2OA9A

Restriction endonuclease mvai in the absence of dna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
246
Chain Sequence
MKSMSEYLNLLKEAIQNVVDGGWHETKRTGIGKTFEDLLEKEEDNLDAPDFHDIEIKTHETAAKSLLTLFTKSPTNPRGANTMLRNRYGKKDEYGNNILHQTVSGNRKTNSNSYNYDFKIDIDWESQVVRLEVFDKQDIMIDNSVYWSFDSLQNQLDKKLKYIAVISAESKIENEKKYYKYNSANLFTDLTVQSLCRGIENGDIKVDIRIGAYHSGKKKGKTHDHGTAFRINMEKLLEYGEVKVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restriction endonuclease MvaI is a monomer that recognizes its target sequence asymmetrically.
pubmed doi rcsb
source organism Kocuria varians
molecule tags Hydrolase
molecule keywords R.MvaI
total genus 70
structure length 246
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oa9A02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2oa9A01
2Q10A 2ODHA 2OA9A 3IMBA 2ODIA 2OAAA
chains in the Genus database with same CATH superfamily
1U8QA 4YC2B 1EHLH 4LAJH 3V52L 5C2UB 5J1AA 1YQVL 1HNFA 3SY0B 5CLTA 2F2HA 5JA8B 1YRKA 2BSSA 3A24A 1I1AD 4XMPL 1F6LL 2N59A 2VXQL 4U1LB 2GIYA 1P4BL 3L3KA 4HJIA 5D4IA 4ODTL 3HC0B 3FSOA 1P84J 2BNQD 5DI8B 1IGCH 1FL3B 4YBQC 1F3RB 5BZWB 4AW7A 1QATA 3LDBC 4Z3TA 1N12A 1QSEB 3FN0H 2P49B 3OM3B 3RVTC 3SOBL 1TETL 3FU0A 1CE1H 1MCPL 5FV2A 3WEMA 4I85A 4WGVB 3PJSB 4XP4L 4KAQL 5C07E 3TO4A 2LAAA 4TOYL 5KS9B 4GSXA 4ZS6D 2APSA 2GTWA 4HUUA 4JREC 1SZNA 4GLRI 1ED3A 1MWAH 5HHOD 1IIKA 4LSTL 5FYKE 3QXDA 3DX6B 4IIZA 4XO5A 4NO2B 4IK6A 1MJJB 4KKAD 2G4EA 5FUOL 2IDFA 4RFNC 1CLVA 5C0JA 4KITB 5KAQF 4NNPL 1F4AA 1NDGB 1I9RH 4I18A 4B9CA 5AEAA 4UOW0 1PVHA 3O6FA 4NJ9H 1EXUA 2CK0L 5DURD 4KNQA 4AK2A 3BH4A 5FM8A 3L1OL 4BHUA 3D0VA 2BSED 3BT2H 3HCVB 4MNHB 1KFGA 3OKDB 4TYUA 3UTZA 2ZXWB 3M86A 4H8PA 5HVHC 3EJRA 3H9YA 3MUY1 4XNZB 4BE5A 4TTDD 5IB1B 4YSQA 1FZOA 3VNYA 3HN3A 2JLPA 2R0KH 4PB0L 4HETA 3TZVD 3JTTA 4ZMTA 1O9VA 2DS4A 2W8CA 1UM4L 1HZKA 1T4WA 2WIMA 3M1OA 5I5RA 4FNRA 4UOQA 2E7LC 3EZJB 3LIZA 2X2HA 2XVKA 4GQZA 2YS4A 2NPLX 3O6FD 3PGCA 1Z5LB 5HD8C 4OV5A 2ZJSH 3MBEB 3CMOH 2HFEA 5AYQA 1JV2A 3OZ9L 1OGPA 3VRJA 3WTXA 1KTBA 2NQ3A 5C09D 3VVWA 5EUOE 1X5ZA 1WBZA 3FO2A 3HS0A 1HS6A 4Y5VC 2D73A 3PL6C 4HD9A 4TSAH 5I16B 1MLBA 1R17A 2B5IC 4CW1B 1P6WA 5F7HA 1OCZB 1Y18B 3QQ3B 3NZHL 2VITB 2EIKB 3GSOA 4DEPB 2CK2A 3P2TA 3VM7A 4Z0XB 4LASH 3BDYL 2HX9A 1IGMH 3DBSA 3DURA 5FV1L 1KPUB 3KDPB 1QFWH 3SKJH 1ASQA 1JK8A 1IGJA 1SBBA 4FQIL 4PTTB 1DJIA 2C1PA 2DM4A 3LRSA 3EOTL 4PJ9B 3T09A 5IB2B 2CHXA 1MLCB 1SPDA 4KVCH 1QFOA 4PJEF 2HRPL 4FNTA 4KI1A 3RIFK 1HHJB 2K4AA 4NEHB 3F84A 3WNJA 1EZVY 4ATTA 4D0CA 1S7WB 2NDGA 3DJSA 4KH9A 1KACB 4NIYE 4XP6L 4LPWA 2PYFA 3KYOA 4DESA 5BQ7A 2O5YH 4KZ0A 4CJ1A 1CC3A 2GUOB 4HU8A 1EEYB 3QZMA 3VWKA 1FYTB 4AM0B 4I18B 4J3OD 2BSCA 4TNEA 1M7DA 3SGEH 4JKPL 4F7KA 4MKMA 2BP0B 3MBXL 3VD1A 1F8TL 1QBLL 5SWSE 3RTLA 2BDNL 3QJXA 4FQHA 3LPWA 1FLTX 4UQCA 2YAHA 3RGVB 2DYRB 4D9LH 1GZPA 3QEQD 3QRFM 4KKPA 3VDCA 4AV0A 1KJ3H 4FULA 4PJCB 1MFAH 1GY1A 1WO2A 3AXHA 4MA7L 4U4IA 2VO5A 4Y0GA 4C55A 3HI6H 5KYYA 4XXDB 2GK0A 4AMXA 4X7SH 4ECNA 3TVMD 5EZOL 1HIML 1WF5A 3GSNL 1F13A 4PQXA 2VLLB 1JN6A 5ACZA 4P2QB 4ZX3A 4NGHH 2VXSL 3WN5A 5E8PA 1IU1A 1UJ3C 4FXLA 3EGSB 5A7EA 4MNQE 4O2EB 1J9CT 1MJ7H 2F9BT 2F7IA 1N0XL 1A7QL 1FG2A 2BLFA 1PVUA 3L3KB 4P4KC 4MDIB 2BCKA 5B3NA 3WXWL 3NFSH 5GGSA 1KTLB 5H35A 2AQ2A 4XX1G 1V8HA 3ECVA 4KTDH 3CZUB 2DJSA 4PW9A 1RPUA 5AL0A 1KULA 1WBXB 3B2UD 1OAKH 4KY2A 4PJGA 3L4WA 1MI5D 4J7RA 4RFNB 3UCQA 1DZBA 4L4TE 5E2TL 4RSYA 4G1MB 4PV8A 4G8GB 3S2AA 3NJGA 4F91B 3O6ML 5EEXA 2J1XA 1CGTA 3BKYH 1P6AB 2CO2A 4BUGA 2F8OA 2FQFA 2R1WA 1GZHC 2D4DA 5CCKH 3LPPA 3MCLL 2ZWSA 5DJ6A 4KKAC 3MV8B 1K2DA 3DJZA 2ZXEB 5EU7E 5HHME 3ZTDC 1A7RL 5E4OA 5DQ9A 2X1XR 1T2QH 5I8KH 4E0RB 3KPLB 1ACXA 4JRXD 4ZS6C 1JZEA 4RRPM 2FATH 5JDSB 3KPSD 1TVHB 4PJGB 4M5ZH 5AVTB 3RY6C 1CO1A 2OR9H 1OTTD 1AOHA 3ALPA 3S37H 4ZOBA 4F9PC 3ZYIA 4YDZA 3GFUA 4MBRA 4IBTA 4GI8A 3MLPA 2Y06H 4IGBD 1BLIA 3KGRA 1BYOA 4FYTA 4V1DA 4JFPB 4PJBA 2NX5D 1RZJL 3IFLH 2HT2D 4UQ2B 2FEDC 2JCCB 3WNNA 3MODH 2I9TB 5FGBC 2FZ3A 2ALWA 1M1XB 1S7TB 3PL6B 4KI5D 1I3RA 1RZIA 2VW7A 3K7UA 1P7HL 1QLEH 5FW7A 5L4MA 1LEGB 4JVPA 3VI3F 1ZLDA 2LGNA 5CP3H 4NQDD 4OVVA 4XXDA 5GSRB 3X3FL 4JFFA 4PJCA 4X5RA 3CPUA 3V52H 1LE9A 3AU0A 4AMWA 5JORA 2YGPA 1V7NL 2Z31B 5D7IF 1N3NA 4DVRL 5F97E 4ZXBB 4PRNB 3RNKB 5G5DA 2HKHH 1T66D 1XF5B 3D0LA 3QI9D 4RGMB 5HYJE 1B4JH 2F54A 3DX1A 2YSSA 3VQLA 5I5JA 2WQXA 3QORA 2ZXDA 4L0PB 1YYLH 3RKDC 2R7EB 3BE1H 4MQ7A 4OCXH 5J6HB 3GMMB 4J6RH 4JM4H 5FM4A 1NKGA 1U93A 4JM2A 4XI5C 1PAZA 2A0LC 3SD2A 1HE7A 3O0RH 1D5RA 4TNVK 3FRPG 1JXJA 2EKSB 5TE7L 5ADOL 4GW1B 1U8MB 3V4PL 2A6DB 2FUQA 3L8QA 4KJQC 5GQBA 1LK2B 3OXRA 5ABAA 3VXPA 1SHWA 1FGVL 1IE4A 3DHPA 3NBNA 4JQXA 2X0VA 4PTTA 4QO1B 4MJIB 5IQ7H 3CU7A 3IXTA 2J55A 3UC0L 4G6JL 3MXVH 5DUML 4M7ZC 5HSFA 4PJGE 4M7LH 3H42L 4UAOC 5B39B 4L3EE 1WC7B 3TV3H 2LHAA 3FQWB 1ILSA 2XHNA 2EDWA 2IWGA 1QVOB 3NGBC 5C6TL 4HH9A 4JG0L 1HL8A 1U8IB 1BP3B 4LHQB 3BFOA 2X9XA 4MAUH 4ODSL 3U2IA 1PU0A 2D7TH 1MLBB 4PRIB 1CVSC 3KVDD 3K46A 2WQSA 1NGZA 4IDJL 3GZOA 4QHMA 3B3IB 3GBNL 5BOPA 4R0LB 4AQ1B 1KLGB 4HEMA 2J4WH 2X70B 4WI8A 5IBTL 3VRJB 2AFNA 3D2UD 5B1KA 1CI3M 