2O9TA

Beta-glucosidase b from bacillus polymyxa complexed with glucose
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
445
structure length
445
Chain Sequence
b'NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRQRYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase B
publication title Crystal Structures of Paenibacillus polymyxa beta-Glucosidase B Complexes Reveal the Molecular Basis of Substrate Specificity and Give New Insights into the Catalytic Machinery of Family I Glycosidases
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 163
structure length 445
sequence length 445
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2o9tA00
4D6EA 2EPLX 1J01A 1FFQA 4P7RA 3WUGA 4CD7A 4R27A 3GZAA 3GBEA 3WQ8A 5AY7A 4WK9A 2J25A 8A3HA 2Y5EA 1JG9A 4PMXA 3W81A 5I77A 2J7FA 4QCEA 1M04A 1BF2A 3T2QA 4UQDA 1WDPA 3AIQA 3WEMA 1CYGA 3OGVA 3VUPA 5A8QA 1WP6A 3W29A 1M01A 1J0HA 1KCLA 1VBRA 1Q6EA 3EDJA 2FGLA 4B3KA 4IPLA 3BSGA 3K4AA 1RPKA 1BPLB 1IZKA 4KMQA 1N82A 1B2YA 2WNWA 1MYRA 3VIFA 2GJXA 2WC4A 2XSBA 4GQQA 4ZE5A 3ZJ6A 3QOKA 3KEHA 5LA0A 3SCSA 4AZBA 2XWDA 4ZEPA 2Q8XA 3FHQA 2Y24A 2EQDA 3K8LA 4UQAA 3CUIA 4W7WA 3HU7A 2OYMA 1W1TA 4P8WA 4PYSA 1J0ZA 2W92A 3QHOA 2CBVA 5FL0A 3BAJA 1TUXA 3AS2A 4J27A 2J7BA 3K46A 2CEQA 1NP2A 3BSHA 5E0CA 3B9EA 3QHMA 4URIA 4GZIA 4PCTA 3VNYA 1XH2A 2CNCA 3S6TA 3VX1A 1K9TA 5A8OA 5CGMA 3NDZA 2J79A 1E4LA 3GXFA 3WD3A 1CWYA 1I1XA 2WZHA 2WBKA 2VOTA 2WMJA 3APGA 1LWHA 1J0JA 3PHAA 3HJEA 1E4MM 2XVNA 1SFSA 5CPSA 2XVPA 1UOKA 4TVUA 1TZ7A 4HA3A 1UQYA 4D6IA 4L4PA 3I3BA 3BLKA 1GQJA 1WZKA 4OBRA 4P8XA 5IHSA 4HPHA 2JALA 3ARVA 3RDKA 2VQTA 4LXFA 1VFFA 3WH5A 7CGTA 5D9PA 2CITA 3CHDA 1JZ6A 1MFUA 2ZX9A 2D22A 3CH9A 4JFUA 4UQ9A 1GOQA 5A2AA 4PMQA 1NARA 3ARZA 1ISWA 4WIWA 2DQXA 5A95A 3POCA 2A3HA 2DH3A 4E8DA 3CZEA 2BVTA 3EMCA 3W27A 3PTMA 2E40A 1E0WA 3RM8A 2YLLA 2O9OA 2ZXBA 4AD0A 1QNSA 4EKJA 4H2CA 3AYSA 3ZT5A 2WCSA 5EMYA 1TFVA 2ZUNA 3G6MA 3T2PA 1MW2A 3F5JA 2QPUA 1V6XA 3L2LA 3SUSA 1AQ0A 1R87A 3M7SA 4PSRA 4TVCA 1R7AA 1ZS2A 3CZJA 1XH1A 1AMYA 1OSEA 2XFYA 1ZL1A 3TTQA 3WQ5A 2FH8A 2V3DA 1TVNA 1SMAA 3OLGA 2VNCA 2G8ZA 4K68A 2BNJA 1GUVA 3WN6A 1HF6A 2CCRA 3N1AA 1UD6A 2YLAA 3UG5A 4Q7NA 4UFJA 5TD4A 1SYTA 5IDIA 2VTFA 1KQYA 1FP9A 1EQPA 1RD6A 3WF4A 2XPKA 3NYDA 5CG0A 3OA5A 2WMIA 1JIBA 4WSKA 4S3JA 3WUFA 3PN8A 1GOKA 2VCCA 3AXHA 1G5AA 5M5DA 4UFKA 3IJ8A 3ZR5A 1E1EA 5A3HA 1KWKA 1US3A 5GQBA 1GJUA 5AC4A 1WZAA 4OBSA 3W53A 5D8WA 1UYQA 4D6GA 3WH7A 1XD0A 2W67A 4WKFA 4YHEA 5GPRA 2ZUTA 4AMCA 3N18A 2RGMA 1BHGA 2A3BA 1WE5A 4P7OA 4LX4A 2F8QA 1OD0A 2ZUVA 3KL0A 4P7NA 2WW5A 1E55A 1D2KA 1UKPA 3CLWA 3WD0A 1KXVA 1ODZA 5C71A 1C91A 3ZSTA 3WIJA 3CIVA 1JYXA 4GZJA 5BCAA 2MANA 3WNMA 3WEZA 4OOZA 5HOSA 3BCFA 1W9PA 2XM1A 3B8SA 3WQ6A 2WXDM 1K6AA 2WSKA 2EXOA 3IK2A 3M07A 1R86A 4C7DA 2JE8A 1W3JA 3CHFA 4J3SA 1FHDA 2GVYA 2BHZA 1EHAA 5DMYA 1E0XA 1PAMA 1JAEA 4OJYA 2GDVA 1K9FA 1W1PA 4ACZA 1UHVA 2YBTA 1HIZA 4LPCA 3DYPA 4H8UA 4KH2A 1OGGA 1WDQA 4HTYA 1WDSA 2J7HA 2OLHA 5EFDA 1DWJM 3SCWA 4JHOA 1OGBA 1UWQA 2EBNA 1UR1A 3A4AA 3A3HA 3QR3A 3VIPA 4N0RA 1J0YA 3W6LA 1JDDA 1EO7A 2VMFA 4M80A 3SCQA 4W8LA 4Z2LA 5JIWA 4TXEA 4OUEA 2E9LA 2VURA 1DHKA 1U33A 1F4HA 1W3LA 1GW1A 2JEQA 1U2YA 3WNLA 3SCNA 3VVGA 2DSKA 1A3HA 1H49A 1FA2A 2CERA 3SIMA 2DSUA 1UWUA 1GQLA 3WF1A 4HOWA 2WYSA 1V0LA 4HZ8A 4UQCA 2W4XA 5A6JA 3BAKA 2VL4A 5AYBA 1HP5A 3ZJ8A 2J7GA 1PX3A 2E4TA 3S2CA 3L4VA 3ZR6A 1CXIA 3NJ3A 4FLSA 1QI4A 2X2YA 2D24A 1CBGA 1GOMA 1DWAM 4NF7A 1UR8A 1VFMA 3THDA 4X9YA 1A47A 2A3CA 4TX6A 2J78A 2WK2A 3SURA 1JI2A 1W91A 4AZHA 1CGUA 2UY4A 3UR7A 4MB3A 1VEPA 1BGAA 4BF7A 2EPMX 4DWSD 1CGYA 2BVDA 4F9JA 1PJ9A 1WB0A 1V3MA 2Z1SA 2A3AA 4JZ5A 4TUFA 4X0NA 2J75A 1E71M 2D20A 3PZIA 4CCCA 4MNMA 1HJUA 3AIWA 1ITXA 3CHEA 5A8NA 1JYVA 4W7UA 1QI2A 1NOFA 1E5NA 5E6ZA 2G3IA 1VRXA 2XJ7A 1D7FA 4AWEA 4W93A 1J0IA 4AYSA 1ZU8A 3TA9A 1BG9A 2J7CA 1HKJA 1UA3A 4U5KA 1ISVA 4A4AA 4JL1A 4PMYA 3AS3A 3SUWA 9CGTA 2CBUA 1CENA 1JL8A 4TX8A 2YL6A 4AD3A 4E8CA 3W28A 3KL3A 3NSNA 3FHAA 5BWFA 3LPFA 5CSYA 2BS9A 1XC6A 2DIJA 2E8ZA 2CBJA 3EDEA 4NSBA 3W38A 5CPTA 1FHLA 4B15A 4GO8A 4F9DA 5I3DA 1HL8A 4HU0A 2ZE0A 2J8FA 2XFFA 4ML4A 3L2MA 1B31A 3ZJ7A 1XCWA 5A6BD 3WBAA 3VD9A 4AD2A 2DSZA 5FL1A 3MMWA 3PZ9A 3VD5A 3ZOAA 3CZKA 3LPOA 4AIOA 4LYQA 3VD7A 1CXKA 3VM7A 1B3ZA 1B1YA 2O9PA 4BCEA 2NT1A 4DWSC 2RGLA 4ZXLA 4OIFA 2PWEA 4QDMA 4PMRA 3BC9A 4R5EA 3AMKA 4CVWA 1VFOA 3GBDA 4U31A 1BG4A 4L4OA 4HU8A 5M17A 2VX7A 2VR5A 3O6AA 2WLYA 5HPOA 1VF8A 4Z2HA 5HDRA 3SUVA 1G0CA 4MNLA 4A3HA 4CUCA 3CUGA 1E43A 4GPNA 2Y8KA 4F66A 3EMZA 1E6SM 1E6PA 1EDGA 1ZB5A 3N12A 7TAAA 4JFTA 1KXHA 1GOWA 2GK1A 1XYZA 3WF0A 1NM9A 3OLIA 3OZPA 2PWHA 5ABHA 4Q22A 4J3WA 4AD5A 4UFLA 3CZ8A 4JKMA 2WHLA 4MDOA 1WNOA 2D0GA 1VJZA 4DWSB 3MKKA 4JFVA 4KGLA 3VPLA 3BAWA 3BMVA 1BYDA 1VEMA 1VEOA 2VZUA 2VUYA 4AISA 2D3LA 2JEPA 3M6DA 2ZWYA 5AC5A 3OZOA 1QI3A 5CPQA 3W0KA 1E4NA 1C7TA 5A94A 3U7VA 5FIPA 2O9TA 1V02A 4J28A 4WKAA 3VIMA 1W2VA 3OG2A 1KR0A 1W1VA 3MUIA 4FLQA 4XB3A 1LG1A 1QNRA 1GORA 1UWTA 4PTMA 3OBAA 5AYIA 4EAMA 2ZOXA 3WH9A 5HBFA 5DFAA 4XZWA 3WF2A 1TMQA 4MJ2A 1C8QA 2VI0A 3AHTA 5F7UA 1JI1A 3L4WA 