2O9TA

Beta-glucosidase b from bacillus polymyxa complexed with glucose
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
445
structure length
445
Chain Sequence
NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta-glucosidase B
total genus 163
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9tA00
3FN9A 4S3KA 4BQ3A 3CHCA 2GK1B 5BXTA 1CLXA 1UWTA 3U5UA 1EOKA 2YDQA 4HZ6A 3I3BA 3SCOA 4AZ6A 2WMIB 4M1RA 4W5ZA 5A69A 5AYIA 2PB1A 2DSKA 3BXWA 3RCNA 3A4AA 4MNMA 1Y7VA 2WVTA 2F2HA 2VL4A 1QI2A 1CNVA 5ECUA 4BQ2A 3U57A 3KZSA 2BS9A 4ZFMA 6CGTA 3WIJA 2CEQA 3FHQA 2BY1A 4HA1A 4AISA 1CZ1A 3DYPA 3CZJA 2YL9A 4JFWA 4HP5A 3PTMA 1XH1A 4L4OA 1YHTA 3VMNA 3ZJ8A 1XRVA 1UD6A 2CIPA 3PTKA 1F4AA 3WEZA 4AZGA 2J7CA 3FAXA 2VT0A 2XFRA 3NDZA 4H41A 1QBBA 3WBEA 2VMFA 1U30A 4QLLA 2ZE0A 1AQMA 2WVVA 3AZSA 2WMHA 3VTRA 5CLWA 1WP6A 3AROA 3T0DA 3N9KA 5E6YA 3WD4A 1L8NA 1E1EA 4UTFA 2WKLA 4M56A 2DH3A 3QHOA 1V3LA 2Y24A 1VEMA 3RMEA 1OT2A 2Y8VA 2DT3A 1WZKA 4WIWA 3W4RA 3VIPA 2OSWA 3BAJA 4MB4A 3AMKA 2GDVA 3IJ7A 5A2AA 4AZ5A 4PRWA 1KGXA 1ECEA 5CSUA 1JZ4A 4AY1A 1B1YA 5A8OA 2DT0A 2WYSA 1CLVA 3N11A 3GNPA 5E0FA 5BRPA 4U3AA 2FHFA 3WKZA 1BGGA 4MAZA 4UFIA 2DH2A 4JHOA 5HNNA 3OB8A 3TOPA 2WAGA 2DGAA 1EXPA 3N17A 3MUZ1 3MUY1 4HA4A 4A3YA 3J7HA 2WMKA 4HOXA 1ZL1A 5I77A 2W91A 5IHRA 4E8DA 2BHYA 3MUIA 2J78A 2BHZA 3VGEA 4DWSD 1O6IA 4NF7A 1LL6A 4BZYA 1WZAA 5DF0A 2WMGA 2WKGA 1OD8A 1E4MM 1J12A 4U2YA 3LPGA 3NUKA 2XFFA 3AHXA 3MANA 4ACZA 4DM2A 5HBFA 1B3YA 2VRQA 3B9DA 5KZ6A 1A47A 5HPCA 3N04A 3IK2A 2ZICA 4MJ4A 2CKSA 1EDTA 2VX5A 2Y2WA 3SCRA 1BF2A 3WH6A 2BFGA 4KGLA 3VVGA 1DP0A 1VEPA 4X9YA 5ABFA 4P8UA 1HX0A 1SMDA 4ZE5A 3VOCA 5A94A 1Q6DA 2E9BA 2E9LA 3KE0A 3VGHA 4DUXA 1SFSA 3UR7A 4V2XA 1IT0A 4OKDA 1C7TA 1S46A 3PZIA 3L4XA 2A3AA 2GVYA 1FH7A 4DUWA 1D3CA 4AZCB 2BY0A 1GHRA 2EPOA 2ZUMA 4CD4A 4MADA 3AHYA 1B3WA 1RP8A 3CH9A 1UWQA 1QNOA 1XHGA 2UY3A 3MKKA 4E2OA 1W2VA 3OLDA 3M46A 4P8WA 3NSNA 1TCMA 2ZX8A 4EAMA 1V3KA 2QPSA 4HU8A 4J3WA 1VFOA 1ISWA 2VQUA 2AOSA 1GOIA 3SCVA 3WD1A 2YBTA 5JBDA 3PZVA 2D0GA 3WQ5A 2G4FA 2PWHA 1GPFA 4UQAA 1UKOA 2GJXB 1GONA 2CBUA 3AI0A 2IUZA 1B9ZA 3CZGA 5AYBA 5CG0A 2BVTA 2VCCA 3NSXA 4M80A 5EMYA 1UZ1A 2YDSA 3I3DA 2QHAA 3VMOA 1UKQA 3RM8A 3AQUA 4ATWA 4MB1A 4FMVA 1Q4NX 2WCSA 4F66A 2JALA 4YHEA 4AIEA 2DSZA 3F5LA 4GI9A 1XC6A 1V0LA 4JIEA 3BH4A 4J27A 1BSIA 2V5DA 3VGDA 4QAWA 3FY1A 2C8NA 1HP4A 3VPLA 1G1YA 1K9FA 3PN8A 5LA1A 3MO4A 2X0HA 1JZ5A 5BXPA 1XCXA 3THDA 5HOSA 4RE4A 2CHNA 5GNXA 1NM9A 1Q6FA 3EYPA 1CXHA 4H8VA 1FH9A 2WHMA 5CJ5A 4GO8A 1CTNA 2E4TA 3K1DA 3UR8A 2JEQA 2ZOXA 5I6SA 2VZUA 3ZIZA 1R87A 4MDPA 2XSBA 3L4VA 4HZ7A 3IAQA 1OD0A 3WF4A 5CPTA 5JBFA 4UFMA 4Y7EA 4UOZA 2BV9A 3PZ9A 2XHYA 2YOCA 3PZUA 4HPGA 1E9LA 2D3LA 3CZLA 3B9EA 4RE2A 2J8FA 2VX6A 2ZUSA 2NT0A 4J3VA 1WO2A 2GDUA 5KEZA 1W1YA 1BYCA 2J62A 1CGWA 3AS2A 4TXEA 1XV8A 3KEHA 2WVVB 3QGVA 2F61A 3ALGA 2W63A 1CXKA 2DT2A 4P7OA 1WAWA 2IXVA 1QHOA 2NW0A 3WNPA 5A8MA 2XGBA 5CXPA 9CGTA 1FP9A 1JDDA 3WMBA 1UD8A 4CGTA 4JKMA 3FW6A 3BC9A 3CHEA 3WF0A 3W82A 4YPJA 4D6HA 1NWUA 4ML4A 3QHNA 3GH4A 1VRXA 2CBVA 1D2KA 4C7DA 4D1IA 4F9DA 3DYOA 1UWUA 1Z32X 2EO7A 2VX4A 3W28A 2W92A 4QCEA 5JIPA 3VIFA 4MTVA 1KFWA 1DWGM 1HKKA 2D24A 4H04A 4R5EA 1KQYA 3QOKA 1W9VA 1W3LA 1J0HA 2WMIA 4P8VA 2WWDA 2Z1KA 3AIBA 2DDXA 4D6FA 1W1TA 4GI8A 4ZE4A 3WENA 3JUGA 4MAVA 4HTYA 4TTUA 3CTTA 1JZ8A 1CGUA 1KWGA 4HMCA 2CXGA 3MUAA 8CGTA 4PN2A 2CITA 1M03A 1UKPA 4ZXOA 3GXMA 2W61A 1H11A 1UOKA 3BGAA 4C7GA 3AYSA 4PBGA 3VX1A 3T0AA 3ARTA 4MB5A 4U5IA 1W32A 2W62A 1AQHA 4LQ1A 2PBGA 1FFQA 1D7FA 4W7VA 1V3IA 3WDQA 3WDIA 2D1ZA 1OGBA 1JZ2A 1KWKA 2J7FA 4R27A 4P8XA 3PBGA 2XWDA 1VB9A 5ABEA 2ZIDA 1QVBA 1XD0A 1V3MA 1W2PA 1JF5A 2XSAA 2WSKA 1UKSA 1E56A 1UHVA 1V08A 5AC5A 3GBEA 3MV11 2Q8XA 4JHZA 4URIA 3EMCA 5ABFB 2ZXBA 1UQYA 1WDPA 2ZXQA 1E0WA 5I24A 1K9TA 3ZJ7A 2UY4A 2XVNA 3AYRA 2EQDA 2DIJA 3BAWA 3G6MA 2ZX9A 2G3MA 2WZEA 3EDDA 2WBKA 1PIGA 2J4GA 1E6NA 1B2YA 4B16A 4MNKA 3ZR5A 3WSUA 4W5UA 1WKYA 1AVAA 3AMLA 4WJXA 3UEQA 3DHUA 4NI3A 4B3LA 2BY3A 1SYTA 4N0RA 1AMYA 2J7EA 2ZWZA 1ZBCA 2XYLA 4D1JA 5M17A 4AD1A 4M82A 1R7AA 2WC4A 1ISXA 4Z2HA 3W6MA 3PTQA 5BXSA 4B3KA 1QNQA 3PZOA 4NSBA 5A6BD 1E73M 3ARZA 1GVIA 5M03A 4QCFA 4XZBA 1H0GA 1M01A 1EO7A 5D9PA 4QP0A 4JFSA 1B0IA 2UY2A 1HJSA 4CKQA 4GKLA 1CIUA 1KXVA 3WBAA 2E9MA 2CYGA 3K8KA 1HJXA 2QV4A 3II1A 5GPRA 2CESA 1EDGA 4W88A 1JXKA 3VD5A 5CPQA 3CPUA 1BLIA 4PMRA 1US3A 1J0KA 4CN4A 1JI2A 2JIWA 4UQCA 3GXIA 3WH9A 1EQCA 3W6LA 1MFVA 2EXOA 3LMYA 1K9DA 1E72M 1CPUA 1TA3A 3T2QA 2AMGA 2YA2A 6TAAA 2GJPA 1UQZA 1G9HA 3SUUA 2V3GA 3K4DA 2GJRA 1HNYA 2XWEA 1UR2A 1UWIA 3WH5A 1X6LA 1ISYA 1US2A 4EANA 1UG6A 4XB3A 4AZCA 1E6XM 1J18A 1OM0A 1MQRA 2A3CA 2V3FA 3WL1A 1W9XA 3OLIA 1U33A 5D9OA 1KGUA 5E6ZA 2WCAA 5IHSA 1NWTA 2VNCA 1UR4A 4P7RA 2XVLA 5A8PA 2G41A 3ARYA 2FHCA 3K8LA 4PTXA 5EB8A 2VCBA 1CXIA 1V02E 3AXHA 3T0BA 3OA5A 4LYRA 3AIRA 1YQ2A 1LWHA 1GJWA 1JI1A 3AS0A 1VJZA 3CO4A 2X05A 1ITXA 1JZ3A 3B8SA 8A3HA 1LQ0A 1V3HA 2WHLA 2FGZA 5FCZA 2WCGA 3AIVA 2EPLX 1LLOA 4ZENA 4DUVA 1KGWA 1MYRA 5CGMA 3PZTA 3M7SA 4A3HA 2VZTA 2XPKA 1WDSA 3EMZA 3CIVA 