2O9TA

Beta-glucosidase b from bacillus polymyxa complexed with glucose
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase B
publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 163
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9tA00
4Z2IA 2J8FA 4TVCA 4GQRA 3WQ4A 4W7UA 3EYPA 3AMLA 3TTQA 3AHYA 1E72M 1JDCA 2W5FA 2O9OA 3NYDA 4Q22A 5A2AA 3WUEA 3AI0A 3W6MA 1HKMA 2UY5A 4LPCA 4W7WA 1QPKA 2XVGA 1QI0A 3WMCA 2J7HA 2OSXA 1UHVA 1GORA 2XGBA 4HA3A 1MYRA 1E15A 1CBGA 3QHOA 4W5UA 4UFHA 3L4WA 1E73M 1NQ6A 1CXIA 3ZR5A 4JIEA 4ZXOA 1TMQA 4ZE5A 4TX8A 4FLQA 3VD3A 2JALA 3SIMA 2PI6A 4M24A 1Q6FA 4C7GA 1XH1A 3VGFA 2YL6A 1RH9A 2WMIA 4MDPA 1XC6A 5A6MA 1KXVA 2D2OA 4GZJA 2XFRA 2PWFA 2VJXA 4WK9A 3O9NA 4AZ6A 4PN2A 3WD3A 2J7FA 4ZENA 2Y24A 1BGAA 3KEHA 1CENA 3N11A 1MW1A 2D0FA 3PZUA 1MW2A 4PCTA 3BAJA 3RILA 2WMIB 3VOCA 4C7DA 1H0IA 1Q6DA 4AIUA 4BCEA 4QLLA 4P8XA 1H5VA 1BQCA 5D8ZA 3PZOA 2XM1A 2A3AA 3WSUA 1M04A 2WCSA 4B3KA 4RE4A 3VIJA 3L4XA 1QHZA 1W2PA 2MANA 4HPHA 5C8BB 2VRJA 1E1EA 3WENA 4KRTA 4HP5A 1FH7A 2JEQA 2VT0A 4GI9A 1K9FA 3MV11 3WUBA 5DFAA 1JDAA 1PAMA 1ZBCA 5CSYA 1R86A 3IJ8A 5A6SA 1FHDA 2W66A 1SYTA 2V38A 3BC9A 3CH9A 3KL3A 1GNXA 4J3SA 3VIKA 2Y5EA 2CBIA 4W85A 3ARTA 1ZBWA 2QPUA 4KGJA 1WKYA 4J28A 3GXIA 2VX4A 1C7TA 4TVUA 2J7GA 2EJ1A 1OM0A 3T2OA 3ZM8A 4MNJA 4HZ7A 1E5JA 5HBFA 5E70A 3PZVA 4HZ6A 5EB8A 1UKTA 5CG0A 3AIVA 1TFVA 2J4GA 4AZIA 3SCQA 2ZUUA 4IISA 2WC3A 4RE3A 1IZKA 2WBKA 4AXNA 1BYAA 2O9RA 4DWSD 4EE9A 3NSXA 4JHOA 4H7VA 4IM4A 3AICA 2VZOA 2DQXA 2ZX8A 3QHMA 1NWSA 1BLIA 2ESCA 3MUIA 1WZKA 4GI8A 4AYSA 5EFFA 1OWQA 3VO0A 4D6EA 4MTVA 4WF7A 1UH3A 4JCMA 4PMZA 3B9AA 4OBRA 4ZXLA 2OSYA 2ZICA 4JFSA 3WH9A 4OUEA 3FHQA 4HU8A 3CGTA 3U7BA 3AIWA 4WLCA 3PZGA 1S46A 2E4TA 1XCXA 5IHRA 1L0PA 1B3VA 1HJWA 4AZBA 1BYCA 3VILA 2G8ZA 1C90A 5IXEA 3AMGA 1ISZA 2WPGA 3W26A 3AXXA 3W4RA 3WNMA 2ZIDA 4WKAA 3WF3A 1KGXA 1PZ2A 2YA1A 2E8ZA 2A3CA 1KXHA 1CTNA 3VGGA 3L4TA 3SEPA 1OT1A 3AMKA 2ZXAA 7CGTA 4ACYA 3SCWA 1GOIA 1PBGA 4IPNB 4JKMA 3L4YA 3AXIA 3L2MA 8CGTA 1W9BM 2DSVA 3CO4A 4MNKA 3B9EA 2OYLA 5ABFA 1RD6A 3VX0A 4AD5A 1XV8A 5ABGA 3ZT5A 3T09A 4P8UA 3AS1A 4LX4A 1UWIA 1WPCA 2OYMA 1HF6A 4IUGA 1TUXA 3LMYA 5BXRA 2VZVA 2J47A 3ARWA 3BSGA 3VPLA 5DMYA 5A3HA 1M01A 4GZEA 1CGYA 3GNOA 4OOUA 2FGLA 4V27A 2WZIA 3WQVA 2DSUA 4NRSA 2QLYA 5ABFB 3CHDA 3ZIZA 1KCKA 3O6AA 4MAVA 1MVYA 1CXLA 1I1WA 2FDMA 4CVUA 2XVLA 3CZGA 1FHLA 3FY1A 3M6DA 4V28A 4EK7A 4D6GA 4QLKA 1PX3A 4D6IA 5HNNA 2YL5A 1SFSA 1AQMA 2OWCA 5BROA 1VBUA 3AS0A 5FOOA 2D20A 3ZQ9A 2WWCA 1G0CA 1QNQA 3T0BA 2VC9A 1UR4A 1V3HA 1UA3A 1UZ4A 4YHGA 3TOPA 4PTWA 1UD4A 1QNPA 1ODZA 2CCRA 4JL1A 4CU6A 2VO5A 4AD2A 4MB5A 2GDVA 3POCA 2YJQA 1H0GA 4E8CA 1LLOA 3W25A 1G5AA 5DF0A 1EGZA 1UUQA 5FIPA 5IHSA 1HT6A 4U5IA 2YBUA 4W87A 3WDIA 5CGMA 1QBAA 1JL8A 3ARXA 4NRRA 4PMUA 1W3JA 5E0CA 3WNLA 3FN9A 2PC8A 1AQHA 3ARRA 4ZEPA 1CGTA 1LL6A 4KRUA 4DWSA 3CUJA 3MV01 4PMOA 2WSKA 3T2QA 4UQ9A 3A6OA 4B16A 1XCWA 2CESA 1QI3A 1QNOA 3VGHA 1BG9A 5CQ1A 1E70M 1VB9A 4HU0A 1ISXA 3U57A 3W27A 1V3LA 4WSJA 7TAAA 1VAHA 2JIWA 3WD1A 3O2LA 5I77A 3VIHA 4DWSB 1JYNA 3WF2A 4P8WA 3W81A 4CU7A 3AS3A 1SMDA 5EFDA 2D3NA 2CBVA 5I78A 4TTGA 3SCOA 5A94A 3WN6A 2YDRA 2O92A 3WQ6A 1CLVA 5BRQA 4RE2A 3N9KA 4AIEA 4D6DA 3NDZA 1QW8A 2X2YA 2DDXA 1W9DM 2WK2A 2J7DA 4RL3A 3GXFA 1F4HA 1E4NA 2J62A 4F9JA 1B3XA 5D4YA 1H09A 3SCTA 1BG4A 2XFFA 1WZAA 2UWFA 2FHBA 3T0AA 5A8QA 5A1AA 2J7CA 3E1F1 4B15A 1XSJA 4DWSC 2ZX5A 4ZFMA 3NJ3A 1B1YA 4AWEA 2XPKA 3PZMA 1YHTA 4EANA 2XVKA 1DEDA 1G94A 1OT2A 5ABHA 5M5DA 1QHOA 3VNZA 4UFLA 3MS8A 2WLYA 5E9AA 3K8MA 4Z2KA 5BRPA 3PHAA 2VTFA 1Q6GA 4UCFA 5A6BD 1J12A 3IJ9A 4H04A 2YL8A 4S3JA 1GQKA 1UH2A 2FHFA 1BVZA 4AZCA 1E4LA 4JFUA 2VL4A 3ZJKA 2X1IA 1DWHM 5JBDA 1V0MA 2FH8A 1JD9A 2WZEA 1OB0A 1CGUA 4JZ5A 3SUSA 2QMKA 2WW5A 4GPNA 5JUVA 2W62A 1E0VA 4CVWA 2UY2A 1K9TA 4CD5A 1ZBKA 2E40A 1TVPA 3VINA 1E6ZA 1E6PA 5A6AA 1JNEA 2VZTA 2AMGA 3AYSA 5A69A 1Q4NX 1R7AA 1E40A 3CHFA 2DSWA 3WFLA 1HJUA 4FK9A 1HKKA 4DUWA 2EPOA 4BQ5A 2CPUA 3MMDA 3HJEA 2GJXA 4LYRA 1OBAA 1E3ZA 1J0KA 1JNDA 3PZQA 4W8AA 3N13A 1UD5A 2VR5A 4MAZA 3NCOA 4H41A 1HJQA 1SR0A 3B8SA 4AZ7A 4LGXA 2XGIA 1W1VA 5A8NA 4PTVA 2GJXB 4BS0A 3CIVA 2F2HA 4P7RA 1U30A 4AEFA 1DWJM 4EAMA 2JEPA 2X0HA 2HVMA 1HL9A 4U5KA 3T2PA 3ZT6A 3SCSA 5I24A 1EO5A 4XB3A 2PWHA 5BCAA 3WF0A 3L2LA 1GOMA 1GW1A 3LPFA 5JIPA 1KXQA 4HMCA 3N1AA 2X05A 3AQUA 3GH7A 2WMFA 4UQCA 2GVYA 5E6YA 4XZBA 3ALFA 1PIFA 1W3KA 2IXVA 3OLDA 3EBVA 2WMGA 1V3IA 2RGMA 3ZJ6A 2ZOXA 5C71A 2J8GA 5M17A 3G6MA 4BQ4A 1NM9A 1QI5A 4QDMA 5BXTA 1E6XM 4A4AA 3PN8A 5D8WA 1D2KA 4UZSA 3AHZA 1WO2A 3ZSSA 3CUFA 1C92A 1FOBA 3WNNA 1VFMA 2CIPA 5D9OA 3AS2A 4M8UA 2JIEA 3VM7A 1WDQA 5GNYA 4CD7A 1ISVA 3GBEA 2D1ZA 3VD9A 2RGLA 5LYRA 1DWIM 5CLWA 3ARPA 1O6IA 1EXPA 1NWTA 3G6LA 4PSPA 3WH8A 4H8HA 3UR8A 3PTMA 2YOCA 2Y4SA 3AIQA 4MB1A 4F9DA 1GPFA 4ATWA 1J0ZA 4WKFA 1ZBVA 2XUCA 3CZLA 1JYVA 3N12A 5A6BA 1JZ2A 1XSIA 1BVNP 2V5CA 1OCQA 3UCQA 4Z2HA 3SUWA 3WF1A 4AISA 2VRKA 3S6TA 1MQRA 1VENA 3PZNA 3PZTA 1UWSA 2Y2WA 3PTQA 4N0RA 1BAGA 3N15A 1J0YA 3DECA 3HMCA 1W9VA 2YL9A 5D9MA 2X09A 