3U57A 3VTRA 2BHYA 1J12A 3D5HA 1JZ3A 2CESA 2E9BA 2WVVB 1R85A 4HP5A 4AW7A 2UY3A 1OINA 3VOCA 1PBGA 1JNEA 2UWFA 1V6UA 1GCYA 3RJXA 4JKKA 5D9MA 2Y8VA 4FF5A 3U5UA 1BQCA 1TG7A 5DF0A 3J7HA 1MQPA 1KR1A 1H5VA 1E6XM 4MB4A 1XYFA 1L8NA 3ARRA 4AD1A 3GNPA 6A3HA 3DHPA 4KWUA 3NUKA 1VBUA 3GM8A 1FH8A 1D3CA 3VILA 1EXPA 4ACYA 2JIWA 2X09A 3OGRA 2NSXA 2VCAA 4FMVA 3BXWA 3IAPA 3RJYA 4CN1A 4AZ6A 2W91A 1VB9A 1C93A 1R7OA 5BXPA 2J7EA 3FAXA 3CZLA 1PPIA 3SCUA 1NQ6A 1E6ZA 3EBVA 4OKDA 2CHOA 4B9YA 2O9RA 4UFMA 2BY3A 2ZICA 1CECA 3VIOA 2PF0A 2ZUMA 2HVMA 2XM2A 2OSWA 1E1FA 3M46A 5DT5A 1Q4NX 1KXTA 5JBFA 4CCDA 1JD9A 1V3LA 1KGXA 3FXYA 1OM0A 1HL9A 1VJSA 2D1ZA 1PZ2A 2D0FA 1CXLA 1GQKA 3VMOA 3TP4A 1X1NA 1H0IA 1NWTA 1QHPA 3F5KA 4GI6A 3LMYA 1MQRA 3AIEA 3WDJA 2J7DA 3LPGA 4M81A 4D6DA 2FH6A 3SCOA 5FD0A 1UD2A 1RH9A 3GXDA 1WDRA 1MW3A 2ZUSA 3GNOA 4FLOA 1DP0A 1C8XA 2UY5A 1GHRA 5IFTA 2CBIA 2WMGA 3WFZA 4GZEA 2VZOA 3F5LA 2O92A 4OZOA 5C70A 3VINA 3VDBA 2F61A 3AJ7A 1QHOA 2JF7A 3B9AA 3FN9A 4P7LA 1FP8A 2XG9A 1LL7A 1UR0A 1AQHA 3N11A 2QV4A 2BY0A 1ZBCA 4HZ6A 5D8ZA 1V0MA 4J3TA 3ECQA 3AHXA 4AIUA 2UY2A 1Q6CA 2WVSA 1BYAA 3VIGA 3ZSSA 5ABFB 1XGZA 4J7RA 3AIRA 5EFFA 1UKQA 4ZENA 2DDXA 3T0BA 4GINA 2FHBA 2QHAA 2DEPA 3MSDA 1DWIM 2DPEA 2PBGA 1E5JA 4TVDA 1B3YA 1UH2A 2ZXQA 3UG3A 1UZ4A 4PMUA 3VGHA 2XHYA 1PX4A 2YL9A 1ITCA 5HNNA 3N9KA 2DSVA 2WCAA 3OLDA 4LGXA 2V38A 2E0PA 2ZUWA 3AZRA 3JUGA 1C3FA 5FOOA 4CD6A 1G01A 5A2CA 1XCXA 3PZNA 3AS1A 3VMPA 1E4IA 2XTKA 2PBOA 3PZVA 4J3XA 1OD8A 2YA1A 1ISXA 2C7FA 3ARYA 3BGAA 4UQEA 4MADA 2C0HA 1W9VA 1JFXA 1IT0A 3BAXA 3QHNA 2DSWA 1LF1A 4AEEA 3T0DA 3VGEA 2YIHA 3VMNA 3POHA 2X0HA 5A8MA 5IXEA 4DUWA 5BYWA 4DM1A 2WPGA 4U5IA 4GI9A 3CHCA 4V27A 3K4DA 4YN5A 4CD8A 4C7FA 2VJXA 1J10A 4JCMA 1XSKA 3E1F1 2E9MA 2YDSA 3UESA 1G9HA 3TTSA 1QBBA 3QGVA 2ZX6A 2ZXAA 1UR4A 1US2A 3VDHA 1Z32X 1UZ1A 3MV01 3FNDA 3SCVA 1ZBWA 2W61A 1WO2A 4F79A 2IXVA 1GOIA 4LQ1A 3T09A 3WH6A 4JHZA 1FH7A 4AZCB 1E0VA 2WHMA 2XYLA 3TOPA 5C8BB 3NIYA 4MNKA 2VX6A 4HMEA 3PZOA 1B30A 1JYNA 3AIVA 5A2BA 1FH9A 3CZGA 4D6CA 2V3GA 1B3WA 3ZO9A 1TA3B 2X0YA 1BLIA 1V6YA 4IPNB 3WMSA 4WKHA 1TCMA 2VRJA 1Y7VA 4W5UA 1W9XA 4LYPA 3U5YA 1HNYA 3GH5A 5I79A 3WNKA 2YDRA 1UG6A 5I2UA 5BRPA 2W66A 4PEEA 2VQUA 1UR2A 2ZX5A 1HX0A 1B9ZA 2DT3A 3MS8A 1HVQA 4PMVA 2IXUA 2ZX7A 2EO7A 3HN3A 4PTWA 1GZJA 5E0FA 4PBGA 1V3HA 3ZT6A 5I5RA 1OWQA 3D3AA 2W63A 3NSMA 3VGBA 4AXNA 5ECUA 3WY1A 1K9DA 2WANA 2WMHA 3AICA 1MQQA 2AAAA 3ALFA 2ZX8A 4CN6A 2OSXA 6TAAA 5JBDA 2BVYA 3AXIA 1JFHA 2WC3A 2J74A 5LA1A 2CXGA 3WF3A 3EMQA 4MAZA 1E73M 3TTYA 4CVUA 2Z1KA 4CN4A 1ISZA 2XSAA 1XD1A 2BFGA 4CD4A 3CO4A 2XVGA 1JZ5A 1HJSA 1B3XA 1QPKA 2WMFA 3AMCA 4PTVA 5D9OA 2PWGA 3BAIA 5A6MA 2G4FA 4CU8A 2GDUA 4UOJA 3K8MA 1HJXA 3K8KA 3AHYA 1LJYA 1MW1A 3K1DA 3L4ZA 1UA7A 2WZIA 5KZ6A 4MJ4A 1H3GA 1PIGA 1NWUA 3AISA 4IM4A 3UERA 3WMBA 4ATLA 3WDQA 3OIHA 3DC0A 4V28A 1VENA 3RCNA 3AMGA 3PTQA 3CTTA 1R8LA 3GNRA 3A4XA 5BXSA 2WKGA 3N17A 1OGSA 5BROA 1QNQA 2PWFA 2AMGA 1E3ZA 4YHGA 4PN2A 1X6NA 2GJXB 3PZQA 4MTVA 3AHVA 4JAWA 3WDHA 1OIFA 4XUYA 1I75A 1MXDA 2CETA 5A6SA 2X1IA 2WSPA 4M56A 1XV8A 3L4TA 3BLPX 2OSYA 2VZVA 4HA1A 2YOCA 5I0DA 2XUCA 3WNNA 3IJ9A 1E6NA 3CGTA 1NP0A 1EDTA 4Z2JA 2VR4A 2Y2WA 3OGSA 3BMWA 2VZSA 4M1RA 3VDCA 3VIKA 3ARTA 3VNZA 3VIIA 4HOZA 1GOOA 1ZJBA 1M7XA 2PI6A 3SCTA 3WDPP 2JIEA 4GQRA 3WL1A 4B3LA 1CEOA 1UKTA 5CQ1A 5BRQA 1KBKA 1MWOA 2VX4A 4B16A 1HN1A 3I3EA 1OIMA 4PMDA 4JFSA 1M03A 1CGTA 2J47A 3UCQA 2TAAA 4U2ZA 3VD4A 4AZ7A 4PSPA 2V5CA 1TR1A 2BY1A 2BY2A 4JKLA 3AI0A 4W5ZA 4ZFMA 1GONA 4W7VA 1H0GA 1L0PA 3AIUA 4D6JA 1G94A 2GFTA 1C92A 1Q6GA 4JL2A 1TE1A 1XSJA 4XZBA 2Y4SA 3AHZA 3FW6A 1BTCA 2G3NA 3AOFA 3UR8A 1C8YA 5E6YA 4U3AA 3MO4A 4W8BA 3SUTA 2EEXA 1LLOA 1F4AA 1TVPA 4FK9A 4WJXA 3PZTA 2W5FA 4JFWA 3T0AA 5M03A 3ARPA 3DYOA 1KB3A 4ATWA 4CU6A 1JGIA 1NH6A 3OB8A 3O2LA 2QMJA 2WWDA 1MVYA 3EYPA 1E72M 3WD2A 1QI0A 2BHUA 1V02E 3BH4A 1UUQA 4DM2A 1CLXA 1H09A 3EDFA 4M24A 1SR0A 5ABGA 1UKSA 1B3VA 1J11A 3VX0A 1EGZA 2D23A 1FOBA 1V6WA 2XVKA 1DWHM 4PRWA 4YPJA 1HJWA 1KXQA 4UOQA 2YJQA 5KEZA 1OB0A 2G3MA 3A4WA 1JYWA 3FY1A 4V2XA 2BV9A 1QI5A 1JAKA 2G3JA 2XWEA 2D2OA 2JF6A 2YL5A 5GNZA 4D1IA 2ZWZA 4IISA 1PEZA 1GQIA 1UR9A 4FLRA 4RE2A 1QNPA 1W3HA 4EE9A 4HOXA 3MANA 1BGGA 4W86A 3CPUA 4UFIA 3GXMA 2WB5A 1V0KA 1BFNA 2DT1A 4JCLA 1HXJA 1UD3A 3TONA 4TTGA 1V3JA 1ECEA 1JZ8A 3GTNA 1E9LA 2D0HA 3L4YA 3WKZA 3CMGA 3MV11 3WBEA 1JDCA 2E3ZA 4BA0A 1C90A 5CLWA 1KCKA 3WL0A 1AVAA 1JF5A 4HPGA 3VGDA 2WMIB 3UEQA 3SEPA 4AC1X 1KWGA 8CGTA 3VIJA 1PIFA 1LWJA 1ESWA 1RP8A 4KRTA 4QAWA 3T2OA 1LQ0A 5FCZA 4GXPA 3QOMA 4CKQA 2E8YA 3W24A 5BXRA 2B31A 5E9AA 1LG2A 1MFVA 1JD7A 2WZEA 1CXHA 1EO5A 1JZ2A 4H7VA 4Z2GA 3MU7A 1GVYA 4P8UA 4H04A 1V0NA 4PMZA 2DT2A 2VZTA 4CD5A 1M53A 2OYKA 1EHNA 4RE3A 4XX6A 1BVNP 5JIPA 1P6WA 4QP0A 2JFEX 3W37A 3WNPA 5GNXA 5A69A 4NZCA 3AYRA 5CLTA 3G6LA 2EPNA 2XIBA 1WZLA 1KBBA 4AZIA 1CZ1A 3W82A 1EOKA 3VO0A 1J9YA 3BCDA 4UQBA 3OLEA 3ZIZA 1BYCA 1DWGM 3U7BA 1OT2A 5CZKA 3FAWA 2J4GA 4UFHA 1UWIA 1W3KA 3AZTA 1GNXA 5HXMA 2VRKA 4ATDA 3AXXA 3MUZ1 1DWFM 3CBWA 1QVBA 3WD1A 1VIWA 2QLYA 3DHUA 4DWSA 1HKMA 2GUYA 3SCRA 1J0KA 2DH2A 3WMCA 2QPSA 3UETA 