2OA9A

Restriction endonuclease mvai in the absence of dna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
246
Chain Sequence
MKSMSEYLNLLKEAIQNVVDGGWHETKRTGIGKTFEDLLEKEEDNLDAPDFHDIEIKTHETAAKSLLTLFTKSPTNPRGANTMLRNRYGKKDEYGNNILHQTVSGNRKTNSNSYNYDFKIDIDWESQVVRLEVFDKQDIMIDNSVYWSFDSLQNQLDKKLKYIAVISAESKIENEKKYYKYNSANLFTDLTVQSLCRGIENGDIKVDIRIGAYHSGKKKGKTHDHGTAFRINMEKLLEYGEVKVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restriction endonuclease MvaI is a monomer that recognizes its target sequence asymmetrically.
pubmed doi rcsb
source organism Kocuria varians
molecule tags Hydrolase
molecule keywords R.MvaI
total genus 70
structure length 246
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oa9A02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2oa9A01
2ODHA 2OA9A 2Q10A 2OAAA 2ODIA 3IMBA
chains in the Genus database with same CATH superfamily
1BZ9A 1CXKA 3IAPA 1E9OB 2OMZA 4MJ6B 3DSFL 4LLQB 3BHBB 3KDPB 3UZEC 4JQVC 3GM8A 2OSYA 5T5NG 3PWPE 1PZCA 4UM9A 4YLBA 2IGFH 2G60H 5FB8B 5EA0H 3EJSA 3ILQD 4UQ2B 5ESQB 4DKDC 4AC2A 5GS3A 5JZ7D 3OD3A 4JO3H 1FNGA 5HY9A 5K93A 2EDBA 3GLAA 4BJLA 1X5MA 4X7DC 5DHVA 4HK3J 4KQ0A 2AAAA 5AKTA 4UOJA 4OLYL 4LB8A 1J11A 5C3IA 5MHSE 3B34A 2IGFL 3SD5A 4F7TA 4E36A 5BPPA 5B1CA 2JJSA 3M88A 1MDTA 4L1TA 3H7LA 1MAKA 1JRHH 3V9EA 3BOVA 5IJKA 1HEZB 3ECVA 3GZPA 1GGIL 1ZA3B 4Z7OF 2WZPA 4PWIA 2Y36H 3ZOAA 2R0ZL 1N8OE 4HIPA 2VXQH 1DBJH 5F8RC 3S2AA 3KL3A 3FKUS 2PP9A 5GJSL 5AZUA 4BCXA 1B4TA 5C6TH 2AEWA 1FLTX 3BWUF 3I74A 1O6SB 3QJSB 4K8RL 1M6OB 4F33B 4QHPA 4Y8AA 4PAZA 4LHUB 1D5XB 5FYJU 3U2JA 2V9UA 3B9KB 2YBRA 4P4RA 5DD6B 5J56B 1EEYB 1H3WM 1SEQL 5E6RB 1LEKB 1NCGA 5T3XE 5L9DH 5G4NA 2XFXA 2I26N 1Y6MR 