Z2LA 5EGRA 2OQHA 1N55A 2GJNA 2NVAA 1VFFA 4ERIA 4DBEA 3NA8A 2BY1A 5AYXA 2Z2AA 2EG8A 1P0KA 3GNOA 5AHMA 1J0HA 2BMBA 2ZRWA 1PKLA 1Q4NX 1UPMB 2B0MA 4GIAA 3IRDA 1TTPA 1JZ6A 1NWUA 2PRLA 1M01A 1LBFA 3LRKA 3BH4A 1VCVA 4LUIA 3DYPA 1Q6EA 5I6SA 1AH0A 3HQPA 1SW0A 3QZEA 4AVOA 5HJLA 1VPYA 3W1LA 4W7WA 4M51A 3VDHA 4I9AA 4FF5A 4HNVA 1UKPA 1QI0A 1Q85A 3GUGA 2OEJA 1EIXA 1TREA 5C2GA 3S5NA 1DE6A 4YNGA 2OX4A 3NQ7A 3I68A 2YW3A 1NF7A 1EPVA 2QAPA 5F2MA 2WC7A 1HO1A 4W84A 1QOXA 1W1VA 1Q7ZA 4HNOA 3IV3A 1ZRQA 3QFEA 3K4WA 3SSJA 5DRIA 4C6KA 1DBTA 3KWXA 3NPUA 4JTSA 1Y5WA 2D3NA 1X96A 1KM5A 1D3HA 3WBYA 1H09A 1MQQA 2J7FA 1CWYA 2QCHA 1CIUA 3NOYA 4B5NA 4LXFA 3FV9A 5A6LA 5K9DA 5AYIA 4RE2A 3NYZA 3N04A 1U5HA 3DOPA 4K8GA 2V0TA 4MPQA 4HA4A 1KM2A 1J96A 4UTKA 4JHZA 1XDMA 1T41A 5A8QA 4QIUA 3MKCA 3E6EA 3RMJA 3L5AA 4HIBA 5B7ZA 4H04A 3AMCA 3G1YA 4DWSC 1LDCA 5CG0A 2RKXA 4M29A 5XINA 3A5VA 5J04A 5A6MA 2PU1A 3MMWA 1Q6DA 2D73A 5EFDA 3ZS4A 3BLIA 3LHZA 1W54A 2QPXA 1P43A 5C9UA 3LM3A 3LLXA 2CCRA 3GIYA 2E68A 1I8JA 3WBEA 4AQLA 3PY2A 4AD2A 4TVCA 2F6UA 4TVUA 3QQ0A 1UR0A 2VRKA 1CECA 3UXLA 2AQOA 1A5CA 3BW4A 4IJRA 3EB4A 1OX5A 3CU2A 1XLJA 3B06A 4JD4A 3VIKA 5CZJA 2XIMA 4ZOAA 3NSXA 4MB3A 3NQVA 1WOBA 3TCSA 4JTFA 4N4QA 4W5ZA 3WJYA 5L9FA 2WZHA 1DOSA 4F0SA 1UQYA 3B8SA 1BG9A 4MZYA 1RXOB 1U33A 4J3XA 5KZEA 5JU6A 1H7RA 5C5YA 1EX1A 2CHOA 3CHCA 2CLPA 4KWOA 1EKOA 4IH3A 7A3HA 2R1MA 3V18A 4QG8A 4F40A 4Q8VA 1AW5A 1FWIC 3UT0A 4QXIA 1RV8A 2GVEA 1R38A 3NZQA 3I10A 3W7IA 1IF2A 2V68A 3P74A 3LV6A 3W7KA 1TX0A 3THCA 3AIEA 3TMQA 2OX1A 4F8XA 2A0NA 2JIEA 4EXAA 4N02A 3LPOA 3ZWTA 2UY2A 1DJXA 1YRRA 3PBUA 3MJMA 4N4PA 1GKQA 3TZNA 3GR7A 4JY9A 1T0OA 3ES8A 4ZTYA 3TEVA 4I9MA 5A2AA 5FA5A 4AIBA 4C1KA 1EOKA 4HHPA 4C6OA 2OKTA 4AZHA 1MO0A 4MKVA 2VEFA 3ZR5A 3PULA 2FFIA 4MZ1A 1XC4A 1ECQA 4AXNA 3M47A 4IOTA 3RM4A 3UYIA 3BWWA 1ITCA 3OZMA 3ZOAA 1M04A 4IUOA 2QIIA 2WW5A 4Z2KA 3W1QA 3W22A 2PDUA 3DFSA 1XFCA 3T09A 1DL3A 3PZTA 3GFYA 2PD5A 4GH3A 5I2UA 2GJLA 3W1XA 1MYRA 