3ZMRA 1B0IA 1CXEA 2OWXA 1V3KA 3N13A 3WENA 4ACZB 3MUAA 3W25A 2CKSA 3W4RA 3MMDA 2YDQA 3GH4A 4NI3A 2VVSA 2WHJA 2WAGA 5IFPA 2V3FA 4OOUA 1JXKA 3A47A 3WD4A 2XGBA 4Y7EA 3PZUA 4HZ7A 2FHFA 5I23A 3L4XA 1AQMA 1UD5A 4BZYA 1HP4A 1CPUA 3VDAA 4BQ5A 1H1NA 2A3EA 4B9ZA 4D71A 4DUVA 3WDRA 1HKKA 4JIEA 3MSGA 5A1AA 1QOXA 4QFUA 1UWRA 4KRUA 4XV0A 1H41A 2IUZA 1XRVA 3ARQA 5EBAA 1CNVA 5EB8A 4D72A 1E15A 4PTXA 1GJWA 2WVVA 5GNYA 3LPPA 3WQVA 1EOMA 1GVIA 3RM4A 4M8UA 5I6SA 4W84A 2VX5A 2BXZA 4DUXA 1VFUA 1KFWA 5D4YA 4EK7A 2WKLA 4J3VA 4WLCA 3VKKA 4D6FA 5A6BA 1W9UA 5E70A 3WNOA 5I24A 4QLKA 4H8VA 4UZUA 5LYRA 4P7QA 4H8HA 3RPMA 3VD3A 3AMDA 3WDIA 3EDDA 2WHKA 3ARSA 4A3YA 2EJ1A 2DGAA 4UTFA 4HMCA 3W6MA 3WEOA 1ZBVA 5M3WA 4QLJA 1GPFA 2FHCA 1V3IA 3PBGA 4W87A 3GDBA 4TTUA 4C7GA 1E70M 2PWDA 2FGZA 2NT0A 5E09A 2XIIA 2OWWA 4ZE4A 2YKKA 2QMKA 1RP9A 5DT7A 3VGFA 1EQCA 3II1A 1QHZA 1ISYA 1I1WA 3RILA 3NDYA 4W89A 2V5DA 2WC7A 4P8VA 2OYLA 1K9EA 1B90A 1W2PA 5DEZA 1HT6A 1S46A 2CHNA 3DECA 4GO9A 4UNIA 3CUHA 2VT0A 1JZ4A 3WSUA 3THCA 3MMUA 4GKLA 1MW0A 1W9DM 2NW0A 1GHSA 3WH8A 1BYBA 1WCGA 1UWSA 3AFBA 4MB1A 3ZQ9A 3ARXA 2CYGA 3PTKA 3RIKA 5I78A 1BSIA 3IANA 2WLZA 1OT1A 1UH3A 1UQZA 1VAHA 2ZIDA 1WPCA 2HISA 4GI8A 4UOZA 3B9DA 4F8XA 1ZJAA 1CGXA 3AROA 3TTOA 4Z2IA 1IZJA 3ARWA 4W8AA 1EDQA 1H2JA 1YHTA 1ZBKA 2QF8A 1LL6A 3ZM8A 3SUUA 1Q6DA 4ZXOA 1WZMA 1CGWA 5JBEA 3WQWA 1HKIA 3N04A 5ABFA 3ZT7A 1IV8A 1OCQA 4W85A 6CGTA 4H41A 4PMNA 3ARUA 1EA9C 2GJPA 2WMKA 5D9NA 1HJQA 2BXYA 4QCFA 1WKYA 1PZ3A 4PUDA 4N42A 1H11A 1MXGA 3W26A 3NCOA 4Z2KA 2AOSA 2J62A 4PCSA 2F2HA 3EDKA 2VO5A 2XGIA 1BVZA 4BS0A 2OWCA 2PB1A 2WVTA 4AZGA 2X8RA 4HA4A 4WF7A 1E56A 1XHGA 3RO8A 4GIAA 4E2OA 1H4PA 2XFRA 3WFLA 2XVLA 5CGTA 2CIPA 2GK1B 4M29A 2YL8A 3PZGA 4CGTA 1O6IA 3CUFA 5ABEA 4J3UA 5IHRA 3VIHA 4S3KA 7A3HA 1QBAA 1G1YA 1O7AA 2ESCA 1WAWA 1E6RA 1NOUA 1SMDA 4U33A 1JDAA 1QNOA 1E40A 3AMLA 4NRRA 2D3NA 1BAGA 2YA0A 4MDPA 4D6HA 3CMJA 3O9NA 4UR9A 4TOQA 1W1YA 1KGWA 3KWXA 4HMDA 3F4VA 1V08A 4CCEA 1NWRA 1LL4A 4AEFA 2DIEA 3BAYA 2EPKX 1HJVA 3KE0A 5HPCA 3KZSA 3WUBA 2WCGA 1QW9A 4MNJA 3DYMA 3RM9A 3WELA 4W88A 1E3XA 4U3CA 4MAVA 1DTUA 1E6QM 2G41A 3AS0A 3T08A 1NWSA 4X0VA 5A6KA 1OBAA 3GYCA 2VVNA 4KGJA 1CGVA 1X6LA 4U2YA 4AZCA 3SCPA 2C8NA 5JUVA 1J18A 2VCBA 5CSUA 1CXFA 2WVUA 4PMOA 2X05A 4RL3A 3RMEA 2WM0A 2ZXDA 5A6AA 2YBUA 4D1JA 4BQ4A 3ALGA 5LA2A 1TA3A 5FKYA 4AZ5A 1JXJA 1C7SA 3MUY1 2J77A 3L4UA 1XSIA 1CLVA 1NOWA 4MPKA 2FDMA 2YA2A 1ODUA 2V3EA 3UG4A 3AZSA 4BQ3A 3VM5A 4QLLA 3GXIA 4MB5A 3IAQA 1PX8A 1V03A 4UCFA 4UZSA 3CUJA 4RE4A 1Q6FA 4CU7A 4AD4A 3HMCA 3PZMA 3I3DA 1UD8A 4WSJA 1DEDA 4PUEA 4AIEA 1UD4A 3NSXA 4E4PA 4EANA 3GH7A 2CKRA 2DT0A 1CIUA 1EIBA 3IJ7A 2VRQA 1KGUA 1U30A 5A8PA 4AY1A 4NRSA 1EH9A 4IUGA 1QW8A 2CPUA 4BQ2A 3VU2A 1W32A 3N15A 2GSJA 3WQ4A 1YQ2A 3AQUA 4LYRA 1XH0A 2WWCA 5DO8A 5A6LA 1UH4A 1HVXA 3AIBA 5CXPA 3KL5A 2PC8A 1JF6A 5CJ5A 5BXTA 1CTNA 1UKOA 1JZ7A 1W9BM 3A6OA 2W62A 2VC9A 1JNDA 2EPOA 2J8GA 3ZJKA 4M82A 2WBGA 1V6VA 2ZUUA 1KQZA 3VGGA 3WUEA 2GJRA 1FFRA 1CDGA
chains in the Genus database with same CATH superfamily
2EPLX 1J01A 4NNBA 4NJHA 3N6JA 3HPAA 4NZ1A 1MRQA 4C6EA 1UBPC 3CMFA 1P5BA 4QJ5B 2OMAA 1JG9A 1VJIA 2V30A 3KOXA 1DQWA 4NQ1A 1AODA 2NVAA 2QDEA 4LUSA 3JR2A 3SADA 3PK7A 2C16A 2OODA 2NQZA 3AIQA 3DZ1A 4JQ3A 3WEMA 4WXYA 4DYJA 2CC0A 3BLOA 5HMSA 1S2AA 1OY0A 3HTWA 3LM3A 4L56A 3TROA 5HINA 3DXIA 4H7CA 4MGGA 3AALA 3VIFA 4O19A 2XSBA 4GQQA 2H6RA 4ZE5A 3ZJ6A 4GZ7A 3KEHA 3SCSA 4AVNA 1ZCCA 1IZCA 1RXOB 4X22A 3D46A 4IMFA 4ENLA 3CUIA 4W7WA 3HU7A 4P8WA 4PYSA 1J0ZA 1OZMA 3Q2DA 3QHOA 1E0TA 1SO3A 3LV6A 1X6UA 3BAJA 4O0ZA 4J27A 3AS2A 4GUFA 4RDZA 1VYSX 5D04C 3C52A 3BL3A 2CNCA 1BXBA 5KINA 1ALDA 3NDZA 2J79A 1E4LA 1XLMA 3WD3A 1XLJA 2WBKA 4KWSA 3EWBX 2VOTA 3N9SA 3APGA 1WX0A 1J0JA 1S1PA 3S1GA 2XVNA 1UOKA 1M7JA 1TRIA 4TVUA 2Z1BA 3I7QA 5CC6A 4RR4A 1TPDA 3C3UA 1GK8A 3D0CA 1JPDX 1WZKA 4OBRA 1YDVA 4QDPA 3SY8A 1R3QA 5D2WA 4CQ8A 1XXXA 2PUZA 1JZ6A 1MFUA 3WLHA 2EAWA 4PMQA 3ARZA 4WIWA 4DBEA 1J2WA 3W73A 3D3FA 3POCA 3PY2A 3LTYA 1WAUA 3MSRA 3WLPA 3CZEA 3N6QA 1DHPA 2BVTA 3EMCA 3PTMA 4GWEA 1A5BA 1QWKA 1AW2A 3RM8A 1YEYA 3MA8A 3GU9A 4N9EA 5XIAA 3SIZA 3AYSA 3ZT5A 5AC6A 3PPGA 4Q7IA 2OEMA 4LBUA 3G6MA 1H61A 3SQSA 2QPUA 3AXMA 5CSRA 1A5LC 5C9RA 4KEVA 2DIKA 4PSRA 1G7UA 1R7AA 4GKTA 1OSEA 3S9IA 5DLCA 1EL3A 2FH8A 2V3DA 3GC5A 3VNMA 3WN6A 1LOLA 5AFDA 1UD6A 1YNYA 4Q8TA 2YLAA 3GUWA 2JK2A 5FF0A 1M7OA 1JPIA 5PTDA 1IR1A 4WJ8A 3EKZA 2OOFA 3O6CA 5IDIA 1FVPA 1GEHA 2QCDA 4N4PA 5FJOA 1EQPA 4QGCA 1RD6A 3WF4A 4QBXA 3CV7A 5CG0A 2ICSA 4YYCA 5TQLA 1NDWA 1JIBA 4QE1A 1KTCA 1GOKA 2VCCA 2FFIA 5M5DA 1KBJA 1E1EA 3RMJA 3UF9A 4LNYA 1AL7A 1US3A 5GQBA 1P4CA 1S39A 3MYPA 1UYQA 6ENLA 1XD0A 4YHEA 2ZKMX 2ZUTA 3GTFA 1S5WA 2RGMA 3HOJA 4O16A 1Q7MA 1WE5A 4WCJA 1OD0A 2ZUVA 4YYFA 2PF8A 1SO6A 1RJQA 2A4AA 1RY0A 3NAVA 5DMLA 4IIHA 3ONCA 3WD0A 5AHIA 3I4EA 3GW3A 1TJ0A 1YIXA 3CIVA 1JYXA 2IPWA 5HOSA 1MDLA 4UTMA 1ECQA 2QJGA 2FFCA 1K6AA 3IK2A 1F7BA 4ZA0A 2YCLB 5C7HA 1RQHA 2DVXA 2J9ZA 3UGVA 3DG3A 1LT8A 2BGNE 4FNRA 5LIWX 3NQBA 4JHMA 2ONEA 2DQWA 3TYAA 4N2YA 4GG9A 4LPCA 5BZAA 2ACUA 4HTYA 1WDSA 3G1RA 4XAPA 4IF2A 3QR3A 