4P5TD 4IW4C 4K71C 5CP7A 3VXMD 3D48R 5J11B 4QKTA 2QVIA 4TPRL 4YBQD 3RURA 1T83C 3QFJA 5JHDE 3S48A 3TCLA 3QGVA 4Y4HC 4AC2A 2WZAA 4P9MH 4GRLA 4HCRA 4ENZA 1TQVA 3NSXA 3T77A 4F5CA 5DMIL 1AKPA 1QTYT 1MHPH 5IB1A 3ZHDA 1N5YH 4N5UA 1MWAB 1CXKA 2E4FA 3CFTA 5F89B 2IAMC 4Z7VE 1MPAH 2KERA 2NY6C 3HCVA 3KEDA 1I82A 3NRQA 3NSJA 4FG6C 1B2WL 4IK7A 2J1KA 2GK2A 4QCIB 3FUDA 2MNUA 3MLYH 4XNYL 1W0VA 5HHQA 5I8OL 3JWDL 3U0TB 4AYGA 4WEUD 4F8TA 2QLVB 4FQPA 4ZPTA 3V4VB 1NFDF 3MLUH 2UWEB 2EVGA 1K6QH 3IWUA 3NCJL 3KXFB 5L6YH 4FRWA 4K5PA 4B9IA 1DEEA 4KXZI 1G7MB 1ACZA 1MVUA 5FDWB 1JF1A 3Q3GA 2EZ0D 3C6LD 2BOCB 1KJVB 3LB6D 1UA7A 3RNQA 4QTIH 3KYNA 3O3BA 5G4MA 2MCPH 2GTZA 4Z78B 2Z6FA 1HC1A 3ILEA 4LLWA 3TO4B 1H0DB 3LN4B 2G0LA 3NCXA 1HINL 1I1YA 1JRHH 1ZANH 1ZGLB 1IKNC 3EH4B 1H8OA 2IDTA 3JWOH 2W65B 2R0WL 5J13C 3ULSB 2VDQL 1T1WB 3T6WA 3SO5A 2PPCA 2Z4QA 4Y9EA 5EO0A 1FFTB 4BQCA 5I8CA 2NY1D 1S3RA 3DTXA 3N9GH 2N7BA 4HULB 1ORSB 2O30A 2OK0L 3V6ZA 4XNAA 3MA7A 2VIRB 4U05A 3C5ZD 3HFFA 1HOCA 2A6JB 4JZOA 3HMWL 5AZEL 3TH2T 1KXHA 5JOFB 3T0VA 4U1LA 2V2XA 3TWCH 3ZX1A 5K59E 3IJ9A 1XF2B 5BV7C 3IDMB 2B59A 4JG0H 2Z31C 4FC3E 5TDOA 1UA6L 1K3IA 3LV3A 3T0EA 4F20A 2FWSA 2GJPA 3ENEA 2MQCA 3LNGA 4FTVD 4RGMC 2OA9A 4YX2H 5B3JF 3H7LA 4LMQE 2A1WL 3K91A 1DQQB 1KEGH 1ORQA 3QG6B 4L5FE 3RWEA 4C4KT 4MAZA 1GGIH 1BA9A 5JNYA 3P4NA 2YPLB 5D2LB 4JDTH 2CD0A 4PYHA 3ABMB 4F7PB 3HUJE 5D6CB 4GG6F 3C5ZA 5LGKA 4HSAC 3PCYA 1DVSA 2JKLA 1BQHB 4QKXB 1U8LA 1GRWA 4HT1L 2QKIB 4KVPA 2ZZUT 5IG7B 1JFHA 2YAQA 1C8QA 5KSBB 5MEQA 5GIRA 1FLRL 1KCUH 2X42A 3QT2A 4P9ML 3ZDXB 4MA1B 3HC3L 3FB7A 1KTKE 4C56A 2DM3A 4PJXE 3UAJD 3D25A 2EYRA 3GSQB 2WIIB 5IGXH 1Z3GH 4BZYA 1K5NA 1PLBA 3OJDB 3CNKA 1M6OA 3D39A 3BUQA 3MNDA 4B96A 1KENL 4PH8A 5F44A 1YC7A 2IANB 4J6IA 4LSRH 3DROB 2Y1YA 4W9CC 4EIBA 3N5AA 1CE6B 2K4WA 5IVZA 3CFBB 1SY6H 3V4PA 2X4RB 4HK0B 2HCZX 1PFCA 1F3DH 4JJ5A 1WFMA 1ASPA 4I5BA 1E4WH 1TPXC 4JDZB 3U7AA 2FIKA 1NQBA 5IFAL 1TZ8A 2BSBA 1PGRB 4HKBB 2F5AL 1FYTD 2L04A 3NT0A 4JY5L 5ANMA 3UTSE 3QNXA 1N8OE 1VACB 3TLRA 1VHPA 2EE2A 1G7IA 4IJ3B 5IQOA 2O6FA 3QAQA 5T5NF 2H2PD 4FXKC 4IGBA 2HKFL 1XEUA 4YK4B 4MD4A 4N2NA 2ADIA 1GA2A 4RFEA 3H6JA 4H8WH 1AMYA 4ZPVB 4KYWA 3BKML 4NO0A 1NANH 1TT6A 1ZJBA 4H0HB 1DJXA 1EJOH 5FA3A 2CBTA 2X1WL 3NIFE 1CFBA 3S3JA 4KK9D 3HRZC 1LILA 1OCCB 1KELH 3DOHA 1NC2A 3JWNH 4IS6B 2FJHA 3QO1A 4HT1H 3T3MB 5MP6L 4JRYE 1JGDB 4FNLH 4BK8A 5C6PB 1OQOA 4UINH 3NJHA 4P46B 1UKSA 2DL2A 1T7ZA 2X4NB 3EYQD 5AL8A 4A6YH 4JFFD 4R4FL 3GHEL 4OZFB 4QRPD 5FGSA 3HRZA 3UERA 4FG4A 2OCJA 3P30L 5E5MA 3LS4H 1ZTXH 2VDRH 5I71C 4MB1A 2ODIA 2DI7A 2NTFB 2OYLA 3WJJC 1SVCP 1S9VA 3VFVB 5EBWB 2JE8A 4JANB 3FOLA 3US0A 3TO4C 2H3KA 2WINA 3ARGA 1QHPA 3TWCL 3QG7H 3ZL2A 2G5RA 4PRHA 1GYVA 4U1SA 3KPOA 4XN2A 4YVUA 3KEHA 3HS8A 3WY4A 4WF7A 1JVOA 1G87A 3ASWA 4PP1D 1MFNA 5LHDA 3L13A 4OFKA 3NJJA 1AYRA 4GXVH 4Z0BH 1E5YA 3VD4A 3QCVL 4AUJA 1PMYA 4XP1H 3W2DL 1TEFA 2R29A 3ROOB 3GBMH 5DJDB 4PWKA 3AGWA 3X3FH 5K9KA 1A6ZB 3X11B 3WTYA 4H2CA 4OUUB 5KWYC 2PR4H 4TKWA 3QIBC 5DURB 1Q4NX 1RSYA 3AGVA 2WINB 1OPGH 3D18A 3MJ7B 5IK3A 3MV9B 2YAMA 3EFDL 5KANG 3VGFA 1MFVA 4JUSA 4M7KL 4QWWD 5JXAL 4O51B 3M8OH 5DUPL 2LU4A 1ROWA 3RWFA 1T04A 3NSYA 1FF5A 5JQ6H 2PPDA 4G8AC 4YO0A 2RH0A 4IRJC 3SQBB 2P47B 3SJVB 1UWEL 5EZIL 3SGJA 3Q7JA 3QR0A 2R4SH 1WAAE 4NBZB 4QNPE 3HLKA 3VXMA 3KCPA 5IB5A 2XV6B 4XVTL 2BMKA 5ESQB 4DEUA 2YRBA 5E0FA 2R2BB 3EG9A 2JV6A 3P3TA 4HIQA 4R7VA 2C4FT 4A6YA 5H94A 5IMKA 2VDML 3CV5A 3V0HA 2F08A 4Z1PA 3MRDA 1Q9OA 1ZEAH 3WAKA 3P73A 1OAYL 1R5VA 4PGCB 3HTLX 5C09E 4OZGF 3EOTH 4ZFZA 5KBDA 5D7EA 5FO8A 4LMQI 2G30A 5JTWA 2XWXA 5SWZB 3DBXB 5CEZL 2BY2A 1XL4A 4PJHF 4BZ2L 1AD0A 3H3BC 5C0BE 1PZUB 1HQ4B 1I7TA 2Y72A 4IHOB 2R29L 5JXED 3MRKB 3K1DA 3HG1B 3RWIA 4NOFA 5EBLA 5FHAH 5DUBA 5JA9A 5J1TC 1H56A 4I5BB 1WWBX 4K8RH 1U6AH 3D85D 1W8OA 2YKKA 3LZQA 1X9QA 4TSAL 1KT2B 4KTEH 4X8JA 4GBXD 3DROA 2AI0L 1T5KA 2FD6H 3MRJB 3ZE0B 3CHPA 3MV7B 4YSTA 5D72H 4JFDD 3QQ4A 5F21B 3VFSB 4E41E 4KJYA 4AYEC 1TOXA 2COQA 5C0EA 3D39B 4NC1E 5T1LB 4BQ6A 1J87A 1W8EA 5A16B 1BJ8A 1GGCL 1OF0A 1QWUA 3FTGB 4C58B 4PW3A 3CPLA 3NAAH 1OAYH 3SE4C 3FH7A 4WUKL 4XNDA 1RIUH 3UXFA 1U92B 4FXGB 2VUOA 1N8ZB 3MRQA 1SY6A 4HBCL 4JHAL 3V4PH 1ZVSB 2LABA 4OZIF 4GQ9L 4KDTA 1U8LB 1T22A 4XNXH 3UAFA 5E7BA 1FNSH 2K70A 2SEBB 1EX0A 5FGBA 3QI9C 3U1QA 3BH9B 3D09A 4GQPH 1NAMH 1DDHB 1MHCA 3P9LA 1AIZA 4F7PA 2HKAA 3MROB 1AI1H 3ZDYB 4ZSOA 2DQJL 4LPXA 1A6VH 1U92A 4FXGA 3K2UL 3MLSL 4X9GA 2VXUL 4AEHL 1VENA 3CPLB 4HBQA 2H1PL 4X5XB 2NSQA 3UP1A 3KXFE 2JJSA 3VGAB 5EC2A 5DU7A 1SOQA 4JO5A 4K7PX 5IROC 2QQNL 3QQ4B 3UJIL 2E74C 3HAEG 3LZOA 2V2XB 5BUGA 4DETA 1ZOXA 3ZRCC 4F2EA 5EFIA 1IQWH 5JQHC 4U6HB 4R96A 1MUJA 4GY4A 5J1SC 5B1BB 3G9AB 5DD6B 4HMCA 2CA3A 3MA9L 2D7MA 4H0LC 3RDTA 3SGDI 3T0BA 3CN4A 4HQQL 5I8CB 2V2WA 2PPFA 4UV7H 4X7EC 2W65A 5IBLC 4XN5A 4ZUSA 1AGBA 4RGNE 1J1PL 2NUTB 2Y1ZA 1MI5E 3QWOA 4JFYA 2CO4A 3N44F 4OGAC 4UM8A 1RJLA 3K0WA 2XN2A 4PUBL 3NDYE 5LDUA 3FT4B 1M71B 2R29H 1BJ1H 2WKOA 5CP3A 1MVUB 4X4XA 5CU9A 5HPMB 4CVZB 1Q9OB 4HG4J 2DQTL 4ZFOB 4ZYKB 2VAJA 3RDTD 4YZFF 4P4KA 3W81A 4EKXA 4Q4IA 1Z9PA 5AUMA 3HR6A 1A2YA 2WW8A 