4W89A 3FAWA 1B31A 1OSEA 1BG4A 4DWSA 3ZSTA 3POCA 1HVQA 3O6AA 1K9EA 5FIPA 4S3JA 4HOZA 3AIUA 1V6VA 4PMUA 1XSIA 2GSJA 3WMSA 4ZXLA 2OWCA 5I3DA 3EBVA 1ITCA 3OZOA 1VJSA 3N18A 4AZ7A 1V6UA 3VD3A 1TE1A 3GNOA 1B3VA 5EFFA 4TVCA 3VMPA 1QW9A 1QNRA 1HKIA 1BYAA 1PBGA 4PTMA 4CCEA 1MFUA 3A3HA 2EPNA 1W9UA 4W93A 3KWXA 2DSWA 3CMJA 4BS0A 1GORA 4XV0A 1CENA 3GNRA 3UETA 4PMYA 1OGGA 3ARPA 5M3WA 1C90A 3AS1A 3AIEA 6A3HA 3WN6A 3CUFA 1J0JA 4AYSA 4BA0A 3BMVA 4GPNA 5A6SA 3HJEA 2QF8A 1E6SM 1VFUA 2V3DA 3PZNA 4AZBA 2X8RA 1JGIA 2WWCA 1GVYA 3W25A 1GOMA 1H5VA 1NOFA 1EH9A 3ARQA 4A4AA 4BQ5A 4F79A 4CD7A 3BCFA 4ZEPA 1BPLB 4W84A 7A3HA 5DMYA 3VNYA 1JDAA 4HPHA 1TFVA 1C8XA 1R7OA 1RP9A 2WW5A 3SUTA 4AEEA 4YN5A 1XSKA 2OYKA 1LJYA 2X0YA 2WBGA 1WE5A 3VD7A 1WB0A 2BHUA 3F4VA 2O9RA 3OLEA 1KBBA 1E5JA 2CKRA 2W4XA 3RJXA 1E3ZA 4GZIA 3NYDA 1FP8A 3WELA 1UR8A 3WNNA 2VTFA 1QHZA 2Y5EA 1FHDA 2HISA 2VOTA 3W37A 4J3UA 3WQ4A 1UD2A 3CMGA 4TVDA 3NDYA 5CSYA 3WF1A 1TVNA 3WNMA 1V0KA 2YLLA 3SCPA 1P6WA 3RM9A 3LPOA 4XUYA 4GXPA 2CHOA 4MPKA 3THCA 2YDRA 4KWUA 2J7DA 4IM4A 2YLAA 1C92A 2VRJA 3TA9A 5GQBA 3VIGA 4PTVA 2VVSA 3EDJA 3QHMA 5A6KA 4LXFA 1H1NA 3WNKA 4J7RA 3WD3A 4JZ5A 5HPOA 3TTQA 5I78A 2WMFA 3A4WA 1HJVA 2X09A 2VZVA 4N42A 1KBKA 3K4AA 4EK7A 1GOOA 1R85A 2J25A 1JDCA 4BF7A 3BLKA 3GM8A 1KXTA 1EHNA 2OWXA 1I1WA 2O9PA 4W8BA 1E3XA 2RGMA 1V6WA 2XUCA 4Z2LA 3WUEA 4WLCA 3HU7A 2E0PA 1JYWA 2QPUA 3VDBA 4LYQA 4WKFA 4D6JA 1W3KA 1UD4A 4P7QA 1BAGA 2VZOA 3EDEA 3O2LA 3VD9A 2D22A 1W9BM 4MDOA 4UFKA 4CUCA 1WDQA 1B30A 1W1PA 3VGGA 5CZKA 1CWYA 1MW3A 1JYXA 2D3NA 4D6CA 1W3JA 4U33A 4JL1A 2AAAA 3AFBA 4W7UA 1RH9A 3VDAA 4PMNA 1ISZA 3RPMA 1TA3B 1GJUA 1UD5A 4GQQA 4AIUA 1TR1A 2A3BA 1UA7A 1E71M 3WH8A 3NCOA 1C8YA 1OB0A 2EPKX 4J3TA 1OCQA 4W87A 4PCSA 2NSXA 1M04A 1IZJA 3T2PA 1CGVA 3AIWA 5BWFA 1WNOA 1NARA 3VIJA 2WANA 2WVUA 1Q6EA 1FOBA 1E40A 1ODUA 1HL9A 3WFZA 1QI0A 4AC1X 5IXEA 4UOQA 5A6LA 3AMDA 1EQPA 2BXZA 1GOKA 5DT7A 5DT5A 3SURA 4GZJA 3VX0A 3O9NA 1WCGA 1W91A 1HKMA 5ABGA 2EEXA 3OGVA 1DWFM 2WMJA 2WM0A 1H4PA 1LG2A 2JFEX 4UOJA 3UCQA 1HT6A 2WLYA 1VEOA 1C7SA 3W38A 2BNJA 3GDBA 1DHKA 3S2CA 1CXFA 3UG5A 4LX4A 3LPPA 4HZ8A 4GZEA 1FH8A 1HKJA 1HJWA 1GQKA 1NQ6A 2B31A 3WF2A 2JEPA 4LGXA 1PZ2A 1PEZA 4HU0A 1KB3A 2OLHA 1EHAA 2A3EA 2J75A 1KXHA 3W26A 3WUGA 2ZUWA 4UQDA 3WQWA 4AIOA 2G3IA 3VNZA 3AZRA 4KGJA 3RILA 1OIMA 1MQPA 1DWIM 1MW1A 3BSHA 4KRTA 5JBEA 1JNEA 1M53A 2XVKA 4BQ4A 1JYVA 1NOWA 1GCYA 1NP2A 5TD4A 3IJ8A 4PTWA 1E4NA 4IUGA 3L2LA 1H3GA 5DEZA 1C8QA 2WNWA 1GQLA 2O9TA 2X2YA 3ZJKA 2YL8A 1UZ4A 5AY7A 1W3HA 2ESCA 4AD3A 1ZB5A 2D2OA 2VUYA 1HN1A 3PZGA 2JIEA 3VIMA 2WHJA 1JYNA 1HJUA 3DECA 5IFTA 1CYGA 1WZLA 4WF7A 4D6GA 5BXRA 2FGLA 4P7NA 3W53A 2E8ZA 1QNPA 2W66A 1J0YA 1HL8A 4QDMA 2OYMA 1ZBWA 2ZWYA 4CD5A 4DM1A 1B3XA 4CVUA 5IFPA 1ZJBA 3CHDA 1F4HA 1UYQA 3TTSA 3WEOA 3SCWA 1ZBKA 1GUVA 3ARSA 5EFDA 3OGRA 1MWOA 4Z2GA 1I75A 3WUBA 1UR0A 4W8AA 4CCCA 5I5RA 3ZQ9A 3VIIA 3BCDA 2XTKA 1AQ0A 1TZ7A 1E6PA 1RPKA 1E0XA 5A6MA 7TAAA 2OSXA 4MNJA 3VD4A 3VIHA 2QMKA 5I0DA 4W86A 2J7BA 4NRRA 5BYWA 4D71A 3E1F1 2YJQA 1HF6A 1B3ZA 1BGAA 1NWSA 2WVSA 5HXMA 4PMDA 2UY5A 5F7UA 1QOXA 3DYMA 3SUVA 3CLWA 3ZT6A 5I23A 1OINA 4M29A 2V5CA 3KL0A 4GQRA 2DEPA 5A6BA 4OZOA 3ZT5A 4JFTA 5CPSA 3VIKA 3AIQA 3BLPX 5FOOA 1JD9A 1DTUA 3TTOA 2XG9A 3AICA 3PHAA 5DO8A 3D3AA 3BSGA 1GOWA 1V02A 4J3XA 3POHA 5D8WA 2ZXDA 4KRUA 2F8QA 2TAAA 4BCEA 3WY1A 3W29A 3W0KA 2XIIA 3B9AA 2ZX5A 1E4LA 1BQCA 3UG3A 1E6RA 1GNXA 3ZSSA 4U31A 2ZX6A 2ZX7A 1PPIA 3BAKA 1JAKA 3KL5A 2G3NA 3CHFA 1FA2A 3N15A 1KR0A 1A3HA 3VO0A 1E43A 4WK9A 3WD2A 5A8QA 1QHPA 1LWJA 4PMQA 1UR9A 3AOFA 3AXXA 1LF1A 1HXJA 2PWDA 5A3HA 2W67A 2Y4SA 1DEDA 2WSPA 1JIBA 2J77A 3VGBA 2YKKA 1V6YA 4D6IA 3SCNA 1J10A 3WMCA 4XZWA 3WNLA 5D8ZA 1JXJA 3FNDA 1KXQA 1DWJM 1H41A 4JCMA 4Q22A 4PCTA 2XJ7A 1NH6A 2A3HA 3ZMRA 4HA3A 4OBSA 4MB3A 5A95A 5CLTA 4OJYA 2EPMX 4Z2JA 3EMQA 1WDRA 1VENA 2NT1A 2VX7A 1C91A 1HP5A 4CN1A 3SCSA 1E6QM 3U7VA 3TP4A 5C71A 1G0CA 4AZIA 2VCAA 3NSMA 3RM4A 3VGFA 3MSGA 3PZMA 3SCUA 4LYPA 2BY2A 4FLSA 2XM1A 3SIMA 4CD6A 5I2UA 4HMEA 2D0HA 5BCAA 1W9PA 3N12A 5CGTA 2CERA 2WHKA 3ARRA 1J0IA 4IISA 4B9ZA 4ACZB 1V0MA 3MMWA 4PSPA 3A6OA 1BYDA 3GXDA 1PX3A 4L4PA 1E5NA 1CGXA 1CECA 2MANA 3ECQA 2YL5A 2VZSA 4MJ2A 1CEOA 3DC0A 1VBUA 1UH3A 1UWRA 2OSYA 4RL3A 4CN6A 4U2ZA 3WQ8A 2VQTA 3W27A 4CU8A 2GUYA 5A2BA 3TTYA 3QR3A 3QOMA 1BHGA 1QNSA 3WF3A 1K6AA 3PZQA 3RO8A 1XYZA 2OWWA 1C93A 2QLYA 3CUGA 1UH2A 5FL0A 1HJQA 1QI4A 3MMDA 3DHPA 2WPGA 1EGZA 4AZHA 1OGSA 2PBOA 4AD4A 3GZAA 4AEFA 3WD0A 2CETA 1CBGA 3RDKA 3AMCA 3AMGA 1TUXA 2CNCA 3L4YA 3BAIA 2VR5A 1EO5A 3WDJA 3NJ3A 2XM2A 3SCTA 1VIWA 2J7HA 1PJ9A 2WC3A 3WDRA 4UQ9A 3VILA 2J7GA 2PWFA 4UFHA 4AD0A 3CUIA 1E15A 1QBAA 1BVNP 4FF5A 4UZSA 4PEEA 3ZM8A 3GYCA 2IXUA 4UR9A 1BG9A 2XIBA 3AJ7A 1H2JA 1TMQA 1OWQA 3CZKA 3WNOA 2EBNA 1QW8A 4FLOA 4FLQA 4OIFA 2DSUA 2DPEA 3MSDA 4K68A 3APGA 5D4YA 3KL3A 4WSKA 2XVGA 1KR1A 4GO9A 2JF6A 2WZIA 4Q7NA 1H0IA 2E8YA 4OBRA 1KQZA 1MW2A 1JG9A 4UZUA 2E3ZA 3G6LA 4CU6A 5A1AA 5IDIA 2UWFA 2CBJA 1W1VA 1WZMA 2OYLA 2J8GA 2E40A 3WEMA 4JCLA 2PF0A 1JD7A 5E0CA 5LA2A 2DT1A 3GBDA 4PMVA 