3DU0A 2CZ5A 2VMFA 4M80A 2JGYA 2I56A 4PL2A 2VURA 2J6XA 3W2UA 2FDSA 1SO5A 1H7PA 3ANUA 1GW1A 3WNLA 2YYTA 3VVGA 2DSKA 4HK5A 2ABBA 4EP8C 5AN7A 3RU8X 1UWUA 1AG1O 1GQLA 2Z6JA 3WF1A 4AUBA 3A12A 1RBLA 4Z0JA 1EJTC 3FDKA 4JEJA 1HP5A 7TIMA 4Z1BA 1CBGA 1DWAM 1FXPA 2G0WA 3OZYA 4NF7A 3THDA 4EXBA 1A47A 3V36A 2A3CA 4RXGA 5FJIA 3UZWA 3VK5A 3GTXA 3TEVA 3GR7A 4LSBA 3UR7A 4IHCA 4MB3A 1VEPA 2W3ZA 4BF7A 2R1NA 2PDQA 5D32A 5MKGB 1WB0A 2Z1SA 4DQWA 2A3AA 4Q4RA 4RV8A 4LT9A 5H8UA 1EP2A 1E71M 3PZIA 3UZ5A 1ZFJA 5GJNA 3TYEA 5E5CA 1QI2A 3LCHA 3SSZA 5E6ZA 2G3IA 1K77A 1DJIA 4AYSA 4M6VA 4MMWA 1UA3A 2BVWA 4AWSA 3LV5A 4B5SA 4JL1A 3BOLA 1SZFA 4ICMA 1W37A 4DJEA 4RLIA 3KZPA 3KOYA 1H63A 4O54A 3AAMA 4E8CA 4DF0A 4GY1A 1YDNA 3W28A 5C55A 1R9YA 3A5FA 5BWFA 4J2MA 1XC6A 2DIJA 1F6PA 2CBJA 4WVXA 5CPTA 4GO8A 1MUWA 3GTHA 3N73A 3NYZA 1AQFA 2J8FA 2XFFA 4RNJA 4JX4A 2G95A 5A6BD 3WBAA 1VFHA 3VD9A 3MJMA 4JX5A 3D47A 1KKOA 4XTDA 2QCFA 1B3ZA 2O9PA 5CKSA 4DWSC 2G96A 4OIFA 1TREA 2Y1HA 4CVWA 1VFOA 3GBDA 4GC4A 3NL2A 1P48A 3PBMA 4WY0B 4HU8A 3E2VA 1WKEA 1ZHAA 1G4PA 3O6AA 3UJ2A 5G4EA 3MBDA 4Z2HA 3H2OA 1F3WA 2HV5A 3MT1A 3VKAA 1E43A 3NPXA 3R10A 2Y8KA 4F66A 4JQ1A 3W7RA 7TAAA 4XSMA 3CB3A 4JPGA 3OLIA 1ZSXA 4C5YA 3OZPA 5REQA 3S5NA 5ABHA 5AHFA 3L0GA 4L65A 2D0GA 4DWSB 1OX6A 4JFVA 1A5MC 3BMVA 1VEMA 3QY7A 4F0RA 4MFDA 2OZ0A 1VEOA 3AU2A 4AISA 2JEPA 2NV9A 2ZWYA 1KTNA 1E4NA 3NQVA 1C7TA 1I6NA 2QQ6A 1OFDA 4O1CA 4YLWA 3U7VA 5HULA 1F3XA 3VIMA 1W2VA 4HN4A 3MMTA 1W1VA 1IWBA 4XB3A 4JBRA 1PYFA 4INFA 5C9WA 1QNRA 4JTKA 1GORA 3VNDA 3KDOA 5AYIA 2PGFA 1RLCL 3LTPA 5MF5A 2ZOXA 3QQ1A 1W0MA 5HQMA 5KITA 1TVLA 3VNJA 5HBFA 3F03K 4XZWA 2VI0A 1WQ5A 3UXDA 3L4WA 3KLLA 4GXMA 5GJMA 1TSIA 1OX4B 3EWUA 3WJXA 4BEQA 2E9BA 2WVVB 4ZB0A 4HP5A 2ZRXA 2UY3A 3VOCA 5AYYA 1TKKA 1V6UA 2VOMA 4POCA 3UYCA 3RJXA 2QCLA 5DY3A 4JKKA 1OFAA 1W56A 4FF5A 4KIEA 1KR1A 3CAVA 2B4GA 1XYFA 4GABA 3W7GA 1IIGA 3NUKA 4HNCA 4DJFC 3VILA 3GFXA 4R34A 1EJUC 3L65A 2NSXA 4P61A 3BXWA 3RJYA 4CN1A 3UP8A 4C90A 1VB9A 4N6EA 1C93A 1XLIA 2J7EA 1L6GA 3CZLA 1R9XA 3M6YA 3SCUA 4LVFA 1E6ZA 4DLMA 4L9ZA 1DJWA 5K3VA 4PCPA 2NQ9A 2BY3A 3P84A 2NX9A 4F40A 1D7KA 2VFGA 1P7TB 2XM2A 4E5TA 5BWAA 3KBNA 4C6JA 4CCDA 5JBFA 3THAA 1V3LA 3N19B 1F3TA 2QULA 3FXYA 4DO4A 2A21A 2Y0FA 2D1ZA 1DJQA 4A8IA 2L5HA 2D0FA 1FCBA 1GQKA 1H0IA 2ZDRA 2P0IA 4YTTA 5AYZA 3F5KA 4XBSA 3AIEA 3TXZA 4NXKA 4D6DA 3TYBA 1UC4A 3QQWA 2NUYA 3GXDA 3FCPA 5C9UA 4C65A 4RX0A 2CBIA 3WFZA 2VZOA 3M0IA 2O92A 4OZOA 1P0BA 3TSMA 3I6EA 3VDBA 4HNLA 3AJ7A 3VC5A 1TWWA 2XG9A 1UR0A 3NQMA 2QV4A 4A21A 5XINA 3KTSA 4HZ6A 5AHNA 2GL5A 2E5CA 3AHXA 3UT0A 1Q6CA 1YPXA 2WVSA 3NDOA 1BYAA 1GVFA 5EFFA 3AUOA 4MYAA 1UKQA 3NWRA 5HQLA 3LYEA 3TA6A 4PEKA 2DDXA 3P67A 2HVOA 4PB3A 4UTIA 3MSDA 3CT7A 5LKYA 4JIHA 3UG3A 1E5JA 3MYOA 1UH2A 2ZXQA 1Q8JA 3KAOA 2XN2A 2XHYA 3S83A 3JS3A 1CB2A 3RLVA 4UTHA 3TN3A 2YGYA 4HGXA 1NIUA 3TJ4A 4LGXA 1Q6RA 1QR7A 3JUGA 3S1VA 1I2PA 3MI6A 4DEFA 4MHBA 1XCXA 4KFPA 2YB1A 1K4GA 3XISA 3VMPA 1TTPA 4H9MA 3G18A 3KBWA 2CU0A 3MSYA 3DFNA 3P80A 3AWOA 3ARYA 5G1MA 4UQEA 2REQA 7ODCA 1Q65A 1L2QA 3QZ6A 2DSWA 4AEEA 3VMNA 4AH7A 5IXEA 3NG3A 4DM1A 2Y5SA 1T5AA 2NQ5A 3CHCA 4H2HA 1SSGA 4V27A 1UB3A 3C86A 1XSKA 4Q8QA 2ZXAA 2R1PA 3QJAA 1YX1A 4HK7A 5HK4A 4JQ4A 1US2A 5CZTA 4UTWC 1XFBA 4F79A 2IXVA 3C3NA 4LQ1A 3WH6A 1PYMA 4MJMA 2PFHA 2WHMA 3TOPA 1TTQA 2CZEA 3N2XA 4HKPA 4HMEA 4KQNA 4HK6A 1B30A 4M0XA 3OJGA 1QNVA 3MBFA 4ES4A 1UIPA 1V6YA 4IPNB 2P88A 1TCMA 2VRJA 1BWVA 1W9XA 4LYPA 3L5AA 5I79A 1H7XA 1B9BA 4NZ5A 3S5SA 3N2OA 1UR2A 4I8DA 3LEPA 2HSAA 1B9ZA 3VFLA 3MS8A 5AHEA 3C2VA 5EMMA 3FKKA 4EF8A 3RX3A 4PTWA 2O7QA 5ECVA 1OWQA 2W63A 3VGBA 4Y8EA 3QV7A 4AXNA 2Q6ZA 4K7VA 4S3DA 3LD5A 2WANA 5F4WA 4CN6A 2ZX8A 4UTKA 5JBDA 3W1AA 1SO4A 1X7FA 3AXIA 5LA1A 1U1JA 3WF3A 3EMQA 4RK8A 3RLGA 4MAZA 4CVUA 3OVPA 5JH2A 1CW2A 2Z1KA 3M0YA 4CD4A 2Z1VA 3W2KA 2XVGA 4GJ1A 1JZ5A 3URBA 3W7JA 1F73A 1UUOA 3H2NA 3ZWSA 4FXFA 3WQDA 3K1DA 5BOOA 4IL0A 4GIYA 1UUMA 3UXIA 1MNZA 1B57A 1A0EA 3FYOA 3AISA 3SB0A 4L1GA 4WEVX 1N2VA 2ZC1A 2ZC8A 4H9VA 2TYSA 3OIHA 4XZLX 3DFHA 4LUSB 4DO6A 1KBLA 3W22A 2WKGA 1R3TA 4HCLA 4UMCA 1OGSA 4GVGA 3P61A 1E3ZA 3N4EA 3M43A 5KSWA 4K1WA 4PN2A 3PZQA 3K5XA 2EG8A 4CQDA 3TJLA 1I75A 4K36A 1K02A 2WSPA 3KTXA 1H7WA 3BLPX 5AC8A 1OVDA 2VZVA 2XUCA 4YVPA 3BMXA 1YDOA 2YW3A 4BKNA 1KM1A 2Y2WA 2VZSA 4AFYA 4M1RA 3VDCA 3ARTA 2W9MA 4GI4A 4L9YA 3O7UA 1ZJBA 1M7XA 1TX0A 3KRSA 4I90A 1GZ1A 1YXDA 3FA5A 3WL1A 4B3LA 5CQ1A 1IXOA 3R12A 1MWOA 2HNEA 2VX4A 1ICQA 1O1HA 3I3EA 2XDFA 2GSHA 4PMDA 1QASA 4S23A 3ATZA 1FKXA 4GVIA 2XISA 3CWOX 2XN1A 2J47A 4V1YA 4CCZA 2Y85A 4AZ7A 4HYVA 1NDVA 4XKYA 4ZFMA 5CC7A 2WQPA 2PDXA 1XGDA 4W7VA 1H0GA 1Y8BA 3AIUA 1ZJHA 3P93A 5I00A 3C0LA 4JL2A 1TE1A 4HMNA 1XSJA 4XZBA 1FWCC 3TSBA 3FW6A 1ZALA 1TJ2A 3G3DA 3W2LA 5E6YA 3SUTA 3IGHX 1W1IE 3EX3A 4FK9A 4LWWA 3PAJA 3PZTA 2W5FA 4JFWA 3T0AA 3B9OA 5M03A 4IP7A 3OB8A 2JKEA 2GVJA 3H6OA 2WWDA 3EYPA 1E72M 3WD2A 2X7VA 1QI0A 4E3VA 4QIUA 2OGJA 1V02E 3BV4A 1W17A 4DM2A 1CLXA 1FWGC 3EDFA 4Q3MA 2XFWA 4F2UA 3P74A 1FOBA 4PRWA 1TZ9A 2TODA 1KXQA 4UOQA 5KEZA 1NTHA 2ZRUA 3KS6A 4IIDA 1JYWA 4V2XA 1JAKA 5LIXX 2QR6A 5GNZA 4ZB5A 