2EZ0D 3GXUB 3AGVA 3VDBA 3PIQA 1QSFD 4LHQB 2W0FB 4JLRB 4U1IB 1OGSA 5BZDB 3MX0A 4M5YH 1JWUB 4Z3EA 1U2HA 2A73A 4L9LC 3IMSA 1D2PA 2O26U 5F9OH 2D2OA 3E80A 1RUPL 5DQ9A 4YDIL 1BFVH 4CGUB 2A2QT 3T8XB 5C0EB 1ACXA 1SN0A 3GSNH 5F9WB 2OMVB 5A2AA 3WE1A 2HVBA 1FG2B 1PX3A 1F8TH 2A6DB 1XGPB 2NY1C 4UQIM 3H2PA 5TFSH 3MJ9A 2Y0SA 3EYVB 5KSBA 1A5FL 2XX1A 2DQUH 1VFAB 3JYBA 2H26A 3OBAA 4KDTC 3BH9A 4OZFH 4N0YH 1CF1A 4NRZB 3AQZA 3STZA 3K7UA 5SWSD 1XXDC 4DGUA 3WIIH 1GPOH 5IHZB 5AYUH 4P23C 1E5UI 4Y16C 2WLJA 1AE6L 5LCVH 5DMYA 5H4YA 1HKLH 1WRFA 3GXIA 5I1DB 2ZUWA 4NKQB 3VMNA 1I8MA 2YQGA 3CNKA 4U2ZA 4JVPA 3GMLB 2EDHA 1XIWD 1KTBA 5KYXA 4LLMB 2LU3A 3E8VA 1FVEB 3L81A 3DX8A 2Y1VA 1KTLA 4PG9A 4A7SA 3UAJD 3NH7H 2WCSA 5GGVL 4PGBB 1N7MH 4Y4FA 5DHMC 3RBGA 5CEXB 2I07A 3S35H 1ORQB 3T3MF 2I27N 5EZOH 5D5MB 5BXFA 4BK4A 4PJ8D 1WBXB 4YWGH 3VFWB 1HHJB 5E2JA 4H88L 3MAWA 2DI9A 4OJYA 1PLAA 3ZXAC 4FNRA 3WYRA 4RFNC 1MFBL 3MDJA 3FT2A 5HYJB 2DD8H 2NZ9D 4DW2H 4ELMB 1AZBA 1PZ3A 4HD9A 1HHHB 3SYAA 1NBVL 3TBTB 1PZ2A 3SYPA 4ONFL 3VH8G 4C57C 3P1VA 5L2KA 1TZIA 5IZ7A 3GJEB 5C0RL 3EYVA 3H7BB 4PCYA 4A6YB 2C5DC 2C3XA 4JHWH 2NY5C 4ORGA 2NYZA 4HSQA 2CWRA 3RVXC 3MV01 2QFRA 2YPVA 3NFSL 2FX8L 4X7SL 3O2DA 5BOZG 2UXTA 4XNUL 2FATH 4PJAA 3N06B 1RUQH 3WDJA 3T8XA 5E99L 2KZWA 3TT3H 1DLHA 2XWCA 3AM8A 4GAGL 1T66C 4NGHH 2VLKB 1URZA 2P5EB 3WY3A 1EZLA 4KNSA 4ERSH 2OMWB 3S35L 3U6XS 3ULVD 4MBOA 1OB0A 4NQEE 3L1OL 2R1WA 4FS0A 5F96L 5I74B 4OKVB 5TPWL 5JOFB 1KCKA 1SYVA 1WD9A 5GHWL 4QLRA 1OCRB 2IG2H 3DWTA 2NQCA 2OJEA 2VOTA 5MP6L 5EDSA 3CFUA 3BISA 3D9AH 1UATA 3N04A 4HKZA 3AT0A 2XNAB 1HYSC 3WGVB 5FYKH 2GAZB 5CGMA 1NJ9A 4LLYA 4MS8C 3HVDA 1MCWM 5I8EA 1EAPA 3KGUA 5I1HL 2VDLL 1NEPA 3IE9A 2MWCA 4H40A 4PREB 