1EYWA 3SGZA 4DWDA 1U1UA 2GVJA 1RJPA 1L6FA 4BQ5A 3TROA 2OPJA 1W2PA 1NU5A 2XINA 1W8GA 1XYFA 1UIOA 4Q4SA 4RW5A 4H8NA 2R82A 4Y8FA 2B7QA 8A3HA 2C0HA 5U4NA 1JI1A 4B9YA 3LB0A 1XIGA 1GVOA 3ZSTA 5K9XA 4O10A 2BGQA 4RDVA 2YB1A 5CGMA 2PLKA 3SJ3A 4KEZA 4MMWA 1MRAA 3Q58A 2PMQA 3LI1A 3V5OA 3PFMA 3T40A 3TQVA 3W2LA 4BI6A 2A85A 3OHIA 3UWWA 2OOFA 4Y6GA 2CZDA 6ENLA 1XYCA 1GQJA 2BVDA 2YYTA 1QHOA 1U1HA 4H1ZA 3CAQA 3T8LA 2V82A 3VYLA 1I4NA 2PDNA 2VX7A 3VILA 3R0DA 2G96A 3RX3A 2IPFA 1MXDA 2C91A 1RBAA 1BF6A 3ONCA 1F6KA 4UQCA 2OGJA 3M46A 4PMYA 4U33A 4IMAA 2YXOA 3SCQA 2E5CA 2R14A 3W3OA 3OYXA 1QK0A 1K02A 1R8LA 3L7RA 2C19A 4HA1A 2G41A 2NUXA 3SI9A 4EX4A 4O53A 4O1CA 2J24A 4GY0A 4GQ0A 3A64A 1EJWC 1FA2A 1IHIA 4C7FA 4WVXA 1E0VA 3E0IA 2Z7KA 3SN1A 3NSNA 3T08A 4KPLA 1A3WA 4HHLA 1ZJHA 1J5TA 3EX2A 1GKRA 2D69A 2RGMA 3L4XA 4AD3A 4GGHA 1GVQA 4KCTA 4LQ1A 4RE3A 4D8LA 3BK0A 2PA6A 1S39A 1VYSX 4FF7A 1DXFA 1WPCA 4IMGA 1S5NA 3L4YA 4Y9MA 1J8VA 1G0CA 2P3ZA 3U7BA 4MAZA 3ARYA 3BC9A 1D9EA 1H61A 4AISA 3VE7A 3UYCA 2FQIA 2J7BA 4W8LA 5A69A 3N2XA 2QJMA 1XCXA 2IMRA 4CEXC 1E6ZA 1C8XA 4HN4A 3V5FA 3KS5A 3TU9A 1KR0A 4KERA 3R13A 1FWHC 3KBWA 4J3WA 3UY8A 4KEMA 4FR6A 3V3WA 1ICPA 4HKPA 4H6QA 1B3XA 3PWIA 2OEMA 4FA3A 4H9MA 3QPZA 3BJTA 2VJXA 1ZCCA 4OVXA 4GYPC 3OO2A 4EPEC 1NIUA 1D2KA 3GB6A 4GVFA 5CAHA 4K8EA 3LPPA 1PDYA 1JAEA 4UQ9A 3WDQA 1V3MA 3K8MA 4C1LA 2FMNA 1TPWA 2WHJA 3QXBA 1KW1A 1XGZA 1GZGA 1EJ7L 3BOXA 3PWGA 2HNHA 3VIGA 4C60A 2Z1SA 1P0NA 4LUTB 3LXCA 1H7OA 2WKJA 3E96A 4QITA 3G3MA 4JTUA 4AZCB 1OD8A 1VIWA 4B2DD 3SBFA 3RGTA 5A8GA 1E43A 1J10A 1E6PA 3KX6A 4YS1A 2BY2A 5BU6A 1E1EA 2ZA1A 2ISDA 3WF4A 4UTTC 4LF2A 2GVYA 3PC0A 3NXFA 1HX0A 3STCA 3WK3A 1JF6A 1JD9A 3V16A 1WZMA 4U10A 1K7EA 4BHYA 4V28A 4PTMA 1JF5A 4FOJA 4OOZA 4BZYA 1FDYA 1GK8A 2WMGA 4X9YA 4AWUA 4BF9A 3BAIA 1WB0A 3W88A 2DT3A 1Q7MA 3LBCA 3RCMA 2VEMA 2OGYA 3WF1A 2G97A 3WENA 3B8UA 1JCNA 1W56A 5DCBA 1S2AA 2NLIA 4UQEA 3DFHA 3AMGA 4Y90A 4MJMA 1TG7A 2Z26A 4WDTA 1NJJA 4JTJA 1OD0A 