4TX8A 3SUWA 2W5FA 5I79A 2XFYA 1U2YA 5LYRA 2YL6A 1MQQA 1QI5A 4D6DA 4FK9A 4MNLA 1E6ZA 1I1XA 5D9NA 1SR0A 2WC7A 4E8CA 1V03A 1ZBVA 4ATLA 1CGYA 1UD3A 3W81A 1BTCA 4OUEA 4WKHA 2ZUVA 4H8HA 4U3CA 4AWEA 3VUPA 2WXDM 4U5KA 5DFAA 1KCKA 2V3EA 5A6JA 2VO5A 4JFUA 4XX6A 3WDPP 1ESWA 2PI6A 1Q6GA 4GINA 4YHGA 4WSJA 3U7BA 4TUFA 2D23A 2VJXA 3W24A 3WL0A 4PYSA 2ZUUA 1J9YA 1UH4A 1PX4A 7CGTA 3ARXA 4TX6A 4QLKA 3ZJ6A 5FKYA 2WZHA 4KH2A 1XGZA 3MMUA 5D9MA 4NRSA 4CVWA 2HVMA 3LPFA 2YA1A 3CZEA 1VFFA 1MVYA 3AZTA 3CUJA 3S6TA 4TVUA 1NWRA 2BVDA 3AISA 4UFLA 1O7AA 1C3FA 2DQXA 3F5KA 3WUFA 5EBAA 3T09A 3RIKA 1N82A 1UKTA 3VKKA 2EJ1A 1VBRA 1JZ6A 3A4XA 1XH2A 4WKAA 3AHZA 2XVPA 4Z2KA 2J47A 5C8BB 3WFLA 2QMJA 2DIEA 2FH8A 4D72A 2Y8KA 1IV8A 2VRKA 3AHVA 3SEPA 1H49A 1MXGA 3F5JA 3BAXA 3FHAA 4GIAA 3AXIA 5GNZA 3U5YA 5A8NA 2PWGA 3ZT7A 3WDHA 2BVYA 2FDMA 4DWSC 5AC4A 2G8ZA 3CUHA 2GK1A 4UNIA 3TONA 4TTGA 3L4ZA 1M7XA 1B90A 1R86A 1V6XA 1HIZA 4LPCA 2YBUA 3RJYA 3N1AA 3CZ8A 4JFVA 1E0VA 1JFHA 3OIHA 4H8UA 5E70A 1TG7A 3IAPA 3VM5A 4DWSB 5JIWA 1CDGA 5C70A 2JF7A 4H2CA 4PSRA 1PAMA 1GQIA 4AD5A 4B15A 1L0PA 3CBWA 5CQ1A 3VM7A 1H09A 5FL1A 1FHLA 1EDQA 1JZ7A 1G01A 3N13A 4NZCA 4UQEA 2VVNA 2RGLA 1MW0A 3ARVA 4HOWA 3SCQA 3CGTA 5BROA 1NOUA 5FD0A 4JAWA 1JF6A 1V0NA 2V38A 2VC9A 3MV01 1LL4A 4OOZA 5ABHA 2ZUTA 3AS3A 1VAHA 2WB5A 1VF8A 4JKLA 4AMCA 2ZUNA 3ARWA 5A6AA 1GW1A 1XCWA 3WQVA 1RD6A 4FLRA 1OBAA 3K46A 3HMCA 1CXLA 2O92A 4QLJA 1PZ3A 3T08A 4AW7A 3IANA 4CU7A 3OZPA 3BAYA 1G5AA 1EA9C 5HDRA 3ARUA 4CCDA 5JUVA 1NP0A 3A47A 3VDHA 5LA0A 2JE8A 4CD8A 4UQBA 3GXFA 1ODZA 2FH6A 3ZR6A 3T2OA 3L2MA 1GZJA 3BMWA 4F9JA 1V3JA 2D20A 3WQ6A 1J0ZA 4IPLA 4GI6A 4J3SA 3K8MA 1LL7A 1X1NA 3M6DA 2DSVA 2J74A 4C7FA 1R8LA 4F8XA 4ATDA 5A2CA 1GQJA 3I3EA 3VIOA 2VI0A 3ZO9A 5E9AA 4EE9A 1J01A 3FXYA 3L4WA 1DWHM 4UFJA 4M81A 3EDFA 2PC8A 1PIFA 2YIHA 3L4TA 4TOQA 3UERA 1BFNA 2D0FA 1UUQA 3M07A 2CCRA 5M5DA 4H7VA 1JNDA 5E09A 3ALFA 4PMZA 1KCLA 1JAEA 1XD1A 1ZJAA 3MU7A 1CGTA 3D5HA 3GH5A 4KMQA 4J28A 3ZOAA 1LG1A 2CPUA 1VFMA 4PUDA 4JL2A 3WH7A 4W8LA 1Q6CA 4V28A 3NIYA 5BRQA 1J11A 3MS8A 4RE3A 4EKJA 2YA0A 3OGSA 4M8UA 1E55A 1BYBA 4X0VA 2C7FA 2O9OA 1JFXA 2PWEA 3VINA 1EIBA 1E1FA 2GJXA 3EDKA 1BVZA 2BXYA 3VU2A 4D6EA 4P7LA 3OBAA 4B9YA 1UWSA 1OIFA 1FFRA 2WLZA 1GHSA 4W85A 1TVPA 1MXDA 3HN3A 3IJ9A 4PMXA 4HMDA 1UA3A 1XH0A 1GOQA 2J79A 2VURA 2ZXAA 3OG2A 4UCFA 1PX8A 3SUSA 1X6NA 2G3JA 4AXNA 1G94A 5GNYA 3GH7A 2FHBA 4QFUA 4Z2IA 1QPKA 1QI3A 1XYFA 1CXEA 1XSJA 4W7WA 2XGIA 4OOUA 4X0NA 4E4PA 4PUEA 1W9DM 1HVXA 3L4UA 1ZU8A 2Z1SA 1EOMA 3UG4A 1UR1A 4AD2A 1ISVA 3GTNA 1E4IA 2WK2A 4M24A 1IZKA 4IPNB 3OLGA 1JL8A 2VR4A 4JKKA 1ZS2A 1E70M 3AHTA 1OT1A 4V27A 4ACYA 2CBIA 2X1IA 1SMAA 2C0HA 3UESA 1DWAM 4PMOA 2GFTA 1WPCA 3VDCA
chains in the Genus database with same CATH superfamily
1L6YA 1TQJA 3PP7A 5AYXA 5BXTA 1TPC1 1DJXA 3TLQA 3HFYA 3SCOA 1YXYA 4KIEA 4W5ZA 1P0KA 3TW9A 2DSKA 3W01A 3QXBA 3NNTA 4MNMA 1Y7VA 3TFXA 1TREA 3VKCA 3VCNA 1QI2A 1I2OA 5ECUA 3U57A 3THAA 2BS9A 2OQLA 3M0XA 4HA1A 1S38A 4M6QA 1FDZA 2BLEA 2IQTA 2ZRXA 1YHTA 4JTTA 1KA9F 1LTDA 4L80A 3TR9A 3FAXA 2I16A 1QBBA 3NO1A 1OFPA 4PFMA 3RU8X 2VMFA 1XISA 3LLFA 1EYEA 4QLLA 3CU2A 1YE6A 4LY4A 3AZSA 2WMHA 1HUVA 3RO6A 5CLWA 3A3WA 4QTGA 5H1WA 3N9KA 4QQUA 1J6PA 3LU2A 4B2DD 1XIHA 4UTFA 1MUWA 2WKLA 2PTDA 1V3LA 1YMYA 2HBVA 3EPNA 2BTMA 2I1OA 3KS5A 2Y8VA 1DIOA 1SW0A 1TO3A 3W4RA 4GCAA 4H9XA 4O11A 3EWBX 4HSHA 2HE5A 2NX3A 4PL2A 4DJFD 1F8IA 1A4MA 3DHFA 5CSUA 2QCDA 2QUMA 4AY1A 1B1YA 2DT0A 4JQ3A 2MUCA 4N9CA 3GNPA 5E0FA 4U3AA 2FHFA 3WKZA 2I56A 3BICA 3N9RA 2DZBA 3LI0A 1EJUC 3GTFA 5FI8A 1PCKA 3OB8A 2WAGA 2HPMA 2DGAA 3MUZ1 1Q2RA 4QE1A 3IJDA 2FZNA 4H6EA 2C16A 4HOXA 2P3EA 1O6IA 3P67A 3T1GA 4IP5A 2PDXA 5DF0A 2WMGA 4Q8WA 2WKGA 3TUUA 4P5UA 3KAOA 3WFAA 5AHLA 1OG0A 4NUWA 1OHLA 2XFFA 4ACZA 5HBFA 3FDGA 2XINA 3NQGA 3KLKA 5D38A 5D2WA 4LAKA 2PC4A 3G24A 3E02A 1DP0A 5G5IA 1VEPA 1XRSA 2ZQ0A 4X9YA 1X38A 3N6QA 3CPGA 2NV1A 1Q6DA 5HAOA 1ZENA 4V2XA 5HMDA 4DPQA 1Y65A 4GJIA 1C7TA 3A21A 2QIWA 3L4XA 2C1HA 4J2PA 3AHYA 4MADA 1PSCA 1UWQA 3CH9A 3UJRA 4UBPC 1I6NA 3MKKA 1W2VA 1GVRA 1KFKA 4P8WA 1YPIA 1KM1A 4I90A 3NQ8A 3VC5A 4A3UA 3STGA 1ZRQA 1V3KA 1A4LA 3OQ8A 1D3HA 1ISWA 5AHFA 5CEWA 3SCVA 1OZQA 2YBTA 3L5MA 2D0GA 3W1QA 4IIGA 1BD0A 3RITA 4HK6A 1B57A 1IEQA 5I3HA 4LF2A 4UQAA 4M3PA 1UKOA 2GJXB 1NDYA 2CBUA 3IPWA 1AA1B 2IUZA 2VGIA 8XIMA 1V5XA 3KOWA 4I6VA 4Z1BA 1IGWA 3C2VA 4IICA 4JDYA 3I4KA 1F8MA 3NSXA 1ZAIA 2YDSA 3KBWA 3WG6A 4PB4A 2QHAA 3AQUA 1EF2A 4JTIA 5FJTA 3S1VA 4MB1A 1Q4NX 2JALA 4YHEA 2V81A 1S5MA 3W1LA 2QUUA 2DSZA 4C91A 4AIBA 1XLHA 1XC6A 5DCDA 4GZ7A 1PDYA 4J27A 1Z41A 1G4TA 1AJ0A 3SRKA 4Y9AA 3T78A 4I7UA 2VEPA 2ZADA 3FY1A 1HP4A 3NG3A 1QATA 2C6QA 3R6IA 5LA1A 3MO4A 4KWWA 5BMXA 4MGGA 6REQA 3THUA 3VCRA 1S1RA 2CU0A 5HOSA 5CCZA 4ENLA 1H1ZA 2CHNA 3EYPA 2YFNA 4H8VA 4FOJA 1FH9A 3C6CA 5CJ5A 2QEZA 4LVGA 2VZUA 3GU9A 1R87A 4MDPA 1QUMA 3UP8A 1IXOA 3PB2A 4XO6A 4S3FA 3IIVA 4Y7EA 4UOZA 1XGDA 3RK8A 4TMBA 2YOCA 3BANA 3PZUA 2XH2A 2R8WA 1TWDA 4DB7A 4YVPA 2DZXA 1TPVA 2NT0A 3QZAA 2GDUA 5KEZA 3G1RA 1CGWA 5CAKA 4UTTA 4TXEA 4DLFA 