2E9MA 3HN3A 4TXEA 1V0NA 2J79A 4JFWA 1HXJA 4KWUA 1DWGM 1WDPA 1H41A 3AROA 3VGBA 3CZ8A 3VKKA 4W86A 4PMDA 1MFUA 4ATDA 1OSEA 1MQPA 2DT2A 1NH6A 1LG2A 2YA2A 3W6LA 2NW0A 1UD3A 5A95A 1CGWA 1US2A 1H3GA 3EDFA 1Q6CA 1MWOA 4GINA 3QGVA 3KZSA 3VD5A 1H2JA 2EPLX 2XJ7A 4YHEA 4CCEA 1W2VA 2CNCA 1LJYA 3VIIA 1H11A 1QNSA 1UR9A 3F5LA 4AEEA 2GDUA 2WB5A 4PUEA 1LWHA 2GJPA 1HKJA 1I1XA 2EPMX 5CLTA 3UETA 1WZMA 1GQJA 4ATLA 2W67A 2B31A 4X0VA 1GOOA 1E0XA 3RPMA 4UOZA 3CUHA 1PIGA 2WVTA 4U2YA 4D6JA 2YBTA 2BY3A 3BMVA 7A3HA 1KGUA 5IFTA 3ARUA 3EMCA 1B9ZA 3FHAA 2WXDM 3THDA 2CYGA 3CZKA 2WZHA 4IPLA 2WCGA 3J7HA 3RJXA 1ESWA 2JF6A 5CPSA 4D6HA 3BXWA 1UWRA 3BGAA 4JCLA 1UZ1A 1CXHA 1EHAA 1UG6A 1ECEA 3T08A 2YIHA 3WMBA 1BSIA 1CEOA 3SUTA 2W63A 1N82A 3WIJA 4P7OA 3VIMA 3VM5A 3RJYA 1JDDA 4PEEA 4WJXA 3THCA 1GQIA 4AIOA 2WM0A 1W1YA 3N17A 2XWDA 3SCRA 1CXEA 1HX0A 2NT1A 1GZJA 2EXOA 2VVSA 4Z2JA 2XWEA 4B3LA 4D6FA 3DYPA 4GO9A 4J3TA 3BAIA 1EO7A 4F66A 4AY1A 3RMEA 2VUYA 4UR9A 2G4FA 2OWXA 4UQAA 1RP9A 3WNKA 1HN1A 1LWJA 1HNYA 2E9LA 2Z1KA 2HISA 4DUVA 3BAKA 1BYDA 1EDQA 2WMJA 3GXMA 4JFVA 2BFGA 1DWFM 1FFRA 3VDHA 4FMVA 2DH2A 3WQ5A 5A6KA 4CN1A 4AD3A 4PMVA 1NOUA 1R8LA 1MW0A 3ARYA 1CZ1A 3AFBA 4UFIA 3BSHA 1JZ6A 3MSGA 4N42A 5KZ6A 1KR0A 3U7VA 1X6LA 3ECQA 3W24A 2QV4A 1W3HA 1EIBA 3I3BA 4QAWA 2J78A 1C7SA 3KL0A 5I23A 4E8DA 1RPKA 1KR1A 1D7FA 1QI4A 5CPQA 1V6VA 1HP4A 3CUGA 3MKKA 3GH5A 1GHSA 4V2XA 1JZ7A 5E0FA 3ZSTA 4BA0A 1K6AA 2C0HA 5TD4A 5FD0A 2AAAA 1Z32X 5LA0A 3WL0A 1TVNA 1FP8A 3K8LA 1B2YA 1JXJA 1ITXA 5I2UA 2BHZA 3A4AA 1XYFA 3FNDA 1E5NA 1G9HA 2FH6A 3PBGA 4WIWA 3M46A 4LXFA 5GNZA 5LA2A 1JYWA 3UESA 2V5DA 4M29A 1XD1A 4PMRA 3ZO9A 4GO8A 1WZLA 3W38A 1GQLA 3GXDA 3RM4A 1KGWA 2UY3A 2EBNA 1SMAA 2BY0A 3FAWA 1LL4A 2XVPA 4NZCA 2BHUA 1E6NA 4HA4A 3WDQA 2YDQA 3D3AA 1FH9A 2J7EA 3OB8A 4GI6A 2DPEA 1W32A 3MSDA 4E4PA 4PMNA 5M03A 2D0GA 4MJ4A 2OSWA 2BVDA 4UFJA 3OGSA 2OYKA 4F8XA 4S3KA 1VFUA 5HPOA 1W9PA 3VX1A 1XD0A 2Q8XA 3OGRA 4W7VA 2PBGA 1UR2A 1GOKA 5ABEA 1VJZA 5HXMA 3GDBA 3CZJA 1OIMA 3CUIA 4TOQA 3BLPX 4OKDA 2AOSA 1JZ8A 4D6CA 5FL0A 1KQYA 1BHGA 4U3AA 2WHKA 4J3WA 2WMHA 4W8LA 4B9YA 1QBBA 2G3MA 2W61A 1E43A 2VR4A 2DH3A 3WH7A 4AD0A 5HOSA 1W91A 2ZWZA 5I6SA 5E6ZA 1HJXA 5A8MA 5HPCA 2DSZA 3KL5A 4YPJA 2E0PA 2A3BA 3UG3A 5I0DA 2DGAA 2GUYA 1V6UA 3VMOA 1TA3A 3W82A 3WDPP 2EPKX 1CXKA 3WDHA 1CECA 1BTCA 2VQUA 2CETA 1LG1A 1OD0A 1TZ7A 1BFNA 3A4WA 1WAWA 3OGVA 1FP9A 3L4VA 2BVTA 3VMPA 1UR8A 3ARZA 1OIFA 1UQYA 1DP0A 5DT7A 4W93A 3OLEA 2TAAA 3F5JA 3EMZA 2PWEA 4M1RA 2CBUA 3VDBA 1E56A 3NSMA 3POHA 3MMWA 4TVDA 3N04A 2PWGA 1PJ9A 1A3HA 1J18A 5ECUA 1MFVA 1OGGA 3VIPA 2V3FA 3OZOA 4JL2A 1V6YA 5EMYA 4URIA 3BH4A 3LPGA 4AZCB 1VFFA 1WNOA 2DSKA 4GZIA 2WBGA 3SUUA 1JD7A 2XFYA 3WEOA 4TUFA 3AIBA 3L4ZA 2J77A 3AZRA 3NDYA 2IUZA 1V3MA 1C8YA 1HL8A 1KFWA 3MO4A 1ZU8A 5AC4A 2XSBA 3DHPA 3PTKA 3NUKA 2WMKA 2PF0A 4CD6A 4ML4A 1KBKA 1NOFA 2A3EA 3II1A 4WKHA 2F8QA 1KQZA 3EDEA 4OZOA 1B0IA 4WSKA 4HOZA 2NT0A 3EDJA 2VRQA 2D22A 3VIOA 2VX7A 4W88A 3OA5A 3WD0A 2FGZA 4OJYA 3QOMA 3K4DA 2XYLA 4AW7A 4NSBA 2CHOA 4UFKA 3ALGA 1ISYA 1ZJBA 4CUCA 3K8KA 3PZ9A 1PPIA 2W91A 1C8QA 2F61A 3NSNA 1QNRA 2CKRA 5E09A 1D3CA 1H1NA 1HKIA 3GTNA 4MNLA 3UG4A 1AVAA 3AHTA 1CNVA 3AIUA 1KXTA 2W92A 4J3VA 4M80A 2G3NA 3EDDA 5AYBA 3VIFA 2E3ZA 1GONA 2JF7A 4HMEA 2QHAA 4JFTA 1W1TA 5CSUA 1UWQA 3BLKA 1C8XA 3IJ7A 4CN4A 3U5YA 2WHJA 4TTUA 3TTOA 1E3XA 3WELA 3WH5A 4XZWA 4U2ZA 3RIKA 3W53A 1BPLB 1VFOA 3CLWA 4P8VA 3CPUA 3RDKA 3BCFA 4CGTA 1DTUA 2UY4A 4M82A 3WQ8A 1UWTA 1UR1A 3SCNA 4LYQA 1V02E 4FF5A 1UR0A 4BQ3A 2DEPA 1GJUA 3VU2A 3VD7A 1J0HA 3ARSA 5D9NA 2VZUA 1UQZA 2BS9A 1G01A 3AOFA 4H8VA 4HMDA 1NOWA 1XRVA 3VGDA 2O9TA 2IXUA 2XHYA 2XIBA 2XIIA 1V03A 4MDOA 4M81A 2GFTA 1EOMA 1UKQA 2BNJA 4QLJA 4HPGA 1J11A 2ZX6A 1UD6A 2ZXBA 4NF7A 1JAEA 4QP0A 3UERA 1GJWA 1UD2A 1MXGA 3GM8A 1KWGA 1R7OA 3W28A 3VTRA 5CXPA 1M53A 3WUGA 3OBAA 4ACZA 4K68A 3ZJ7A 2CITA 1JYXA 4J3XA 3ZOAA 3WL1A 4U3CA 2ZUVA 4MB3A 4F79A 3GNRA 1NARA 1ZL1A 2ZX7A 3TA9A 3CZEA 1DHKA 2EEXA 1GVYA 1GUVA 4HOXA 2DT3A 2JFEX 5IFPA 1PX4A 1CDGA 4ACZB 4HA1A 4BZYA 3DC0A 5A6JA 3WMSA 3N18A 1EHNA 3SCVA 2J74A 3WDRA 3OZPA 4W5ZA 3VMNA 3AMCA 2ZXQA 2BY1A 2PBOA 3TTYA 1IZJA 5CGTA 1V3JA 3GBDA 1EDTA 3OLGA 4YN5A 1E55A 3WY1A 3MUY1 3AYRA 3AISA 3WKZA 1FA2A 5M3WA 3CMJA 1J10A 2G3JA 4XUYA 4B9ZA 3CHEA 1OINA 1OD8A 5FKYA 3CHCA 3IK2A 5CJ5A 4MJ2A 1EQCA 1XHGA 3B9DA 3KE0A 4PMYA 1X1NA 2WCAA 2GK1A 2XSAA 1HVXA 2ZX9A 4HOWA 3SUVA 1JF5A 2WVVA 1U33A 1PZ3A 3BMWA 4PBGA 1Q6EA 4JKLA 1WCGA 3CTTA 2VOTA 1UKPA 2EQDA 3FAXA 2ZUTA 3F5KA 3UG5A 4FLSA 4PRWA 1GHRA 4U33A 2GK1B 2C7FA 3M07A 5KEZA 3M7SA 3QOKA 2WVVB 1IT0A 3K46A 4QCFA 4MNMA 3VNYA 1HVQA 1UYQA 4JAWA 1JG9A 1VJSA 1TCMA 3IAQA 1LF1A 2WHMA 2VQTA 3WFZA 1CGXA 4PTMA 4AMCA 1BGGA 1KCLA 4Q7NA 4Y7EA 3MANA 3OG2A 1NP2A 4KMQA 1R85A 2VCAA 3CBWA 1V3KA 4UOJA 1V0LA 4D1JA 4UQBA 3F4VA 1H49A 3NIYA 1UWUA 1KBBA 4GXPA 1TE1A 1Y7VA 1GVIA 2DIEA 4UOQA 2VZSA 1JZ5A 1IV8A 1CYGA 5AYIA 2XTKA 4MADA 3T0DA 5A2BA 1W1PA 3WD4A 1HJSA 2CHNA 3K4AA 3ZT7A 2V3GA 2YLAA 1EA9C 3AMDA 2Y8VA 1DWAM 1ZS2A 4LQ1A 1OGBA 2QMJA 1WDSA 2V3DA 2X0YA 2WLZA 