2XM1A 4CD6A 1PZ3A 2EEXA 2Z27A 4PEEA 1GWJA 3G1DA 4ORMA 3EPNA 3PK7A 3VKCA 4IG2B 5LNWA 2YLAA 1E6XM 3POCA 3A24A 3EA1A 4GC4A 4M6PA 3L68A 5ECUA 1UR4A 3D6NA 4ZOBA 1Z8AA 2SFPA 4US5A 4Q33A 4AG0A 2Y2WA 4AH7A 2J8GA 2P0OA 5D37A 2R94A 3AHTA 2QLYA 3WLLA 3QHOA 3IJQA 4O15A 1UR9A 4NXKA 3LYEA 2XIIA 2YZRA 3QYQA 1GKPA 4HMEA 2XVPA 2WOQA 4D2JA 4NYYA 3WH5A 1KCKA 1KRBC 4IXXA 2O55A 1AD1A 3PVFA 3W7LA 2UY4A 2ZRZA 3CAVA 1DWGM 2HXUA 1CZ1A 4KFOA 2EG7A 3R94A 3OBKA 2PTWA 4ZR8A 4FXFA 4IIBA 1UJQA 2Y24A 4P8VA 3DI0A 4Y96A 4QSFA 1A5NC 1BF2A 1FQ0A 4LVBA 5HUPA 4ZO6A 1TWZA 1F3WA 4FOKA 5HDRA 2NLYA 3P5ZA 4I9TA 4MHBA 1OGSA 3URQA 3WBWA 4AC1X 3CAKA 2WSKA 2C0AA 3WQGA 4CD8A 5REQB 5FL1A 3AIUA 2VGBA 3OGRA 4XZMX 3SY8A 2Z1XA 2V3FA 1OX4B 3HOJA 1D3CA 3SIZA 4X2PA 2VZOA 4XG1A 4FP1A 3BAKA 3EMCA 2XTKA 3UWUA 5D9PA 3W83A 3AOFA 2WMFA 3A3XA 5IHSA 4DNHA 1DIOA 1UZ4A 1LRQA 4UTMA 1UCWA 2VURA 3LCFA 4WZHA 4KWWA 3E9AA 1TVPA 3A13A 1DHPA 2D0FA 3NQGA 3EMZA 4XZLX 4GINA 1KR1A 3BJSA 4F0RA 1ZP4A 1K8CA 4H6RA 4YXGA 2VEPA 4XKYB 2V30A 5MKGA 3LUTA 5LYRA 1DWFM 3GXNA 1XLFA 4ZO8A 3I3EA 3THAA 2O9RA 3QF0A 3NAVA 1UWTA 2PF8A 4QR6A 4Z2JA 4WKAA 3VOHA 1I45A 3W1RA 1RK6A 3O16A 1T6MA 3VNMA 3BSMA 3QV9A 1FOBA 3GTHA 2V2CA 2Z29A 4IGSA 2VGGA 2ACSA 4OKDA 4URIA 3CZKA 5CQ1A 5HR6A 5AC5A 3HQOA 4UTHA 3Q67A 3IARA 1IZJA 3MI3A 3TONA 4UCFA 4GFIA 3MU7A 4R88A 1IEVA 1XX1A 3CQIA 1UD4A 4UFJA 1UD2A 2VM8A 1RD5A 4J35A 1MXGA 3TN3A 3F2DA 4XO6A 1ZHAA 3KCOA 1J01A 3LI0A 1X1ZA 1YXDA 1G1YA 4KETA 1F76A 2E4TA 3TTEA 2ZX7A 1A5MC 3AALA 4OT7A 2I17A 2CKSA 4ATLA 1FXQA 3A4AA 5C7HA 3FJ6A 1TCMA 4QLLA 2PI6A 4TMCA 4XBSA 3WN6A 5I7GA 4LS0A 3STEA 2QV4A 4A6GA 4NXSA 1V6YA 1QW7A 2FIQA 4KESA 1HQTA 3GG0A 4H7ZA 1J0IA 2R9RA 2YZ5A 1EC8A 5FL0A 4K6AA 3DFYA 2XH7A 2I9EA 5AZ0A 1W6TA 3LOTA 2EF9A 2V38A 2YCEA 3OW1A 1H1YA 7TAAA 2RDXA 5XIMA 2CWNA 3GDLA 3C2EA 2BV9A 3P0WA 2DU2A 1E9LA 5HXMA 2WJEA 2G4JA 2D2OA 1QI4A 2X0SA 2QR6A 4FALA 4DAIA 3QGKC 1GJUA 3T4WA 1UR3M 4XD4A 1NEYA 2BGSA 2CWXA 1Q5MA 4QTGA 4KS0A 