1XV8A 1R46A 1VFHA 2F61A 3ALGA 3QGVA 3NL3A 1QHOA 2NW0A 2RJHA 3UU0A 5A8MA 3PUDA 4FSAA 4CGTA 2G97A 2FLIA 2Z1WA 2PFHA 3CHEA 4GC3A 3TMQA 3U8GA 3GH4A 2ZA2A 2CBVA 1B4EA 4D1IA 1UWUA 2W92A 2TODA 3BJFA 3HURA 1N55A 3VIFA 1DWGM 3NQ7A 2PZNA 2G4JA 1HKWA 1IEXA 3Q58A 4JGDA 4XSLA 1W3LA 5FJIA 2PEVA 1VPYA 2PTYA 2WWDA 5T91A 4DYKA 1P4CA 2QCGA 1TELA 4XD6A 1W1TA 3GVRA 4ZE4A 3JUGA 1J2WA 4S2BA 4HTYA 4HMCA 1EGMA 3FJNA 1M03A 1A3XA 4ZXOA 3PBVA 4INFA 4V1YA 2A7RA 5EMJA 3E12A 3GXMA 5AYZA 4DN1A 4QGCA 4QG8A 3AYSA 3VX1A 4M1BA 2AL2A 4CNUA 3PR2A 3C0QA 1AQHA 3TOYA 4X63A 4Q6XA 4G7FA 1YDNA 4UTJA 1VCGA 2V6AA 5B7YA 1KCXA 4IQJA 4Q4MA 1XRFA 4LBSA 3SECA 2J7FA 4R27A 3WLSA 5BOFA 1IWAA 3SR7A 2XSAA 3LCFA 3CQHA 3VKDA 1AH0A 4JHZA 1PTAA 3W7PA 1UQYA 1WDPA 4FR1A 2Q8LA 4JYFA 4FXJA 4UTLA 3ZJ7A 2UY4A 3DKLA 3THQA 2EQDA 3BAWA 2G3MA 4EF9A 4YL2A 3A9IA 2WBKA 5G4WA 5AN7A 2J4GA 1E6NA 1B2YA 4B16A 4EACA 3FXGA 3R43A 3TC6A 3WSUA 2QNEA 2OTDA 4W5UA 4HBKA 3NOYA 2NX1A 4F3HA 2VD8A 3EXSA 4GVGA 3HQNA 2OZ0A 2J7EA 2VR2A 2ZWZA 1T41A 4DRSA 1VR6A 3I6TA 1QR7A 3P8JA 1JCYA 4WJEA 3PTQA 1QNQA 3PZOA 3U2ZA 1PZ1A 3CAVA 3UA3A 3ARZA 1GVIA 3BK0A 3CQIA 1KLYA 2ACSA 2VEMA 4ADTA 3TYBA 4KWOA 3N2XA 4QJ1A 2A79A 1CIUA 4NU7A 3OG3A 1VJIA 2H3BA 1FTXA 2VFDA 1SO3A 1HJXA 4C6MA 2Y5JA 4W88A 5CPQA 4GABA 4ZQCA 2Q3OA 3CYVA 3WJSA 3MJMA 4UQCA 3YPIA 4HSOA 4HQVA 4IL2A 3W6LA 2CZEA 2Y7GA 1YX1A 3D47A 1K9DA 1E72M 1CPUA 1TA3A 1KTCA 1G9HA 2V3GA 4HPXA 1RALA 4GVIA 4NZFA 4KWSA 2Z6JA 2J66A 4EANA 3M41A 3H2OA 1P0NA 1S2WA 4AZCA 1OM0A 1IHIA 1DJQA 1A5KC 4Q4SA 1U33A 1YKWA 5AB3A 2DZUA 3IGSA 3G8RA 2FPYA 4QJ3B 4P7RA 4X2PA 2FTYA 4MUPA 2VCBA 4QEHA 4HMNA 3T0BA 2WJFA 3AIRA 4FR6A 1GJWA 4ZOAA 2HE8A 4ERGA 3KBJA 4NASA 2CLLA 1VCVA 2QDDA 3R1ZA 5CSRA 4DXXA 2EPLX 3NEVA 1K6WA 1LLOA 2O4QA 4RZ6A 1MYRA 4IIFA 5J5RA 3PZTA 3M7SA 4A3HA 2VZTA 1WDSA 2ZZ3A 2DU2A 4O0ZA 4LB3A 3FAWA 1SPQA 4Y96A 1QO2A 5DMLA 1NAL1 3WQOA 4FXSA 1K9EA 4QRNA 1WXZA 1TTQA 1JULA 3CL7A 4HOZA 2PDBA 1BXBA 2X40A 4ZXLA 2WO5A 1C9DA 4LSBA 1UC5A 3N18A 3TKFA 4WD0A 4JTRA 3VD3A 1YPXA 3UPMA 4TVCA 5EFFA 3C2OA 1HO1A 4OU1A 3WQFA 1V93A 4IMAA 4FIRA 4CCEA 1MFUA 2EPNA 2DSWA 1NEYA 3CMJA 5EMLA 2BG5A 4C5ZA 4PMYA 4JS3A 3AS1A 3LN3A 4FXRA 3PPCA 3WN6A 5HMFA 3CUFA 4HNNA 4GPNA 5A6SA 2QF8A 3O16A 1E6SM 1VFUA 2QUNA 4AZBA 3N3MA 3SFKA 5CZJA 2X8RA 2YPIA 4KW2A 3B04A 2FDSA 3W25A 3UD6A 2HNHA 3VDGA 3WLNA 4ZL1A 4W84A 7A3HA 3VNYA 2G95A 4HNUA 4XISA 5LXXA 1VFLA 1LRTA 4XKMA 3IV3A 3QSRA 3CYJA 3LQGA 2OYKA 2WV8A 4A8LA 3G0UA 3VD7A 2BHUA 3NM1A 1Z44A 1FWHC 4H4IA 4XZMX 2PMQA 1UR8A 2PDMA 3P5ZA 3NWRA 3SIZA 1FHDA 2YDAA 3SRDA 4D8AA 4C1LA 1XM3A 1M5WA 3EXTA 4M7TA 4H7ZA 1TVNA 3CLMA 5B80A 1S5WA 1V0KA 3SJ3A 3C4UA 4IFOA 3LPOA 4WDWA 5C2GA 4RDVA 2YDRA 1EZWA 1RQBA 1Q6RA 4JIRA 2OKOA 4FNQA 2YLAA 3E49A 3TMLA 4AY7A 1KCZA 3V4BA 1YW1A 2VRJA 3TCSA 1O4UA 4AEOA 1XKJA 2VVSA 1YXDA 1TPWA 3WD3A 4JZ5A 5HPOA 2GSHA 5FEPA 1TQXA 2VZVA 3CTLA 4EK7A 3PUOA 1FBAA 2OZTA 5I03A 2ISWA 2XSXA 1UJQA 2OWXA 1P0DA 2GVLA 5CG7A 4QE5A 3PNZA 2PDKA 1KBJA 1EJXC 1JRCA 1OYAA 4NZ4A 3KRSA 4I8YA 4KT2A 1NU5A 1UD4A 4P7QA 1MNSA 2GVEA 2VZOA 3VD9A 1LLZA 2E5DA 3RU6A 3PANA 4CUCA 4UR8A 1HO4A 1W1PA 2D3NA 3NTYA 3DGBA 2AAAA 1JPIA 3AFBA 4W7UA 1EC8A 1RH9A 1RJQA 3IUDA 1GJUA 3OZYA 3SY1A 4I9AA 4GQQA 2XN1A 3SN0A 1JJKA 4LC6A 2P50A 2CZFA 4HU3A 2CLPA 3NR0A 1TMHA 4B90A 1OCQA 3DESA 1MEIA 4PCSA 1SZNA 4RKAA 2QW5A 3N4AA 4YTUA 3M0MA 2AL1A 5BWFA 5CGQA 3LHUA 1VZWA 3S6OA 1FOBA 1E40A 1ODUA 3WFZA 3C52A 4UOQA 2OLAA 1EQPA 2BXZA 3I68A 3E0LA 4PMJA 4GVFA 2HVNA 1ZCCA 1Y5WA 2CLFA 3PY2A 4Z0SA 3UCQA 5LNUA 1ZPTA 3PUEA 1C7SA 3W38A 3GDBA 3N4EA 5L9FA 2C71A 4PUMA 4HZ8A 2C91A 4GZEA 1HJWA 1NQ6A 2JEPA 4FX6M 4LGXA 3SQMA 4HU0A 5MKGB 4HPNA 2OLHA 1Z42A 2J75A 2F9RA 3WUGA 5HINA 2R1NA 1AH3A 2ZUWA 1RK6A 2AGKA 4KRTA 3R2GA 4V1XA 5FACA 5E9XA 1R3RA 3LRMA 1AW2A 1FX6A 4DPPA 1TJPA 2G3FA 1E4NA 4IUGA 4TV6A 1QFEA 1C8QA 2WNWA 3OEXA 2X2YA 1GWJA 1W3HA 4GYJA 1ZB5A 3MB9A 2VUYA 1OFQA 4H9VA 2JIEA 5K9CA 2WHJA 1JYNA 1HJUA 3DECA 5IFTA 1EP1A 4WF7A 1KM0A 3P14A 2FGLA 2C13A 2ZVRA 2E8ZA 4GUHA 1FKXA 4QDMA 2OYMA 4CVUA 3OU8A 3MUXA 1F4HA 4IG2B 1RV8A 1G4PA 3URAA 4GY0A 4ILSA 1MWOA 4Z2GA 1MDRA 1S2VA 4CCCA 2Z29A 3BCDA 3NXLA 1AQ0A 3C0JA 7TIMA 1TZ7A 4DJDC 5BOOA 4C6NA 2YCEA 4HNVA 4UR7A 5BYWA 3ME3A 3P7YA 4EWND 1A5BA 3BW4A 1XLIA 4PUNA 1NWSA 1PYMA 3B8UA 3F4CA 2UY5A 3GSMA 1QOXA 3DYMA 3CLWA 1S3TC 3OHIA 1XS2A 5A6BA 4OZOA 3LCGA 3ZT5A 1IWPA 1PZ0A 3LXAA 2DZAA 1L2UA 4AF0B 3AWNA 4WOQA 3TTOA 3HB9A 2WQDA 3F7JA 6ENLA 3AO0A 3ORWA 4ES4A 1GOWA 4J3XA 5D8WA 2ZXDA 4KRUA 3L5LA 1WDDA 2FZ9A 4ZOCA 4BCEA 1U1HA 1X1ZA 3W29A 4Z42C 1B3OA 3O0KA 3M0LA 1GNXA 3UBPC 3W72A 1DJNA 3VNIA 1ZZMA 1PPIA 3NQBA 3BAKA 2G3NA 4A3QA 4GQ0A 3N14A 3FEMA 3N15A 3L7RA 1TMLA 4RV8A 1E43A 2V5LA 3LRKA 2NWRA 1DJZA 3UZYA 4ZR8A 3AXXA 3MYPA 3HFTA 1HXJA 4LUSB 3FVMA 3BLOA 2A21A 4W9TA 1GVOA 2YKKA 1V6YA 4G56A 3SCNA 1R47A 4ICNA 2IS7A 3KP0A 3WMCA 2J9XA 3WNLA 2HROA 2VOMA 2XIJA 3REQA 1JXJA 3GU2A 3PWGA 1YADA 4QHRA 3TJ4A 3EEZA 3PPHA 4Y90A 3HBLA 5H8PA 4LVFA 4C6PA 3T0CA 3UXDA 2ZZ7A 3LHTA 3GQYA 2L5HA 1W1IE 1I2NA 3EKZA 2JKEA 3WLHA 1FWBC 3GR8A 4DEFA 3D3FA 4S3AA 