1KSRA 1BVZA 3EHBD 1PJWA 2A9AA 2XN1A 2FATL 3B9KC 1ZLEA 4LSPL 1QSEA 3NRPA 1AKJA 1JI2A 3R18A 1NUFA 4WI5A 1D7BA 3TEWA 4K7PX 1J9TA 1I3GH 2IAND 3CHRA 3LKPB 2HXAA 3DPDA 4IMKC 4GO8A 4KI5F 3EOYG 4X9HA 4ZNEE 1X9RA 3GI9L 4OIFA 1UGKA 1GGBL 2GI7A 1TQWA 3UCQA 3QHTC 4H8UA 4M8UA 2PO6C 5ACZA 3L17A 4J1UB 4WUUA 5C0DA 4K71C 1QRKA 3TTYA 1TTRA 5E8NB 2VXUL 3G6JE 2Z31B 5ITBL 5B1BB 3HE6A 4OY9A 3S8FB 2D7TH 1NCHA 2XRAH 3MLXH 4AOFA 1AP2B 5I1EH 4P07A 1YNLH 4OLXL 3FUNA 5HYSB 3VWKB 2CNYA 3QQ4B 5L88L 2Y5TB 4GUPA 5G5DB 3KAAA 3QIWC 1SYSB 2DEXX 5C86A 2WSPA 4QHMB 2CDEB 3ARGC 3CDZA 1LHZA 1TNMA 1AC6A 1RZPA 4ETQB 1IC4H 1OZUA 3H9HA 1XCXA 4J4PC 4M02A 2ICWI 1KGJA 5C92A 4M62H 4F57L 2A73B 5FV2A 4PYGA 1FQ9C 3MNVA 4KQ4L 5CINL 4KXCA 5FUZH 2WQRA 1IJNA 4IBTA 2P5WA 4JM2B 4EUPA 2NY3B 5IVXB 1Y1UA 4GLRH 4TUOB 3K2MC 5IMKB 4XGZA 1KBKA 2ZOWA 3C5SA 4BV1A 1YEHH 4M6ML 4LCIH 1J18A 3KPRD 1XSOA 3UAEA 5CINH 3TBVB 3H54A 3MRHA 4TUKH 1AHWB 1OQOA 1CFNA 3FOMA 3KR3L 5BVPL 4HPHA 3TBBA 5SV4A 5AAWC 2YRLA 1MAMH 5CJ5A 3V0IA 5BS0B 1X5FA 4JRYB 1JGEB 3PP3K 5J13B 2X1WL 4P2OC 1IGML 1CTMA 2N7SA 2JXMB 2ZUTA 3W57A 2ADFL 5IFHL 2BSRA 1Z3GL 2BNRD 1EANA 3P3YA 4KJQD 1Q9KB 5KTEH 3X12A 1I8KB 3BWAB 4B9ZA 5AVVB 1AQ8A 4PWKA 4PEEA 1E3ZA 3BMVA 4HJ0D 3FB6B 1JK8A 2ESVE 4KYWA 2ZKHL 4H1LB 4G7YH 1S9YA 5I5JA 1THAA 4XO4A 3T0WA 4JDTL 3LZFL 1ZLSL 2DQTL 2ALAA 5FOBA 5TTRA 3U30B 1D5ZB 5HI5D 4D8PB 1OP5H 2G9KA 4LSUL 2IANA 5EFIA 5GJSH 5DVMA 4JRYD 4QRBA 3UMNA 1DUZA 2NY4D 4YC2B 2Y2YA 2WBJD 3CHXA 1ZLUK 3PGCB 4KU1A 3GJFK 5TQ0L 4Z7VE 2AXGB 2WYTA 2JVUA 4J4PD 4S0HA 4LSQL 3BMWA 5AW1B 1KIPA 1BF2A 5FYKU 1B88A 2I7SA 5I6NA 5EEUA 5IW3A 3QDJB 1KFAL 1Q9LA 2NNFA 1AY1H 1XR9A 3HI1B 2JB5L 3DX2A 1OD7A 1A6WL 1M53A 4NNYA 4PGDB 4WI7A 