5BWFA 1OGSA 1R87A 4X9YA 1E9LA 2WHLA 2ZUWA 1WDRA 5A6LA 2ZE0A 3VGEA 2J75A 2D23A 3APGA 2WYSA 3SCPA 1I75A 1L8NA 4D71A 1WE5A 4FLRA 2WVUA 1TR1A 5FL1A 4XX6A 3IANA 4QFUA 2A3HA 4TX6A 4HZ8A 1M7XA 1UOKA 5JIWA 1JXKA 4AZ5A 2YKKA 3TONA 4A3HA 1GOWA 1MW3A 4AD4A 3LPOA 3AZTA 1JZ3A 1EQPA 3TP4A 4OIFA 3AIEA 2GJRA 3JUGA 5BXPA 4R27A 1RP8A 4HTYA 3MU7A 3WH6A 4UNIA 4MPKA 3ARVA 3OLIA 4PMXA 1ZB5A 2CKSA 3WNPA 1B3YA 1B90A 3DYOA 3VD4A 1E6QM 3I3EA 1LL7A 1BF2A 1US3A 3W29A 1HP5A 5I79A 4DUXA 2WNWA 1E71M 2XM2A 3EDKA 3PZIA 1U2YA 2Z1SA 2PWDA 1E0WA 3U5UA 2CERA 2G41A 3QHNA 3WEZA 4CU8A 4CKQA 5EBAA 4BQ2A 3A47A 1UKSA 2D3LA 3VVGA 1VEOA 4XV0A 5LA1A 4Z2LA 1MQQA 2E9BA 3RCNA 5GPRA 5A2CA 1BYBA 4CD8A 1A47A 1QHPA 3VDAA 5GQBA 1E1FA 5I3DA 3ZJ8A 3WBEA 2CXGA 1HIZA 4R5EA 3WQWA 1M03A 6A3HA 1JI2A 1CGVA 1VF8A 1V6XA 2WANA 2DT0A 4W84A 4AD1A 1W9UA 3SCUA 3AHXA 1PX8A 2C8NA 4AZHA 5DO8A 3WNOA 2ZUSA 2CBJA 1QW9A 1ITCA 4PCSA 9CGTA 3RM8A 2OLHA 4LYPA 4H2CA 3WF4A 2BVYA 2ZUNA 4CN6A 1V02A 2VX6A 3AZSA 3FXYA 4D72A 4UQDA 4J27A 4QCEA 1ISWA 5CZKA 2YDSA 2WKLA 3GYCA 4EKJA 1PEZA 1KWKA 3WD2A 1UH4A 3A3HA 1W3LA 4U31A 3MMUA 2EPNA 3IAPA 5DT5A 3DHUA 4E2OA 4NI3A 2Y8KA 2DT1A 1V6WA 5IDIA 3SURA 3HU7A 4L4OA 1CXFA 4DM1A 3WBAA 1CPUA 5A8OA 4KGLA 2O9PA 2E8YA 3GH4A 4JKKA 2J25A 1WB0A 3GNPA 4AC1X 1K9DA 1GCYA 4CCDA 4ZE4A 3I3DA 4UFMA 1F4AA 1CIUA 1WP6A 2YA0A 2YLLA 3VIGA 1JZ4A 3FW6A 3OIHA 1P6WA 4BF7A 1J0IA 3UR7A 2XG9A 2VI0A 2WC4A 2WVSA 5D9PA 4FLOA 4PYSA 5CPTA 2BXYA 3VDCA 1TG7A 4J7RA 4PMQA 1JAKA 5A8PA 3ZR6A 3A4XA 2VCCA 2BHYA 2WWDA 1UD8A 1JIBA 5AC5A 3CMGA 2ZXDA 2XVNA 4Z2GA 4OOZA 6TAAA 4M56A 1V08A 1J9YA 2ZUMA 1CWYA 1VEPA 1CLXA 4H8UA 4P7QA 4GKLA 2OWWA 1XGZA 1B3WA 3KWXA 8A3HA 1EH9A 2WC7A 5GNXA 1JFXA 1TA3B 3L4UA 4P7LA 4UTFA 4C7FA 1JI1A 1V0KA 2JE8A 1C93A 1MXDA 1XH2A 2D24A 5I5RA 2WAGA 3K1DA 4CCCA 2WSPA 2NSXA 1HJVA 1GOQA 3QR3A 5BXSA 5BYWA 2PB1A 1QI2A 4CD4A 1J0JA 1W9XA 1X6NA 5C70A 1VRXA 2G3IA 5HDRA 1NWRA 2DIJA 3WEMA 3BAYA 1JFHA 1E4IA 1NWUA 2QF8A 5FCZA 2ZWYA 4GQQA 1LQ0A 4AZGA 2VMFA 4UZUA 3DYMA 4UQEA 2VVNA 5DEZA 1XH0A 2VCBA 1QOXA 4OBSA 4KH2A 3D5HA 3RM9A 1C3FA 1KB3A 1ODUA 3BAWA 3W0KA 3ZMRA 1B30A 1JF6A 4P7NA 1FFQA 2CEQA 1AQ0A 1H4PA 3AIRA 2J7BA 4J3UA 1QVBA 4W89A 2VNCA 2VURA 3AHVA 3EMQA 3TTSA 1VIWA 1ZJAA 4L4PA 4D1IA 2QPSA 4W8BA 3MUZ1 2BV9A 1UA7A 4PTXA 1B3ZA 3WUFA 3VUPA 1VBRA 2FHCA 3LPPA 1B31A 3WDJA 3GZAA 1E6RA 1FH8A 5AY7A 2BY2A 1EDGA 1J01A 1C91A 5JBEA 1K9EA 3MUAA 6CGTA 1E4MM 3BAXA 4PSRA 2VX5A 1XYZA 2BXZA 2D0HA 1XSKA 2V3EA 4A3YA 1O7AA 1EOKA 1JGIA 2GSJA 3AJ7A 5F7UA 2EO7A 1AMYA 4JHZA 4X0NA 1UKOA 3UEQA 3AXHA 4MB4A 1E6SM 4DM2A 3ARQA 1YQ2A 3S2CA 3W37A 4GIAA 2X8RA 5JBFA 1G1YA 1NP0A 1VEMA 4PUDA 3RO8A 3BCDA 2WKGA 2W4XA
chains in the Genus database with same CATH superfamily
3WQ4A 3EYPA 3TTQA 4S38A 1JDCA 2W5FA 2O9OA 4Q22A 5A2AA 3S9YA 4DAFA 1Q4WA 3QV6A 4PUMA 1J6OA 2XVGA 1POJA 3WMCA 2OSXA 3ABQA 1ONRA 4HA3A 4KWWA 3OHMB 3JZEA 4IUOA 1ICPA 3LA4A 4LVBA 4GXMA 3NQAA 4IMAA 1EP2A 1EWEA 4R7OA 3TJXA 4TX8A 1L6SA 1Z3NA 4NY2A 2GGIA 4KFNA 4LU0A 4PODA 3B8DA 4C7GA 3MTWA 3GZ3A 2GWNA 1XC6A 5A6MA 3XISA 1KXVA 4M7SA 1Q6QA 4PCPA 1IYXA 3WD3A 2J7FA 1BGAA 3TYZA 2XISA 4PCTA 4IG2B 2AMXA 2WMIB 3KAOA 4H6QA 4FIRA 1U1JA 3GHSA 4H01A 1H7NA 2BMBA 2ZC8A 4GYKA 1H61A 4L9XA 4RE4A 3VIJA 1QHZA 5EBUA 4C1KA 2MANA 4O1CA 4HPHA 3KM8A 2VRJA 1E1EA 1F61A 4DJFA 2ZVRA 4PCNA 1GGOA 4HP5A 1FH7A 2V6AA 4QG6A 4O11A 4GI9A 2CLLA 2AKMA 4IIHA 2XN0A 1M5WA 1EBHA 4PRRA 1N8WA 2B7OA 1VD6A 1XW8A 3BARA 3P84A 4KBXA 3M5YA 1V6TA 3IJ8A 5A6SA 4DAIA 2FZ9A 1AW1A 3MCNA 4UWMA 4YIWA 2Z29A 4JTRA 4OT7A 5CPOA 1SU5A 3UF9A 1ZBWA 5C2CA 3HG4A 3A3WA 3WLNA 4OHQA 4IL2A 2YR1A 4JR5A 3UWZA 2E6FA 2IPJA 3ZM8A 4HCLA 4HZ7A 4N6FA 5E70A 2QJNA 3PZVA 3KX6A 3DHFA 1UKTA 2QJIA 5CG0A 1TFVA 1FVPA 4BF9A 2J4GA 4K7YA 1R3WA 2I7GA 3DFNA 3TXZA 4AXNA 4HYVA 2FPTA 3H54A 2DW6A 1XFCA 1XIEA 1QATA 1RQHA 4EE9A 3PWGA 1FCUA 3C86A 3UXDA 3AICA 2VZOA 3QZEA 5LGXA 4O10A 3QHMA 1C9DA 1LORA 3MUIA 1WZKA 4AYSA 2Z25A 3O6CA 3VO0A 4MTVA 2IKIA 2YCLA 1UH3A 5G2IA 4JN7A 4FB7A 4JCMA 4MJZA 4PMZA 3B9AA 1MZRA 3WH9A 1S3TC 4HU8A 3B04A 6ENLA 1BXCA 3H53A 1B3VA 4KS0A 4AZBA 2DU2A 3HGRA 3BJTA 2DZSA 3TYCA 1XIMA 5IXEA 1DE5A 1EJVC 3W4RA 3W26A 4FALA 4WKAA 1PZ2A 2ASHA 1KXHA 4NNCA 1CTNA 3RRAA 5TIMA 3AMKA 2XN1A 4JQAA 3UWQA 3EOOA 3L4YA 4RV8A 3L2MA 5FJPA 4JHMA 3O0KA 3WLKX 1BRLA 8CGTA 3CO4A 4MNKA 3MUCA 3EWWA 1BXNA 3B9EA 5ABFA 2WSQA 3VX0A 2G37A 1F3EA 3PAJA 1VH7A 3HURA 4P8UA 2DVXA 3HQ1A 2FFCA 2REQB 4LX4A 1WPCA 1BQGA 4UTMA 3R43A 1HF6A 1UOZA 2VGBA 3LN3A 1ONEA 2VZVA 4WJ8A 1A5KC 3MQTA 1TMHA 4HQVA 3BSGA 4O4VA 2PDGA 1M01A 4GZEA 3LI1A 4OOUA 2IPFA 2FGLA 4NRSA 3B9NA 3JW7A 1KCKA 3O6AA 2CLEA 1CXLA 1FHLA 1F3TA 1FCBA 4YWSA 4D6GA 4QLKA 1N8IA 2QPXA 3IGUA 1GWJA 3HPXA 4DBWA 4BWLA 1W54A 2D20A 4TMBA 3ZQ9A 4DWDA 3T42A 2OGYA 2FMNA 5EMMA 3CUZA 1UR4A 5G5IA 1UZ4A 4YHGA 4QQUA 2QDHA 3TYBA 2PRHA 3L0NA 3WLSA 4C6FA 3WLRA 4JL1A 4AD2A 3W7IA 2Q01A 4GLEA 4QE4A 1A53A 2YJQA 1H0GA 4S3DA 1LLOA 3RRXA 1ZUAX 1G5AA 5K3VA 3V3WA 3KW3A 5FIPA 1HT6A 1W5MA 2YBUA 4C6PA 5CGMA 1QBAA 3ARXA 3H7VA 3P8IA 4K3ZA 4PMUA 9RUBA 1TTQA 5E0CA 4ZEPA 