1DE5A 1EF3A 4O50A 2F6KA 5DXXA 1HP5A 3SCSA 4YU1A 1E6QM 3TP4A 3KCJA 3NSMA 3KVJA 3VGFA 3ES8A 3WLKX 3XISA 2BY2A 4CD6A 2CLOA 4XTDA 3GLCA 3ARRA 3EXRA 3Q94A 4IISA 4G8TA 3DBNA 1TRIA 5XIAA 1V0MA 2XZ9A 1US0A 1BYDA 3MKVA 1CECA 2OG9A 3VA8A 4CNSA 2R14A 5HMSA 1W54A 2Y8UA 1K8XA 2OSYA 2F7FA 3IGHX 2HJPA 2RUSA 2REQB 3QOMA 2C19A 1QNSA 4GH1A 1BTMA 4R88A 4C6OA 1K6AA 3WX7A 4AWSA 4GCXA 4CQAA 4CQ9A 3PZQA 3BARA 1J5SA 1XYZA 1T99A 2OWWA 2QAFA 1ADDA 2QLYA 3CUGA 4EPBC 2EJAA 4K1WA 1OGSA 2UBPC 2ONEA 2PBOA 4AD4A 2X1UA 3TNBA 3KBNA 3WD0A 4ZSTA 3B4UA 3DZ1A 2YW3A 3S0CA 4PUUA 4GX8A 2CNCA 3TQKA 2VR5A 4O52A 4M6PA 4F0LA 2QUVA 2J7GA 1IGSA 2PWFA 4NNAA 4LB4A 5EY5A 1E15A 1QBAA 1BVNP 1RLCL 3S9IA 1GKQA 1P0BA 4PEEA 4MWAE 4UR9A 1AUSL 2XIBA 4I5XA 4C6JA 3CO8A 1H2JA 1G67A 3CZKA 2HWGA 3CEPA 4ADUA 4OIFA 1K4HA 1Z9AA 1TJRA 3MUCA 1SGJA 4H6KA 2WZIA 1F2JA 3LXCA 4TX9A 4OBRA 1MW2A 3E5PA 4UZUA 5A1AA 5AC6A 3G6LA 4CU6A 4GY1A 3Q2DA 4DO4A 2OYLA 2J8GA 4YTRA 5T8GA 4JCLA 1JD7A 2DT1A 2W5FA 4HNCA 5LIWX 3TJLA 1MUCA 4O1EA 2WQPA 3VNJA 4UTMA 3MVIA 5D9NA 1UC4A 2WJDA 3GB6A 4DQWA 1H1YA 1SR0A 2WC7A 4ATLA 1E9YB 4WKHA 4H8HA 1YTKA 1K1DA 5AHMA 1KFJA 2WOQA 2E68A 4DELA 1IEIA 2WXDM 3T9PA 2PD5A 5A6JA 2VO5A 4IIHA 5REQA 4GJJA 1H7NA 1DJGA 4Y8EA 2D23A 2WJEA 1UH4A 1TWWA 1KKOA 3ARXA 4KKXA 3NQEA 1LORA 3N2CA 1RPXA 1L2QA 5FKYA 3ZJ6A 1EX5A 5D09A 1MUMA 3MMUA 1OX4B 4CVWA 3LPFA 1RK5A 1VBHA 2GQ9A 3S6TA 1KW1A 4TVUA 3L0NA 1NWRA 4MYXA 4NNCA 4UFLA 3AISA 1E0TA 3VKKA 1PV8A 3KOFA 2YBVA 1O12A 2XVPA 2DZPA 2DIEA 2FH8A 4QM1A 3GC5A 4R7WA 2VUNA 3R11A 4K8EA 4KEZA 7REQB 1XYMA 1X7IA 3GK0A 4HKPA 5A8NA 3WK1A 5BOEA 3W1AA 2HTMA 4DWSC 4CEUC 3CUHA 3M4HA 4UNIA 1VKFA 4XZLX 1B90A 2FPVA 2PDHA 2Z00A 1A3WA 2ANUA 3FKKA 1E0VA 4QS6A 4LC8A 5E70A 5JIWA 3ITCA 5L6UA 3WBWA 2JF7A 3GC4A 1FXPA 4B15A 1AMKA 4MF4A 3VM7A 1H09A 1MZHA 3V0SA 4FNSA 2HK0A 3L12A 1WX0A 4NZCA 1TV2A 4UQEA 2VVNA 4HOWA 3C0SA 2OFJA 1M68A 3DBPA 1Z69A 3CGTA 4R34A 5BROA 4C6EA 2WZTA 4MSSA 4XIMA 4DJED 2GQ8A 5D33A 1KO0A 3B0PA 5ABHA 1VAHA 1OX5A 1VF8A 2J13A 4X9SA 1RD6A 2PDCA 1FCBA 4JN6A 5M1TA 3SDOA 4AXKA 2PDWA 3IWPA 3RCYA 3KHJA 1BVWA 3W1RA 2O92A 4DO7A 4JIIX 2IPWA 1HQTA 1PZ3A 4K38A 3L67A 3RLUA 4F2TA 4XAYA 3KUMA 3NVTA 1W5NA 3QV7A 3TIMA 4JDBA 3GR4A 3TC7A 3RMJA 1PDZA 1FWCC 3EKGA 4QQ3A 3A47A 4BKNA 2P0OA 3LV5A 3GXFA 1ODZA 3T2OA 3L2MA 1TR9A 4IP4A 3CL6A 3N29A 3W86A 1XP3A 4LBRA 2DSVA 1LRQA 1SJCA 3DFQA 4M6VA 2PU0A 5A2CA 4ICMA 1FUYA 2VI0A 2DIKA 4A35A 4EE9A 3VOIA 4IHCA 4LUYA 3L4WA 4FO4A 2DVTA 4UFJA 4M81A 1KFLA 3EDFA 2PC8A 3QW4B 3L4TA 3UERA 1JCNA 4XBJA 1UUQA 4UMAA 4BEQA 3W7NA 4PMZA 1NJJA 3TJIA 4JTQA 3BSMA 1ZJAA 4K7VA 1RY8A 3GH5A 2A6NA 4HA0A 2V82A 4KMQA 3VFLA 3C5QA 3V35A 2Z28A 4JL2A 3P93A 1Q6CA 4MZYA 1GZGA 4V28A 3W74A 1U5HA 4KCWA 4GLEA 3ITYA 2OLSA 4QSHA 3VE9A 3GFZA 5DBTA 1E55A 1BYBA 2C7FA 3MC5A 3P74A 5JMUA 1O1HA 2GJXA 3EDKA 3KTSA 2BXYA 1IR2A 4D6EA 2W0UA 1WA3A 3JVAA 1UWSA 2PRHA 3QLLA 1FFRA 1GHSA 2VDGA 1T8XA 3HN3A 3IJ9A 2NV2A 1RA5A 1GOQA 3PUGA 1ELSA 2IKIA 1GT8A 4NAEB 4R9XA 1PX8A 2ZYFA 3A24A 3SUSA 1X6NA 1YPFA 2G3JA 3HA1A 4AXNA 5GNYA 2FHBA 3UPWA 1QI3A 1XYFA 2FGBA 1XSJA 4H3DA 4FNUA 2NWSA 2XGIA 4OOUA 4WHBA 4WSHA 2A1YA 4X0NA 4KPLA 4PUEA 3E3HA 1W9DM 2HZGA 4GNVA 4JNMA 4NJIA 5EMUA 4AD2A 1F76A 2KZHA 3RHGA 1ISVA 5CSSA 3QV8A 1H7WA 1JL8A 4JKKA 3KS6A 1RHCA 2H8ZA 3AHTA 3QQ1A 2DUXA 4UCGA 1GW9A 3CAKA 3JZUA 4PMOA 2GFTA 2Z26A 3VDCA 1POJA 4HZMA 1UWTA 2GGIA 5PTDA 2WMIB 3M9YA 4KS0A 3SQSA 2I9EA 2NZLA 2PB1A 4B5XA 3I6RA 4MKSA 1EJVC 4J2MA 2WNQA 4JIPA 2WVTA 3A4JA 4FALA 4BQ2A 3KZSA 3WK2A 2CEQA 3FHQA 1YNYA 2BY1A 4LCQA 3UXLA 4AISA 1CZ1A 2X7WA 2YL9A 1OC6A 4GUJA 1QPOA 3CM4A 5GVJA 3PTMA 1XH1A 1Q6QA 4L4OA 2V67A 3OVPA 3WEZA 4AZGA 2PA6A 3R4IA 4G6CA 2VT0A 2ASHA 4IXHA 1YDVA 4L9ZA 3WBEA 4FNRA 2ZE0A 4S3BA 1AQMA 3O6YX 3P0XA 3T0DA 5F4WA 5E6YA 1ICPA 5JU6A 1IQ8A 3AAMA 1Q7QA 3GHUA 2PD9A 3CWHA 1G7VA 1WZKA 4FAMA 4WIWA 5HNUA 3BJTA 3L9CA 4XAPA 4QJ5B 4E38A 4LAOA 3S83A 3E0WA 4MB4A 3AMKA 4YTSA 5A2AA 2PP1A 1KGXA 3WLMA 3GXTA 1E1CB 1JZ4A 5A8OA 1MEWA 4B5SA 1TE6A 1A50A 1KLZA 3W1MA 3ABQA 4QEEA 1A5SA 1QK2A 3TN4A 4EPDC 3QTGA 4UFIA 1XLAA 1XIBA 4I5UA 3GHRA 3USBA 4DJFC 5AVNA 2TSYA 3UZWA 4QITA 3V1PA 1YLVA 5FJJA 4GQGA 3BVJA 3J7HA 2XIOA 4FXFA 2FKPA 3MUIA 3COTA 4BI7A 2J78A 3VGEA 2GOUA 4IZGA 2QDHA 3GRIA 2VC5A 4HT3A 1NFPA 1E4MM 2XN2A 4RX0A 2BVWA 4Y8FA 4GXWA 1OYCA 4DM2A 1B3YA 1A0EA 1TV3A 5KZ6A 3LX9A 3NQFA 1V4YA 3AYTA 5CPNA 4DY1A 1EDTA 1AK5A 2Y2WA 3SCRA 4I8DA 2GGHA 3WH6A 1RJRA 1E9IA 4N6FA 1XLKA 3M0HA 3VVGA 3IJIA 1XIMA 3IRDA 3DG6A 3UFYA 1SMDA 4LF1A 3VOCA 5A94A 4B2DA 3KE0A 4DUXA 3NVDA 4OKDA 4IQEA 1VQTA 1IYXA 2A3AA 2F84A 1BRLB 1FH7A 4AZCB 2ZUMA 1XHGA 5I3JA 1HFBA 4E2OA 3OLDA 3RAOA 3NSNA 2FZ8A 5LGZA 3K13A 4FEZA 4NX0A 3MY9A 2DY3A 2GVJA 1TCMA 2QPSA 4DBEA 4J3WA 2VQUA 3IS4A 3MT1A 4IP7A 1XDLA 5C0QA 5TBOA 1GOIA 1GJPA 1Y8BA 3BGJA 5MF5A 2HPIA 1VC4A 2PWHA 3PNUA 4QDPA 3GW3A 3W2UA 1GONA 3AI0A 3GFXA 1LLWA 1B9ZA 4ASTA 4WOZA 1SUXA 5I3IA 5CG0A 3OBEA 3GG8A 5C9RA 2BVTA 2NSOA 4RE0A 3NZGA 4XD5A 3I3DA 3O6CA 5HUPA 3VMOA 2QJIA 1UKQA 2H3DA 3QMTA 3W73A 4KFNA 2VKZG 1HGWA 4AIEA 1W6TA 4MWAB 4O15A 3KZPA 