1W6TA 1ITUA 4IIGA 1GQIA 4FLRA 3GFZA 4RE2A 1GKPA 1V4YA 4B92A 3ITCA 4EE9A 4F0LA 3KVKA 3H2MA 1FBAA 4W86A 3CPUA 2XIQA 3OO2A 4L6HA 1FDJA 2WB5A 3FVDA 4JCLA 4IMEA 3ZLFA 2VGFA 4E2VA 4A3RA 1O5RA 2QCDB 3ID7A 4NP7A 1W54A 3GTNA 3VC6A 1E9LA 3WBEA 1JDCA 4BA0A 1C90A 5CLWA 3QMRA 4JYFA 4Q4KA 4WXZA 1F8MA 1DPMA 3KFTA 4GIEA 2G37A 3SEPA 5HJLA 4US5A 3NO5A 4IX0A 3LCWA 1PIFA 3W23A 1LWJA 3CYVA 4QAWA 2MNRA 4L1XA 1LQ0A 1UPPA 4O1DA 1D3GA 2QDDA 1ZPTA 3W24A 2G4JA 4CQ9A 2VGBA 1WDWA 4MY8A 1LG2A 2NUWA 1JD7A 4WDUA 5LHFA 4LUYA 4UTUA 4O12A 4P8UA 3VOFA 2VZTA 4CD5A 3DI1A 1EHNA 4H9UA 4XX6A 1GVEA 5JIPA 1TPC1 3PJXA 3KHJA 2NZLA 5GNXA 5A69A 3E2SA 5CLTA 1F6YA 1BXNA 2EPNA 2QIWA 2YCJA 4CNOA 3ABXA 4NUWA 4KT2A 4JIPA 4XQ6A 5EPDA 4MM1A 3U4AA 4XK2A 3OLEA 5B7ZA 1OT2A 3PNZA 2I5GA 3FAWA 2HCVA 2J4GA 1CX9A 4UFHA 5I3IA 1UWIA 3BW2A 3W7NA 5HXMA 3TZFA 4R33A 3TYCA 2XH7A 1DWFM 1QVBA 2QLYA 1SFJA 3RK8A 1CCWB 2GUYA 2PDLA 4KCVA 2YPIA 2DVTA 3WMCA 2QPSA 3VNLA 2DZWA 3GR8A 3M5VA 2OWXA 3L68A 4JXCA 4U4MA 3W4RA 3JVAA 3MMDA 4ERGA 3HGRA 5L6UA 3P3BA 3H53A 3A47A 3W1RA 2XGBA 3PZUA 4HZ7A 1K6WA 5LIYX 2FHFA 1GWJA 2E68A 5FEWA 2QAPA 4BQ5A 2PP0A 4JIEA 1DTNA 3ONBA 4JTSA 3RG6A 4LCQA 4QFUA 1EC9A 4XV0A 3KTCA 2VUNA 1XRVA 5EBAA 5CAKA 1EBGA 4M1BA 4D72A 1J4EA 3VOHA 2PA6A 3GDKA 2QXWA 1EOMA 4NYUA 2DZUA 4ZVJA 5CAHA 1OFQA 5FSDC 3FIGA 4MF4A 2FB3A 4DUXA 1NSJA 4DAIA 1KFWA 1OCBA 4WLCA 3VKKA 3E0LA 4LB3A 5A6BA 3WNOA 5FJPA 1S5VA 2J66A 4H8VA 4JTAA 3AMDA 4ZQPA 3WDIA 3ARSA 1ONEA 4HHPA 4CNNA 4DJEC 3Q58A 3A9IA 4IICA 5M3WA 1GPFA 4AXKA 2HVNA 2XIIA 3RPDA 3T9PA 4ZE4A 3OPSA 2HZGA 2QMKA 1CI1A 1TWSA 4PH6A 1I1WA 3RILA 3NDYA 4GH1A 1F5ZA 2V5DA 2WC7A 1T8QA 3BV7A 4P8VA 1W3NA 1HGYA 3M1ZA 1K9EA 1YDYA 3DECA 4GO9A 4PE8A 1ZP4A 3VKJA 2O4MA 1QPNA 3CUHA 3WSUA 3OZMA 2NW0A 1GHSA 1UROA 3W7LA 1M5WA 1BYBA 4KCUA 3TN6A 4KIRA 3PTKA 1BSIA 2V68A 3OODA 4JDYA 2E6FA 2DZPA 1KLYA 3NM1A 3L9CA 1F6KA 1RLDA 2WJFA 3SECA 3A23A 1QOQA 3M0HA 1QO5A 2V5LA 3QC3A 1IZJA 5D33A 1ONRA 3EWCA 3M16A 3ZFHA 1BEUA 2Q02A 1ZBKA 4JTQA 1NU5A 2QF8A 1KFCA 3SUUA 1Q6DA 4ZXOA 1CGWA 4ZR8A 3EX4A 4GUJA 3EB4A 1IV8A 4GLEA 4G1KA 4H41A 3PPCA 3DFPA 5D37A 1EA9C 2NWSA 3PSVA 3RX2A 1F76A 2BXYA 5G5IA 3TR2A 3UW6A 3SAZA 4PUDA 4N42A 3OBKA 3W26A 1IE7C 1AJZA 3DFYA 2V8ZA 4BI6A 2WZMA 3W1NA 3LHTA 2OU4A 1NF7A 2WVTA 3BZJA 1XHGA 3RO8A 2PRMA 3V5CA 1RA5A 5EKYA 3U4FA 1AW1A 3KOFA 4KEZA 1A5CA 4IQDA 4M29A 1XF0A 3PANA 2F38A 5REQB 4CGTA 3CUFA 4J3UA 1O68A 1OYBA 5J5RA 5AZ1A 4LF2A 1G1YA 3T55A 3ZR4A 4PGLA 1NOUA 3O07A 1R47A 4U33A 2BGQA 4MG4A 2Z2BA 5D2TA 3TDFA 2D3NA 3DFTA 3P6LA 1L6WA 2A7RA 1W1YA 2LLEA 1RSCA 4HQVA 1XRSA 4O53A 1TELA 1LL4A 3TFCA 3B0UX 4JQAA 3SGGA 2ZZ5A 3WUBA 2Z0IA 5D2XA 1GKRA 1XIMA 1QW9A 3LXCA 3MI2A 4QM1A 4LS0A 4B90A 2EGZA 3RM9A 3WELA 5I06A 4L61A 4U3CA 2YSWA 4MAVA 4WDWA 2G41A 3TOYA 4X0VA 2RDTA 5A6KA 1OBAA 2OLSA 3RN6A 4AZCA 2C8NA 1J18A 5CSUA 4JNMA 2CLPA 3SFWA 3RUBL 3R5EA 1FWJC 2GDQA 1IHIA 2R8WA 1W3TA 1TMLA 3ALGA 5LA2A 2QJNA 1TA3A 1JXJA 3OVRA 1S5MA 4Y8FA 3IJQA 2J77A 3L4UA 1KV8A 3INPA 1AK5A 4G5DA 2C1GA 1OX5A 1ODUA 3UG4A 5FJTA 1UASA 3IAQA 1DQUA 3HMCA 3PUDA 3BJTA 3S1UA 1UD8A 2Z28A 1KRAC 4LVBA 4WSJA 4E4PA 3GH7A 1OFEA 1EX5A 3EA2A 4NJGA 4D9PA 1IXPA 2Y62A 1CIUA 3IJ7A 4NY2A 1RK5A 5HWNA 1TPB1 3NQ8A 3HPFA 3NZPA 3HPXA 3M4HA 3QR1A 4NRSA 4IUGA 1J6PA 3EOSA 2CPUA 4HBKA 3SN0A 3VU2A 1Q85A 3G0UA 5J8LA 1ONXA 1AL8A 3WQ4A 4AX7A 3G8EA 3AQUA 2WWCA 3QRHA 5A6LA 3GG0A 4O10A 4XG1A 5CJ5A 1JZ7A 3A6OA 3UJSA 4DHGA 2EPOA 4AY8A 2Q3OA 3ZJKA 4PUJA 1HG3A 4BF5A 3ES8A 1V6VA 1FKWA 1K7XA 2V67A 1KQZA 2GJRA 1CPUA 3ITVA 1CDGA 2BTMA 2VENA 3NQ2A 3CLMA 1YXCA 4R27A 1SW7A 4FNSA 3GZAA 3WQ8A 5AY7A 3T7VA 4WK9A 2J25A 1EF3A 8A3HA 2Y5EA 1R9ZA 1GT8A 3W81A 2J7FA 2PLCA 2Q8ZA 1QXLA 4RNIA 3U2ZA 3EGJA 1BF2A 4UQDA 1WDPA 4TMBA 1DJYA 1FWEC 1HO1A 1M01A 1KCLA 1Q6EA 2R1LA 2F7FA 4B3KA 5JQ9A 5HNRA 1IZKA 3A9BA 4KMQA 5LNSA 1BWLA 3EEZA 4JTIA 1MYRA 1RY8A 2GJXA 4ERIA 4GACA 3F2DA 3QOKA 1LRQA 4AZBA 3HFYA 4B2DA 2Q8XA 1GTEA 1UP2A 3QFWA 3QTPA 2EQDA 3F4CA 3MWCA 1XGEA 3R6IA 2W92A 1YPFA 2ACRA 3IS4A 2J7BA 3MB9A 4Q6JA 2CEQA 1NP2A 3BSHA 1XICA 3R58A 4HCHA 4GZIA 3DKJA 2WJDA 4AHPA 1K9TA 4H19A 3GXFA 1HQTA 2OOGA 1CWYA 2WZHA 3N3MA 3BQ6A 4ZQRA 3EPOA 3KCOA 3B4YA 3ENLA 4FS9A 2REQB 1ADDA 4RE0A 4FOJA 4MLJA 1US0A 3PHAA 3HJEA 1OK6A 3M41A 3CYJA 3ABQA 4ZO6A 4D6IA 4H6KA 1WA3A 3UXKA 4M51A 3VKCA 3FLUA 3BLKA 3CM4A 1AZ1A 4DO5A 4P8XA 1GW9A 2RDXA 3ARVA 3ZLGA 2VQTA 1VFFA 3NO1A 7CGTA 1N8IA 4GX8A 4N4QA 2D22A 4JFUA 1GOQA 1EJXC 5A2AA 3U2OA 4B5VA 1Z3NA 5FEPA 2INEA 3VNIA 1PKMA 4E8DA 3DI0A 3KM8A 2E40A 1E0WA 5LNWA 4FR1A 1TWZA 2XH0A 2ZXBA 4AD0A 4AHOA 4EKJA 4L4LA 2ACSA 4Q7BA 3KLKA 1I0BA 1F9CA 4E2BA 2B81A 2OEKA 1B4EA 1V6XA 3SUSA 3TH6A 1MDRA 1AQ0A 2H8ZA 4TVCA 1FWFC 3CZJA 1JUKA 1AMYA 1VGAA 1PKYA 3QH2A 2GVEA 2X41A 4ZO7A 1XR2A 3GHTA 3OLGA 2VNCA 3UG8A 1GUVA 1HF6A 4M19A 1A4MA 1ZP3A 3UG5A 3LCXA 4ML9A 5CC5A 4KFOA 2VTFA 1KQYA 3LRKA 4K3ZA 5E9XA 2VEGA 3PUGA 4WSKA 4S3JA 3WUFA 3PN8A 3HG2A 3NPUA 2QNEA 4JN7A 3MC5A 1G5AA 4EIVA 4UFKA 3ORWA 1KWKA 3DFSA 2XZ7A 1A0DA 1NJJA 5D8WA 2OLAA 3R7MA 3UNTA 3W1TA 3WH7A 3FEQA 1H51A 1R6WA 2OPJA 1PS9A 4I3GA 4XKMA 3OHMB 4WOQA 2A3BA 1UKPA 3OVGA 1K8YA 