3FBQA 2E0PA 1B0RB 5EZIH 4K23H 1I3UA 2WVUA 5CD3B 5CN2A 1PAMA 1D5XB 5HGDB 3QQDA 1EO8L 3N1MC 1SGKA 4M29A 3U82B 5ANME 3UTSA 1G1OA 3WIHA 3X2QB 2ZX5A 2FSEB 3U79A 3KYKH 4W9JC 1XCWA 3R7RA 4ABVA 3FFOA 4PS3A 2YD1A 5AOZA 5AYUH 1Z9LA 1B0WA 1W72B 4EOWH 3PVIA 2WLMA 4KXDA 2YWZA 1V55B 4DKTA 4GW5A 1D5ZB 4WGWB 1N5AB 4JPKH 1J9RA 5KSAA 4KV5F 4LOVA 1UACH 1OZTG 2AXFB 3BWUF 3QDJE 4KHTL 4JPSA 4HVBA 5F7FA 2E7BA 4L4VA 2PN5A 1OAZH 4NM4L 2IH1A 1OSZA 4B27A 4CSZA 5FF6B 1G9MH 1U58A 5GHWL 5D1XB 1J8HA 2WLIA 3G6JB 4PJ8C 2DBJA 3QUXC 3CLFL 3MMEA 4UT9L 5FCUL 2Y1VA 5J6GA 1PDKB 4PJXA 2VDOH 2UZYB 1JD7A 4CJ0A 5DS8A 1NCOA 3L17A 3IDNA 3BX7C 4HQQH 1EBAA 4AZUA 5BOJA 1N67A 1KGUA 2X4QB 2OL3B 2XFXB 5AYTA 5K9JH 4Y1AB 1WICA 5GRUH 2VXQH 3RZCA 1U8NA 3L3HA 3WFBH 4B97A 1L5GB 1N4XH 4NENB 1J8HE 2IMNA 3D4ZA 1OAQH 1KXQE 1WC7A 3RFZA 4MAYA 3U7WH 2QZQA 4AIZA 4CU7A 4Z3GA 3PUCA 2EYSB 4E9RA 3BWSA 2VDPB 3QA3A 4DP1X 1D5IL 3HHSA 1KNOB 2OZ4H 1B90A 1X7SA 3CBKB 3SDXB 2YGNA 4WHTA 5I30L 5LN4A 4IOFD 1LK2A 3OXRB 5HDLA 2MRYA 1DVYA 1OAXL 2UXTA 4GI6A 2FX7L 4L8SB 3FU9A 4OZFA 4DNLA 3KWTA 3PQYB 1U4EA 2AJXL 4AVKA 3MCYA 1EJOL 1KJ2L 3AWEA 3ARXA 4MWFB 4NQTA 5I1DA 1ZTXL 3QR1A 2WMPA 4POZD 4H25B 1ZS8A 4LSUH 2WXPA 1KPRA 2Q3ZA 3IJHA 3DXAB 3BVWA 4YL9A 3S35X 3D52A 3C5XA 3MO1A 4X80L 4N25A 1BAGA 1WISA 1G7QA 2F54B 3OC8A 4OD3H 5B39G 1D7BA 1HHKA 2CRMA 2WCSA 3P2DA 4IM8A 3T9WA 4XCFL 3FC8A 3H9SD 2VWEE 4YNYA 4ABWA 1Q90A 4U7SA 3UAAA 5EU5B 2P8LB 5E00A 1RZFL 2CJUL 4EI0A 4RAUB 4GAJH 1RURL 3QUML 1NCWL 1ZEAL 4PTUB 3ATDA 3BVVA 1FIGH 2OW7A 1R3LB 1QZ1A 2IOOA 3B2VL 2DQFA 3VMNA 5B3SB 2JH2A 1U8KA 2P5WD 2X89A 3VXRD 3OD3A 1DL7H 3Q43A 4F92B 1X5XA 4R0LC 3MOBL 3HKZA 1IMHC 3U25A 3L4CA 3AREA 4JFPA 4PJBB 4NFBA 1ID5I 4KNSA 4DK3A 3II2A 4GKNB 3N0PB 4N28A 3TEYA 1JTPA 2Y3AA 2XN0A 4HWNA 4HWZA 5GZNC 2EDNA 1IBDA 2V6HA 4GRMA 3QHFL 2AF2A 2Y7MA 4KUCD 2BHFA 4PJAA 3RAJL 3DGGB 2VWEC 5CGYD 2JJTA 4M48H 5E1IA 4DN3H 4EBQL 2KZBA 4XZUA 1Y6KR 4RBPH 1Z3GL 3VSTA 3BVDB 1FN4A 1WYJA 4FQ2H 4FCHA 3EOBA 4QXTA 1A0QH 1GC1C 2WB1A 4N6RA 1E6OH 1TQUA 5CHNA 1BAFH 1OK8A 2DYPD 3DO7B 4XPAL 1G6RA 3KL3A 1DQTA 3CZKA 1USQA 2IQ9H 2XWDA 1JK9B 1CFMA 1A1NA 1Q0YH 2BVPB 2CUHA 3AJ7A 3H7BA 1Z2KA 2I7OA 4WFGE 5AB1A 5PCYA 3S5LA 4MB5A 3WO4C 4BQ9A 2XA8L 2O5ZH 5I6OA 1IAKA 1JXFA 3CXDL 4XPHH 2ZXQA 3LQMA 4PJ8B 1IO4C 1AZRA 1QNZL 1OW0A 2EDEA 5FDYA 3S8GB 2XUWA 4GUPB 4XMLH 3INOA 2XIIA 5FYKH 4TPRH 4MDIA 4PVNA 2K8MA 4XP1L 3WOVA 5CN3A 4OBRA 4G43A 4YDVB 4PWJA 4YDMA 1NFIB 4D0DB 1KBKA 2D03H 1FG2B 3WFZA 4I87A 2JI2A 3S2CA 5FA4A 4MYPA 5DQDH 2MHAB 5CKAA 1R3HB 2DMKA 3LKNB 1AKJB 3NPSC 1TJHL 5AQ0A 3UIZA 4NZRL 3ZKXC 4HGWA 3U2JA 4JUTA 3RA7H 2DQEH 4NHCH 1ZGLA 5EN2B 3TBSA 5DRXA 1KELL 1M42A 2ADGA 2BNQE 1H0DA 4GAJL 4I9XA 3FH8A 3QDJD 2BVUA 3EYSH 4WUUA 4ABUA 2GTZB 4TSBH 4L4VE 1PX8A 5C08D 1NFDB 3MV7E 1LXMA 4B0MB 2JIXD 3ZE0E 2AEIT 3MRHB 2ITCA 4YDLC 2EDHA 3BZEA 3IN2A 4PJDE 2CMRH 2Y5TA 2NLJB 1FO0H 2NW3A 4AOFA 1IGIH 3AAZA 1W91A 2Z92A 3D3VD 4P2QE 3IMVA 1I7RA 3GQFA 4XN1A 5GS3A 2E9BA 3I50L 1AJ7H 2OMZB 2YPLE 3QUXD 3MJWA 4P05A 4HJJH 5D2LE 4YBLB 3QRLA 3WS3A 5DD0H 4S1RL 1IKNA 1A9VA 1NFAA 3Q6GH 4JN2A 1E5UI 1B0IA 4LIQL 5MEPA 3B3BA 2ZKMX 4K9EH 1A65A 1UH2A 4KDWA 2ZCHH 1MRFH 1HH6A 1Z32X 2WTRA 4OR1A 3MRBB 3DV4B 1FAKT 1OLZA 3DURB 5BRZD 3OHXC 4BFJA 1E27A 3RU8H 1TTRA 4XP5L 2XTSA 2QQKH 7TAAA 4XAKD 5AVSB 2W0FB 1MXGA 2DPKA 1DTUA 3H9HA 5LKNA 4PLOB 3E7JA 5EBMB 4D0BA 1T89C 3UTSD 3ZY7A 4ZMNA 5IMOA 1AO7A 2B08A 2ZPKL 4RNRA 1UYWL 3MRCA 4PW4A 4Y4KC 3QQ3A 3V7AE 4OZ4A 1HHIA 1QEXA 3IFOA 3F00A 2V7HA 4F24A 5I1LB 5KG9A 5FUCE 1QMUA 3JUZA 2AK4E 2XRAL 2MTPA 2F7OA 3MJ9L 5MHSD 1X9UA 3MGTB 5F3HB 4R90L 1GIGH 1HI6A 4Z7UE 4AGPA 2AEQL 3GBEA 3L7FB 3IFLL 5CZRA 3ZL4L 4B9ZA 2C9SA 5IMOB 1GW0A 1BZ9A 4CGTA 4MD5B 2W0FA 4L4TA 1F97A 4UOJA 5FHBH 3OF6A 4ODSH 4A2MA 1NCJA 1BD2B 4HXBH 4KI5E 1JS4A 1JMZA 4LNRB 1HH6B 2WTRB 3Q8AA 5JO5B 5JW4N 1QFPA 3II1A 4A37A 4FKKA 5FM5O 4H1LH 3GINA 1UUNA 4O9HH 4N1HB 2X4UB 3R1GH 4XB7A 1U8MA 3PDOB 43CAB 1CS6A 1D5IH 1VADB 2OS7A 4Z77B 1DLFL 2WNKA 1NLBL 5KVEL 5FO9A 1SF5A 4KJWC 1U93B 5D1ZI 3DVGB 3SDXF 3B7RL 1I9IL 2Z92B 3AAZB 4L9DA 1W8NA 2WLZA 1YPZE 1HQRB 1FL5A 2NLJA 2I25N 2BVOA 2NY5L 5C0CE 3WSQH 4NO2A 1K72A 2H6PB 1DANT 3CXDH 4XPHL 2YQGA 1G0DA 4WCYH 5KVGH 3VGDA 2DQEL 1A1MA 2XSKA 3ET9F 2QVMA 5I73B 2A6IA 4JQXC 5DHYB 3EYOA 3JV0A 4GKLA 4NO5B 5F9WC 4P57B 1DBJL 5LNGA 4NI3A 1DHKA 1QEWB 1LEGA 1ZHNB 1AS8A 4ANVA 2XNAA 2YBRB 1HEZA 3WFBL 3IJYB 2FBJH 4CDGC 3G5ZA 4OCSH 4HLEA 1TYRA 1KIUB 1FL3A 4IIQA 1CXFA 1ZVNA 3C6SB 2VYRE 5D1QA 2DWSA 4HKXB 2JMRA 5D7SH 1A14L 2BFVH 2YXWA 3QEHB 2Q2EB 2F19L 3S98A 5B1JC 1RERA 4P2OD 3TCXA 2OR8A 5LJYH 2JCCE 5IV2B 3WY2A 4LQ1A 5F2FA 4YSRA 1M4KA 4GS7B 1IAKB 1BFSA 3D4YA 5GGVH 4YHPA 3MOAL 5J9PA 4N22A 4WEEA 5CCKL 1N18A 4LDEB 2W0PA 1MDTA 2ID5A 4G9FE 4WO4C 4YGAB 1F58L 4CILA 5EF1A 5DQ9B 4JFTA 2FBOJ 3K3QA 4JZJC 3VXME 1SMOA 3DO7A 4PJ5B 4HJUA 1KCVL 4GFXA 1T7XA 1E3FA 3SKOB 4QXTB 3GJEA 4GKSA 3KHOA 4S2SA 3RIAF 1CD0A 2AEPH 1MWOA 5FGCE 1RJYB 4G1MA 4PV8B 1YNTF 4JHUA 4APXA 5BVPL 3S97C 1WA1X 3RWJB 5J9PB 4ODBD 2ITEA 2RCSL 3H42H 4RISL 2BP8B 3I75A 2PO6A 3MA9H 4NP4L 5D4HA 3FSWA 4EXPX 3O81A 1JPSH 4OLUL 1PYWB 