1PNDA 1P4UA 3HUJB 2ZT9C 1ODAA 3S5LB 1U8HA 3UTSB 3CQPA 4KKBD 2J1WA 1YSOA 2IOMA 2FX7H 4J8QA 1E5YA 4JFHD 3I9GL 2WKOF 4O02H 4JN2B 2WMPB 4NQCE 5FECB 2YPLA 1T2QH 4L4VA 2DQCL 4N2CA 5JOEA 4YIQB 4HZLA 2MSPA 1VSCA 3RWHA 1DFXA 4OTXH 3AU1B 2Q3ZA 3SBWC 3V0AC 5BMFH 5EF2A 1XF2B 2XZCH 1NANH 1RK0A 4M1GL 2XWRA 1U3HA 3T65B 4U3HA 4WENB 5K1JA 4ZDHA 3QORC 5HHMD 2UZPA 2QHRH 1PLBA 5J0BA 4TVSa 2XZZA 5DCCA 5F7LB 3QNXA 4HBCH 4IIQA 3UZQA 3OKNA 1E28B 2DYPA 1AYOA 4HKXA 1MLBB 3UCRA 4NKOA 2X70B 5GGRB 3ABKB 3FT4B 4PU2A 3BAEL 1TSHA 2LLNA 1E4WL 4L3FA 1XGTB 4AIEA 1YAIA 4MMZB 1U8MB 2JKJA 5GRUH 1OGPA 4PP1D 3V6BR 2I24N 2V0AA 1WZMA 1G9NH 4GKSA 3K4DA 5AZEH 1ZTXE 2C3GA 4M03A 5JHLH 1C5BH 1NBYA 3QUMA 1XH3B 2IWEA 2QQKL 2EXWC 3NTCL 2C26A 4PRDA 4GH7B 1HT6A 5AOJA 2EVGA 2DICA 3IS1X 5TDPB 3L3KA 2ZAGA 3NP4A 1UXWA 4K7FA 3LXUX 4YZFF 5B3JE 4UNIA 3ALPA 4LASH 2BDNH 1SBSH 3B6SA 4LCWB 1P6FA 5TQ2L 1C5CH 2F15A 4HEME 5D1QC 2UWEE 4L8BA 1E5AA 1JVKA 3QUKB 4DOHE 2C8NA 1NCCH 1HILB 3K0YA 2P43B 3LD8C 1KENH 4HJGA 4UUJB 4AMWA 1CTOA 4FI6A 5KW9L 4NAMA 3MRNB 4HCRA 3TBVA 3ECBB 2NX5E 2CCWA 4WFED 3VFUB 5L2KD 4C4UA 3UBXI 3BUBA 5C08D 1TYRA 2EDDA 4LNRB 4ZZKA 1FV1B 3D8MA 5BNXD 1YEJL 2VWEE 2QKIB 1H6FA 1A8JH 4XMKL 3PWVB 1KELL 2X4PA 1K8IA 4AIZB 2OX5A 1KELH 4LPCA 2F6AA 1IAMA 4CW1B 5JDSB 4MA3B 1UQSB 1E2ZA 1EBAA 4PVMA 4D2NA 3VFSA 4NC2B 4GAYA 2W65B 4HSAC 4HJJL 3IDJA 1D5RA 3ARUA 5DWUL 1KCLA 4ZUUA 3S37H 4RLDA 3UIZA 2PW2A 1RK0B 3WN6A 2V9TA 3CVDA 3SGKC 2GUOA 2FYYB 1Q9OA 3IDGA 1TNNA 2IPUK 1H5BC 1DL7H 3KWWB 1TENA 2MCPH 4YHOL 3MFFA 1OTTC 3FT0A 4AUJA 3SDAA 2CDFA 3BIKB 1CXEA 4FTDA 2ZWZA 4NJAH 2VXVH 3DUSA 4WRLA 3FUMA 4JFQA 4X7FC 3T6ZA 7PCYA 4OU3A 1D9KD 4X7CC 5AOZA 3NABH 3FU6A 4CU7A 1TZAA 3B2VH 1NANI 1MFVA 