1ODZA 1EZWA 1X8FA 5C71A 1QPQA 3WIJA 5BCAA 3WNMA 3CQ0A 3WEZA 4UUIA 1W9PA 2XM1A 2PLMA 2VFEA 3GO2A 3WQ6A 3VE9A 2WSKA 1W5MA 1IF2A 1I60A 4C7DA 3KBVA 2PZNA 5C5YA 3Q67A 1FHDA 2JQXA 2Y70A 1EHAA 5DMYA 1E0XA 4G7EA 4OJYA 1ZTVA 2GDVA 1K9FA 4HA0A 1UHVA 2XIMA 3GC2A 3UYIA 3W83A 1HIZA 4IPJA 2ISVA 4KH2A 4DF1A 2C1HA 4H9TA 5EFDA 4PTNA 1DWJM 1XIEA 4A8NA 1UR1A 3A4AA 2QUNA 1U83A 5FACA 5DQPA 4Z08A 3UY8A 3VIPA 1J0YA 4IG2A 2CLOA 4C6LA 3Q45A 5AECA 4HSOA 5JIWA 2E9LA 5ABTA 1DYSA 2PDIA 4HZMA 4RCXA 4ALDA 2PTZA 2ATMA 3HQNA 3W84A 4IMCA 3FXGA 4J5NA 4ZQOA 1KM3A 3PPFA 2DSUA 4FP1A 3GNNA 3QKEA 4XKYB 4HOWA 4HZ8A 1XWYA 4QNWA 1BRLA 1YMYA 2PZ0A 2BOFX 1WUFA 3BAKA 1PXGA 2VL4A 3EB2A 4XVEA 5AYBA 1KRMA 3ZJ8A 2J7GA 1PX3A 3EA1A 3GHRA 1JDEA 3TJIA 3L4VA 4KKXA 2DZBA 3CPRA 3F1QA 2PDHA 4DWDA 1VFMA 4ZGYA 2UBPC 5LNVA 3A13A 4RJEA 4TX6A 3SQMA 3K30A 3SURA 4AWTA 4UC5A 1W91A 1CGUA 2UY4A 2BB0A 4XWUA 1BGAA 2XU2A 3WLQA 3UPMA 4F9JA 2W27A 2HPIA 3S6DA 2WNQA 1PJ9A 1XPYA 4WY0F 4QJ4B 1XQLA 2J75A 4OU1A 2D20A 3KXQA 4MNMA 1ZGDA 3HIJA 4Q8WA 1SW3A 1HJUA 4L5ZA 1ITXA 3LXAA 3COTA 4ZCWA 1JYVA 1NOFA 2D2GA 2CLIA 3MJYA 1OF8A 2XJ7A 2V82A 4IGMA 5SWUA 3MHFA 1A0CA 4U5KA 1UOZA 1JVNA 5EGRA 4GK8A 4JNZA 2CXEA 4DBDA 5AZ0A 2CBUA 1CENA 1JL8A 2QJHA 3BURA 3I6RA 4FX6M 1Q7ZA 1XLFA 4DI8A 5HAOA 3HJZA 1NFPA 1QATA 4O11A 4KPLA 3FHAA 2FZBA 3L67A 3LPFA 4X61A 3QBUA 2OO0A 4QQ3A 1UJQA 3UBPC 5I3DA 4YWIA 3NTYA 4HU0A 4XD4A 3GX9A 4O0KA 3VABA 4HNNA 4Q8NA 3L2MA 1B31A 1XLGA 3ZJ7A 1XCWA 4OECA 4NT0A 5FL1A 4BK9A 1ADSA 1WXYA 1VC4A 1IQ8A 1UZHA 1EP3A 4AIOA 4US6A 1XLHA 4LYQA 4XTIA 2R14A 2QCMA 3VM7A 2YFNA 3VXGA 1R38A 4BCEA 1LORA 3B8UA 1REQA 3HQOA 2QCNA 4QDMA 4R5EA 3AMKA 4ZZ9A 3G8RA 2DJLA 3UJRA 5M17A 1IEVA 2OZTA 5I03A 4JTEA 2WLYA 2VC7A 3KBSA 3HGSA 5CJMA 4A3HA 2F84A 3HV8A 3CUGA 5TAOA 1BWKA 3EMZA 1E6PA 2X0SA 1EIXA 1GOWA 5CZSA 3WF0A 1P1MA 1Q6OA 4DVOA 6REQA 4UFLA 3CZ8A 1ENUA 4MDOA 3CTLA 1RK6A 3G1YA 1VJZA 3FKRA 1GG0A 3S9ZA 3TMQA 1BYDA 4Q4OA 1UW9A 4J2PA 2VZUA 4O1AA 2D3LA 5CPNA 1OZQA 3M6DA 1J5SA 4DLFA 4QS6A 5CPQA 3W1PA 4ADSA 2WSQA 3LNMA 5FIPA 4Q33A 3GG7A 4J28A 1J6OA 3NNTA 2KX9A 4DPQA 3MUIA 1XI3A 3BLEA 4C6PA 5MHBA 4UR8A 3KP1A 2PPGA 3TKFA 1S2WA 3LUTA 3TMLA 1KM0A 5DFAA 4PULA 2J9YA 3WF2A 4MJ2A 1C8QA 3AHTA 3KX6A 4EOUA 3W7DA 1W5NA 1J12A 1HKVA 3SRKA 3B9NA 4LVGA 4RDVA 4YMZA 2CESA 4OT7A 3TUUA 3GNDA 1R85A 4AW7A 3CK5A 2QUUA 1GCYA 3QY8A 2PS2A 3TQPA 5D9MA 2PDBA 3F4WA 5LXXA 5DF0A 3J7HA 3WBWA 2NQJA 2ZVRA 3K13A 3ARRA 1WBHA 3DHPA 3STGA 1VBUA 3EZ4A 1SPQA 1UBSA 3P2VA 4ACYA 3RR4A 1EA0A 1WYIA 3EX2A 3MW7A 3IAPA 2GQ8A 2W91A 3NXLA 3UWZA 1DOSA 2HROA 2P3ZA 3FAXA 2HE8A 2Z4GA 5T26A 3EBVA 1XLLA 4HPJA 1R2TA 4AC7C 4B9YA 4UFMA 4H7ZA 1FWWA 1UCWA 3VIOA 2PF0A 4C60A 2HVMA 3RO6A 1E1FA 5C9ZA 5DT5A 4J4KA 4S3BA 2GGEA 1Q45A 1VJSA 1B4KA 2XH2A 3LM7A 1PZ2A 4Z1DA 3WLIA 2P53A 4XO7A 1X1NA 3O8AA 1VKFA 2B0MA 3DOPA 1D8CA 4PB4A 4LJ3A 1MQRA 1W1A1 3O6YX 5K9CA 2J7DA 4GYFA 4JY8A 1PHWA 3LPGA 1RA0A 2FH6A 3SCOA 1UD2A 1RH9A 4H01A 4MWAD 2DW6A 3CWHA 1MW3A 4J3ZA 1FCQA 1TPVA 4FLOA 3MCMA 4CQBA 1GHRA 5IFTA 3IIXA 2OT1A 4GZEA 1SJAA 1GYNA 5FJRA 2F61A 1SZNA 1X1OA 1LL7A 4LANA 1R3RA 2X1RA 2C19A 3PG8A 2F9RA 4J3TA 1GVRA 1KD0A 4XZIA 4IP5A 4GRSA 4IP4A 3IGUA 3VIGA 1K7EA 5AYXA 3M0VA 1IIHA 2DY3A 3RYSA 4ZENA 3GRIA 3T4CA 3T0BA 3F7JA 1O95A 2DPEA 1B3YA 3GAYA 3VGHA 1VIZA 4A8LA 1PX4A 4V15A 1ITCA 2VDHA 5CJNA 2QEZA 3RCMA 2FPVA 3N9KA 3WG6A 3S4TA 2BBFA 2WCAA 3L23A 2V38A 1ME7A 2ZUWA 2I17A 3AZRA 3QZAA 5FOOA 4YNGA 4CD6A 2D2HA 5A2CA 1DJNA 2PODA 5D02A 1DBTA 2VEIA 4YTQA 1A50A 2XTKA 3B8IA 4XAZA 1TPUA 2PBOA 3WMLA 3ICJA 1JCNA 4J3XA 3GS6A 4KW2A 2YA1A 2V63A 1ISXA 3R1ZA 3BGAA 4LV9A 1VP5A 4WDXA 3E5PA 1ME8A 2VC6A 4AYGA 1W9VA 3WZ0E 3S2JA 3F2CA 1XP3A 1TZZA 4QXIA 3QHNA 4E4FA 5M1TA 3T0DA 3VGEA 2NLIA 2A3LA 1TWDA 3C0QA 4DUWA 1JCLA 3UZJA 1EJWC 1V77A 2WPGA 4U5IA 3WQOA 4GI9A 5K9XA 2A6LA 4CD8A 1J10A 4ZOAA 2YDSA 3EAUA 4PR4A 3TTSA 1QBBA 2ZX6A 4C6IA 4G7FA 1UR4A 1LCOA 1UZ1A 4LOCA 1ZBWA 1GOIA 1PV8A 4AZCB 3IGXA 1E0VA 1YTDA 4Y2WA 2C1IA 1TE6A 3NIYA 5HUPA 5L9FA 2HJPA 1JYNA 3CZGA 4D6CA 1B3WA 1TA3B 3M0LA 4J40A 2X0YA 1BLIA 2VFFA 1FWIC 3DH7A 4WKHA 2W0UA 1I2RA 2GJLA 4TR9A 5G2IA 4F0HA 4QHRA 2ZRVA 3VI2A 3V16A 1I2OA 5IM51 4DXVA 3GH5A 3G1HA 1UG6A 1TV2A 2W66A 2YZ5A 1M7PA 2DT3A 7REQA 1U1UA 3HN3A 3TV8A 2X7WA 2YDAA 1GZJA 3A64A 4O50A 2C71A 4PBGA 5I5RA 1KRCC 3D3AA 5IOBA 3NSMA 5FI8A 2NXGA 2GGIA 3NGFA 5FEXA 3UWVA 1IWPA 1K9DA 3P81A 2WMHA 4IH3A 4HVXA 2VGIA 2BVYA 3CJPA 3QPZA 1DXFA 2OCZA 2E1WA 3S5YA 3A3WA 3W7CA 3W75A 4H6QA 5JH1A 2A6NA 4IIEA 3VFCA 4HU4A 3HV9A 1ZAHA 4ZO8A 3ISIX 1ISZA 2XSAA 1XD1A 5GJPA 1NY1A 4KFNA 3SBFA 4XAGA 2FZNA 1B3XA 1MRAA 5D9OA 1ML1A 3BAIA 5DY2A 5A6MA 4CU8A 4CQCA 4UOJA 1CLKA 2A85A 1RD5A 3K8MA 3PS7A 3LCLA 2X1SA 3AHYA 3PTDA 4O57A 3TX9A 3G1FA 1V6TA 1Y0EA 4V1XA 1UA7A 5KZ6A 2WNNA 3QM3A 2D73A 3U48A 1PIGA 1BVWA 3H4XA 2NXIA 3UERA 3BANA 3HBLA 4BWLA 4ATLA 3BQ5A 3WDQA 4QAIA 3TW6A 4HHHA 2YZRA 4AG0A 4PUUA 3AMGA 2Y88A 2ZZ2A 1TIMA 3A4XA 4MFEA 3ITTA 3UA3A 3ABZA 3N17A 2YR1A 3W00A 5C2GA 3WLMA 1S5NA 5DBTA 2PWFA 5DCBA 4JYDA 3UWYA 3G0XA 2FJUB 4YHGA 1X6NA 2GJXB 4JAWA 4GGHA 3WDHA 4LAOA 4GOAA 5A6SA 5HANA 2X1IA 1E1CA 4OQVA 