2G5WA 1ZAJA 1BSIA 4FA3A 3VGDA 4K36A 3VKJA 2QAPA 4HN8A 2VFGA 3SGUA 3WQGA 1TPDA 4ZOEA 1KM2A 1P0EA 1K9FA 2X0HA 4GY7A 2DVXA 5C6MA 4NVTA 3VUSA 3G22A 1XCXA 1XI3A 3UG8A 3THDA 3QZ6A 4GYKA 3ZS4A 3C56A 2VFHA 1NM9A 3BG5A 1I0BA 2I5GA 2X41A 4DBSA 3K1GA 1JPHA 2ABBA 1CTNA 2E4TA 2R82A 3P3BA 4GFSA 2JEQA 2PLMA 3BE7A 3LDVA 1OFRA 4PUKA 3BOLA 3IAQA 4JICA 1XX1A 3WF4A 1EKOA 5JBFA 4UFMA 3G0XA 3PZ9A 3G1XA 4HPGA 1LYXA 2D3LA 4GA8A 4WVXA 2VX6A 2V69A 1R9YA 2ZUSA 4B4FA 4J3VA 1WO2A 4DO6A 1OF8A 3UCDA 4WDTA 4XKYB 1YDYA 5H8MA 2DT2A 4P7OA 1QXLA 2IXVA 3GXNA 4GOAA 3T40A 1GKPA 1ZQ5A 9CGTA 3KDOA 3C2FA 5HMEA 1UD8A 3WMBA 4JKMA 3SFWA 1LWIA 3S5OA 1R5YA 2J24A 3W82A 3QHNA 1D2KA 3DYOA 1LUCA 1Z32X 2D2JA 1XLBA 2VX4A 4MY8A 3F2CA 4H04A 2BMBA 4R5EA 3U9IA 6ALDA 3SBFA 3RLVA 2QCDB 1BWVA 3F1QA 2PDGA 4GFIA 1K8YA 4C6BA 3MYOA 3WENA 4H7CA 1KWGA 3TYUA 2CC0A 2NQLA 3DI0A 2A6LA 2CITA 1T6MA 1L6GA 3P2VA 2E6YA 3GDRA 3CPRA 3FA3A 2W61A 4C7GA 3GYEA 1N8WA 4PBGA 3T0AA 2A0NA 3ARTA 1XBVA 3S5NA 1W32A 2B4GA 2PLKA 3O3RA 1ITUA 4LY8A 3W2MA 1FFQA 2ZVIA 1NSJA 4UWMA 1D7FA 1TWIA 3RR1A 1C8VA 2NQ9A 3M5ZA 3WDIA 3UWYA 3A3XA 3CUXA 3U2CA 2D1ZA 4DWDA 2OT0A 1VBGA 2VC7A 4PUWA 1KWKA 3KWSA 2ZCGA 1TV8A 2QCCA 4P8XA 2XWDA 1VB9A 4AHQA 5ABEA 2ZIDA 1SW7A 1SM9A 1V3MA 5T9CE 1JF5A 2WSKA 3V3WA 1H7RA 1RVGA 5ABTA 3MV11 2Q8XA 1P1MA 1YIXA 1QDSA 1ENUA 4YCPA 3EMCA 4PUJA 3BDKA 3APYA 1K9TA 1C9WA 3QBUA 2DIJA 4CNPA 2WZEA 3S1GA 4ZO8A 3SY8A 5HJLA 4KETA 1L6SA 3QR0A 2J6XA 3P80A 3QPEA 1VP5A 1IXQA 1WKYA 2GWGA 3NZPA 1IT7A 4NJJA 1AVAA 3GC2A 1DVJA 3W7DA 5AHEA 3GG7A 1F3XA 1SYTA 4N0RA 5REQB 1TIWA 2XYLA 2UZ9A 3O0FA 5M17A 4AD1A 2WC4A 3AUOA 4Z2HA 1DJWA 4B3KA 5A6BD 5CJNA 4AH7A 4O53A 3H2FA 1JCJA 1F7BA 1E73M 1XUUA 4UTIA 1YEYA 5C2CA 3KHDA 3IJ6A 4S1FA 4XZBA 4QP0A 3UXIA 1FWNA 3WBAA 2E9MA 2CYGA 4G5DA 5AHNA 1KRCC 2QV4A 1XG3A 3UVIA 4YNGA 2VGBA 4Q8PA 3CPUA 3W88A 2I9UA 4J9JA 3WLRA 2QCNA 3R8GA 4CN4A 3PK7A 4Q4PA 1YBQA 3GXIA 3WH9A 3T4WA 1O1ZA 2ALRA 1EQCA 3C0LA 1JCMP 1JUEA 4DYEA 3QYQA 2CLHA 1QW7A 3LMYA 3E74A 4HIBA 6TAAA 1EL3A 2GJRA 1YBQB 3LCHA 3KCOA 1SJAA 5DCEA 1I2PA 2FMNA 3WH5A 1ISYA 4JTLA 4Q3MA 1UG6A 1O5XA 1OG6A 3N9SA 1AH4A 1TJ1A 1TKKA 1NTHA 5JVLA 3GIPA 3WL1A 1W9XA 5D9OA 4WY0F 3RGTA 3GD6A 1KGUA 3CQ0A 1Q2SA 1XG4A 5DRCA 1UR4A 4MLRA 4PTNA 2E25A 4PTXA 4B5NA 5EB8A 1YNQA 4TR9A 2DZVA 1V02E 1ZJHA 4H9MA 1YQ2A 4PCNA 2DW6A 4C6FA 1NDWA 1RQHA 4EAYA 2I5IA 3CO4A 4E2DA 2VC6A 3DFOA 2O56A 4TO8A 3IRSA 1SR9A 8A3HA 2WHLA 2FGZA 2XISA 5FCZA 3AIVA 3H4XA 3STCA 4ZENA 4DUVA 1KGWA 5EL1A 1RQEA 3GDKA 4JN8A 1ZTVA 3E2QA 3LD5A 3FKRA 3BUVA 4DO5A 1OSEA 4NZ1A 1NELA 3ZSTA 4P61A 1BRLA 1NIUA 1XRTA 4JQ1A 2OJPA 1X7FA 1A5CA 3AIUA 5AVHA 2GSJA 3WMSA 1O66A 1Q66A 1SO4A 2Y6ZA 4GKTA 3DCPA 2Y7FA 4HHLA 1XIDA 2GOKA 2YCKX 3G0SA 1GOXA 1TE1A 1Q63A 1QNRA 1DBTA 1HKIA 3FA5A 1BYAA 3HO8A 1W9UA 3KWXA 2P8CA 4BS0A 4GIYA 3OP2A 3PFRA 4XV0A 1CENA 2FJUB 3GNRA 1OGGA 2E6DA 1C90A 5C7HA 1TPUA 3I6EA 5CC6A 5E1QA 4Q7IA 5D02A 4JTJA 1R6WA 3G1AA 4E5TA 3DXIA 3PZNA 1SSGA 2WWCA 4KCTA 1GOMA 5C5YA 1LCOA 5D05A 1EH9A 1W5OA 1YDOA 3MSRA 3S1UA 4CD7A 3BCFA 1TFVA 4LBUA 1LT7A 4A2SA 5AZ0A 3H7VA 3MDWA 3SUTA 4CNTA 1FRBA 4AEEA 5CBIA 1KNWA 1LJYA 2WBGA 2O55A 3EPOA 2HEJA 3USZA 4AQLA 3OLEA 1KBBA 3R25A 4Q4OA 2CKRA 4X61A 1E3ZA 3HJZA 3W1UA 3WELA 3S3GA 1RY0A 1EJSC 1LOLA 2NUWA 1QHZA 2Y5EA 2HISA 5HA7A 1RA0A 4J3UA 3WQ4A 3CMGA 1KFBA 5G4EA 5CSYA 4UIOA 3LGDA 1YYAA 3RM9A 3ABZA 4XUYA 4GXPA 1Q8AA 3WO8A 2CHOA 3FYYA 3THCA 2J7DA 3VC6A 5CBBA 1GTHA 1UP2A 3UZZA 1WUEA 9XIAA 2ZBTA 4QJ4B 3IJLA 1MEHA 5GQBA 4PTVA 4LXFA 2NVCA 3WNKA 4JTFA 3NL2A 4R33A 2G37A 3A4WA 3HG3A 2TPSA 4N42A 1NFBA 3L5AA 1JDCA 3W7QA 3VYLA 4ZQRA 2O9PA 4I3GA 4GYPA 2RGMA 4IJBA 3S9YA 1KBLA 1V6WA 1VD6A 4Z2LA 4IGNA 3WUEA 1JPDX 1JYWA 4O18A 1G4EA 2QPUA 4XTIA 4LYQA 4WKFA 1N8IA 6PTDA 4D6JA 1ITQA 2QR6A 1TZ9A 2CWNA 3I7QA 1CWYA 1MW3A 3WQCA 3TQ0A 4U33A 2ZRZA 4BFAA 4H1ZA 3RXZA 1DQWA 2PRLA 1ISZA 3VZXA 1JEZA 1TJ0A 4G1KA 1UD5A 4K7YA 1MRAA 1TR1A 2A3BA 1O60A 1UA7A 2W9MA 3F4NA 4FIQA 4RLIA 3BMXA 2PDPA 1C8YA 1OB0A 3NAVA 2EPKX 3RRXA 4W87A 2NSXA 2VGGA 1IZJA 1LBFA 4LTSA 1CGVA 1JCLA 1WNOA 1NARA 3ITXA 3BLEA 3GG0A 4PULA 2WVUA 1EPXA 1Q6EA 4HU4A 2XDFA 1GVSA 2YB1A 5A6LA 1EUNA 4EPEC 3KBVA 1WCGA 4ZQMA 5ABGA 3OVQA 4Q8NA 3ZLGA 2CXEA 1DWFM 1ONRA 4O1DA 3GG1A 2JFEX 2CLEA 2RKXA 1HT6A 3DFHA 1P43A 1VEOA 2BNJA 2GWNA 6XIMA 3UG5A 4DXVA 3A23A 1HKJA 3NL6A 2B31A 3WF2A 5LXEA 4PCFA 2OT1A 3EWUA 1PEZA 1KB3A 2A3EA 1R2RA 3N4FA 1KXHA 4GGBA 4OVXA 1KV8A 3H7RA 3KRUA 3W1XA 4UQDA 4AIOA 4LWWA 4NJHA 3RILA 1MW1A 3BSHA 1JNEA 3B8DA 4YS1A 9XIMA 1JUKA 3LSCA 3QKEA 4U10A 4BQ4A 3U48A 3W70A 4DBUA 3L2LA 1H3GA 1RD5A 2C15A 3T42A 4UTWA 3GDTA 4O17A 2O9TA 4EWJA 3KOXA 3VOFA 4Q6JA 2TRSA 3F4DA 2D2OA 2PDIA 3SN4A 3PZGA 3VIMA 4AU0A 1YTEA 3Q4DA 4KERA 3UNTA 4HNLA 1YRRA 3LCWA 4D6GA 5BXRA 3QGAC 4P7NA 4ZGYA 4UTHA 1EPVA 1WXYA 4CD5A 2ZWYA 2A85A 4QSFA 2VWTA 3OOQA 1V6TA 4JYDA 3TTSA 3WEOA 3SCWA 1GUVA 1M3UA 4QX4A 5EFDA 3PG8A 3F03K 2ZRWA 1UR0A 2H6RA 2FIQA 2BGNE 1ONEA 3S9ZA 3JW7A 1E0XA 4Q7BA 3VABA 1Y5XA 3RR4A 2OSXA 4MNJA 3VIHA 4GBUA 4NRRA 3BOXA 3EEGA 1XBZA 2PCEA 3MWCA 2Y62A 1HF6A 4JN7A 