1Q2RA 1CGTA 1OX5A 3CUJA 2XDFA 3MV01 1LQAA 3MY9A 3RU6A 2WSKA 5D33A 4UQ9A 2IKGA 4K38A 1NFGA 3OU8A 2CESA 1QNOA 3W07A 3EWZA 7TAAA 1V3LA 2E6AA 2ZQ0A 5I77A 1EPVA 3W88A 4DWSB 1JYNA 3WF2A 3W81A 4WR3A 2PZ0A 3SSJA 2D3NA 1K4HA 1AJ2A 4KCVA 2H8XA 3WN6A 2O92A 2ZTJA 3L9CA 1FWTA 5BRQA 4E3TA 2TRSA 3S1VA 3WJWA 5DELA 3ENLA 1E4NA 3CTLA 1JPIA 3PK7A 3VNKA 2DUAA 5MF5A 3NZRA 4ALDA 5D2VA 2D69A 2XFFA 2FVKA 2UWFA 2PF8A 3GQYA 3O1NA 4N4QA 5AC6A 1QO2A 1XYAA 3OW1A 3W7PA 1W5QA 1W1A1 4ZFMA 3NJ3A 4AVFA 3KZPA 1VPYA 3KLLA 1L2UA 1G94A 2ALRA 4WDUA 3MSYA 4XISA 5F4WA 2Q71A 3W6YA 3H6OA 4CNNA 5BRPA 4JBRA 1Q6GA 3IJ9A 2Q3RA 1A4MA 2R14A 4Q8PA 1Q66A 3LU2A 1R6WA 4AG0A 2VL4A 3FFSA 4OGZA 1V0MA 3IUHA 3QFEA 1VR6A 1T41A 4Y96A 2F6XA 2WZEA 5I06A 1OB0A 2YPIA 3FJ6A 3SUSA 2W62A 2UY2A 1K9TA 4DZIA 1SO5A 2I56A 4R3UA 1BWLA 1F73A 1PTAA 2O56A 3BW2A 1E6ZA 3CUXA 1JNEA 1W5OA 2VGIA 4GUJA 3BQ6A 4I7WA 3O05A 3AYSA 3PANA 3S0CA 2IW0A 2TPSA 4IL0A 1J2WA 3IVUA 3WFLA 1HJUA 4FK9A 1DQWA 4RX0A 3HG3A 5HQMA 1R3QA 2J8TA 1M6JA 2NQHA 1GEQA 3G2GA 5IRPA 4Q8UA 1UP0A 5G1YA 4R53A 1VKFA 4Q6JA 3PZQA 3N13A 3MI6A 3G8RA 1UD5A 1FWJC 2FVLA 4JTKA 1M1BA 4MAZA 2Y63A 3TJ4A 5F2IA 1A5BA 1DV7A 4HPJA 4LGXA 1W1VA 5XIMA 2DW7A 5B7ZA 1NF7A 2BSLA 3GKFA 4FSAA 2IPGA 2X0HA 3T2PA 2G97A 1S5NA 3NPWA 3ZT6A 1SFJA 5HMEA 3KCOA 4PBEA 3GK0A 1IEXA 2R6OA 1TJ2A 1JQXA 1GOMA 4QE1A 3LPFA 3PPCA 3S1XA 2V69A 2X05A 1UMLA 1LZOA 1BWKA 2WMFA 4LVFA 4XZBA 1W3KA 4GX8A 2RGMA 3S1WA 3S5NA 2A21A 3FVDA 4NZ3A 1NM9A 5CBJA 4QDMA 3OEXA 2Z28A 1GTHA 1D2KA 4RLIA 1FY6A 3GU1A 3I10A 3IWPA 3WNNA 3CWHA 4H1ZA 5D9OA 4M8UA 1WDQA 5GNYA 4CD7A 3H2CA 1TTIA 2A4AA 3QTPA 5LYRA 2Y6ZA 3OP2A 1KTCA 3TCSA 5G2HA 3WH8A 1FTXA 3ANUA 1HGWA 4NJHA 3UR8A 3EZ4A 3CAVA 3AIQA 4RKAA 1EX1A 3TKFA 3M43A 1ELSA 1GPFA 3HGSA 3N12A 4HU3A 3HQPA 1BVNP 1UUOA 1OCQA 4AISA 2H9AB 2VRKA 3T4CA 1VENA 3PZNA 2E09A 1RR2A 2Y2WA 3GHRA 3AC0A 3PB0A 5A5WA 1J0YA 4PULA 3PF3A 2YL9A 1RK5A 2Y5JA 2X09A 2I16A 3F1QA 3V5OA 4KWUA 3ES7A 3SB0A 1H41A 2BOEX 1P1MA 4NJIA 3GTFA 1YMYA 3CZ8A 2V9DA 4C6DA 4PMDA 4KEUA 4ATDA 1OSEA 2J9YA 4Z1CA 1MQPA 1XX1A 2F9RA 1P0EA 1LG2A 2YA2A 3PWIA 3ABRA 2EKCA 3W6LA 3E0IA 3QC0A 2EJAA 1H3GA 2ZA3A 3T0TA 3QGVA 4AX6A 5H91A 3KZSA 3A4JA 3U0HA 3BOLA 2W79A 2EPLX 5D02A 1XRTA 4NYUA 3HGOA 4EP8C 1LJYA 1MRQA 1RCOB 2X1TA 4UXDA 4MG4A 1UR9A 4NJKA 2ZRZA 2VD8A 4PUEA 1JUKA 3GVWA 1I1XA 2W6RA 3UETA 1LT7A 1LUCB 2QIIA 1U5JA 1YE6A 4Y9MA 1TELA 4UOZA 3VOJA 2C15A 4F40A 2WVTA 4U2YA 1XLJA 2BY3A 3BMVA 1KGUA 5IFTA 1LM1A 3ARUA 1XBYA 2R9RA 3K5XA 2OZ3A 2CU0A 4MHBA 1DHPA 4I9AA 2UZ9A 7REQB 2WZHA 4A29A 4JDBA 1VFHA 2CLIA 4X22A 4D6HA 3BXWA 1OFEA 1KM5A 1QU4A 4LW7A 1RLCL 3JZUA 1VS1A 1UG6A 3TZNA 3K4WA 1G4PA 3PVFA 1DJNA 3WMBA 4NJGA 3HPSA 1CEOA 4JX6A 2W63A 1N82A 3XINA 4O50A 4GUFA 4H9MA 3QY7A 3RJYA 3H26A 5HQEA 4PEEA 4S23A 4KFOA 4PB5A 2XWDA 3QN3A 1DJHA 3HGJA 4KRZA 2O4QA 5H6HA 2OR2A 3B0XA 4GCXA 4MF4A 3P0XA 4F66A 1DIEA 3HQOA 4UQAA 3TLQA 1XLKA 2Q8ZA 5CAHA 3TWBA 1G67A 2R1MA 3W1TA 3MZ2A 2CLPA 4F48A 1HN1A 1VP5A 2E9LA 2HWGA 4DUVA 3MDWA 4N7QA 1FFRA 1Z44A 1I2QA 1TPC1 1FHVA 4C6JA 1MW0A 3PPGA 3ARYA 4GXWA 4MWAE 4FX8A 1JJKA 3MSGA 5KZ6A 3QQWA 1KR0A 1X6LA 3NXLA 1REQA 1AZ2A 4MJMA 3I3BA 2Z7KA 1C7SA 1OY0A 2PFHA 4HNCA 1TPFA 2ZBTA 3P62A 3UBPC 1XLIA 4HK7A 1OFBA 4UNLA 1JZ7A 5E0FA 2C6QA 1NAL1 1UIOA 5H8UA 4E0CA 5J5RA 2P53A 2EGZA 1KTNA 1A80A 1JPHA 3K8LA 2QIWA 1ITXA 3A4AA 2FTYA 4FNSA 3OPSA 2VGGA 1E5NA 1RCQA 2O7SA 4HK5A 1RQBA 5FSDC 1VCVA 1GOXA 1JYWA 3SGGA 1XD1A 2GOUA 4JD4A 4GO8A 1OYBA 4F0MA 1M68A 1SSGA 5H8PA 1GQLA 3QM3A 1KGWA 2BY0A 3FAWA 1LL4A 7PTDA 2XVPA 3P67A 4YYFA 1CI1A 3D3AA 1GKRA 3CL8A 1RZMA 3DFTA 4AEOA 3EOEA 4CNSA 1W32A 4NT0A 4FAMA 3HBLA 4E4PA 3A13A 1SO6A 4XQ6A 4MJ4A 1HKVA 1QNVA 3QSRA 3KWSA 3GG1A 3MHFA 3L5LA 2OYKA 3SY8A 3GG7A 4F8XA 3U6WA 4S3KA 4ZCWA 4OWGA 3N6JA 3VX1A 1GKQA 1XD0A 1OJXA 3IIOA 3OGRA 3PPHA 1X7FA 1UR2A 1GOKA 3FGCA 3CL6A 1VJZA 3GDBA 4MKVA 4DRSA 5DQPA 2QCDA 4IMDA 4TOQA 2YXXA 3HB9A 5KZEA 4D6CA 3E0WA 6REQB 2OU4A 2I1OA 2GJNA 2WMHA 1EYWA 2VR4A 1Q65A 2DH3A 1Y5XA 2XINA 5ENLA 4GYFA 2YFNA 5I6SA 2GVEA 4JEJA 3UYIA 3ZR4A 5HR7A 4YPJA 4IPJA 2A3BA 5I0DA 4LCRA 4TX9A 1H50A 1W6TA 1TA3A 1XKYA 3WDPP 3EXSA 3NZGA 1Y0EA 3W7HA 4N9CA 2CETA 3SQMA 3IJ6A 2Z00A 1PTDA 3OGVA 1FP9A 4IMFA 1UW9A 1TZ9A 1DP0A 1QRQA 4W93A 3OLEA 3VDBA 3NL2A 4DI9A 3ERPA 4ZZ9A 3M0YA 4GCAA 1MFVA 3KVKA 2PS2A 2V3FA 1A5SA 3OZOA 3ZYZA 4GZ7A 5EMYA 3LPGA 1VFFA 1MEHA 4GZIA 4A8RA 4XKYB 2V2DA 3AIBA 5C9UA 4K2SA 3AZRA 1J4EA 3NDYA 1V3MA 5E9XA 1KFWA 3N6QA 4NNBA 3MO4A 5DRIA 1ZU8A 1T5AA 1P5BA 1DIKA 3PTKA 3RR1A 2WMKA 5KITA 4CD6A 4ML4A 4YJ5A 2ATSA 4I5XA 4WSKA 3RX3A 3L5MA 3VIOA 2NWSA 2VX7A 5BMXA 3WD0A 4OJYA 4AW7A 1HFBA 3UR2A 2Z27A 1ISYA 3W7NA 3BSMA 5HA7A 2OQYA 4B90A 3D6NA 2J9XA 1QNRA 1HO1A 4O14A 5EMJA 5E09A 1D3CA 1HKIA 3TZFA 3AIUA 3CASA 3SJ3A 2G3NA 5HNUA 2G5WA 2JF7A 4JFTA 1AW2A 3S6DA 3TTOA 1UC4A 3N2XA 3SN0A 3VE7A 2PDUA 3R4IA 3RIKA 4DY1A 4JS3A 1A0DA 1VFOA 2G50A 3P3BA 3CQJA 3MW7A 3WBWA 3EX3A 4CGTA 3GU2A 8XIAA 1SZFA 3WK3A 1L6WA 4M82A 3WQ8A 2NXHA 3H7UA 3LV5A 3R79A 1LYXA 2C1IA 1GJUA 1PYMA 3VD7A 1J0HA 2Y89A 5FJUA 2NUWA 4UMAA 