1UD8A 5D7JC 5ELIA 2CQVA 4MJIA 1NKGA 1U3HD 1KJ2B 3EFDL 3QEGH 3RWDB 3LEYL 2NSXA 3L4CA 3DO7B 4YE0A 1MIEL 5D70H 1M9WA 5CBEA 3R4RA 3KGTA 4HZ1A 1CQYA 4DQAA 2E47A 3OB8A 5I0WA 2WLIB 3FTSA 2X6UA 4XCEB 2MCMA 2PNDA 3VI3B 5C7XH 2IMMA 1QA9B 2BVQA 3I6GB 3J07A 5C7XL 3MJ8B 5CBAB 4F8TA 1KIPB 3VD4A 4L8SC 1LE5B 3WN5B 2X4SA 3C5JA 3VDAA 3IJ8A 4AITA 3CSTA 3LVTA 4K71B 2BP0B 3LKNB 2JQAA 1PKQA 3V9CA 1X9UA 3G5YA 1IFGA 2E9JA 4OB5H 5BUGA 4S10A 4HWEL 3EDDA 4YDMA 5CZRA 2XVGA 1PX4A 3NPSB 4HK3N 4FNUA 4JHAL 4LVEA 4FMVA 3LPWA 3H2WA 2WLNA 5T1LD 3LKRA 1QLRA 2ARWA 4TNWK 3VWKC 3HRPA 3Q2NA 2WTOA 4FULA 3WJLC 3VG0L 1SMDA 1S5HA 4KDTA 5DTFB 2J2ZA 3PL6D 1U91A 3EJZC 1RI8A 4JVUA 3HPJB 3QUHA 3W56A 1A3LH 3Q0HA 1PZAA 4M6MH 2WXNA 3C09B 1DQQA 4TMPA 3V4PB 2BCMA 4OKVA 4PJGF 4OZIF 4QRTA 1L6PA 2WWKT 3NJNA 4DP6X 4ZFOL 2A9BA 1M7IA 2CO7A 2WNWA 4N0FB 4L3ED 4PV9B 1OOAA 3FUIA 3AFLA 4F2ME 2HH0H 1TF4A 3EKCA 2D3VA 1FFOA 5DD1L 1AS6A 3DX0A 4Q9QH 1JGEA 4F3FA 1YPZA 1AZNA 5DJDB 1U8IB 3MOBH 2WXFA 4Y1SA 5FO8B 1HHGA 2XQBH 5I9QB 2F1BA 4PJCF 5T3XH 4DFHA 1UZ6F 3IFPA 3P0VH 2Y2WA 2APSA 5EC1B 1GSKA 1HI6B 1L0PA 3X1GA 3KPPB 2DIJA 3SGDI 3SQRA 3E1ZA 4XMUA 4HC1L 1X7QA 1M7DA 4X6CB 1R24B 5J13C 2LR4A 3JYCA 5TK4A 3WEAA 3OX8B 2J5WA 1G5GA 3APMA 4I88A 3C2AL 4UAHA 4OM0L 1K3ZA 5C0GB 3WFCL 5DURD 3MV8B 2HMID 1JPTL 4W9DC 2QVMA 2DQMA 2KQNA 3BKJH 3GIZH 3HUJF 3JSSA 4Y5YA 5C0BA 2PVIA 1JGDB 1UVQA 3IETB 3OAYH 1A4AA 4ZFOB 1IAKA 4PRHB 1E43A 4QWWD 1QSVA 5CEYA 4NRYB 1LK3L 5CEZE 4L1DA 2WSKA 3GNML 4L18A 2BVPB 2QLYA 5GGTL 3V6OA 1HNGA 3MRGB 4LOUD 3DYMA 2GSIB 4J3BA 5CO1A 1KXQE 2XETA 1WICA 2BOBA 1VZGA 4P2OD 1QNIA 3QHFH 5HI3C 5E5MA 1ONQA 3H3KA 1SQ2N 3MNZA 4N26A 3PGDB 1G6RA 5DRWB 5KVFH 3RHWF 1OAXL 2X7LA 2Y5EA 3PWNB 1KTCA 