2NUYA 3V36A 1BGAA 2WVSA 3MHGA 2OZ3A 3C3UA 5LIYX 3ZT6A 4M29A 4JHMA 3SGGA 3KL0A 4Y2WA 3B4YA 3BLLA 1CB2A 5FJRA 4LRTA 1O94A 5FOOA 5D2VA 2AKMA 3D3AA 3W07A 4YYCA 1V02A 4HNTA 1FCVA 2WZMA 3W0KA 4M5PA 1E4LA 3SRFA 3UG3A 4F0KA 5HNTA 2ZDRA 3KTCA 4I7WA 4RK8A 5I3KA 5G1YA 1DE6A 3O8AA 1OQFA 3WD2A 3TK7A 3W71A 3H2MA 1QHPA 1LWJA 1LZOA 2FJKA 3TYDA 3I7RA 2P5NA 2W67A 4AB4A 1DEDA 1J6OA 1JIBA 2Y61A 4MY9A 4D6IA 1J10A 1YTDA 1EBHA 5D8ZA 1MXSA 4JXCA 1KXQA 1DWJM 3T4CA 4TU1A 4JCMA 4Q22A 3NGJA 1PKLA 2XJ7A 2R1LA 2HBXA 4LAUA 3W83A 2EPMX 5EPDA 1NF7A 4B5WA 4NXKA 3MP4A 1C91A 1UMLA 3S5SA 3U7VA 1DIDA 5DXYA 2VCAA 1XYAA 2XGZA 2XN0A 3HGOA 5FF0A 1AL7A 3SIMA 4LALA 3S8HA 1W9PA 4IXXA 3N12A 1DOSA 4E3VA 2Z27A 3TNOA 3W2JA 4Z1AA 1PX3A 5DMNA 1W1A1 3M47A 4OHQA 5EKYA 1BEUA 3MQTA 1CEOA 3CWOX 4US6A 2H90A 4MHBA 1UWRA 4DLMA 1POKA 4U2ZA 4K39A 3WQ8A 1KBIA 3LEPA 2PDFA 2VQTA 1U83A 4CU8A 1UIOA 3URNA 4XQ6A 3QR3A 5CZTA 1FDJA 3GAYA 3LHYA 1S3HA 3H55A 3IACA 2NLIA 3CIWA 3R0KA 1TZZA 1PIIA 1QI4A 3O06A 3UZ5A 1XGEA 3DHPA 4V15A 3TX9A 4WZHA 3GZAA 3RDKA 3AMCA 3AMGA 1AFSA 3L4YA 3KFTA 1EO5A 1JUBA 2XM2A 1XC4A 3SCTA 3EA1A 4DAIA 3IIPA 2WC3A 4UQ9A 1UZHA 3VILA 3BLDA 5D03A 4AD0A 1V51A 2GUUA 4FF5A 1PWLA 2F2KA 2HXUA 3AJ7A 2RDXA 2EBNA 4S3GA 4OFCA 3CWNA 1UBSA 4S3DA 5E93A 2DSUA 3H6OA 3BURA 3MSDA 4K68A 3WLIA 3G1SA 4Q8OA 3GNDA 2V30A 4WSKA 5LSMA 3XINA 3LCXA 3MO7A 1H0IA 3G1YA 2ZZ5A 4DBDA 2E3ZA 5HQMA 1GVEA 5K9XA 5IDIA 2CBJA 3SGZA 1WZMA 1TYGA 4AYGA 2PF0A 5E0CA 5XINA 4RUBA 5LA2A 3GBDA 3M0IA 4TX8A 3T0TA 4UB9A 3QY8A 1F3TA 4PRRA 1U2YA 3MPGA 3WZ0E 4UC5A 2ZKMX 1QI5A 4D6DA 1S1PA 2FZBA 5G2IA 1E6ZA 1I1XA 4JEQA 2W6RA 2HCVA 5LIXX 3PPGA 2GYIA 5HULA 3I4EA 3S46A 4U5KA 1B4KA 3WDPP 1H63A 1U22A 2PI6A 4GINA 2G96A 1MMFA 1ADSA 3U7BA 3HIJA 5HK4A 3W24A 3WL0A 4DZHA 3W7CA 3EX2A 1FCUA 4QLKA 3UXKA 6TIMA 4KH2A 4WEVX 2ZDSA 3EPMA 1XGZA 3FJLA 2P8BA 4N02A 1MVYA 4GUFA 3HPSA 4AC7C 3TSDA 4J3ZA 8XIAA 5JH2A 5HQEA 1C3FA 3IIXA 2DQXA 5EBAA 4ZOBA 3UWQA 1UKTA 2OEMA 3P62A 1BF6A 4HPJA 2NXIA 3MBFA 4WKAA 3AHZA 3SY5A 2BGSA 2INZA 2PDJA 3QLDA 1HGYA 4IMEA 1Q7ZA 2QMJA 2Q01A 1ZNNA 2VRKA 4J4KA 1H49A 3F5JA 3E96A 2ISSA 3FHAA 4GIAA 2VYOA 5GNZA 4QR6A 4BF5A 2Z4GA 3U5YA 5C9UA 2P10A 3MW7A 3N2TA 3ZT7A 2BVYA 2X1SA 5E0KA 1SZGA 3MHFA 2FDMA 4O4WA 3Q67A 4WRHA 1M7XA 7XIMA 4O12A 3AWOA 1HIZA 1E0UA 1EJWC 1LRNA 3CZ8A 3HQ1A 3DENA 1XLEA 3OIHA 1TG7A 4DWSB 4YWIA 1E51A 1CDGA 2KX9A 5HR6A 4AD5A 4GMEA 3C8NA 4DF0A 2R9RA 3GNNA 3IIZA 3B40A 3TCEA 5DANA 2RGLA 1QT1A 1MW0A 2GPTA 3ARVA 2QDGA 5LKYA 2IQDA 4MJMA 1V0NA 2V38A 1DV7A 5F2GA 3AS3A 4NHVA 1SZEA 2V8ZA 3ARWA 1GW1A 2X42A 4XAZA 1RSCA 1SO6A 1TSIA 1OBAA 4JEJA 3K46A 5E5CA 3BTNA 3N73A 1CXLA 2VDIA 1PTGA 3T08A 3EOOA 1VYSX 1PWMA 1WV2A 3MI3A 4XZIA 3BAYA 1W3NA 1G5AA 1EA9C 4CCDA 1NP0A 1GQNA 3PWAA 2GZXA 2Y7DA 5G1MA 3VDHA 2EGZA 2PPGA 3TJXA 4OE7A 5LA0A 1X8CA 3S2NA 2FH6A 3ZR6A 1S5VA 2A4AA 2PDYA 2A2IA 2VEIA 1J0ZA 3PJXA 1XLDA 3KDNA 4J3SA 3K8MA 3P60A 4JNYA 2TMDA 3FIGA 4LEQA 1Z89A 1LL7A 3M6DA 1J4EA 4DJEC 1AW5A 4FB7A 4ATDA 3VIOA 3EX6A 1J79A 3FXYA 5C55A 2QJHA 3NQMA 2VDHA 1IIHA 2Y1HA 3C61A 3BW2A 4I7VA 1UR3M 2INEA 4H7VA 1SFLA 3UXAA 1D9EA 3MU7A 4XZHA 4H9TA 1FDYA 1FHVA 3CQJA 2FTPA 1VFMA 5TQLA 3UT0A 3B03A 3LTSA 5BRQA 4ZZ9A 4EKJA 7REQA 1DIKA 3EOUA 3TH6A 1ZHAA 4GE8A 1J93A 2PP0A 5FF2A 1TWZA 4O1FA 2WSRA 1KRMA 2PSNA 2O9OA 1LP6A 2PWEA 4Q8VA 3VINA 1EIBA 1E1FA 3NZQA 3PULA 4IPIA 5B7ZA 1G6CA 1OIFA 3DAQA 3S5ZA 4W85A 4XD3A 2G0WA 4HMDA 1XH0A 2E7FA 2VURA 2ZXAA 4UCFA 1BWKA 5U7SA 1G94A 3TFCA 3N19B 4ZMGA 2YXOA 3ATZA 3PBMA 3TC3A 1FQ0A 2QCLA 3UWEA 3GUWA 4POCA 3M0VA 3UVAA 3W7GA 1HVXA 1ZU8A 2Z1SA 3ENLA 4NQ1A 1N7KA 3ITVA 4L5ZA 3FX4A 4N7QA 2Y85A 1IZKA 3KRBA 3E2SA 3HPZA 4GWEA 1OT1A 4LT9A 3CMFA 4AWTA 1DJYA 1SMAA 1A5LC 3P82A 3ERPA 1WPCA 4IT1A 5IBXC 1M7OA 3U5UA 1EOKA 4HZ6A 3I3BA 4PH6A 3WLLA 2G50A 4M1RA 3AXMA 5A69A 3DG3A 3BXWA 3RCNA 3DFTA 3H26A 2WM1A 2OGJA 1TV7A 3P81A 5FA5A 2F2HA 2VL4A 1I45A 1QO5A 2X0SA 3PS7A 3BPWA 6CGTA 3WIJA 4ZBCA 3CZJA 2QJJA 4IMGA 3GTXA 1P1XA 1T0OA 4K6AA 1OF6A 3EWCA 5FESA 1O5KA 3ZJ8A 1XRVA 3PTKA 3FK4A 4GIRA 2J7CA 5DLCA 3G3MA 3HPFA 4GD0A 4JPGA 1U30A 5DMMA 4IGSA 5AOUA 3VTRA 1LBLA 1WP6A 3NO3A 4TIMA 4QE4A 5EMKA 1UIPA 1L8NA 3LGGA 3NPVA 3GWQA 1R3VA 3W7HA 4JTEA 1E1EA 1H7XA 1K7FA 4UTTC 2DH3A 1VEMA 2BOFX 3KP1A 3N25A 3RMEA 2HNEA 2YYUA 2DT3A 1PCWA 2QJMA 3VIPA 5T9BG 2OSWA 3W1PA 3WBXA 2GDVA 4AZ5A 4PRWA 1ECEA 4IFRA 4GG9A 2Q71A 4TQTA 3L21A 3S42A 3TV8A 4E0CA 4NG3A 5BRPA 3ZVIA 1CX9A 4MAZA 4K1GA 3U4AA 5D32A 2DH2A 4JHOA 2OPJA 4C1KA 4LUSA 3FJ6A 3FVDA 3N17A 2PF8A 2WMKA 2W91A 4MIMA 4E8DA 4GH3A 4NILA 2NQ5A 1AD1A 1WZAA 4JTCA 1OD8A 3CASA 1J12A 4U2YA 1KM3A 1IEWA 3LPGA 3NUKA 3VOGA 3CT2A 1FWSA 4H6QA 1FWWA 3MANA 1EA0A 2GGGA 4BWLC 1A47A 5HPCA 3IK2A 2ZICA 3TYAA 1A5MC 3SRHA 1TVLA 5IRPA 2Z6IA 2PTWA 2VX5A 3CB8A 3BLFA 3E9AA 3EA3A 1F6YA 1XQLA 4KGLA 3MCNA 2A3LA 2OX4A 5HJYA 4AHPA 4ZE5A 2PTZA 4I5RA 2E9LA 3VGHA 1QWKA 3VNLA 3UR7A 1IT0A 2GVGA 4JBRA 4J35A 3PZIA 4ZQOA 1SZRA 2GVYA 3NEHA 3R13A 4DUWA 1D3CA 1K7XA 3QMRA 2BY0A 1GHRA 2YX0A 5FJUA 4CD4A 4E3TA 1OCNA 4ZFCA 5J5DA 1QNOA 2UY3A 3BOFA 2YXXA 4MFEA 2ZTKA 5LGXA 