1SO4A 3NQGA 4H8VA 1XRVA 1R30A 2DZPA 4FEZA 2OCZA 4M81A 2GFTA 3SRKA 2BNJA 3IIXA 4EIVA 2ZX6A 1W1B1 1XUUA 1K70A 1NEYA 2BB0A 2X7VA 1MXGA 1KWGA 1R7OA 4JTSA 3RPDA 1JYXA 1VQTA 4K68A 4YU1A 3ZOAA 3WL1A 3TUUA 1HGYA 4MB3A 1GPWA 4F79A 3GNRA 1JQVA 3P0WA 4C6QA 4O13A 3C2EA 3NQDA 3INPA 2OJPA 1K77A 1GVYA 1PB0A 4HOXA 3LTYA 3W7CA 1V7AA 5IFPA 1PX4A 2XIQA 5BU6A 1GYLA 5DMLA 1VYRA 2HVNA 3DC0A 3WMSA 3N18A 1EHNA 3ZWTA 3WDRA 4QXIA 4S3GA 1J5TA 5L6UA 4GNJA 2HRWA 2YW3A 2ZXQA 1P0NA 1IZJA 1V3JA 1W8GA 3E12A 4DLMA 1XF0A 1E55A 5C7HA 2Z0IA 3F2DA 2AAMA 3AISA 4FNTA 5M3WA 3FV9A 2QCCA 4BEQA 4B9ZA 3CHEA 1OINA 3LBMA 3QV9A 3IARA 1EQCA 4XIMA 4XBJA 3KE0A 3H4GA 3CT7A 1AW5A 2ZX9A 1TKKA 3SUVA 1JF5A 2WVVA 1W1ZA 1U33A 2W0UA 1I0BA 2IS7A 3C5QA 3HTWA 1GVRA 2VOTA 2EQDA 2Y1HA 3FAXA 1XGEA 3RK8A 3PFMA 4PRWA 4K1GA 2RJHA 1UZDA 3NL5A 1OC7A 4U33A 4GQ0A 2C7FA 4DIAA 3TCEA 2R8WA 2HPIA 4FX7A 1UYQA 1JG9A 1VJSA 5DX7A 1TCMA 1T8QA 2VQTA 1BWVA 2PLCA 1BGGA 4Y7EA 4C5ZA 1JULA 3EKZA 3TU9A 3OG2A 1NP2A 4KMQA 3NQFA 5CC7A 1R85A 4YNGA 2V0TA 3ICJA 5HUPA 3CBWA 1Q2SA 4UQBA 1UWUA 4C6CA 1GVSA 3G1FA 1GVIA 4V15A 2RUSA 1SR9A 2AQOA 2Y7FA 5CJMA 1XPGA 2BGSA 5AYIA 1OF6A 1W1PA 5CPLA 1QJWA 3K4AA 2DY3A 2GVJA 2V3GA 4LQ1A 1YX1A 1OGBA 3HQNA 4WOZA 2CZVA 2X0YA 2WLZA 4GVFA 3S46A 1R87A 2WHLA 4G9PA 5K7JA 2ZE0A 2YCEA 3LCHA 3VGEA 2D23A 2KZHA 1AJ0A 5FJIA 3LGEA 2POTA 1VFTA 1TR1A 4DZ5A 3H12A 3L12A 3IANA 1Z89A 4QFUA 3KOXA 3B8UA 4Q32A 3SN4A 4A8IA 1UOKA 2Z2BA 5EL1A 3VOHA 1JXKA 3TONA 4A3HA 4MUPA 2GGJA 4M6VA 4B5VA 1RBAA 3GC4A 3AZTA 1A5UA 4HZMA 1QWGA 1Q6OA 1EZ2A 3AIEA 4Q4QA 4R27A 2PGFA 4GJIA 4HTYA 4UNIA 4IMGA 3ARVA 1FWRA 4PMXA 3DI0A 1JCLA 2CKSA 3WNPA 1B3YA 3DYOA 3VD4A 1OZMA 5F1VA 4H9YA 3I3EA 1LL7A 2RHGA 3MWAA 4ZL1A 1BD0A 3SQLA 3W29A 2QV5A 4D8LA 1NELA 2F7FA 3UU0A 2Q8LA 2Z1SA 3W7DA 4JX5A 2G41A 2NQ5A 5EBAA 2QGHA 2B4GA 1W0MA 1XYBA 3N73A 3A47A 1UKSA 1Y5VA 2C13A 2D3LA 3LBOA 4GA8A 4YTUA 3V5FA 1KFEA 4YVVA 1VEOA 5LA1A 5TAOA 3VZXA 5GPRA 4R34A 5FEZA 2E67A 3TNBA 3KCJA 5CZ0A 2CXGA 3CXOA 4WDTA 1MO0A 1V6XA 2WANA 2EG7A 1W9UA 1WXZA 4YVXA 3LUTA 4FO4A 4NU7A 1VJIA 5A6TC 4PCSA 3CU2A 3BMXA 2BVYA 3H2OA 5CBBA 3UJSA 1LOSA 1GW9A 2GQAA 4ZA0A 5T9CE 2WKLA 1M65A 4EKJA 4JIRA 2O55A 2R1NA 2ACSA 3STGA 1UH4A 3RHGA 4U31A 3WK0A 3MMUA 2QNEA 3IAPA 1ADOA 3DHUA 4E2OA 1WUEA 2PGWA 4HNUA 4L9YA 4GH3A 1A4LA 5IDIA 3DOPA 4L4OA 1P0DA 2EHHA 4XAZA 2E7FA 3RR4A 3GG8A 3KHJA 2OX4A 4HCHA 2J25A 2WM1A 5FF3A 3GNPA 1UP3A 3UNDA 1K9DA 2FYMA 1GCYA 2CLHA 1GVQA 1TIMA 3S2MA 3QLDA 4A21A 4LVAA 1JZ4A 1LDCA 4L9ZA 1DIDA 4LF2A 2V82A 2VI0A 2WC4A 1P6BA 4BI6A 4RPPA 2BXYA 3VDCA 3QFWA 3N9SA 5A8PA 3P5YA 2PP0A 4B91A 4JTLA 4B2DD 4HN8A 1I2PA 3R25A 1JIBA 1AA1B 5RUBA 4OOZA 3DG6A 3HOJA 4H8UA 1S1PA 3DHDA 4LSBA 1B3WA 4YVPA 3KWXA 4DYEA 4JYFA 1TA3B 4ORIA 4A2RA 1JPDX 1Q45A 1MXDA 2WAGA 1O5XA 2PMQA 2INEA 3N14A 1HJVA 3CM4A 3ZVHA 2PB1A 4CD4A 2VHLA 3R13A 5C70A 1VRXA 5DCEA 2F38A 4PFHA 2DIJA 3LRLA 4JTGA 3NM3A 3VKAA 4F0HA 1EF3A 3MP4A 1IEIA 3E5BA 3KCLA 1FWEC 1LLWA 2INFA 1Q13A 3RM9A 1C3FA 3W1PA 3BAWA 3W86A 1JF6A 3EX2A 2J7BA 1QVBA 2E68A 3VNJA 4C6EA 1O66A 1AFSA 4LAMA 5LNWA 1VIWA 1ZJAA 4DO4A 1TV5A 3VK5A 2QPSA 4D1IA 3MUZ1 1UA7A 3BOXA 3WUFA 3LPPA 3LENA 2IKJA 2ZTKA 3VKJA 1KBJA 1S5WA 3QMRA 1EDGA 3W7GA 1J01A 2J66A 4L1WA 1OYCA 5JBEA 1K9EA 1GZGA 3KFTA 1TIWA 1FWDC 4YTQA 3BAXA 1IGSA 3G24A 3HM7A 4A35A 2E5DA 2BXZA 2D0HA 1XSKA 4US5D 2DJLA 3QXBA 1E6SM 2VUNA 4S3FA 3S2CA 3SFKA 1KW1A 2X8RA 3E6EA 4HCDA 1G1YA 1VEMA 4QX4A 1RK6A 3RO8A 4AHPA 2WKGA 3T4WA 4TVCA 4N6EA 3NR0A 1VYPX 4W7UA 5CC6A 1TVLA 3NQBA 1TRIA 3NYDA 1FXQA 1ZJHA 3WUEA 4E2VA 1JGMA 1HKMA 3NXFA 1QPKA 4I8DA 2H3DA 2OT1A 1QI0A 2Y70A 2PLJA 4HB7A 4LBRA 1GORA 4PL1A 1IHIA 3TYEA 3W9ZA 1F6KA 3ABXA 3QHOA 4W5UA 2CLFA 4UFHA 4L4LA 3L4WA 3TVAA 3WBYA 4X2RA 3ZR5A 4ZXOA 3GDTA 1YKWA 3DXIA 4L80A 2ADAA 3FYOA 3VD3A 3SIMA 4M24A 2ONEA 1OX6A 1R46A 2NUYA 1J79A 5AKQA 4UTLA 1YTKA 1N55A 2VEIA 4AFYA 4F3HA 4IIBA 1RJQA 1GT8A 4WK9A 2FTPA 4AZ6A 2PZNA 2R24A 4S3AA 4ZENA 1TV2A 3KEHA 4US6A 3S5OA 1MW1A 3BAJA 3VOCA 1K3UA 1XCFA 1H0IA 4QLLA 3LERA 2XM1A 1M04A 1DQXA 3IRDA 2WCSA 4O28A 1QMLA 1RD5A 4WQ6A 4MFDA 1GYNA 4PR4A 4JTUA 3M6YA 3OVGA 4ZODA 3BTNA 4HA0A 3STPA 3WENA 4KRTA 4PUKA 2VT0A 3ABZA 1AZ1A 3WUBA 4LRSA 5DFAA 2QJHA 1IR1A 4X9SA 1ZBCA 3GNXA 1M7JA 1O1ZA 5CSYA 2C71A 2HXUA 4GE8A 1FHDA 3E2VA 4X60A 5IOBA 3WQGA 1GNXA 3VNMA 4BR1A 2CBIA 2G3FA 2QPUA 4RK8A 1YNYA 4ZB0A 2XH0A 3C3UA 2J7GA 3PBWA 3T2OA 4US5A 5HBFA 3GYEA 3IJDA 4RNHA 2BXVA 1PVNA 5EB8A 4DXXA 2MNRA 3H2FA 3TC6A 3AIVA 3THQA 3SCQA 4IISA 1R3VA 3LNPA 4UUIA 2WBKA 4UC5A 1VPXA 1VPQA 4DJFC 4KCTA 4JHOA 1OEPA 3KP1A 2DQXA 2ZX8A 5AHMA 2CLMA 3WLHA 1NWSA 2ESCA 1R2RA 2OQLA 4JX4A 1NF0A 3UA3A 2Y5SA 1OWQA 4WF7A 4AF0A 3A24A 1AUSL 3FA5A 4ZXLA 2V30A 2OSYA 1R0MA 3CGTA 3T8LA 3AIWA 3PZGA 3K30A 1B54A 1IEQA 1GYMA 5IHRA 1L0PA 1TREA 2Z6JA 3LD5A 3LGGA 1KRBC 6XIAA 1EGMA 1PKNA 1IWBA 3QR0A 3AMGA 2WPGA 2ZIDA 2RAGA 1KGXA 3IUIA 1QXLA 4ICMA 2A3CA 3A22A 3L4TA 4ZBCA 3QLLA 1DJQA 3QF0A 1M7OA 1E0TA 2P0IA 4EWJA 3W1AA 4INFA 1GZ1A 3FSTA 1FKXA 3KXQA 1AH4A 3MI3A 4TQTA 5REQB 3R2GA 2WZMA 1K1DA 2OYLA 1RD6A 1RXOB 1K02A 