4NKOB 2JNZA 3MKGA 1LL1A 1FE8L 5FLUA 3TJHC 3GSRB 4KNUA 3L4YA 2W91A 4PJ5D 3WEXA 1SXZA 3IDGB 3QRBA 4MMXC 2NZ9D 5I6MA 2D7NA 2XWEA 1IC0A 4G71B 3NFPA 4K3GA 4KI5F 4OCRH 4L0ZA 4C56D 4FG0A 5E6IA 4D2NA 3EGDB 2DQFB 5FCSH 5DWPA 3CLWA 4PJFF 4UZUA 4TL5A 2K3TA 5DD1H 2BXYA 3V2AR 2XZCH 5DHYA 3RPIB 2X88A 4ZUVB 3FJTA 2P8LA 1EZSA 3RGVA 2AK4B 2ZKHL 1ZMYA 3VUAA 1J1XL 5KW9L 3V5KA 3CFCL 1S7UA 3PWPB 1JDAA 2YUZA 2QFPA 4F8LA 4J3OC 1J05B 5DZVA 1PEWA 3NK3A 3QYCA 4OTXH 4Z9KB 3IVKA 3TEWA 2AS5M 4KVCL 1GYWA 1IBYA 4U3HA 5GRUL 5IHWA 1D2PA 4LVNC 4FKHA 4ERSH 2PYFB 3KYOB 1ZGLM 2R9HD 3DC0A 4D0CB 2HVKB 1S2EA 4IRZA 4WK4B 1ES0B 3KM2A 2Z91A 5DYOA 4Z7QE 1CL7I 4ZW3A 5I66A 3IRZA 5IB2A 4HIEA 2EVJA 1IC4H 1KPUA 5JHDA 3A6CH 5EO1A 4HFWB 2Z3FA 1DCLA 4JO3H 2UZPA 5DJXB 1I4FA 1IC1A 3WTVA 5F7EH 1NL0L 1YJDC 2CBMA 4LASL 2X05A 5DGRA 3K5RA 5EA0L 2GUYA 3IBEA 1J1OL 4ZUWB 4L29A 3UBXI 2QDVA 3BWUC 3PABA 3ABGA 1E8YA 5ALCH 2VAAB 4KMQA 5T1DH 1HHGA 5CM1A 4PR5B 1UB5B 4HG4K 4N2BA 3DETD 3BYTA 2VR3A 5FECB 4HH8A 3G5YA 2VXQA 2GBVA 3CBRA 4QYOA 1M7XA 2VDLL 4WW1A 1U95B 5FF6A 4OKDA 3AQZA 2FBRA 5AKSA 3OZ9H 4BEIA 2OJZH 3MC0A 4U31A 2N3JA 4LEOA 2OFQA 3QQ9D 4OVUA 2N01B 4NQED 4N2GA 3QIBA 3NCMA 2ZOTA 5T1DL 1MG2C 3ARYA 5I74C 3BFWA 5GGUA 2Y07H 4N24A 2VZUA 4DO4A 3AY4A 3SE3C 4BM7A 4FQLH 4MNHA 2HFFA 1HEHC 3QUZB 3FB6A 5BVJB 2HPOA 1GZHA 4X4ZA 2W9DH 1UURA 1EO7A 1UEMA 2GJRA 2XACC 2I7SA 4XOAA 3RDTC 2RFXB 3SGJC 3BI9X 4JMXA 4PBVC 5B4MC 5LXVA 1BYPA 4KKBD 3HG0A 4JVUA 3NP4A 2DLGA 4Z7AA 5ETUB 4Y2DA 2WLNA 1OOAA 4ELMF 4CVZA 5HPMA 1SOSA 4AC4A 2QHRL 4FADA 2ZOWA 3N42B 1NMCB 1QA9B 1M71A 2P24A 4KFMA 4HLZG 1A4JB 4Z7VB 5KS9A 1WZ1H 2FB4L 2YBGA 3EFDH 1A8ZA 3M6DA 4P4RB 3QUXB 1CB4A 2UZIH 5EN2A 1HXMA 2WB7A 3RJDA 2DMBA 3STBA 4CDHA 2YRZA 3D3VB 1T1YA 3L3IB 1Y6MR 2V2WB 5CZVH 3FCSB 4PREA 5D70H 2ZOLB 3GRWH 4HKZB 3PFUA 4FFVD 4J8RA 5B1CA 3RHWF 2B5IB 4PJBE 2Z65C 1ANUA 1GZQB 1WFOA 2J8UA 4OD1L 2B39A 4EEEA 4LSPH 2EDKA 2E9GA 2VZVA 4S1QH 1UXSB 5GJSL 5L0QB 3PS6A 4WO4A 4N2EA 2D0HA 3G5XB 1OCWH 2ED6A 3VXUD 4DEPC 2W1NA 4B95C 2CLZB 1U8QB 4HIXH 3X12A 2VLRB 1CDHA 3CH1B 4HUKB 2WCPA 4QWWC 2DKUA 1LO3L 1M05A 2R2HA 2J7LA 3K72B 4KQ0A 1MFMA 4JMNA 2VC2L 1GJWA 2WZPD 1AKJD 4M62H 1HSAA 3L5XH 2FT7A 4XNMA 3MROA 2I26N 2CHNA 3LN5B 3UACA 5D6DA 4JFHE 4YFLI 4FMKA 5H37A 2X3BA 1ZTXE 1NGXB 1HH9A 1TTFA 3H9SE 4WY7H 4HIJA 1MHEB 4Y4FA 5GRJL 3T6QC 1LGVA 3GLDA 1YA5A 4LOEA 5EULV 3UPRA 4J2XA 2AV7A 1UM5L 5DR5L 5LCVA 1IBGL 1H6TA 4NP4H 1BIIB 4JGMA 4Y8DC 3AITA 3DGGA 3AG3B 2Z34A 2D3LA 1RIVL 4RWYL 4LP4A 1WAEA 4NQCE 1E43A 2GHWB 2XPZA 3MLZH 3W11D 1SY6L 5AVRB 3NZHH 1GS6X 4OFPA 1TZGL 1P6FA 4KJWD 4UB0L 4X5PA 2VDMH 4NPKA 2HAZA 2ZUVA 2AHIA 5A6LA 2ATAA 4HEME 2QQKL 1P5VB 1JPFB 1OWWA 1R5IB 4WO0A 1JZ4A 3RJQB 4F2MB 3TFKD 4G3YH 4M9PA 4O2CB 4X7CC 2WXKA 5A2CA 2WSDA 1JPSL 1JGEA 5ECJE 4ZMYA 3EH1A 5JPNA 2CDGA 4JFWA 3WIFA 3HBPA 4P5KB 5CWSB 3HA0A 3ZBMA 4CGUB 1DJSA 3FB8B 1J8KA 5D7JC 3HC3H 3UEZA 1Q9KA 4OZGB 1O7VA 5TF1H 4XX5A 1XR9B 3TT1L 4F2FA 4X7DC 5DUJA 4PBDA 2FECI 5C0BD 1R19A 5JIIA 1AGDA 2PTUA 1L4IA 5GZOC 2F53A 4M7KH 3KS0H 2EVFA 2K7PA 5FFOA 4G5ZL 3TIEB 1CTMA 1FA4A 2IPTH 1EBPA 3E2HC 1NZRA 2JJWA 4MNGB 3AREC 5CO1A 5CIPH 4QOKB 2ZCHL 4J1UB 4FX5A 3F05A 5E03A 1CDIA 1K3ZA 5HDQH 2R4SL 2HMIC 5GRZA 3IJ7A 1TYJA 4NQCB 3LZFH 4IMKC 2BMKB 2NXYB 4UTCA 4UYQA 3VFPA 4QRFA 1AY1H 4QF1A 2BHZA 3KH3A 5ID0B 4LP8A 1PG7H 3O8XD 5I19L 5L2KE 2XN9E 1G7HB 3P77B 2APFA 1RUAL 3TA3A 5BZXA 1V7MH 2ZWKA 1AGEB 4HK3N 3VG0L 1SN2A 2CNZA 2EECA 2J43A 4K7PL 2KHAA 2UUDK 3BQUB 3M17A 5EZJA 3G6AA 1SEBB 3K8KA 4KMTL 1NMCC 3S35L 4MXWH 2NY5H 3RQ3A 1E8XA 4JFFE 4QGYA 3VCLB 3MJ7A 2XTJB 4BSVA 4M6OL 2AJSL 1BZQK 1WCQA 2N1KA 3K6SB 4Z0BL 1DQLH 1OAUL 4HU2A 2CR6A 3RVXD 3MRRB 1WZMA 1XO8A 1NLBH 3X11A 4K73A 4W4OA 5FOBB 2Z8VC 5KYUA 3TS8A 3QPQD 4U3SB 3VU1A 3FOMA 4S1SH 3U83A 5E94B 3VGEA 5KSAD 1S9WB 1P4BH 4QRPB 3PHSA 3WSQL 5DS8B 2ZWLT 4ZTOL 3QJQB 3ZKNC 3KPOB 4HXBL 2IVFC 1F86A 4P46D 1IGFL 2EDXA 4OFVA 3FUNA 1EYUA 4XT1C 4MCMA 2C1OB 4TXVB 5TQ2H 2G2PA 3WUWG 4HJTA 1GYCA 3D3VE 4WTZG 5L7XL 4WAFA 1KV7A 3AXLA 1IQDA 3CFJB 2FNWA 1GYAA 4HUMB 4K7FA 3BQUA 5EPMB 3ES6B 3EDJA 4EUPB 1XGUA 2EE0A 1RMFH 2WZ6A 5I1CH 3EDFA 1P9MC 5DMKA 5HHOE 4BGLA 1W72A 2HT2C 3O45A 3HMXA 5EOCJ 4G8EB 3GXIA 3QRGL 3QDJB 5D7JA 1RY7B 3ZRSA 2ZYRA 1TVBB 3PWLB 3GKWL 3C5ZC 4KZCA 2ZYIA 3I84A 4J6RL 1RCYA 2H0PA 3VFUB 3AM8C 4MAYD 4OM0H 4RX4A 3FF8A 4XX1E 1KYOJ 3NCEB 5FO2A 5LWYH 4HPOH 1NEZB 1B4LA 3BVTA 3BSZH 4NKIL 3ZYJA 2EUZA 4BGDA 3REVB 4TVUA 4PHXA 3JT0A 2GB2A 1RZQA 4PVBA 4L1TA 4GW4B 2WBXA 2F5BL 4L1DA 3OHXB 2GJZA 1BQSA 1QYGL 2ADIB 2HTLC 4ZQKB 4TQPA 5CR1A 3H3PL 2ZQKA 4JHWH 4OZIE 4S1RH 1XSOA 4XMXA 3JUYA 3DMMC 5AOJA 3KPPA 4IKNA 3ILPB 5DYFA 5AW7B 2HH0H 4M7LT 4A7GA 2HB0A 4JFZH 1I7UB 1GW6A 2AXGB 4HPYL 1OSPH 1OT2A 2J6EL 4I0PC 4XZ4A 2ESVA 5JPNB 4UNVA 2LV4A 3RIAK 1NINA 3JZYA 5FKAA 4ZFFA 5AW5B 1M2VA 2DYPB 1P69B 3B9KA 1RHHA 4OIIH 3VFTA 3CDGA 5D7LB 3ZKSD 2H32H 2WXRA 1V05A 5EV7A 4A63A 4Y8AA 4HC1L 4QAMB 4BA8A 1CFSB 3FQ4A 4X9HA 5IKCB 2FEJA 2YMXL 2R56H 2C3VA 3PREA 1FVDA 2XBDA 1NDMA 3LRHA 4PM1A 2XVGA 1WAAF 5MERB 3CVIL 2JJUA 4C54A 2ZSWB 1MHEA 4DP4X 2HP4A 2IDSA 3KR3H 3K5SA 2LTQC 1FZMA 