4M56A 4EF9A 2Q3RA 3L5LA 4HA1A 3W7KA 4DYEA 4F0MA 4FXSA 3IJ9A 1E6NA 3VCCA 5HWJA 1EDTA 4B5WA 3ANVA 4IQEA 3RU6A 3OGSA 3BMWA 4KCWA 1ZAJA 3NEVA 3QSRA 3MI3A 1SJDA 3MQTA 4QTGA 3C2RA 3LXBA 3VNZA 3GG8A 3VIIA 1GOOA 1IYXA 3P5YA 3SCTA 2CZVA 2JIEA 4GQRA 4LRTA 3T1GA 3APYA 4B16A 1J2BA 4YS1A 3EOOA 4HD5A 3T0TA 1M03A 1CGTA 5FAJA 4EXQA 2QJIA 3STPA 4PSPA 2V5CA 3W1UA 2BY1A 4JKLA 5I3KA 5CPLA 3L0KA 1L0PA 4D6JA 1VRDA 3QZEA 4FNPA 5KMYA 2PGRA 4EPDC 2Y4SA 4HT3A 2NVCA 3ITLA 1PO9A 3G77A 2EEXA 5D2YA 4I9TA 4AX6A 4CLMA 1VS1A 4IT1A 3ARPA 4CU6A 2DFAA 5LXEA 4DZ5A 3SRFA 2VEKA 2VFHA 5CBBA 3RCYA 1WOBA 4M24A 1H09A 5ABGA 4L7ZA 4QISA 5TF0A 1UKSA 1J11A 1EGZA 3DEQA 3TYZA 2XVKA 2HXUA 1HJWA 2YJQA 3OHIA 4FXJA 3FY1A 3W7OA 1M9HA 2G3JA 2D2OA 2JF6A 4O8RA 4D1IA 3LCIA 2UZ9A 1DIKA 4HOXA 3MANA 3FS2A 4UFIA 2CLHA 4MVAA 1GYLA 2QCHA 2RJGA 1BFNA 3EA3A 4H9ZA 3QV6A 4G9PA 3WK0A 3WQPA 3K2GA 1A5SA 4QSFA 1V3JA 4YJ5A 2O0TA 5BOFA 1R0MA 5KETA 4M6PA 3L4YA 3WKZA 3CMGA 2E3ZA 3MWAA 3IJLA 3WL0A 4FR6A 3VGDA 3MY9A 4KETA 1KWGA 4KESA 1RP8A 3T2OA 3W7MA 1ZZMA 2VEPA 4S39A 3QOMA 4CKQA 1KA9F 4OV4A 2B31A 3KCLA 5E1QA 1MFVA 3B0VC 2X40A 2P5NA 3WCZA 4Z2GA 3ITYA 4BHYA 2PDPA 4E8GA 4PMZA 5C6MA 1M53A 3NM3A 2JFEX 3SRHA 3W37A 2ZZ4A 4NZCA 3DG6A 1TV4A 3G6LA 2XIBA 1WZLA 3ZVIA 3W82A 1EOKA 2PDKA 3QF0A 3O6DA 4XBJA 4WRHA 1W3IA 3GLCA 3U7BA 4JTHA 3UWUA 4D8ZA 1TTIA 5F1UA 1PSCA 1W3KA 1GNXA 1YADA 2I9UA 3WQCA 1LWIA 4ZTYA 1POKA 1EGMA 4JD4A 3CQIA 4FZIA 4GFSA 2J9XA 3DHUA 4I7UA 3H70A 2FTPA 1B0IA 3AYTA 1CXEA 4G7EB 3N13A 2FPTA 3WENA 2Z00A 2CKSA 2HS8A 2Y5JA 1RR2A 4NI3A 2GQ3A 5IFPA 1HTIA 1MZRA 1SFTA 1WDDA 3WD4A 2NV1A 4DB7A 1RCXB 1XJBA 4Y7EA 5I23A 3FA3A 4PRRA 1UD5A 4BZYA 1IT7A 2Q8LA 4IG2B 1H1NA 1TR9A 3WDRA 1HKKA 2FZ8A 1GPWA 1TO3A 2I5IA 5LZLA 1QOXA 5BMXA 4AVOA 1DKWA 1CNVA 3E12A 5EB8A 4LU0A 1TPWA 3W74A 3PF3A 9RUBA 4F4RA 3MDWA 3RM4A 1U1HA 3LQGA 3TAOA 3BG5A 3F4NA 4W84A 4MKNA 1KCXA 2PD9A 2BXZA 3LLXA 1DJGA 1BRLB 1PHQA 4PC8A 3C61A 5IDZA 3TCEA 1J8VA 4XZMX 4DJDD 4UZUA 1FWRA 3NXFA 3RPMA 4K6AA 2R82A 1SSDA 5CCZA 3O15A 4Y9OA 4UCGA 3G1VA 2FYMA 2FHCA 3H54A 3QLLA 3GYEA 4W87A 4C7GA 3XINA 7XIMA 1E70M 2FGZA 2Z1XA 1YW1A 2E67A 5DT7A 1TPH1 2IW0A 4RPPA 3VGFA 3BO9A 3BVJA 3TCSA 1M6JA 4W89A 5FF3A 3WBYA 1NAL1 3PWGA 5HMEA 1W2PA 3S2NA 5DEZA 3LMZA 3H22A 2V6AA 3V3WA 2O4QA 3GG1A 4WZHA 2GYIA 2NSOA 4L4MA 3SN4A 1JZ4A 3THCA 3MMUA 4XD5A 1W9DM 4UB9A 1VQTA 1QK2A 1FHVA 3CUZA 1UWSA 2EG6A 4ZQNA 3WQFA 3ZQ9A 1QFEA 3KOZA 3N29A 1EPXA 1AH0A 3P62A 4H1ZA 1UH3A 4IX2A 1UQZA 2C79A 5AKQA 2CHRA 1JCTA 4FNTA 3KRBA 4F8XA 1ZJAA 2P8CA 3AROA 5DMMA 2ADAA 5KZMA 2W6RA 1H7NA 3RFAA 4GJIA 3RAOA 3T6CA 1EJ7L 1EDQA 3DHDA 3NO3A 1XFCA 3CL7A 1LL6A 1WZMA 5JBEA 2PTYA 5JXQA 1IGWA 3N04A 5ABFA 3ZT7A 2YXXA 6TIMA 5BRBA 6CGTA 3QQ0A 3AJXA 4TO8A 1REQB 4I7WA 1WV2A 1EWDA 4GMEA 2GJPA 2WMKA 1KKRA 4LBSA 1HJQA 2EHHA 4WOZA 3WK2A 3GDTA 1QW7A 1H11A 4FA3A 1A5NC 3UJFA 4UTTA 3B4UA 3LCGA 2J62A 2ZRYA 2F2HA 3LGEA 3UGRA 1NVMA 1BVZA 1RPXA 3FYPA 3EXRA 4BS0A 1HUVA 4O13A 3MDUA 3R94A 4JX6A 2PB1A 4HA4A 4G8TA 5EY5A 3ZZ1A 3PVFA 1Q3NA 4CEUC 2XVLA 5CGTA 3C6CA 4FO4A 2RHGA 2QJMA 4DO7A 2YL8A 2WV8A 6REQB 3GIPA 4R7WA 5IHRA 1L6FA 2AAMA 1QBAA 1EYWA 2ESCA 1WAWA 1WXZA 1E6RA 1SMDA 3M44A 3WLOA 1QNOA 3B8DA 1EJVC 2YA0A 1FCUA 2HEJA 4D6HA 3UQNA 3CMJA 1DORA 2ZYFA 4TOQA 1KGWA 3IJDA 3KWXA 3B8WA 4HMDA 4ZOBA 3QMSA 1FDZA 4LY4A 3HM7A 3KE0A 3KZSA 1EYEA 2IKHA 2AQVA 5CPMA 3URNA 2F6KA 4W88A 2VFDA 1GTHA 1E6QM 1NWSA 1N8FA 3GYCA 4FAMA 3P60A 1CGVA 5BW6A 4U2YA 3OU8A 2VCBA 1EJRC 4MWAA 3NQGA 4RL3A 4GGBA 3EWYA 1KFKA 4DPPA 3N14A 1EWEA 4DZHA 5A6AA 5K9DA 3IJIA 4BQ4A 4MYXA 1IXNA 4QG9A 5FKYA 2ALDA 4OE7A 1C7SA 4F48A 5E93A 1LQAA 1NFGA 4XBKA 4PA8A 2PDGA 1VHCA 5F2MA 1TYGA 4MPKA 1TJ1A 3OEXA 2PLJA 3DFOA 3N2MA 1RQBA 3QLDA 3VM5A 3BARA 4MB5A 3JRKA 1Q6LA 1V03A 3CUJA 4V33A 1JULA 3UWQA 5EMUA 3MVIA 3OQ8A 2OKOA 4PUEA 3NSXA 3GNXA 1S2UA 3DX5A 2FZDA 4K39A 1CT5A 3VCRA 5HMFA 2VRQA 2OX1A 1U30A 5A8PA 3F2BA 3IWPA 2EF9A 4QG6A 3WLJA 3C2EA 3R0UA 4Q6XA 5EL1A 3LHVA 1W32A 3N15A 2IKJA 1DL3A 1YQ2A 2X42A 3LI0A 1RJPA 4A3UA 3Q37A 1DQXA 1OFPA 1UH4A 4TQTA 3TC6A 1JCYA 2WJZA 5BXTA 3QSTA 3W1LA 2VC9A 3GTIA 3WYZA 3KHDA 1K8ZA 4QITA 4M82A 1EC7A 1SQ7A 3MZ2A 2FZ9A 3URQA 3UXLA 1M41A 1GG1A 5K7JA 2PGEA 2P3EA 4X60A 3W2NA 4CD7A 3LNPA 1EC8A 2FKPA 3GBEA 1E0UA 3TFXA 3EWZA 2VC5A 4R9XA 4WX2A 3R25A 2CLEA 4QCEA 2WSRA 1JPHA 3GHUA 1ZAIA 1QK0A 3LHWA 3W7IA 1KM2A 1G4TA 4ADUA 4AIBA 3KRUA 1TV8A 1WP6A 2HTMA 3RLHA 4GY0A 3WQGA 3EDJA 3BSGA 3K4AA 1BPLB 2PDFA 1HL2A 4O4VA 3UNDA 1B2YA 2WNWA 3B05A 1JQVA 2PTDA 5LA0A 4R7JA 1F05A 3G2GA 2Y24A 3T07A 4UQAA 4ZOCA 1RAKA 4REQA 1W1TA 3EKGA 1KM5A 3MCOA 1ICSA 2CBVA 3W7QA 1TUXA 3K46A 1DIEA 3H2AA 3LLFA 4FOUA 5E0CA 3B9EA 4I5XA 4PRTA 5AHMA 4URIA 3CHVA 4PCTA 1XDMA 1XH2A 5FF4A 3S6TA 2HPMA 1E9ZB 3E02A 5CGMA 2P0OA 5IBXA 3SRDA 1XDLA 3DIPA 3V5OA 1OEPA 1XKYA 4IWWA 1LWHA 1YE6A 4TIMA 1P0EA 1GVSA 4LALA 4YTRA 3ABOA 1E4MM 3IGSA 2XVPA 3LGGA 2AMXA 3LG3A 1UQYA 2HXTA 1F61A 3PBVA 4L4PA 4DIAA 2PMQA 5C9XA 3I3BA 3CB8A 4D8LA 4K8HA 4ROQA 1GQJA 4XZNX 2NV2A 4HPHA 3F4DA 2JALA 2QIIA 3SSJA 4I9JA 2ZQ0A 4GIRA 4RV3A 5HUOA 3E49A 2ZX9A 2VKZG 4UQ9A 3MTWA 1ISWA 2PDMA 1TRDA 4DJED 