1EBGA 1OHLA 3F4WA 3AS1A 3O8AA 4IUGA 1BSLA 1UASA 3VZYA 3NURA 3VPLA 5DMYA 1HL2A 1F3WA 5A3HA 1RJPA 3MBFA 1CGYA 4V27A 3V1PA 1KFJA 2DSUA 3VA8A 3FOKA 1AD1A 2Y7DA 1YYAA 4LBUA 2XVLA 4XIAA 2NLYA 1P6CA 5D05A 5FEPA 3W7QA 1BXBA 1XFBA 1PO9A 5BROA 5FOOA 1MEWA 4RDZA 1G0CA 1QNQA 2Z4GA 4MPQA 1G4EA 1X98A 3GHTA 3TOPA 3W7KA 1IEVA 1UD4A 1JDFA 4QDPA 1ODZA 4CU6A 3PBUA 4WY0A 4MB5A 3POCA 1G4TA 4J4KA 3B8WA 3W25A 4RZ6A 2NV1A 3RXZA 1H1ZA 1UUQA 4U5IA 1OX4A 4GIYA 1A3WA 2P50A 4AB4A 2A2IA 2GSEA 1XLBA 4MFEA 1W3JA 1AD4A 2YYUA 4OV9A 1HZYA 1YLVA 3SQSA 4HMNA 1UBSA 3A6OA 4B16A 4DPQA 2OTDA 3OG3A 4TV6A 4XZ9A 3AYVA 5K2ZA 3TYAA 3VGHA 4AUBA 4BWLC 1DYSA 1VB9A 4HU0A 3B03A 4LUSB 3U57A 3W27A 3WD1A 4XKMA 3IPWA 4H6RA 3O06A 2QDDA 2ZC1A 4GG9A 4CU7A 1IIGA 5I78A 4LVDA 3T81A 2YDRA 5AVHA 4AIEA 2H6RA 1B4EA 1X39A 3T9PA 3DGBA 4ZQMA 4RL3A 3GXFA 1R3TA 1F4HA 2C19A 3TFCA 2FZMA 4PEKA 3W22A 2DUZA 5D4YA 3SCTA 1BG4A 4PTDA 1WZAA 2FHBA 4L1XA 5A8QA 2G95A 5A1AA 1ZAIA 1QK2A 1D8WA 4NX5A 5DANA 5I3KA 3E1F1 4B15A 4XZMX 2OZ8A 1XSJA 3E2QA 3QQ0A 3EWDA 4AWEA 1XLLA 3PZMA 4LAZA 1I6NA 4Z08A 1WXYA 2OOFA 1ZCCA 4KW2A 3SM0A 4MM1A 4RDWA 1H7WA 1EP3A 1V8EA 4AY8A 1QHOA 2EKGA 3M5VA 1OABA 3N2TA 3MS8A 4DO6A 4DXKA 4Z2KA 1SJAA 1Z48A 3PHAA 5A6BD 1J12A 2R1PA 2YL8A 4S3JA 4L65A 1BVZA 1V77A 2ISFA 2OGJA 3NGJA 3ZJKA 5JBDA 4WGHA 3WLQA 1PV8A 2VD9A 1JD9A 1A5MC 2V5KA 1G69A 3XIMA 3W1UA 1DXFA 2QMKA 2WW5A 5JUVA 2FTWA 3P7YA 4CVWA 3AUOA 5KETA 2WO5A 1JR1A 1S2WA 3C8FA 3RF9A 1J8VA 2V5LA 4Q4OA 4IT1A 1E9IA 1K4GA 3W2KA 5M1TA 3QTGA 2QF7A 2VZTA 2PP3A 3D46A 1T40A 2QCMA 1Q4NX 3NL6A 2ZDRA 2FKPA 2GYIA 1XISA 3M0KA 2V5JA 1HKKA 3OVPA 3NVTA 3RPTA 2RDUA 1WKFA 3HJEA 1SW7A 2PCQA 2FJUB 3UZZA 4XVDA 4HGXA 2D2JA 3ZLFA 3RN6A 3MSRA 1KM4A 3MCOA 1SR0A 2HJPA 4GJJA 5A8NA 1P0KA 1VGAA 4WY0F 2GJXB 4O8AA 3CIVA 2F2HA 4Y2WA 1QUMA 2O7QA 1DWJM 3TX9A 3UPBA 4YL2A 2HVMA 1KBIA 1S5TA 1VLWA 1HL9A 1WDWA 3SCSA 1EO5A 3R0KA 1VCGA 4XB3A 2PDJA 1GW1A 1NDWA 1KXQA 4HMCA 3CB3A 4O0KA 3FCPA 5LIXX 2GVYA 5D2TA 1FCVA 1VIZA 1RSCA 1PIFA 3WQFA 3EBVA 2WMGA 3L65A 2ZOXA 5C71A 1ZQ5A 3UW6A 5LIWX 4BQ4A 3AALA 1LWIA 4GC4A 3CJPA 5BXTA 1E6XM 1BF6A 4UZSA 3W87A 3AHZA 1Q8JA 3VC5A 3CUFA 1DJZA 3AS2A 3FA3A 4CEUC 3E2RA 4ZO7A 3VM7A 2ACQA 3N4AA 1XDLA 3DERA 4A2SA 3GBEA 5JQ9A 3VD9A 1C29A 1DWIM 2X40A 3G6LA 4DN1A 3LCWA 3TW9A 4WCJA 2YOCA 2DORA 2ACRA 1KM0A 1N2VA 4WKFA 4I6KA 2BZNA 3CZLA 3S1UA 3U4AA 8TIMA 5A6BA 1JYVA 4H4IA 1XSIA 5CJNA 3R7MA 1TWZA 4JTTA 2V5CA 3R5EA 4NZFA 3WF1A 4A8LA 1DJIA 2ZDSA 2FPYA 4AWSA 4N0RA 3N15A 3HPZA 3PBYA 3R11A 1W9VA 1NVMA 3GO2A 3TEVA 1X6UA 4EVZA 2NVCA 4JFWA 1WAUA 1WDPA 4A3UA 3VGBA 4IJCA 3IRSA 3VKKA 4W86A 5IBXC 1MFUA 4GK8A 1W37A 1XPYA 4XAFA 3DG7A 4I7UA 3CIWA 3GHUA 1NH6A 4GNKB 1OG6A 3H21A 1E1CB 5AN7A 1TJ0A 3RX4A 3EDFA 1SJBA 1YEYA 3C2VA 3TDFA 4DJDD 3SFWA 1H2JA 1ADSA 1W2VA 2VEKA 3VIIA 1H11A 3L0KA 3F5LA 3G77A 1ONXA 2WB5A 3O7UA 2GJPA 1HKJA 3RU8X 1U5HA 1S1RA 2PTZA 3ID7A 3UWEA 2RDXA 4ATLA 1R3SA 2W67A 1U1HA 4X0VA 1GOOA 4DBUA 2PSNA 3T8QA 3H4WA 4FPSA 2DZWA 1I2RA 2ZZ2A 3EMCA 1B9ZA 4LC6A 2KAUC 1Z8AA 3THDA 1U5VA 2CYGA 4NAFB 2LLEA 2Q09A 1QK0A 4IFOA 2HDJA 4FIQA 3BVJA 3PJWA 4NVTA 4KCUA 3BGAA 1ITUA 4PA8A 1CXHA 2V81A 1F3XA 3C6CA 3CV6A 1ECEA 3LK6A 3T08A 2JGQA 4NJJA 1UP2A 1XIFA 4O15A 3VZZA 1EJ7L 4LOCA 4GYJA 5U4NA 1RPXA 2HE8A 2BG5A 1K03A 2GUBA 3VIMA 3RO6A 4ZMGA 4IFKA 3THCA 4Y90A 3S5SA 3CL7A 4MLRA 3N17A 2ZRXA 4YLWA 2NT1A 5EU9A 2XWEA 1ZAJA 3RCYA 2NX1A 4D6FA 3DYPA 3VKDA 4GO9A 1IQ8A 3BAIA 4AY1A 3RMEA 2A1YA 1TWWA 3R8RA 2OWXA 4WX2A 4KWVA 2NQZA 2E1WA 1VZWA 5LZLA 2QDEA 1XICA 5F2MA 4DLFA 3CEPA 4KFPA 3FKKA 3BAKA 3GXMA 2BFGA 1J93A 2ZKMX 4RE0A 3NTYA 4UMCA 3WQ5A 5A6KA 4CN1A 3EXTA 4PMVA 1NOUA 4MY1A 3IVTA 3AFBA 1DTNA 2CLKA 4FXRA 3WYZA 2ISVA 1PCWA 3ECQA 1W3HA 4MYXA 2J78A 3MC5A 4GVIA 1RPKA 1KR1A 1QI4A 5CPQA 5HANA 1V6VA 3N34A 2QCFA 3GKAA 1OVDA 4V2XA 1PXGA 3ZSTA 2C0HA 3M47A 3MKVA 2C0AA 5JU6A 1LQ2A 1FBAA 4DJDA 4LC8A 5LA0A 3EOSA 5K9DA 3G1YA 3TYDA 3WQDA 1W3NA 1XYFA 3F4NA 2FH6A 3A23A 4FR6A 2GQ9A 4LXFA 5L9FA 2QJJA 3RITA 1F74A 3UESA 2V5DA 4M29A 3TN6A 4PMRA 4LUIA 2TSYA 3NO5A 1M7PA 3HA1A 3PG9A 2HK1A 5CSSA 1I2NA 2R94A 3GXDA 5EMKA 2J9ZA 1MRAA 4YWIA 3P5ZA 4DB7A 3T44A 2YDQA 4XVEA 5AHIA 1X1ZA 3QJAA 4C6BA 4JQ1A 3OB8A 1LP6A 2DPEA 4RCXA 1SW3A 3MSDA 4PMNA 1OG0A 3FLUA 2D0GA 2OSWA 4L6DA 1CX9A 4YTRA 5H8MA 5HK4A 4UFJA 3B0YA 1QPNA 1B9BA 4RNJA 3MMTA 4N9EA 2RKXA 4DO5A 1VFUA 2HSAA 2NV9A 5HPOA 1I2OA 2Q8XA 3OOQA 4W7VA 1C8VA 2BOGX 4S39A 3OQEA 3B97A 5D03A 2OPJA 5HXMA 3CZJA 1OIMA 5DY2A 4AU0A 3N9RA 2AOSA 1I60A 3BDKA 3QKEA 3F7JA 2I5IA 4Y8FA 1KQYA 2H90A 5D2XA 1WDDA 4W8LA 4Z1DA 4REQA 1E43A 5BZAA 5HOSA 1W91A 3DGRA 5T8GA 2PD9A 5A8MA 3UP8A 3UY8A 1RALA 3ITLA 3TN5A 3UG3A 4IF2A 4KIRA 2CHRA 5I3FA 3EA2A 4MWAD 4P2VA 3LOTA 4GYPA 1B4KA 2JK2A 4LB4A 1TV3A 3WDHA 1CECA 2QUUA 3N3MA 2ZRUA 1BTCA 3U2CA 2Z26A 2C18A 2CZ5A 3PUEA 1P4CA 2J24A 5C2GA 3DX5A 1OD0A 4RZBA 4ICCX 1EGVA 1BFNA 2ACUA 1WAWA 3VMPA 1F2JA 3ARZA 1SPQA 2CLOA 4Q8NA 2VXNA 2TAAA 1OC5A 3EMZA 2PWEA 5GJPA 3Q37A 2CBUA 1E56A 4ROQA 5HWJA 4TVDA 4HHHA 2FVMA 3D3FA 5LGZA 4DZHA 1A3HA 2XH4A 5ECUA 1YPXA 2VP8A 3VIPA 