3KGUA 4AEEA 2EH7L 5A43C 4OKVB 5CUSL 4AUUA 5FS5A 1G43A 3LN5A 5HGHA 2FJUB 2Y22A 2ZOKA 4ORGB 5J12C 3WHXB 4UNTA 5DFTA 1ZXKA 2IXQA 2J6WA 1BF5A 1L3NA 5BV7L 2PCPA 2ICEC 5D93C 4EDXA 4PV9A 5I75C 4HISA 3VD9A 4PS4L 5INCB 3T3PF 4I2XA 4KJYB 3A6OA 3Q2NA 3CLFH 3QUMA 3B7UX 3VFSA 3W9DB 3ZE2F 1KLFB 2OSXA 2R0ZH 4XPAH 3WKQA 3O4LB 2YD6A 4JZOB 4NC1C 1GZQA 2J8UB 4IKJA 3IDYC 4H8WC 1YUHA 4AL8H 1THCA 1ORSA 2YOAA 2VZTA 1BJ1J 3WIAA 3C12A 3HE6A 2E9JA 3GF8A 5FYJL 3FTYA 4AIEA 1JAEA 4DFIA 1T1WA 3IMTA 4JZJA 3P4OA 4X7SL 2PW2A 1EAPA 2ENPA 2FWUA 4WNQA 3HZKA 4RMVA 3KW7A 5T1LD 3G3LA 2C9RA 3PQYD 1U21A 1YEEH 3S5LG 4D9RD 4IRSC 3L3OA 4P3DA 4L1HA 4OIAA 3MRPB 4NZJA 3WJMB 1TLKA 4DKDC 1U8PB 4P2RD 4X6FB 5SWZE 3QIWC 3BAWA 4RLDA 1PW3A 5JUEL 3H4FA 2HJLB 1NM9A 3GSNB 3TT3H 5EEZA 3A23A 3K71A 4G9FA 1RV6X 3NP3A 2B1HH 1L9SA 1AFVH 1JGLL 3FAWA 4M6MH 4UQAA 3T04D 3TBWB 4QXWA 3ARDC 5F71A 4QCIA 3VXMB 3PWLA 2H26B 4N2IA 1YPZB 3NYKA 4ZS7L 4IYKA 5C7XL 1DVTA 4G8EA 3L9EA 1BQHG 4ADJA 1DJGA 4GP5B 2MQGA 4TQ8A 1C1EH 1JF5A 3CFUA 3SY6A 4FYRA 3K4AA 2CLRA 5E4EC 2EADA 4LESA 5DSCA 4NCDA 4PD4J 1ACCA 4UM9D 5EIIB 4W81A 2DJMA 2O26U 1HU8A 2V3DA 5AW9B 3DGDA 3KPSE 3OKKB 1K5WA 2ROXA 3G5YB 4XC3H 1G7PA 2GTQA 3U46B 4PGJA 5SV4A 3MLXL 3ESUF 1MFAL 3AS0A 4MJID 2IO5A 2X70A 4A7UA 3F6LA 3ROOA 2VMCA 12E8L 3TA3D 3O4LE 4FS0A 2GSIA 3QRGH 2VXTH 3KYMA 4OJFH 1IGYA 4JCMA 4J3TA 2NNCA 1X5AA 1E6JH 4G6JH 4KZEL 3N1PC 1QNIA 1NTDA 1SDDB 3QDMD 5IBUB 5JR1H 5L88L 3V6OA 2WHVA 4NSKB 4PJXF 1UVQB 5T3XL 5J57B 4OGAD 4I1RA 4JANA 3Q13A 4AENA 2Q76B 1Q1JH 1N4XL 3WTSA 1ZLEA 5F0MB 5KW9H 1S5HB 2VUKA 4HIEB 2ZXAA 5IOPB 3IAGC 4JM4L 3QIUC 1WWCA 5DVNA 1U8HA 4U33A 1VFBB 3HRZB 2W60B 1G7JB 3MV8E 2OZ4L 3SPVB 3HS0C 4PD4K 1BEXA 1VZIA 4UTAH 5IWLC 5ABDE 4P46A 1N6VA 1GGTA 5BJTB 5KBLA 2HKHL 1C8PA 3IGUA 4GXUN 3VXQB 2DQHH 2FJHB 2XKUA 3C5SA 2R7EA 4K7PY 4AQ8C 4G70B 2LLNA 1JXDA 1OE3A 3PL6D 3OKMA 2ORBH 4GRLD 1DSYA 3NVQA 1FH2A 1X9LA 4ZXBA 2W95A 1YECL 1CLYL 1KIRB 1P1ZB 5L2JB 1J86A 1EEQA 3GBDA 3NOIA 2MCG1 2AK4A 1VKXA 5H2BA 1IGTB 3QUYA 5EUKB 4IGBB 3GTTA 2OSWA 1QG3A 3HUJF 4J3XA 5CEXB 2PW1A 4U1NB 5FK9B 1JWMB 5BOZG 3QC5X 1R3IL 3HHRB 3W39B 4HV8B 4YPGA 5ANMB 2XCMC 4K94L 1MAML 2V0AA 3O6KH 4QRBA 4KZDL 2WXLA 2Y25A 1UFUA 4OLZL 4M93B 4IMKA 1M1XA 1IGCL 1AGCB 1S7TA 1TCRB 3HNVL 4WEBL 4ZMPA 3AS1A 1YYCA 2AAVA 1NBVL 5FGRA 1FJ1B 4Z7QF 4IHBA 2R15A 4PLKD 1TFHA 2KQNA 4DQOH 5HGAA 4JDEA 1HHHB 4L8BB 2DQUH 3RWDA 3L9RA 3D08A 3BSZA 1K5NB 3U0PA 1LEIA 3BDBA 5GJTL 3GMLA 4RGNB 5IHBA 4L8DA 5KVDH 2LVCA 4NNXA 5B1JA 5H8DA 4PB0H 5I6LA 1DQDL 1CFNA 4ODUB 4YDJB 2QVKA 5MP6H 4FHBD 3ARDB 1W80A 4GKSB 1SHXA 5C0DB 4GBXB 3WJLA 5I5MA 4DGIL 4UIKL 3VGBA 4NRZB 3AABA 2DKSA 2BINA 5FO7A 3FQ1A 3V4UH 5DD3H 2A9NH 4A2LA 1CT8A 3D39E 1YAZA 3HG1D 2I9LB 4U6XB 3S36H 1F3DJ 3AWGA 3HBZA 3X12B 2FRGP 3CFEA 3IRCA 2IGFL 4I48A 3TVMB 3VQ2C 1SJXA 3QXUA 3E6FA 4LSQL 5SWZD 2Q3AA 4FZEH 3V5HB 1S7SA 4CNIB 5ID1A 2K6YA 3IKCA 3RGVD 5IJKA 5JOFA 2DD8H 4ODHL 4Y19E 3HUJA 4XN4A 5HGBB 4MGXA 4N2DA 3ZKQD 3QJHB 1RPQA 1DR9A 1QSFE 1HT6A 6FABH 4PV1C 1RZPA 4LSVH 2QKSA 4IQHA 2VNCA 1J9QA 4XOBA 3VJ6B 1KLUA 2EIEA 1ZHNA 4R4FH 4ENED 4FFZA 2GK0B 4UTAL 1LMKA 3OL2A 2OMUA 1EV2E 5J4MA 2A6KA 4Q56A 3JQOB 2NCMA 4I0KA 3QFDA 3BRGC 3ETSA 4JQVC 1S8DB 3FUKA 3D69B 5DVPA 4PJ9D 5IMLA 2HLEB 2N0KA 4XXWC 4FERA 5HXMA 2BP0A 3ERXA 4Q9RL 3GMPB 5ICZB 4S0HA 1ND0A 1M7DB 5HYFA 4HJGA 3X1NA 2XKNA 2OQJB 1EEYA 4LLYB 1R5WB 5E6RB 2TRHA 5C9JB 4G72B 4Z8FL 3QSKB 1CFQA 4BZ2H 3OLDA 5BO1H 1YSOA 3HNSH 3MR9B 5D7IE 3VFWB 2WP3T 4OJFL 4J28A 5FX3A 5H37G 3I6GB 4FFYL 1Q0EA 4FEIA 2WLHA 3C6LB 3LRGA 4WQOA 1QR1A 2DBLH 2IBGA 3RPBA 2JKNA 4OI8A 4J3OH 5F7MC 5C09B 3UG4A 2XTLA 1U3ZA 4LARL 2QJDA 2Y6SD 3BP6A 5T1KB 2AMGA 3EW3B 1UEYA 3ZN6A 4O02L 5F0JB 2AQTA 1XH0A 1FBIH 2NW2B 2XG4B 4YSEA 4OLYL 1UADC 5G2NA 5F6IC 1DVFC 2OZ4A 2RCSH 1JZ7A 1RKRA 2Y69B 3UYPB 1RZKC 3CZSA 4FQQB 3ARTA 3FO2B 5KN5B 3JWNE 3LDBB 4DWHA 3NH7H 1UM4H 1YEEL 4CUCA 2V7NA 3G04B 3GPEA 3C8DA 4ABQA 1ZPUA 4JPIA 3NCCB 3CSPA 1NIDA 1QVOA 4GKOA 2DQUL 4L4JA 2B15A 2ZOUA 3TJEH 3BIAX 3RBSA 5I1HL 1OD9A 4PG9B 3CN3A 4TTDC 1T83A 5I15L 3CFDB 3DV4A 4NOBA 4YDNA 5IR1A 4MA3B 1Y0LB 5FB8A 5I18H 3IF1A 1I7ZA 3EYSL 4X50A 2IGFH 2A6DA 5MEPB 4AGOA 1XGRB 1DO5A 4M00A 1PJWA 2EKSA 1F1DA 2UYLA 1FFNA 2WOBA 2DLFH 2EC9T 3QHZH 1AZVA 2EACA 2YD8A 3CC5B 2BIOA 3DXAE 1U3HA 4IBZA 2EDJA 4XGZB 3CZNA 4G8FB 3QHTC 4XN8A 2IPKA 1QSED 4FQXB 4WU7A 4E9WA 3ZHKA 2KYIA 5AW3B 5ICZA 4Z23A 4JO2L 4DP5X 2H7WA 1MCWW 4UM9B 5G5DB 4Q6IB 3QXDB 2QELA 3BAJA 4XVSH 5LG1A 3T71A 3VH8A 3KPNA 3C75A 3D69A 3NSDA 2MCMA 5EF2A 3R0MA 3ARBB 4OLXH 4JFOB 2NR6A 3MUGA 2O5ZL 3NZ8A 3L2MA 4HUWB 4PS4H 3U6XA 4JPVH 1Q0XL 1V27A 4ZJ9A 4BD4A 3JT2A 1D5BA 1FZKB 5BXFB 3H0TB 1S7QB 1ROCA 4HLJA 3MJ9A 5C0NC 4UNIA 3TWYA 3K8LA 4MCNA 4MJ5B 4TNWK 3M1BB 4Q6YA 3GI9H 5ENWB 5BZWA 5FA4B 4FFZL 4ZXBD 1B0GB 3L9BA 2AJYH 4JZNA 2Z31D 5I8EA 1KCSL 4CKQA 4AGMA 5FYJU 3GSWB 4JFED 4ZT1A 3OKEA 4UT7L 1GMEA 5JHLL 1KBBA 3ARDD 2AK1L 4R8WL 1D3CA 2YPLD 2VMDA 4MXVF 1C5BH 4FNUA 1KYDA 4QRTA 1KMGA 4FNLL 2QQQA 1YN7B 4BSJA 1SBSH 4XO8A 1DUYA 3L7EA 4FTVB 4RGND 4ZTEA 1PPIA 2IIJA 5JDSA 4APXB 2DLEA 4M43L 3UTQB 3TFBA 4PJDF 1EUTA 4FJ6A 3OXSA 