4O52A 3E6EA 2WM1A 2DQXA 5A95A 2VHLA 1VCGA 4LB4A 4C6MA 4NU7A 4ICCX 3S5OA 5BU6A 1P1XA 4DUOA 3W27A 4FIRA 5G2WA 2O9OA 3CQHA 1QNSA 4JTCA 2G97A 2C18A 3QW4B 2NWRA 1IEWA 1C29A 2ZUNA 5IRPA 1XBZA 3UXAA 5LIUX 4WSHA 1R87A 2VWSA 3M7SA 4LFYA 4ICNA 3H4GA 1ZS2A 4PODA 1MXSA 2XFYA 4FALA 1ZL1A 7REQB 1OADA 4Z0SA 3T78A 1PTAA 1Q5MA 2G8ZA 4KERA 2BNJA 4R9OA 2CCRA 1IEXA 4NX5A 3TYUA 4Q7NA 4B3ZA 4UFJA 1PZ0A 3FFSA 4MUPA 1O12A 3P14A 1FP9A 1C8VA 1TB3A 3W87A 2C15A 3NYDA 1LUCA 3OA5A 4BWLC 3TSDA 4CEXC 1S3HA 4K37A 2WMIA 3MP3A 4JN6A 1A53A 3CAQA 1IGSA 2A2IA 3C4UA 5CC3A 3A24A 4WQ6A 3AXHA 1ME9A 3TN5A 4EXAA 1R5YA 4GNVA 2R6OA 1GJUA 1W8SA 4LAZA 4F2BA 3W53A 4EAYA 1BSLA 3T8LA 3MPGA 3N18A 1KV5A 4FOKA 1W1ZA 2Y7FA 4LX4A 2F8QA 4DI9A 3KL0A 4P7NA 2WW5A 1QT1A 3M0JA 3QPEA 2ISFA 2WO5A 3H12A 1E55A 1D2KA 3CLWA 1KXVA 1HW6A 4JTRA 2ZE3A 1C91A 1XQKA 4HPNA 1QPRA 4GZJA 1VBHA 1X98A 3BCFA 3AO0A 3B8SA 4PBFA 2ISSA 1QAPA 2PE4A 2WXDM 1V7AA 2EXOA 3M07A 1R86A 2VM8A 2POTA 3ABRA 4M7TA 3W7HA 2JE8A 1W3JA 3CHFA 4MKVA 3S42A 4O0QA 4GQ0A 2GVYA 4AWUA 4M5PA 1W1PA 4ACZA 4YXGA 1E1CB 4X9SA 1OFRA 1Z48A 3GAKA 2FMOA 1WDQA 2ALRA 3O0FA 2J7HA 2OLHA 4YVXA 4JHOA 4MY1A 2GOUA 4HTBA 3WK1A 2EBNA 2O7SA 4JICA 2MUCA 3A3HA 3DDMA 1R46A 3DFQA 5CBJA 1JDDA 3L2IA 4NKCA 3CPGA 1U5VA 4TXEA 1DHKA 3QEZA 2FLIA 3C8NA 1U33A 3B8VA 1W3LA 3KCJA 9XIAA 2JEQA 1U2YA 2XH4A 5KZDA 3EOLA 3SCNA 3PUOA 4RZ6A 5C2CA 1A3HA 3CH0A 1H49A 1FA2A 2CERA 4DZIA 1FWNA 1UP3A 3LQLA 2WYSA 3A4JA 4GYKA 4ILSA 3LCFA 2PDJA 2INFA 4UQCA 3T81A 3QKZA 5A6JA 4TU1A 4Q4SA 3UCCA 2TMDA 3VYLA 2E4TA 3S2CA 3ZR6A 3NJ3A 4FLSA 4QSHA 2X30A 1C9WA 1QI4A 4GJJA 1UR8A 2Z6IA 1SZEA 1JI2A 3O63A 4RXFA 4MLRA 1Q2SA 3GKAA 2EPMX 1CGYA 1W5OA 2X2GA 3EXTA 2D69A 1Z6KA 3KVMA 4X0NA 3WLTA 3URAA 4CCCA 2A7NA 4YTSA 5U4NA 1G7VA 2C91A 4LVAA 4OFCA 3AIWA 1D8WA 3T05A 5A8NA 4YCOA 2BP1A 4S3GA 1E5NA 4JTUA 1VRXA 1D7FA 4AWEA 4W93A 1J0IA 1M3UA 4C6QA 3QR0A 1BG9A 2J7CA 1HKJA 4EPKA 4OGZA 4PFHA 4A4AA 1L6SA 3SUWA 2BX7A 5I7GA 3L21A 3VCNA 9CGTA 2QYGA 3USZA 3OYZA 4GBDA 4AY7A 4TX8A 4AD3A 3W02A 1S1RA 4H3DA 3KL3A 4UWMA 2VP8A 2O56A 5CSYA 2BS9A 3MHGA 4NSBA 5JMUA 2ZCGA 3W38A 4B15A 4F9DA 1WOAA 3BCJA 1HL8A 3PFRA 3GU1A 4QEHA 2FQIA 1YNQA 4ML4A 2QZRA 3UVAA 2FJKA 3RRAA 2DSZA 2BOGX 2E5DA 1R30A 2HBXA 2J8TA 3PZ9A 1G6CA 3M64A 3RF9A 3N4FA 1THFD 3ZOAA 3LPOA 1KBIA 3IVTA 5F4XA 2EG7A 4R88A 4UMBA 3WJYA 3BOXA 3CL6A 5LHEA 4NHVA 1EJSC 4U31A 1S3TC 4L4OA 5LGXA 2QF7A 1LRNA 1BQGA 4TX9A 1UMLA 2ISWA 1VF8A 3REQA 3IACA 4IOTA 5HDRA 3SUVA 2Y61A 2WSYA 4X63A 3N12A 4DJDA 5T8GA 5G1YA 1SU5A 1Z89A 2C6QA 1KXHA 3KW3A 1XYZA 1K70A 1XW8A 2PWHA 2XZ9A 4Q22A 4DAFA 2ZA3A 1J93A 3BJSA 1W5PA 4AD5A 1LZOA 1H7RA 4JKMA 2WHLA 3CIWA 1DJZA 1WNOA 2B7OA 5T91A 4KGLA 3VPLA 4ERAA 4IMAA 1SGJA 3QW3A 4WJEA 4CNUA 1BD0A 1XYAA 3FJ6A 1A5AA 5M2FX 2VUYA 3E74A 4NNCA 4F0SA 1IR2A 1JCJA 4LYKA 1QI3A 3W0KA 4HN8A 3W9ZA 5A94A 1QWGA 1OK4A 2O9TA 4WKAA 1K7FA 4ZQCA 1LG1A 4I5RA 2EKGA 4ASTA 1Y5XA 3W2MA 1V51A 3FSTA 3WH9A 4P5UA 1DIDA 3GC4A 5F7UA 1JI1A 3U57A 4ZBCA 3VTRA 1JZ3A 2B7NA 1TV5A 4O8AA 1KLZA 2DZVA 3N4AA 3LTSA 3PB2A 1PBGA 1JNEA 1XYMA 2UWFA 3VZXA 3GZ3A 3R8GA 2Y8VA 3G3MA 3U5UA 1BQCA 1MQPA 1LRTA 1H5VA 3U9IA 4JIQA 1L8NA 3IIPA 4AD1A 1A49A 6A3HA 4G6CA 4KWUA 5F2IA 3GM8A 1FH8A 1D3CA 1EXPA 2JIWA 4JYEA 3LN3A 2X09A 2VCAA 2GZXA 4ADTA 1QRQA 1VZWA 4FMVA 2GWNA 3PJUA 4ZODA 2GGJA 2V69A 1R7OA 3UZYA 5BXPA 1Q4WA 3VNKA 1NQ6A 1YE4A 4OKDA 2CHOA 2O9RA 2GUBA 1VH7A 3LENA 3SJNA 4I5UA 5LNRA 1PVNA 4S3AA 2OSWA 3M46A 1Q4NX 1KXTA 1JD9A 4O4WA 1TMHA 3TIMA 1KGXA 3N9RA 5D2VA 1HL9A 3GY1A 1KC7A 3WLKX 3NL3A 3TP4A 5G4HC 1TTJA 4JEQA 4GI6A 3LMYA 1JQXA 3OQEA 2ACQA 4M81A 4A05A 5FD0A 2E6YA 1XRTA 3TU9A 3DBPA 1WDRA 1W8GA 4UTTC 1KM6A 1DP0A 1C8XA 1DXEA 3F5LA 3UWEA 3DUGA 3QYQA 3B9AA 3FN9A 4HSNA 1U5JA 1AQHA 3N11A 2PWVA 2BWGA 1X96A 3DAQA 2BY0A 5D8ZA 1V0MA 1PB0A 1Y65A 1TUFA 1XRFA 3PG9A 4Z42C 1YKWA 1ZCOA 2UY2A 4M7SA 2P10A 3L7RA 5ABFB 2IQ0A 3L0NA 2GWGA 2C13A 4JTJA 3FGCA 1QCWA 4GINA 2FHBA 3UWWA 2DEPA 3I7RA 2ZDSA 1JJKA 4QS5A 4GY7A 3EKLA 2PBGA 4Q8MA 4TVDA 3OP2A 5I3FA 4GYJA 1UZ4A 3T42A 4PMUA 1XLKA 1QJWA 2YL9A 5HNNA 5HATA 4L1WA 3M9YA 3JU2A 5CG7A 5A8GA 1MMFA 2DSVA 3OLDA 1EUNA 3BGJA 1JCXA 4MUZA 2E0PA 3QV9A 4IXHA 3H24A 4CNPA 1C3FA 4KWOA 2Z2UA 4D8AA 1G01A 3S8HA 4P2VA 2VR2A 3V75A 3PZNA 2BMBA 5EA9A 3AS1A 4DXXA 5HJXA 5D30A 5HQEA 3LSCA 3EB3A 3PZVA 3BLDA 3A21A 4L80A 4MWAC 3NA8A 3OTRA 1NQKA 5HJYA 1JFXA 2E6AA 2IPFA 4B5NA 3W3OA 3BAXA 2H9AA 4HYRA 3NZGA 1HGWA 3POHA 2X0HA 3PUEA 3P5ZA 1EBHA 3R8HA 4YN5A 3C2FA 2Z27A 4LW7A 3R43A 4B5UA 3E1F1 2VXNA 6ALDA 4YCPA 3UESA 3CUXA 2AQOA 3QGVA 2NQHA 1LQ2A 2TRSA 1RJRA 4LEQA 3VDHA 1Z32X 3BGGA 4GNJA 2H3DA 3MV01 3FNDA 3SCVA 2W61A 3IIVA 1GJPA 1GYMA 2OO6A 1TV3A 4JHZA 1FH7A 4ZOEA 2XYLA 4MWAB 3HGJA 4NZ3A 3R2GA 3PZOA 5DXXA 4IFRA 1IT8A 1FH9A 5I3JA 2HBVA 2V3GA 4QDWA 3KS5A 3ZO9A 3U8GA 3THUA 3B0XA 1PTDA 3EOUA 4BR1A 2HK1A 3I4KA 4US5D 4NG3A 3PBYA 1A3WA 2QUMA 2F6XA 1HNYA 2YDRA 5I2UA 4Q8UA 5BRPA 3PWAA 3C8FA 4FX8A 2VQUA 2ZX5A 1PIIA 1HX0A 1KCZA 3RNDA 1QDSA 4PMVA 2ZX7A 2EO7A 4OHQA 3ATYA 1V3HA 3ZT6A 4W4QA 4XVDA 1JPMA 2J6VA 2ZRZA 3W85A 3AICA 4E2DA 1MO0A 3ALFA 3E0VA 4ZFCA 3ZS4A 3GIQA 3TQVA 1T7LA