4G7EA 4IGSA 2X30A 1R3RA 1V6YA 4URIA 2A7RA 4LS1A 2CFFA 3BV7A 2DSKA 3GVVA 3WEOA 2WV8A 3L4ZA 4FNRA 3WLOA 5DN1A 4YTSA 3SRHA 4B5XA 2IUZA 3R8HA 1HL8A 4LAOA 1MDLA 1X1OA 2QUVA 4TV5A 3DFPA 4I3GA 5FI8A 2I5GA 4XZHA 5TBOA 4WKHA 1FKWA 2F8QA 3B4YA 1B0IA 2HNHA 4XUGA 2NT0A 2VRQA 2D22A 2PDYA 1A5AA 4Z42C 3K4DA 3NEHA 4LUYA 4HT3A 4V1XA 4FXJA 2QR6A 4UTTA 4HN4A 3DN5A 3S2JA 5HMFA 3NZPA 1EC7A 4RNIA 3VI2A 2CXEA 3QW3A 1D3GA 2F61A 1H1NA 4GHRA 3UG4A 1AVAA 3BLDA 3S1GA 1KXTA 2QAFA 3EB4A 3LXBA 3FX4A 4DF0A 5G4EA 1GONA 2ATMA 1G7VA 3R58A 1PHQA 2BASA 4PUJA 3ME3A 4TTUA 4R7WA 4FNQA 4Z1AA 3OODA 2PAJA 2AQVA 1S2AA 2I17A 2VEMA 3WJZA 4ZGYA 3BCFA 3W1MA 1MEIA 1XLCA 2CWXA 4C1LA 2W27A 3E96A 3BO9A 4JYEA 1T8XA 4LYQA 1JRCA 1UR0A 2DEPA 3T7VA 1X8CA 4KIEA 3T40A 3LTPA 1G01A 4HMDA 2C1GA 3PY2A 4RJEA 4AHQA 2IXUA 2XIIA 1V03A 1UKQA 2QAPA 4Y6GA 4HPGA 1GEHA 4LAKA 4RUBA 1JAEA 4QP0A 3UERA 4MWAA 3GC5A 2YW4A 3G0SA 3W28A 4TU1A 3WUGA 3GTXA 1R2TA 3ZJ7A 2CITA 4IFRA 1EYEA 2ZUVA 4RR4A 4F2UA 3TJIA 3KRUA 1UC5A 3HG5A 3EPNA 2ZX7A 4ZOAA 3TA9A 3CZEA 2YYTA 1DHKA 3QPEA 3CMFA 2IQDA 2HV5A 2JFEX 1QCWA 3GIQA 4JPGA 1CDGA 2E5BA 3SY1A 3E74A 4ACZB 3V18A 1R9XA 4OECA 4R85A 3SCVA 2J74A 2ON3A 2DIKA 1B57A 3W2UA 4FNPA 4KETA 4ZQRA 3P80A 5DBTA 5AOUA 1RQEA 4J35A 3TTYA 5JVLA 4HNLA 1XIIA 5FESA 3GBDA 5E93A 3AYRA 3WKZA 1FA2A 4XUYA 2GLKA 1OD8A 3EXRA 1YADA 1ZP4A 4LUTA 2PRLA 4ORMA 1XHGA 3V0UA 2P5NA 2XSAA 1O95A 4Q3MA 4JTEA 4IIGA 1PZ3A 2OEJA 1S2CA 3IIZA 1UKPA 4ILSA 3QMSA 4ZTXA 2WNZA 4FLSA 2VOMA 4BK9A 5D38A 1GHRA 2GK1B 1I4NA 4EF8A 4CQAA 2CWNA 4M0XA 3MI2A 3QOKA 3QY6A 1HVQA 4HTBA 4AYGA 3QGAC 2HZGA 1G7UA 4O12A 5F4SA 3QYSA 2G0WA 2ZFAA 1YBQB 2Z1XA 4Q8TA 7ENLA 2C3ZA 3F2BA 1XIGA 4DI8A 4H9VA 3NIYA 3MZNA 3ONBA 3TC7A 3BGJA 4GXPA 4O4WA 1TUFA 1JZ5A 1IV8A 4GVHA 1CYGA 2XTKA 3T0DA 5A2BA 3MT1A 2I57A 3E9AA 3WD4A 1HJSA 2YLAA 5DCDA 1ZS2A 3HMJG 1A50A 1LCOA 1A5NC 4K8EA 4AIBA 1OGSA 4X9YA 1GG1A 4FXSA 1IZCA 4B92A 2J75A 1JCTA 2WYSA 1I75A 3LTSA 4MGGA 4K8HA 4D71A 1WE5A 4FLRA 5E1QA 3AXKA 2WVUA 5FL1A 4E3VA 4XX6A 3H2EA 4MLJA 4AC7C 4H7ZA 2A5HA 3MKCA 2A3HA 4QGCA 2DQWA 2NQJA 4TX6A 1M7XA 3STEA 1IWPA 1XYMA 1AH3A 4A22A 3L0GA 3LPOA 2OXNA 1IXNA 4OVXA 3JUGA 5BXPA 5HR6A 3WH6A 3MU7A 5CZTA 1TPEA 1ZB5A 3Q58A 3G5EA 3UXAA 4TR9A 3VNDA 4L61A 4QISA 3QZ6A 4QEHA 4CNPA 3C0LA 4XAYA 2QJMA 1E71M 5FF7A 3C3NA 5DRCA 2HEJA 3G1DA 2PWDA 4NXSA 4CU8A 4CKQA 5CKSA 4BQ2A 5DMNA 3N4EA 4Q7IA 1XWYA 1RAKA 4GH1A 3VVGA 3CS2A 3PNZA 2OZTA 5A2CA 3W2LA 3T1GA 1OF8A 4C6MA 1WQ5A 1E1FA 3ZJ8A 3WBEA 1HIZA 2C79A 3W2JA 1X97A 6A3HA 2XH7A 5LNSA 1QOQA 2DT0A 4W84A 3LHYA 4MZ8A 3SCUA 2PWUA 3NO3A 2ZUSA 4NG3A 2CBJA 1QW9A 2XIJA 3GB6A 1XBXA 1GG0A 4LYPA 1ZJIA 2YX0A 2QCHA 1POKA 2VX6A 3BWWA 2HPMA 4QJ4B 3SAZA 4D72A 4PL2A 4G5DA 4QBXA 3URQA 3OA3A 1N8FA 4RZ4A 1ISWA 5A8GA 4DBEA 2YDSA 1P7TB 1EP1A 3VABA 2AL2A 3O6DA 5FEWA 4JIPA 1DPMA 2VFHA 3WD2A 6TIMA 3TWAA 1W3LA 4X2PA 2PDPA 3AO0A 3MBDA 2EPNA 5DT5A 4A6GA 4C6IA 4LH8A 4PMJA 1V6WA 5HULA 3IEBA 3UG8A 3W2NA 3FDGA 1TPH1 5A8OA 2E8YA 5B7YA 1PWMA 3S47A 3GH4A 1NFPA 2DV0A 3PC0A 1WB0A 4OUIA 4AC1X 3ITGA 2YLLA 2YA0A 3OIHA 1P6WA 3OBKA 4NKCA 4X61A 2XG9A 3P2VA 2BGNE 1KBLA 4XD4A 3A12A 2OQHA 4LANA 3AWOA 3QPZA 2WVSA 5D9PA 4PMQA 1TYGA 3A4XA 2VCCA 2BHYA 1PSCA 4MZ1A 2VDHA 3CPRA 3NQMA 4A8NA 3PSVA 2XVNA 2CW6A 4Z2GA 2Y62A 4QIUA 1CLXA 4IP4A 3S2LA 4P7QA 4W9TA 1M41A 2OWWA 1XGZA 2VFGA 4DX3A 4CQ9A 3S6OA 2YXGA 4OBTA 1AODA 3L4UA 4UTFA 1CCWB 1JI1A 3FEMA 5LXXA 2CC0A 2JE8A 1C93A 1ENUA 2DFAA 3HJZA 4NHVA 3PJUA 2VDIA 2NSXA 1GOQA 3QR3A 3BLOA 1QI2A 2WJFA 3W00A 1VYSX 1W9XA 1U1UA 1CW2A 4ZTYA 4AH7A 2G3IA 1NWRA 1JFHA 2PPGA 2OB3A 2BDQA 1JVNA 5FCZA 3E5PA 2OO6A 3SGZA 4KESA 4UQEA 4EPEC 3DG3A 3L23A 1XH0A 1L8PA 3S5ZA 2NWRA 1EEPA 2VCBA 1QOXA 1KC7A 4KH2A 3D5HA 1XBVA 5PTDA 1ODUA 1W8SA 1HW6A 1NY1A 3W0KA 3ZMRA 3HFYA 4IICA 4TMCA 5EMLA 2ISWA 5LHFA 4ZVJA 1AQ0A 4W89A 3AHVA 3UJRA 3EMQA 3IS4A 2XSXA 3M5ZA 1FWWA 3UQNA 2BV9A 4BF5A 4WDXA 3USZA 1B3ZA 4ROPA 1VBRA 5C6MA 3V1HA 4K37A 1F76A 1C91A 1UR3M 2HROA 3MUAA 1DKWA 4HJWA 6CGTA 1E4MM 2ICSA 1XYZA 4Q4MA 4DXVA 5I3HA 3REQB 2INZA 2PDQA 2GSJA 3AJ7A 5F7UA 1YXYA 2EO7A 2NVAA 1L6FA 1AMYA 4JQ2A 4JHZA 4ZO8A 3UWVA 3AXHA 3ARQA 6XIMA 3GX9A 2FIQA 5JBFA 4J2MA 2MUCA 4PUDA 3BCDA 3KS6A 3A3XA 1MMFA 2EAWA 2J8FA 3AMLA 3RCMA 3AHYA 5HATA 5D30A 4QAIA 3W7LA 3AI0A 9XIMA 2UY5A 4LPCA 1TQJA 5AECA 4NAEB 3VUSA 2ALDA 4R88A 1RBOB 2J7HA 4IXHA 3LSCA 4GIEA 1UHVA 1RBLA 2XGBA 3T6CA 3FKRA 1HTIA 1E73M 1NQ6A 1CXIA 1DOSA 4JIEA 4S2CA 3V75A 3DCPA 1TMQA 4IJRA 3URBA 1BVWA 3LQLA 4Z1YA 2JALA 2E6YA 4QQ3A 3LGDA 1DORA 2YL6A 1RH9A 4IG2A 2WMIA 4MDPA 2WOQA 3ORWA 2D2OA 1LBLA 2XFRA 5T26A 3UWYA 2PWFA 4IHCA 2VJXA 2H8ZA 5LIKX 1W5NA 4PN2A 3M0XA 4QEEA 1J5SA 2GGHA 2Y24A 5LHEA 4LNCA 3UR5A 3KVMA 1WYIA 3PZUA 1MW2A 4WVXA 3RILA 3P74A 1Q6DA 3MWCA 4GUHA 2ZE3A 4BCEA 1H5VA 4Q8MA 1BQCA 5HAOA 2A3AA 5C5YA 2YDAA 4RV3A 4GY1A 3KDNA 4B3KA 1L6GA 3L4XA 4UTUA 4PB4A 1W2PA 2A85A 1ZALA 2GDQA 2JEQA 4QJ3B 3UPWA 3U2ZA 1K9FA 3NA8A 3MV11 5IDZA 1IEWA 1ZRQA 1JDAA 1PAMA 5J8LA 5I09A 1H63A 3DAQA 3URAA 2V38A 3W7EA 3WMLA 3BC9A 1XIDA 3CH9A 4Y9PA 1KM2A 4J3SA 1VHCA 2Y5EA 