5K9QI 5IW6B 1E4WL 3ISWA 1E3XA 3QPQC 1OANA 4NRZA 3DMMD 5EU7C 5HJDA 5HDBB 4CMHB 4DF9A 1H5BA 4PY8I 1AQHA 5F7DA 4V1DE 3ZDYE 3AG4B 3AY4C 4MCZB 1MFEL 5I1JL 2CO1A 3UTQA 2O4EA 2WTPA 4PJAB 2EXYC 1NAMA 1DUYB 3L7EB 4K9EL 2W0KA 2Y4SA 4P2CG 1U8OA 4G6AD 3FUEA 3T0XA 1TO4A 3ESPA 5CIPA 2H9GB 3RWDB 5IV2A 1PG7X 3TO4D 3RFZC 4JS7A 3FYIB 4L2YA 4XN7A 4Y9GA 1W6WA 3G5VB 3GSWA 5DUMH 5J56B 5K93A 3ZHFA 2WYHA 1FJ1A 1QHQA 4IOSD 3DMMB 2XETA 3KLQA 2B77A 1H8SA 3DX7B 2J1WA 2VJ8A 4HHAB 3S0PA 4BELD 5KJ4A 5ISZB 8PAZA 3UAJC 1A4CA 1NFKA 5DJ2A 3QAZB 4QRSA 3CXFA 1X5FA 5JUEH 2W88A 1MI5B 1K8IB 2XNAB 2YBRA 3KWVA 5BXFA 1FZKA 1KZYA 3EYVA 4F8QA 1GSMA 2R8SL 2IC2A 2W92A 4LVEA 3UO1L 4OFQA 4U1JB 3WNLA 2Z0BA 4NO5A 4JFOA 4M4RA 5CMAB 4BFNA 1IGTA 1A1MB 2LQRA 3GTVA 3NJMA 4N90E 4NZFA 4HAGA 3ZZSA 4RIRB 1U41A 2E9IA 4OGQC 1KBVA 1SMDA 2XT1B 4WI4A 1LM8V 5AKVA 1K8DA 4F15C 1MNUH 4TLSA 1QASA 1CFTA 2ZX8A 4YHYC 1XCQA 4KKNA 1N59B 2I27N 4HJ0C 4AV4A 1B3JA 1UWGL 4H25A 2VXVH 2V37A 1UJ3A 4BFKA 1PZ5B 1OB1A 5I1DB 1F4XL 4NUMA 1MQ8A 3PHQB 1FFNB 4P5TB 3IJSB 1ZVHA 3BZDA 3GSUB 4LRNL 4UZGA 3US1A 3GS7A 1RUKL 1OGSA 1XGRA 2CLVA 5AB0A 3WY1A 1P2CA 2A7BA 1ZT4A 3FQUB 3HPLA 1G7LA 2WLYA 5JO5A 1NMAL 4X9BA 1Q0YL 4KX8A 3BEWB 2DWDA 4GXFA 4LNVA 1AZUA 2EYSA 4AENB 1JGVL 4N8CL 1GH7A 4RMUA 1Z7JA 1OP3K 4MAYB 4OB5H 3GSOB 4XPTL 1T21A 5CGMA 4XI5D 4BFFA 4DAGH 5C71A 3GO1L 4X5LA 3ZT6A 1IFGA 1U3HC 3FQRA 5KVEH 4Z7WA 3LNDA 4HAFA 4LAQL 3LVEA 4FQQA 4XRCB 2I60H 3HN8A 4HWEH 3LSOB 1CGSL 4LT7A 3TEUA 3ZKXB 5J6SA 1QSEE 3ZYOA 1BWWA 1N7MH 2BCMA 2XWJB 1KCBA 4OU3A 1URIA 2CCLA 1INEL 1Z5LA 3NRFA 3FN9A 4OQTA 1WQVT 3LH9A 4OV5B 1E6OL 1XD1A 4YUEH 3P0VL 1J0JA 4AJ0A 4XNYH 2C4XA 1R24B 1L0PA 3KBEA 4WFHD 2NXZC 1OSZB 3EBGA 4I3SH 4NZUH 5EF3A 1ZD6A 2ZUXA 1DN0B 2XFGB 3OGOE 2HRHA 2WQRA 3EJZC 4NKIH 5JQIB 2JTYA 2OI9B 1CD9B 4MKTA 4OF5A 4R90H 2E47A 3OJMB 2NUPB 3BUYB 4YSCA 1E90A 1FG9C 1VCAA 1J5OL 1RUPL 2DDQL 2XWBA 4YHKL 5AW2B 3VI4A 2YLKA 1SYSB 4NQEE 3MV01 3DTDA 3O6FB 1HYSD 4TUOB 4UYPA 2FX9H 2IADA 4L3EB 4EAEA 1F18A 1M7IA 2XTJD 4ONGH 5DHVH 3HS9A 4G9FB 3K71B 4KPHH 2BHYA 3D9AH 3L45A 1NGQL 4I3RH 2ICCA 4PP2A 4RFOL 4QHLA 1P9MA 2VSCA 3Q0HA 3D06A 2DWYA 3QUKA 3DI3B 4AG4H 3KMDA 3BQUD 1IQWL 1BX2A 2IAAC 2R23B 2VZ3A 4GMSL 3FPYA 4DPCX 2AK1H 3O4LD 3WJMA 4LDOB 2C9UA 3VFMB 2JJSC 3NIFB 4DW2H 3AUVA 1PL3A 3ETBJ 3ZDZB 2EVHA 4NX0A 3SGDH 4M43H 1A7QH 1Q9WB 2YN3A 3ZK0A 3BGFC 4PPTA 2QPDB 1T5WA 2VTFA 5E8NA 2ZWYA 1KCKA 1QSEA 3IMBA 3S4SA 3QO0A 1E8WA 5JMRA 3QEUA 1QABA 4H7VA 1VSCA 5IQ7L 4A7TA 1BQRA 1OGTA 1YUHB 2ZUSA 3MTRA 2VR4A 4IKIA 2TRYA 4KU1A 3ULVH 3QQ9C 3L16A 3NEXA 5ID1B 1PKQA 4ZUUB 4NT6B 4O2FB 1M2OA 2IH3B 2JJVA 2OXHB 4O5LL 4QT5A 4WTXA 2VMEA 4YIQB 3SE4A 4WI7A 4L9LA 3MVSA 3CFEB 1SJMA 3O11A 4I48B 4Z7OE 3L5WA 1AAJA 1FFOB 1EHKB 3RVWC 4M8VA 3Q8FA 4U6XA 3OPUA 3KPTA 1YYLL 2ZG3A 4MLSA 4B0MM 1A1NB 4R4NC 3W9EB 4W4NA 3IGKA 2VERA 1RUAH 1KTDA 3B9KC 3K6DA 4X6BA 2DLFL 3VWKC 4XVOA 5INDB 2EDMA 3PHOB 3W5MA 2FLRT 4G7SB 1DDHA 1JL8A 4OLWH 2XG5A 4XC1H 5D7IB 3PWNB 3A4EA 1TJIL 3GJFA 3BFQG 4JFEA 5IOKA 2EVIA 3HC4L 4DP0X 2UZXA 2ZICA 4MB3A 5ACMA 4ODHH 2BC4B 3M07A 2EKJA 4P2QD 3OC5A 1QTSA 4GAYB 2V4LA 1YN6A 5DVMA 1TSRA 3C87A 4O4YL 5C70A 3TEXA 4LCUA 3TFKC 3L9RB 1UHVA 1CE1L 3ABZA 4AGQA 1C5BL 4X2UA 5HGAB 4EIZC 5LXGH 2OMNA 5GRXG 1RHHB 1MEXL 5CCGE 3SBRA 1EO8H 1BDYA 2WBKA 5IF0B 5GHWH 3DV6B 2ZNXA 4HUNB 2NY4B 5CINL 4YSAA 2FGWH 4FFZH 4UIKH 5E4AA 4WU5A 4MDJB 4Z7UB 2G5BB 1EDQA 3GS0A 3LS5H 2G2RB 3IWVA 1O5PA 2YJQA 5GS2H 4A7QA 2XWCA 2BIMA 3TBCA 3ILPA 4G5ZH 4QAWA 3F3HA 3TBYA 1B4RA 5HHXL 4Q9BA 1YYMH 1X6NA 5GS1A 3SKMA 1C08A 3VXUB 2CK0H 2VW4A 2P44B 4H5SA 5TGBA 2R83A 3ALWA 2IPUG 1QP1A 3APCA 1J5DA 2B20A 1AR2A 3A4FA 8CGTA 3KBHE 1Q72L 2JKIS 2IANE 1KBGL 5I1AB 5HI3C 3SCMC 1NL0H 3MRDB 2OMWB 1JERA 3O6MH 3FCTB 3MO1B 5BRZA 1PZAA 4N8VA 3VD7A 5IHZB 3R06A 3COOA 2GSGA 2BPBA 2FLBT 3T0EE 1UD8A 3I74A 3O6FC 1WVZA 3C08H 5BZDA 2J2ZB 3EYUH 4WKZB 4H26A 2X9YA 3S7GA 1EEZA 3SPVA 2G9HB 3F65A 1INDH 4LARH 1S7RA 5E99H 2PPAA 3CCHA 1U8CA 2VJ0A 4P9HL 5JW4Q 4UNUA 5IOPA 1TKWB 2OCCB 3CHRA 3R19A 1A6VL 3FTSA 2HG0A 4X98B 5D7LE 1IQDB 1JHKL 1W72L 2NY0B 4QHNA 2ZCKH 2EXTA 1A7OL 5DRZA 5I1IL 5J8OA 3H4HA 2VDLB 2NY3B 4AV5A 4KKZA 3SDDC 4QHKJ 3PAYA 1XF1A 1G94A 4Y89A 4HCRH 2VDRL 1CZ8L 4WTWA 1DFBL 5E2UL 4NCC2 1UCBH 4W6WB 3MYZA 5LN8A 4NWUL 4ETYA 4AEHH 2VH5L 3P11L 3ARFD 5F96L 3ULVF 4LCWB 1V3KA 3EAKA 2JKJA 3B7SA 3QB7C 3QH3B 1PDKA 2ZSVA 5J6GB 2PNDA 4N2KA 3LKQA 4IJ3C 2IFFH 3KM1A 5BS0B 3X3GL 4P2OC 4P9HH 4Y4HA 4LSPL 1R0AH 3LN9A 1BVKB 2PP7A 4JE0A 3SYQA 4B9JA 3GIZL 4NN7C 1SEBA 4NUGH 5LUMA 3MRLA 3M7OA 3B2UC 4JQVA 3RVTD 1QAWA 3NPZB 3NGBB 1N64H 3LH8A 2ZP8A 3WGVB 4KX7A 3TA3B 4N2OA 1E9PA 3LKSA 1NGWA 5C0BB 4D9RE 4YHZH 3O3EB 1RZ7L 3SDAD 4ZFGL 4JAMA 2D9CA 3Q01A 1SF3A 3THML 4GUCA 2WLJA 5IB3A 4IBLT 2MEJB 4DTGL 4MNGA 1AHKA 5EOQL 4ZYKA 5FHAL 3GUTA 3QDHA 5F3BB 1MW1A 3L3GA 4WFFE 3M88A 2CJSA 3TIEA 5F0LB 2VC2H 2IFFL 1I1AB 4P3DB 4H5SB 5TGBB 1UZ6E 4DERA 4I3SL 4AQOA 4P3CL 3RGBA 2AGJH 4E42B 1TUPA 1AH1A 4PJAE 2HLFD 4PJ7B 4Z3FA 4E9TA 3VW3L 2V17H 3W82A 5DMGC 3V5DA 4QJ5B 5EOCL 1FORH 4YEEA 2WVTA 3BXNB 5K1JA 4D7PA 2BSTA 3FZUC 3WIFB 2DH3A 4FA8A 5C0RL 