2E09A 3M46A 2D73A 3WBYA 4KRZA 3TR2A 2ZX8A 4EAMA 4HU8A 4JQ2A 4Q33A 3VKBA 2AOSA 1H7OA 3PZVA 3LHZA 4PL1A 1I2QA 1ALDA 1XKYA 2ZC8A 1GPFA 1R3SA 1UASA 3HQPA 4XG1A 3AXKA 5IDZA 1FWTA 3H4GA 1DQXA 1FWAC 1DJIA 4YVVA 4QIUA 2WNZA 4M19A 2VCCA 1D7KA 1UZ1A 3BV4A 1I2RA 2YXGA 3GAKA 4M6UA 4ATWA 2OX1A 4A2RA 2DZTA 4F66A 1V8EA 1CT5A 4GI4A 1PL9A 3F5LA 1LT8A 4A8NA 1V0LA 3LHVA 4WDXA 4A21A 1KTNA 3ZFHA 2IMRA 2V68A 3HMJG 1RAKA 1QWGA 4DJDA 1S5TA 1G1YA 2REQA 1XIIA 4OQVA 1W56A 3WMLA 3PN8A 2ZZ2A 1JZ5A 2DJXA 1OK4A 3ABOA 3TROA 2HS6A 2DZSA 1EB3A 3FSTA 3U2EA 3OODA 3NL5A 1Q6FA 4K37A 1CXHA 4GK8A 2WHMA 1UZDA 3K1DA 3UR8A 2ZOXA 5TNVA 1X97A 3ZIZA 1JDFA 4S3CA 4ZQPA 2XSBA 3GIQA 1R0MA 1KRAC 4HZ7A 4RNJA 1OD0A 5CPTA 4KCVA 4L7ZA 4F40A 2XHYA 8RUCA 5FJPA 4XAFA 4RE2A 3CZLA 3B9EA 2GSEA 4GXMA 4WDUA 4M7SA 1NFGA 2CZ5A 3R58A 1UOZA 2J62A 1VPQA 5CC5A 4I9TA 1EXBA 4HK7A 3KEHA 1KTBA 2WVVB 2W63A 4ZSUA 5G1TA 3N34A 1WAWA 4RNIA 4FNPA 3P8IA 4HHMA 1DXFA 4UXDA 5K7JA 3OIXA 1FP9A 1JDDA 4MKVA 2OZ8A 4FX7A 3FW6A 4QG6A 3H22A 3BC9A 4ROQA 2NX9A 4YPJA 4ML4A 1OFBA 2J8TA 1VRXA 3M44A 4C7DA 4F9DA 4I6KA 2GJLA 1GPWA 5FSDC 4IPPA 5JIPA 4MTVA 4BWLA 1JCXA 1HKKA 1SW3A 2D24A 3QH2A 1M7JA 2JKPA 1EP2A 1KQYA 5KINA 3TE9A 3QOKA 3EX3A 1Z7AA 5EYWA 2WMIA 3BLIA 1SJDA 2Z1KA 3AIBA 4IUOA 3KVKA 1DPMA 2VM8A 1GKRA 4D6FA 1M7PA 4GI8A 4UTUA 4TTUA 4GX9A 4DYJA 3MUAA 3HGRA 4PN2A 3W1NA 2QJGA 5J04A 1QOQA 1QAPA 1XLMA 3LXBA 1H11A 1CCWB 1M9HA 2EG6A 2ZRYA 1JCTA 4G9PA 3STFA 2EKCA 4R7JA 1UCWA 2MNRA 2EPHA 2PBGA 1ME8A 4W7VA 2B7NA 3OZMA 1Q13A 3WDQA 2R24A 3V5FA 5LIUX 3VCCA 5HWJA 4Z08A 3QQWA 2CW6A 2JGYA 2HVOA 1XCFA 1JZ2A 3RCMA 5H2ZA 4NZJA 1QVBA 1XD0A 3VXGA 1QTWA 1UKSA 1FWRA 2QDEA 1BKSA 3GBEA 1TPEA 4IQLA 4URIA 5ABFB 2ZXBA 7PTDA 4PFHA 2ZXQA 3W87A 5I24A 3E0VA 1ECQA 2GDQA 3PJTA 2XVNA 4DI9A 3ABRA 3EDDA 5I7GA 5GJMA 1XXXA 3WYZA 3AMLA 3UEQA 4ONVA 3DHUA 4NI3A 1ME9A 4HB7A 2FVMA 4ML9A 3TZNA 4RW3A 2BY3A 2I7GA 1AL8A 3EOEA 3CAWA 5IOBA 3PBUA 1AMYA 1AG1O 4GISA 4H9YA 1ZBCA 5CPMA 4E4UA 1R7AA 3PG9A 5CC7A 4L1GA 2BBFA 4LU0A 3W6MA 4B92A 2DQWA 5BXSA 3TWAA 3KBSA 4Z1DA 4DJEA 1XUZA 3D0CA 1ZJIA 1M01A 2PWVA 3UJEA 2OODA 3C2RA 5D9PA 2UY2A 5A6TC 2IPJA 4NJKA 4D8LA 5BRBA 1HJSA 1VBJA 3MBDA 4EVZA 2PLJA 3WJZA 1AJ2A 3W7JA 1AZ1A 4DXKA 2CESA 1EDGA 3VD5A 5D30A 4Q8TA 3L23A 3VKAA 3APTA 1XIJA 3O7UA 4PMRA 4L64A 3WK0A 1US3A 1J0KA 3NGFA 2NQZA 1IIGA 2JIWA 3R79A 4O0KA 1BXCA 2A7PA 4KFPA 3AALA 4XZ9A 4X22A 1KFEA 1Q85A 4O0QA 3SUUA 4UTWC 3BV7A 3R89A 1HNYA 2XWEA 1UR2A 1UWIA 1X6LA 1US2A 3RPTA 2YCLB 1REQA 6XIAA 2IQ0A 4RZBA 4MWAD 1E6XM 1H51A 4WY0B 1MQRA 2V3FA 1G7UA 4DZIA 3RLGA 5LNRA 5XIMA 3MMTA 4XK2A 2H8XA 2WCAA 5BNKA 5IHSA 2BZNA 1NWTA 1UWAA 2VNCA 2NVAA 3I65A 1LM1A 1W0MA 2XVLA 5A8PA 1PE1A 3K8LA 3OVRA 1CXIA 2F38A 3AXHA 3HV9A 3OA5A 4N4PA 4LYRA 1OCJA 3TDFA 4H01A 1FCQA 4JR5A 1JI1A 3AS0A 1VJZA 3L0KA 1FWIC 1ITXA 2QF7A 1JZ3A 2Z2AA 1N2VA 3B8SA 1LQ0A 2VD9A 4B5VA 2Z24A 2WCGA 4DX3A 4IPJA 3W9ZA 4LCSA 5CGMA 4LRSA 3DFPA 2V2CA 4ZCWA 1B9BA 2XPKA 4W89A 2Z1BA 4AAJA 3PBYA 3W6YA 4G7EB 3U0HA 1BG4A 4DWSA 1TX0A 4Q8QA 3SADA 5H6HA 4S3JA 4PMUA 2Z7KA 3GVVA 1EP3A 4MKNA 2OWCA 4AX6A 1KM6A 4O16A 4Q8UA 3SAZA 4JY9A 4OBTA 5F1UA 4OGZA 3FCPA 3H21A 3GNOA 3WLOA 3VMPA 3W85A 3F2DA 1QW9A 3TA6A 1NF0A 1PBGA 3A3HA 1OABA 1ZGDA 3R12A 4JTAA 1ML1A 3LBCA 4G1NA 1WUFA 1G69A 4L1XA 3UETA 3GNXA 1ZLPA 4AYSA 3NQCA 3VFCA 2PU1A 4P2VA 1W1ZA 4NXSA 3W84A 4YWSA 1JGIA 1GVYA 4PGLA 2D2HA 2I17A 3ARQA 3DHDA 4LAZA 2NUXA 3ISIX 1BPLB 1MO0A 3ZVHB 4HPHA 3UWZA 4Q8MA 4XZNX 1C8XA 1LQ2A 1R7OA 1S2UA 2WW5A 2X1TA 4I9MA 2IKJA 3T7VA 5AFDA 3G1DA 4ZO7A 1QPQA 4YJ5A 1XSKA 2QV5A 2PDUA 2X0YA 1DQUA 2PDLA 1WB0A 4AX7A 1W8GA 1HTIA 1EJRC 2O9RA 4O4VA 2V5KA 2W4XA 4GHRA 4RV3A 5AYYA 3NYDA 1FP8A 3NYZA 2VTFA 2OO6A 2NXGA 3CV7A 2VOTA 5CJMA 3NDYA 1RCOB 3WNMA 5KZEA 3HOJA 3SCPA 1P6WA 3E0IA 3EZ4A 3EWWA 5D37A 4FPSA 4BJHA 3W7EA 2JK2A 1XFBA 4L4MA 1XDMA 5DQPA 2C79A 1ADOA 3TLLA 4CEXC 2FVKA 4JTKA 3TA9A 1K3UA 2HSAA 3NQDA 3GKAA 5CC3A 4J7RA 2ZRUA 4IQDA 1AJZA 3TTQA 1FXQA 2WMFA 1EIXA 2X09A 3G1VA 1KBKA 4YTQA 3K4AA 4Y9OA 1GOOA 4MFDA 4N2YA 3W7MA 1QNVA 1KXTA 1EHNA 4GJ1A 5T26A 4W8BA 1E3XA 2WJZA 1PS9A 2V2DA 1NDVA 1VS1A 1DYSA 4WLCA 2ZZ6A 4V33A 3VDBA 2JGQA 1Y5VA 2BASA 3M64A 1BAGA 3P5YA 3O2LA 4ROPA 2D22A 5HWNA 1GG1A 4MDOA 4PBEA 3CH0A 5CZKA 1H62A 3BJSA 4I9JA 3FJ4A 3CXOA 2QKFA 3VDAA 4PMNA 3E0FA 3TEVA 1ZCOA 1K77A 3EX1A 5LHEA 1E71M 2Q02A 1TTPA 1M04A 3H54A 3T2PA 4FOKA 3AIWA 4HNOA 2W3ZA 3KXQA 2WANA 3VZYA 3BGGA 3UWVA 1KV5A 5BWAA 3ZLFA 4FOUA 2CLMA 1XQKA 5DT5A 3BZGA 4GZJA 3IIOA 1W91A 2YB4A 2DVUA 2E28A 2TYSA 3OGVA 3EWYA 1QCWA 3QM3A 5FF3A 4NIRA 4DBWA 4MY1A 3LPPA 4MWAA 1FH8A 4HYWA 5HNRA 4K3ZA 4RJEA 4QS5A 3LLDA 1XICA 4IMCA 3CAQA 1DORA 3QR1A 4PBFA 3R8HA 4AMAA 3NQVA 2NLYA 1EWDA 2G3IA 2X2GA 2ATMA 2FZMA 4AG0A 3VNZA 3C3NA 4KGJA 1DWIM 3CL8A 5JBEA 3TSMA 3DH7A 3M5XA 1L6FA 1JYVA 5LNSA 4A8IA 1GCYA 3NFUA 5TD4A 3IJ8A 4PTWA 3B9NA 3IGUA 1FWEC 3ZJKA 1K8CA 3G18A 3L68A 3R0UA 2ESCA 4WXZA 4DZAA 4AD3A 2E1WA 1T96A 5DCBA 3CNYA 1DL3A 1IZCA 4JYEA 2FFIA 3W53A 1QNPA 2W66A 3MSYA 5C2XA 4PC8A 3LYEA 4DM1A 3LCLA 1UROA 1B3XA 1ZJBA 3CHDA 4KFOA 3PC0A 1D8WA