4MOZA 4ADSA 2GOKA 4GWEA 4UMBA 4W85A 3ARTA 4KGJA 1WKYA 3LDVA 4J28A 1NDYA 2VX4A 1V79A 2ISSA 1YE4A 4TVUA 2PE4A 1TZZA 2EJ1A 1OM0A 4CQDA 1E5JA 1S5MA 3LCIA 4HZ6A 4AZIA 3C61A 3CAWA 1MUWA 1BYAA 1PYFA 2O9RA 1AL7A 4DWSD 1RVKA 2VEGA 1A3XA 4H7VA 1MNSA 3DI1A 3M0JA 4DNMA 5CGQA 2D73A 4C90A 2A7PA 4GI8A 4ZQNA 5EFFA 3CV7A 4D6EA 3NPUA 3UNTA 3EPOA 3ES8A 2ZICA 3WQCA 4N4PA 3FHQA 1IIHA 4G7FA 4WLCA 1TV4A 1XCXA 2TODA 3GDMA 2RFGA 4CCZA 3EX4A 4PUWA 3VILA 2QVNA 2YCLB 1C90A 1D8CA 7ODCA 3NQ7A 4I90A 3AXXA 1O12A 3RMJA 1SFTA 2X16A 2GGGA 3D47A 1EXBA 1TTPA 5CPNA 4C1NA 3ZFHA 3IJLA 1NDVA 4AQLA 1OT1A 2J88A 4H8NA 4ACYA 5LIUX 1GOIA 4IPNB 4JKMA 3AXIA 1XS2A 1YTDA 4Q4SA 2DSVA 1Z69A 4LEQA 1DBTA 1ME9A 2YB1A 1XV8A 5KZMA 5ABGA 3T09A 4F0LA 3TYUA 1S38A 1JDEA 1Q85A 3LMYA 4RDYA 1EJUC 3ARWA 2I14A 1BRLB 1XLHA 4O18A 2R82A 3GE7A 1VFLA 4L1GA 3GNOA 2YB4A 3GNNA 4XG1A 2QLYA 5ABFB 3SO7A 3CHDA 1O68A 3WJXA 1FRBA 1TWDA 1YTEA 1PZ0A 1MVYA 2P10A 1I1WA 1LBFA 4CVUA 3M6DA 3FY1A 4JN6A 3GWQA 4V28A 4XD6A 1FWCC 4Q8WA 2DUXA 4O1AA 1I0DA 1PX3A 4D6IA 2VEFA 3B40A 5HNNA 2YL5A 1SFSA 1AQMA 2OWCA 4UTJA 1VBUA 4ES4A 3T0BA 1E9YB 3QKZA 1UA3A 4PTWA 4UIOA 3PUGA 4GMEA 1MUMA 1QPQA 3JU2A 1Z41A 2WJEA 4P61A 4IGNA 2VO5A 4JNYA 2GDVA 4EXAA 3BCJA 3DBPA 4LUJA 4E8CA 5DF0A 1EGZA 1PKLA 4WUIA 4HNNA 3LRMA 3LCLA 5IHSA 2XGZA 4LRTA 4QS5A 3I7SA 4QNWA 4AMAA 3M4HA 3WNLA 3FN9A 2PC8A 1HO4A 1AQHA 4Q8OA 4WD0A 4A3RA 3LM3A 5FACA 4KEZA 4DWSA 4ZSUA 3SBFA 4PMOA 4ZB2A 3SZ8A 3RYSA 1AMKA 3LXCA 3Q45A 1XCWA 3EWYA 4NX0A 4HHMA 2C1HA 4OTKA 3PAOA 2OO0A 1QOPA 2JIWA 4JTQA 3DFHA 1JCYA 3VIHA 1XDMA 3KBVA 4P8WA 1R5YA 3ANYA 4XO6A 5EFDA 5G1TA 1LRNA 1FDZA 2CBVA 4JTHA 3I6RA 3WQ6A 4ZR8A 1W17A 1W9DM 1XYCA 2WK2A 2DZAA 1VBGA 3T05A 3R0DA 2QULA 4UTWA 4PBFA 3CIXA 3TFXA 4KEMA 1B3XA 1IGWA 1RUSA 4KF1A 3RLGA 1K8YA 2QW5A 1H09A 4JQ3A 3GW0A 3OZYA 3T0AA 3GNDA 5AHLA 3W1RA 3CQHA 4XTDA 2YCJA 2F6UA 1V7YA 2XPKA 1IXPA 4M19A 2XVKA 1DEDA 1Z7AA 1OT2A 5ABHA 1EWDA 5M5DA 4LT9A 3VNZA 3EWBX 4UFLA 2WLYA 2PP1A 4JOMA 5E9AA 3V4BA 3SY5A 1GK8A 3P81A 4F2BA 1Q5MA 4KT2A 4MIMA 4H04A 1ECQA 3GR8A 1GQKA 2FHFA 1UROA 5HINA 3MHGA 4AZCA 4QJ1A 1F9CA 3NPVA 2VFFA 3KBNA 3R6IA 3L67A 2DZUA 3GVQA 5HMSA 1CGUA 1SQ7A 4J1OA 2WQDA 2BODX 1E0VA 2DJXA 1OFDA 5LNVA 4IP5A 2E40A 4I9TA 3KTCA 2HMCA 1TVPA 3M5XA 5A6AA 3HO8A 1TPB1 1S2UA 2AMGA 5A69A 3WX7A 1E40A 3EA1A 2IQTA 3FXGA 1QWKA 2EPOA 1A5CA 4BQ5A 3MMDA 4LYRA 4E8GA 1OBAA 1RV8A 4YS1A 1JNDA 1EJTC 3FJ4A 4H00A 1IXQA 1H5YA 2VR5A 3NCOA 1LOLA 1HJQA 3QH2A 4FNUA 3A9IA 2OT0A 3K1GA 3N3TA 2XGIA 1HG3A 1F8IA 3GY1A 4PTVA 2HS6A 4BS0A 1DVJA 4I9JA 1U30A 3QMTA 4U5KA 1K8XA 3WLIA 2VC6A 4UR7A 3TH6A 3GAKA 4YYCA 1XR2A 4UCGA 2PWHA 3K13A 4LEFA 1QAPA 2OFJA 3L2LA 5KMYA 3M7WA 4XO7A 5I07A 3N1AA 1OCNA 4NASA 4Y9OA 3GH7A 4UQCA 1IF2A 5E6YA 2P88A 3CYVA 1W31A 3MB9A 2IXVA 3OLDA 3H7RA 2ZZ4A 2Q6ZA 1V3IA 5M17A 1VFSA 4S3EA 3LCFA 3N19B 3EPMA 3C52A 5D8WA 5KZDA 3NWRA 5DY3A 3BW3A 3ATZA 2ABBA 1VFMA 2PA6A 2P0OA 1T0OA 3APTA 5F2LA 1ISVA 2D1ZA 2PLKA 3HV8A 1O6IA 1EXPA 1NWTA 2H9AA 3B05A 4FZIA 3CYJA 4BJHA 1W1IE 4H8HA 1Z9AA 3B0VC 4R7JA 2Y4SA 3W7MA 1D7KA 1LTDA 3I65A 4ATWA 1K8CA 1J0ZA 4X3ZA 4O57A 2RH9A 1ZBVA 3PWAA 2XUCA 3WO8A 2HK0A 4LV9A 4KERA 1JZ2A 5BRBA 4Q7BA 2WKJA 3UYCA 3UCQA 4MMWA 2SFPA 3SUWA 1MQRA 3PZTA 2Q02A 3KRBA 1MUCA 1UWSA 4N9DA 3PTQA 3S2NA 3NQ2A 3DECA 3HMCA 4IIDA 1XYLA 4BI7A 1RJRA 4TXEA 4LTSA 1ALDA 1DWGM 3UA4A 5LIYX 5C7VA 4HSHA 4LYKA 3VCRA 4L7ZA 4S3BA 5BOFA 1QR7A 1KM6A 3W76A 2BGQA 2PDNA 4DZAA 2NW0A 4G1KA 1YXCA 1CGWA 1Q6CA 3QRHA 4IGHA 1MWOA 3N6HA 5C9ZA 1FWBC 1LUCA 1SUXA 4KKXA 1VLIA 3W72A 1PCKA 2XN2A 4CCEA 4AHOA 3L7RA 1B3OA 3GTIA 1QNSA 5CC3A 2OMAA 2EPMX 5CLTA 7REQA 1WZMA 4Y9AA 1GQJA 1XJBA 2B31A 4FI4A 4ADTA 1E0XA 3Q4DA 3CUHA 1PIGA 4D6JA 2PD5A 1H51A 3DESA 2GWGA 2WXDM 3VCCA 3BLEA 1ME8A 4LNYA 1DIOA 2ZZ6A 3DFQA 4F0RA 2WCGA 1HQTA 3O15A 4EXQA 2BLEA 3J7HA 4S1FA 3RJXA 5C2XA 1ESWA 4PTNA 3NM1A 5JH1A 1XXXA 3M9YA 1UZ1A 1EHAA 3PUOA 3CQKA 2YIHA 3O3RA 4MKSA 1BSIA 5I7GA 3SUTA 4GX9A 3WIJA 3BLFA 4HJFA 2ZA1A 4LCSA 3VM5A 5CZSA 2ZADA 4WJXA 1KFCA 3SRDA 1W5PA 1W1YA 5DXXA 8RUCA 3G3DA 2VVSA 5K4ZA 1XG4A 4B3LA 1CB7B 4IQLA 3EOLA 2NXGA 2VUYA 4UR9A 3SADA 2G4FA 1KLYA 2IPWA 4M1BA 4HHPA 4ML9A 2XZ7A 3M0HA 3B3DA 3N2BA 1HNYA 4JXCA 4C1NB 2Z1KA 3WK2A 3UT0A 1Z42A 3TSMA 1BYDA 1R2SA 1EDQA 2WMJA 2W3ZA 4E6MA 1DWFM 3VDHA 3F4DA 4FMVA 3A5VA 4LS2A 2DH2A 3QVQA 3GR7A 3LG3A 4DJED 3QYQA 1DJXA 4LALA 1MXSA 1CZ1A 2D2GA 3GR4A 1F7BA 4UFIA 2OOGA 4IX0A 3LHTA 1JZ6A 4N42A 1XIHA 3U7VA 3H8AA 4K1WA 2QV4A 2TYSA 1EIBA 4QAWA 3Q65A 5I23A 4E8DA 4EXBA 4KWOA 4DHGA 1HP4A 3CUGA 3MKKA 4C6OA 4E4UA 1H60A 1GHSA 1K6AA 5TD4A 2AAAA 4EF9A 3TSBA 1REQB 4GISA 1B2YA 1JXJA 2BHZA 1SZRA 3FNDA 2B7NA 1G9HA 5G2WA 5LA2A 5CZJA 4H6KA 3ZO9A 2QKFA 4IQDA 3NFUA 2YBVA 3EB2A 1Q7ZA 3RM4A 2UY3A 1SMAA 3VE9A 4NZCA 4D8ZA 1NFBA 1XLAA 2OX1A 3HPFA 3LXAA 2Y7GA 3UZXA 1FH9A 1J6PA 4FF7A 4NZ4A 4GI6A 3WLLA 3QSTA 4JTFA 4U28A 2ZZ3A 2QJGA 2Z1VA 2ANUA 3GFXA 3HV9A 2PC4A 2C14A 4IQEA 2BVDA 4JGDA 4ZB5A 3S9ZA 1ZHAA 3LS9A 3OGSA 6REQA 3CH0A 3BE7A 1K7FA 3IUDA 3UZ5A 4DJDC 2XIOA 1W9PA 3BPWA 4WZHA 1LOQA 1EA0A 3KBMA 5ABEA 4L5ZA