3MJ8A 4JJ5B 3GWJA 4EN3B 4ZO6A 2VLKB 2VQ1A 4K3DL 3H9SA 4TQIA 2ZE0A 4IOIB 1GAFL 2KC0A 5F8RC 5KSVA 2AK4D 3UDWA 3D2TA 2VC2B 1KLFA 4D8PB 2AJVH 3BT2L 4ZDHA 1BF8A 1B6UA 3T0EC 4FTVE 2GJ6A 5AAWC 5T1MB 4LEBA 3VXOB 5I76B 3RWCA 5KYWA 1IZJA 2VLRD 1KOAA 4ZZFA 2OKMA 5FYKU 3HE7B 4E5XA 2HPTA 5I74B 2F54E 1A14H 2BFVL 3SKNA 2R1YB 2WXOA 3MNZB 3FUJA 3DVFA 1X4ZA 2SEBA 5D7IA 2NX5A 4HX1A 2HVJB 4TVSa 5CJOL 5HJ3B 4HJ1A 2VRKA 1XH2A 3PHOA 2VE6B 5BPPA 5CD5C 5DZJA 3OLEA 1BM3L 5DZOA 3VRIA 1GKOA 4PMFA 1AXSA 1DQQA 2X4SB 2H0JA 1TJIH 1YEIL 4GRLC 4LLAA 1MHHB 1OV8A 2AEWA 3ULVL 2Y7QB 1ULVA 2Y07L 2DQHL 3SN6N 2GC4C 5T1MA 1DBJH 3NJKA 4LP5A 5C0EB 1BBDL 3DK2A 1GPOH 3SDDB 1PKQB 4ZUUA 4M6AA 1FIEA 3VFTB 1T03L 5KBPA 1XCTB 2WAQA 3BZ4B 5AG9A 2JFCA 4QGTA 3CGTA 4U7KA 5HHNB 3V6ZB 4BBWA 4Y1AE 4ZAKA 1JRHI 2WKLA 2Y5EA 3ARRA 3QI9A 4YQXL 2R8SH 1DBKH 4K3JL 2EH7H 4YR6B 3FCSA 4YHNB 5DLLA 2Z4QB 3GSXA 1ZLWH 1T1YB 1YHPA 5I1KH 3BISA 3SYPA 4BCXA 2WWMC 3L4UA 3DLQR 2JB5H 1LE5A 3LN4A 1PTZA 3KLAA 4P4RA 1W0WB 4QXGL 3PAZA 4P2OB 1GKEA 4OJEH 3FT3B 3R1GL 5HP5A 3EH5B 1TTUA 5D7LD 1MJUH 2R4RH 3IGAA 5E8EB 1HKFA 3E9UA 4X4YA 5DC4B 4Q97A 2PCFA 2FWOB 3TASA 1GJUA 3DVNA 4P5RA 5DRNA 5IB4A 1XGTA 1ZE3C 4JO1L 1MCEA 3C8KB 5B38A 1CN4A 1CYWA 3T0AA 3W3BA 5KJRL 3GXMA 1AR1C 1IT9L 1JVLA 1QKZH 3AG1B 1OARL 4ZS7H 4LO9A 2YN5A 1VCBC 1CXHA 2YPVA 4UTAA 4ZPTB 3MLXH 4F1ZA 2O6CA 1L6PA 5IQLA 1TXKA 5E2WH 2FEEL 3CTTA 3UZEA 1XV8A 3C9NB 3UTOA 3FDWA 2V2TB 5GS0D 1WH0A 1BVNP 3O3EA 3FN3A 3MCKB 1HXYA 4UDTA 3QDJA 1OP9A 4Q14A 1NGWB 3LKSB 1YPZF 5ITFB 3N41F 5BO0D 5DMKB 3HZMA 5AVUB 1MWAA 1HTYA 1XD0A 1T04B 3AADB 3RWFB 2PXYC 2GEQA 2A4EA 3BQVA 1ZSHA 5C6TH 1D7CA 1L0XA 1UYWH 3C8HA 3OMIB 2UX6A 2Q20A 3ME0A 4JQIL 1BVKA 2KDGA 3JVFC 4Z7WF 5KZCD 2CCWA 3QNZA 3FRPA 3BMWA 3P4MB 4QYOB 3P0YH 1A3RL 3CN0A 2BXZA 3VX0A 4QHUA 2W80C 4OD2B 3FU7B 5EOTB 1UB5A 4NZUL 3GPSA 3PWUB 4QHMB 3I9GH 2UXGA 4DPAX 1J5HA 2CUIA 1QPPA 4CSPA 4ELME 3FRUA 3FO9B 5DJYB 2E56A 3QAZC 5KYUB 1UA6H 1LDPH 2WWMD 2W9EL 5GGVL 4WHDA 3GK8L 1BD2D 1I3GH 2NDFA 4BIKA 5DJXA 3B5GA 2XPGA 3FPXA 3GB7B 1KB5B 5I2IA 5D7SL 3TN0D 1UKTA 2O72A 1S9YA 1IFHL 2OMTA 1XGPB 2PCXA 3N3EA 2V5TA 4N2AA 5I9QB 2BOBA 1CF1A 2Y9RT 4XBPB 3QS2A 2CRYA 2BH0A 3LRKA 1ZCRA 3FQUA 3TESA 1U8CB 3BN9C 3JXAA 3IDUA 5E5MB 4MTMA 1ES0A 1YVLA 1O5DT 2HWZL 3B5HA 4LCWE 4S0SD 3X1GA 2G9HA 2O1AA 1URZA 3LNFA 4PVLA 1EXGA 2X4NA 5CJOH 4CC4C 3PP3K 1N0LB 2NXYC 3MX0A 4PWHA 4JM2B 3V95A 1OTUC 1HL4A 3DHMA 4H8QA 2IDCA 5AZEH 4Z7IA 3RJOA 3GNML 2ATPA 2FTAA 3BWAB 3QFJD 1JZ2A 2BS9A 4UT6L 4GSDL 2B1HL 3HG4A 4Y5YA 3SQOL 4CMMA 1TU2A 1N2RB 5DMYA 5TH2A 3B9DA 2W07B 4Z7VF 4ELMB 3OKLA 2LW3A 3N42F 4N6QA 4GUOA 2OW6A 4KHXL 3O8XB 3CG8A 1C08B 1TZHB 4RA0C 3VXUA 2NYZA 3HZVA 1G7IB 3LKOB 4IRJB 5I71B 3T0ED 5HYQB 3C60B 4NQCD 3D12B 3RDJA 5C0FA 2WBJA 4WU5B 2IQ9L 1R3KA 1NUDA 4AGLA 4UQ2A 4KK5C 3IDGA 1O6TA 4IKLA 1IEAA 3VW3H 3DMMA 2JIXB 2QV4A 1BXXA 4W4OC 4ODXB 4AXWB 3ZXAC 4NZTL 3FZUD 1XIWD 4W9KC 4BK5C 4NKOA 1PX3A 4P2YA 3U7YL 5B7MA 1HWWA 3AQDA 1OAJA 3AB0C 2Q1EA 2IPTL 1QBMH 5CBEA 3WUWB 1E5AA 3QXVA 1NPNA 2VDNH 1CF8H 1VDGA 3SPIA 3S3CB 1LTXA 3BCDA 4L37B 3SD5A 3CVDA 1I8MB 3FB7B 3K6OA 4U1KB 4Y7OC 5AALA 5AVQB 3IS0X 4FHJA 9PCYA 1UQSB 4YDKH 1DN2A 2DMHA 2DBLL 1FWXA 1G9NH 4F37F 4UMGA 5IM7B 3TX4A 4NKMA 5L2KB 1XSKA 4QXUL 3VXTB 5GRVK 3SKOA 1TFPA 3SJVE 4MS6A 3F7VA 3W0WE 3UYOD 5ICXA 4LSRL 1SXCA 4Z3IA 4NGHL 2MIZA 3NRPA 3P4NB 1JUFA 3ZE2B 4K94C 3I9PA 2AZUA 3VTTA 3VACA 3D30A 4HZ1A 4QRUA 1ZTMA 2UVFA 4IDJH 5AWNH 3L5WB 4U1MB 1WBXA 3IKKA 1S5IL 1UATA 4HWBL 1NCWH 4L9LB 3PAUA 1CMOA 5DHEA 1FVEA 3UZQA 4GMTL 1SLUA 3IDMA 3QDME 4NT6A 4O2FA 3OZLA 3O9WB 4KTGA 4HZLA 3ZDWA 4G6ML 5LVEA 3VD2A 2VIRA 5A6IA 1IBGH 2XY1A 4XMUA 2HVBA 3GYRA 2WN2A 4WV1C 4KK8D 1GPOL 5TDNB 4AEIH 3NZSA 4XPBH 3WEOA 5E56A 4OD1H 4OFDA 3KLHD 1CYGA 4HPYH 4OZGE 5C3TA 3QJFB 1D5BB 3MRFB 3U1PA 2F7PA 4N5ED 1WTLA 2HG5A 3FSAA 5DD5L 3OMZA 4IDLA 1XZ0B 3FFCA 1LVEA 2R0LH 3EYOB 4G7VH 3N43B 3LPGA 4GQRA 5E5LA 3NA9L 3HHMA 5F7YC 5I1IH 2ODHA 1MCHA 2K9FB 2ITFA 4ICWA 3RVVD 4JEGB 2YARA 5GJSH 4I4WB 4TVPL 2EDQA 4AUYA 4CN6A 1KGCE 4G8FA 3VXSA 1FYTA 4HP5A 3VWKB 4DP8X 3C60D 3DVGA 3H6AA 1SUHA 5LGJB 4L5FL 4N68A 4PRHD 1H9DA 2X0UA 5ECGA 5BVJA 1QKZL 2Q5BA 1CBVH 2XWBB 3AS3A 3O2DL 5HDQL 2F8IA 4ADGA 1S7WA 1JV5B 2NUPA 2H2SD 2OR9L 1EAOA 2HN7A 4B9YA 5F1SA 4PJ9A 1ITCA 4KXZH 4HS8L 1DN0A 3CZEA 4AM0Q 3GGWA 2VDOL 2EYTA 5I19H 4N0UB 1U91B 1AS6A 1WDAA 4NQXA 4F7EA 5I75B 3QFJB 3TCLB 4APQC 5T33H 5C0GB 1NEUA 2F15A 4MD5A 3C5JB 5ESVA 4M4PA 5B1AB 3QUZD 3MGTA 3OTTA 5F3HA 1FNLA 4ZQTA 2YPVH 4N0CC 4XRCA 3KJ4B 1NGZB 4J23A 4L29B 4M1DH 1XR8A 3NPSB 4OGXH 1AQKH 5I0XA 1V54B 3NSFA 3J07A 4NN6C 1HNYA 3V6FA 4HH9B 4XWOD 1QR4A 3O2WH 2CIIA 3UGUA 5HHPB 3ZTEA 5B39A 3RYMA 2CWRA 1NPUA 1RULH 2OV0A 5E2VH 5KSUB 1LLAA 4C47A 1DANU 1L7IL 3BKYL 4N8UA 4Y16A 3WNIA 1SQMA 4KXCA 4N0YL 4PJDA 4IOFC 4ZUTA 1X4YA 4W9FC 4MNQB 3RY5A 4AYMC 1FZOB 4OLYH 2K9UA 2Z8RA 3V6OC 1USZA 4QRAA 2OMXA 3KE0A 5D7KE 2J44A 2E27H 3WFEL 2H8PB 3I6GA 4LKCB 2YD4A 4WUUE 2AITA 3WFDH 3ZL1A 3HI1B 4WW2F 3GMRA 3WLWC 2VM3A 3MYJA 4OCNC 3HG5A 4MAUL 5LGJA 4PWGA 4WVRA 1UFGA 1SHSA 3V55A 2BJML 2CJTA 1NCAH 4BFGA 4YFDB 2ED9A 