4ATWA 1XIIA 3SFKA 1PL9A 3PJUA 5CPNA 2VGFA 4KRTA 1NP2A 3CV2A 1RQEA 3PBYA 3NEVA 1EQCA 3G2GA 1ENUA 1E3XA 2BASA 2QCMA 1BTCA 2IPJA 3NTYA 4IQDA 1DJZA 1AVAA 3NQEA 2XGZA 3HN3A 1GG0A 3C86A 1OSEA 1Y5VA 2PWGA 3VNYA 4C6IA 3I65A 4K68A 4AAJA 1FX6A 1HVQA 5FEZA 3OB8A 2PB1A 3TXVA 4XB3A 1E1CA 3LTPA 4CQ9A 1U5VA 1IZCA 3MO7A 4CQAA 4DWSD 3G1VA 1XCWA 4WGHA 3LSCA 1IXPA 1ITQA 3VABA 1L2UA 2UV8G 4I8DA 5CC6A 2DP3A 3CL8A 3LENA 1KO0A 5AVNA 3RUBL 1W1B1 4GYPA 1GYLA 3MHGA 1B1YA 3W7EA 1W1TA 1E56A 1M7XA 4AIEA 4S3JA 4X3ZA 3BANA 1JUKA 4C6CA 3AXXA 1R9XA 3TOPA 2IKIA 1L6WA 3K1GA 2Y61A 2VD8A 3XIMA 3TN5A 2HDJA 4IMEA 3N6JA 5A6BD 1P1MA 2VEKA 2ZZ4A 1VR6A 4AC7C 4LUJA 4REQA 3LQLA 5JBFA 5D30A 4GFSA 4XVEA 1MRQA 3SO7A 3BL3A 4FEZA 3T0DA 1UYQA 4DO5A 2E7FA 4QSHA 4HHMA 2E1DA 4UTTA 3V36A 2DSUA 4BQ4A 4Y2WA 3GU1A 1IYXA 2PDXA 2NQJA 1LWJA 1EF3A 4LBUA 4FNQA 4CU6A 1JUEA 2FGZA 3NO3A 3IGSA 1YTKA 3HBLA 1G7UA 1PDZA 4OZOA 4OBTA 4BY3A 2VCCA 1F8MA 1K7FA 5I09A 5C70A 4MSSA 1GVRA 1CLXA 1Y8BA 2PLMA 3O06A 3DFPA 3V7PA 3UP8A 1JXJA 3MBDA 2XIBA 3ZR4A 4L4OA 2TRSA 1Q13A 4DM2A 5E0CA 2FTYA 4QS5A 1CB7B 5A94A 4V1YA 4WGXA 3PZMA 2ZXBA 3VKBA 1HKWA 3R25A 3KOFA 3WBAA 3WFLA 5DY3A 1W9VA 1NQ6A 3SM0A 2GLKA 1HO4A 4JNMA 4S2BA 2KX9A 3PAJA 5FSEC 1FWEC 4QGCA 4DZAA 2E6FA 2PZNA 4GKTA 2VO5A 2C16A 1I1WA 5E0KA 3P8IA 3QW4B 1LBLA 4FZIA 4JKKA 4N42A 5IXEA 1F3TA 2WMIA 1G69A 2ZXDA 3PBVA 1QNQA 3U2ZA 3NNTA 4H2HA 1S5MA 2XN0A 4NJJA 1MVYA 4JX4A 1UMYA 3BUVA 4CCEA 4HTBA 1RLCL 1I1XA 1AH4A 4OUIA 3E02A 3ZSSA 3YPIA 3ZXWA 2J25A 2B4GA 4HOZA 1CPUA 4UB9A 2HK0A 2NQ9A 1FWGC 3KTXA 4D1IA 2VOMA 3K2GA 4WF7A 1V7YA 2C1IA 3WUEA 3W7NA 3TWBA 1UUQA 2WMJA 3DFNA 1EJVC 3IVTA 3TSBA 2E40A 4HMDA 2YDSA 1IE7C 1EP2A 2EO7A 2H6RA 1RUSA 4EF8A 2ZUVA 1KLYA 4JN7A 4CD5A 4G7EB 4MYAA 1S2VA 3GVRA 5LGZA 3WLOA 1WKFA 4A8NA 1KGUA 3M41A 4XTIA 1G67A 4H3DA 3NQAA 3AYVA 3RU6A 3THDA 1XL9A 4HD5A 2VRJA 1HJWA 3W29A 4YIWA 2JKPA 1HXJA 1XLBA 5BWFA 3AHZA 1UP2A 4JTEA 5J5DA 4YHEA 2NQHA 1EA0A 4ADSA 2GOKA 3SW6A 4W8AA 2BVWA 5