1ND0B 5KZCB 1HAUA 1NUNB 4JQIA 4JRFA 1G9HA 3C2AL 4POYA 3HAEH 3KL5A 4TUJB 4TULH 3VSUA 1MCQA 3MLVL 4KO5A 4XE5B 1RUMH 2XWTA 4OZIB 4M1GH 5C97A 4PJ8D 4AKQA 2B14A 4U1JA 1NAKL 1VZHA 1JZ5A 3TBSB 4F3FB 3WIHL 4U6YA 3X14A 4L8SC 5TF1L 3T8MA 3NJVA 2IH8A 1FAIH 2EDLA 3BUDA 3EDDA 3L5HA 1VGEH 3GTNA 1VAHA 5IVXB 3HBGA 1TQWA 5AKRA 1BBJB 5CFAA 3UZEC 1IM3D 4PJFB 4P59H 5HGBA 4JNXA 2V33A 4NFDA 4D0DA 3PWPD 2JK5B 5C8JB 1KXTA 1YMMB 5ANHA 3BKCL 4CNIA 2Z93A 1IE5A 4JKWA 1JI2A 1Z1WA 3MV11 3PGDB 5HHVH 4X5WB 1W0YT 4PJ8A 4PJHE 5GSVA 3RGVC 4W93A 4LGPB 2XZQH 3SE6A 4QTFA 2IV9A 4WK2B 1NBZA 3UZVA 25C8L 4MJ4A 1QFWI 4CVUA 3FMGL 4FQIH 2E7MA 1GS8A 2ILLA 3KPLA 1RJYA 4G6KL 2FLMA 5F7DB 1XXFC 3NCYS 4GBXA 3HE6C 5C0DA 3VXTA 5L2KA 2Z7ZA 3KHQA 3DUUA 3AT0A 4XMKL 1YMME 1JHLL 3SDDD 3ARDA 4OF7A 2Z7WA 3OJVC 3LQZB 2E5EA 3QIUA 5T1JA 3S6CA 4XZUB 1O9ZA 3HE6D 4ODUA 1CFNB 1CICC 1PBYA 3MUUA 4J8QA 3IFNL 3NABL 3MUZ1 4YXLL 2Y06L 1YEHL 5CLXA 4L8DB 2Z1PA 4X6CF 3UZVB 5IVXE 3HAEB 1CG9A 3OB8A 4FQJL 4KKBC 3U0PB 4ZMVA 4CSTA 3Q8CA 3CIAA 3UL4A 3MRGA 3PGDA 1IBBA 2BY0A 1KTLA 3EUUA 3OKEB 4HXAH 3GRWA 3SPJA 4LLQA 3F7RA 1PLGH 5IROD 5D1QB 4AXWA 4M61A 2JIXA 4BFBD 4JZNB 1E0OB 2FWLB 1QZNA 3BSGA 4U1IA 3MCLH 3SPCA 2FJSA 3DDFA 3D7PA 5DWUL 1OAQL 5L4IA 3DYMA 1U8KB 4RMTA 3GEWB 4UQIM 3FQNB 4IEFB 5ES4B 4NN5B 1T3FB 2YRLA 3J8F7 1MW3A 1QUNA 3QFJE 4IU3B 4M93C 4M8QB 3WE6A 5CZVL 1EDYA 2W94A 3C2AH 4JKLA 3BAEL 4AVIA 1BMZA 1JI1A 1AIFB 1VERA 3BRFA 5K9JL 4CVXB 5IFJA 5FFGA 3TTYA 3TPKA 3RUGF 1SDYA 5CCHE 4JFDB 3S34L 1ZT1B 2XWTB 3TCTA 4OZIA 4KWUA 3MOAH 2FO1A 2V5SA 4NXKA 2YC1B 4FQHB 4HDIA 4UT9H 2ZD0A 5TH2B 2NY2C 4S0TD 5CJQH 1RL1A 4EN3D 4PSRA 5KVGE 3CE1A 3DO3A 2BX5A 2O6EA 4ILDA 4JFXB 4DUWA 1HQRA 2BW4A 4P59L 4N1EA 1I85A 2YQ2A 2JELL 4XR8C 2ZG2A 4XNBA 3C5SB 1F1AA 4IMLB 1ACYH 5D5ME 1QSFA 4NYLA 1U3YA 5BJTA 4GG8A 1R3JB 2A77H 2BZDA 2K6WA 4TSCH 3EH3B 2VABA 4QRRE 3ZTJH 4Z77A 1A8JH 2A74B 2ZUQB 3EFOA 5D71L 3LQAL 3T0WA 1LMIA 4ONOA 4ZMZA 5HHOA 5FB8B 3Q2VA 1Y0LA 4WUKH 4Q9QH 1JK8B 4ESKA 4LQFL 1KN2H 3CFDA 3QPKA 5AENA 5HYJB 4Y16B 2FH8A 1WUNT 2Q76A 4X4KA 1RHFA 1HCFX 3P3RA 1PF3A 2QPSA 2A2QT 3PDGA 4H1LA 3IRPX 3L9YA 2H6OA 3WFCH 3VGHA 2MFNA 2XQBH 4JCWA 4JHVA 1H3TA 3RY4A 3SJVD 4DK5A 1MREH 3OKYA 2VDQB 3QJSB 4Y1AA 4DP2X 2H6UA 3DI2B 3KYMB 3ULUF 2XN9B 3WFDL 3SPGA 1RIUL 2PYED 2JKTM 2K8QA 4ZAKC 5I1LA 2QQLH 1P4IH 1JV2B 3IDNB 1OSPL 2XZCL 4J3VA 4OD2A 2EH8L 1MF2H 1XT5A 1CYXA 3MV9D 4KPHL 1NOFA 2FL5B 2X9ZA 5BS0D 2YAPA 3Q5OA 4Q58C 3WY3A 3NTCL 3FRPB 1C1EL 4QTHA 3BGMB 3BW9B 3N85H 2NSMA 4DK6A 25C8H 4JKMA 5I23A 1DJHA 1M9WA 3ME0B 4L1SA 4R7DA 3SOTA 2EYTB 5DSCB 1DZ0A 1NCBH 3ETBF 3QJUB 1KF9B 3B34A 1P7KB 2D4FA 3GHPA 4UT9A 3ARFB 5TE4H 4NC0B 4X8CA 3C6LA 2WAHA 4RBPK 1QR1B 4J3OF 5ICUA 2OSLA 4R9HA 2WLLB 3VFWA 3F7YA 1BFVL 4HPOL 4RMSA 2IWKA 1DCEA 2HH0L 3F7KA 3V79C 2ZWZA 5KUKA 3UTSB 1AI1L 4G82A 2R59A 4LLYA 2ADFH 2UXVA 3LEYH 3V0WL 1PSKL 6TAAA 4GG6E 3TN0C 2M1KA 2EE9A 3N91A 4AMKH 2Y5TB 3LB6C 3ZGIA 1PLAA 2HFGH 3V4VH 1MY7A 2FUTA 3N41B 2ITCB 4TNFA 3TIDB 1IJNA 1CU4H 1DJWA 3AXIA 2UVEA 5LDSA 1E4KA 4DUXA 4X4YB 2IWEA 5KBMA 2HRLA 3FT4A 3MNWB 1LEKA 3RVVC 3L3OB 2X4PA 4PVMA 4X6DA 4N4YB 5AD0B 2VZSA 1JNLL 2H5UA 2HG5B 2NUTA 1E67A 3EO1B 4Q0XH 1WEJH 1KLUB 4JHBA 3QZPA 5GISH 2BP5M 2J8HA 1JGVH 3UOAB 1Z3RA 3VD3A 1F5WA 2BJMH 2OJ1A 2EIZB 3LKNA 5JPMC 3BVXA 3HOGA 2DQIH 4KV5E 1N68A 4GSDH 2HT3C 5DI8A 2A9DA 4KQ3H 3NMEA 5HHNA 3U4EA 1PCXA 3UCRA 1OP4A 4TF4A 5KS9F 4U6HA 1SEQH 4B9PA 4Y19D 4KK8C 3BPOB 2CXGA 4NRXB 4HZLB 1G5AA 2ARJB 2BIHA 3VFRA 1XGYL 3L1FA 3PHAA 2Z1KA 1A7NH 1LP9B 1NANI 5TQ2L 4NQDE 5GGQL 1Y6NR 4BK4A 4X5XA 2GFBB 3KNBB 4TSBL 3AG2B 3T6ZA 3NQIA 2E86A 3DTUB 2HA1A 3H7BB 4FJZA 2BVPA 4YHLL 3PGFH 1CT8B 3L08A 1S78C 4DUVA 4YZFE 1JPTL 4K5OA 5J13B 1OT1A 1NSNH 3F01A 4LF3A 1BVOA 5MHSE 4OKVA 4X9FA 2HVJA 1NJ9B 4LHUA 2XX0A 4RMQA 1J9TA 4TNWF 2R1YA 5K33A 2YGVA 1U8JA 4HMDA 4G6MH 3WKNA 4E9SA 1UQSA 4HUVB 1IM9D 2D03L 3CSFA 3RL1A 1ASOA 3H55A 4FQXC 1I8MA 2NZ9C 2C3VB 4LRIA 4N87A 2C9QA 3OWRA 2DZEA 3MLYL 3SIKA 3VFGL 3P02A 4A39A 5CLYA 1CPUA 3CXHK 4KKLD 4X6EA 1UKQA 1XGYH 5E95B 3HW7A 3BP7B 4GKNA 1VGKB 5GZND 4WUUD 1CLOH 1YNKH 5EU6D 1MFCL 4ODXA 1A4KA 5GGTA 4LVHB 2CCVA 2A0LD 5ISZE 5I6XB 3KVQA 4I9WE 4QXUH 3KWWB 4DKEH 5T3XE 3MJ8B 3DRTA 3HZYB 4HOMA 3KPQB 2AXGA 15C8H 1I7UA 1VPOL 2JTDA 4R5TA 3EJYC 3BXNA 3OAZK 4PRDA 3HG3A 1PVIA 4YOKA 1F2QA 2IG2L 4YPGB 1IC5H 1T0NA 2WWOA 4KKLC 3QZNA 4I0PD 2NSXA 1I7TB 1DL7L 1HQ4A 3W5NA 3AU1B 3II3A 1BFOA 3HZVB 1GY2A 3LKOA 4IRJA 5SWZA 2RQ8A 4ZQKA 3BAYA 4XOEA 5EUKA 5GZNA 4TVPH 3ZTJG 4N0FA 2EXSA 1QX1A 3OPZL 1TR7A 3FT0A 3RWGA 5TE4L 5F3BA 2R2EA 3F12B 1N10A 1PZDA 2AJ3B 3VXRB 4X7TA 4I1PA 2E59A 1B3IA 1G7QB 4AITA 1SYVB 5JHDD 1JZHA 5IT2L 3MBEC 3WL9B 1KPRB 3IJHB 5IB3B 2F5BH 1S9KC 2DQMA 3EG9B 5AKTA 3VA6A 5KTEH 1EXHA 3WLBB 5A2IH 1R75A 2KMWA 1NPJA 4Y5VB 3WV0A 3T3PB 4N26A 5JLZB 1VFBA 2R1XB 4LLVB 4AYDC 2ZYSA 2AKRA 3SQBA 3QUGA 3DIVA 3VFGH 1OARH 3V6BR 2A83A 4MXVE 3WFCL 2F54D 1RZFH 1TCMA 3IMUA 4QOKE 3BP4A 1OF2B 5FYLL 4ZW5A 4FL4B 3DXAD 4YHMH 1HJBC 4G9FD 4AIZB 1IFRA 4L9LC 1LDSA 2EXWC 4LCVA 3PP4H 3VX1A 3P40A 3LKQB 3TN0A 4PJ9C 2VB5A 2V8MA 3DVIA 3FONA 5E8OB 2CHZA 5GRJH 4XVJL