4JPVH 4X7TB 2XCMC 5HDQH 2Z31A 5HHVH 5IQ9A 1NMCB 2BVTA 5GGSA 2VDRB 2PTTB 3U4KA 1BWMA 3G9AB 4L3EE 5JLZA 2OSXA 2B3RA 1S7XB 2GW5A 1P4LA 1SN5A 1NGYA 4FNTA 3NQKA 3ROOA 5HYSG 3G9VA 4W6YB 2GSIA 3VU2A 3B7TA 3FPYA 4OZHE 1VFBA 4QAMB 1JE6A 3AY4A 4NIKB 5KUMA 3HE7C 2IBZX 3SE4A 3MLVH 1CWVA 2XTJB 4MDIA 3ZDXF 3C6LB 4C55A 3NZHL 1OAYH 1U8KA 4JFDE 2FECL 2OULB 3DV4B 4PRID 3U7WH 1I3VA 4GMTH 3VYNA 2AQRA 1Z7JA 4LQ1A 4I85A 2GYSA 3TN0A 2NSQA 3GNMH 3PL6B 5JUEL 3TIDA 4YPJA 5FCSH 3TVMA 4OSUH 5DJ0B 4ACTA 5H4ZA 3ARGD 2EUVA 4QHNA 1N4XH 1BVLB 2Q10A 3SDAC 4CVZA 3ABGA 2FSEA 2HLFC 3IDXH 3P4NA 1S7SA 4ZUWB 1B4LA 2FWOB 4KTDL 3AADB 4ATTA 4CC4A 3ULVL 3QSKB 1FC2D 4AEHH 2VL5A 4X5PA 1WE5A 2EDQA 3LN9A 3DPBB 1LO4H 4TNWF 1TQVA 3H42L 3ES6A 4IOIA 3PGDA 2PCPA 4WNSA 5DJYB 4OGAD 5FYLH 2OMWA 1UD5A 5DZVA 1IM3D 4B27A 1Y6NR 3TNMB 1QTPA 3G6JF 2Z4QB 3TVMB 4ZFZA 2BXYA 2EEBA 1QNZH 3ME0A 4J12A 5FX3A 2AEOA 4JE4B 1ZIBA 2DQGL 4LGRB 4NFBA 2ESVB 2CJ3A 4UU9A 2Q2LA 3X3FL 1ZS8B 4NO2B 2IALB 4GO6B 4AZ8A 1C7SA 4YHPB 3OZKA 4YBLB 1YMHB 4RISL 1JL8A 2H0JA 1JMXA 1Z3RA 1C08B 2H41A 1QG3A 5I18L 2GTWA 3ZZSA 1V3KA 4U3SB 2D3LA 1LP9E 2JKNA 1C12B 3EGSB 4Q2ZB 5HP5A 3MR9B 2ZX6A 2FQFA 2X09A 3MRCA 3EOAB 4MA7L 1BMZA 4ALAH 4NCDA 4WJ5A 1EJ8A 4HGWB 4N0YL 4PJBB 1OAJA 2FQGA 4AL8C 3WDHA 2Z92A 5F3HA 4IU3B 1QKZL 2ZXBA 3MXWH 1L7IL 1MJ7L 4YSCA 1V7NH 4MXWH 3ARBD 5LGJA 2J43A 3Q5YA 3BHBA 4GMSL 4A7TA 5I6MA 1I7TA 4ZO6A 3DIFB 3SPHA 3N91A 4N68A 4IKLA 3RJQB 2VDRH 2DN7A 1Z9NA 1Z9PA 4LEOB 3MLZL 4XB8A 4KX7A 1AQHA 4JM4H 2W07A 3KPQA 5ANHA 2C3HA 4HOWA 4XN8A 3CBRA 1CICD 3SBRA 4C4BA 3WY2A 1I8MB 5D7IA 2YBGA 3GBMH 2NY2D 4LCIL 4OF8A 4Z78B 3IETA 1OSPH 4OVVA 5BJTA 4PWEA 5D7JD 1XV8A 1Z9SB 3RIKA 1AI1H 3C8HA 3GDCA 4OF3A 4D9RD 1YQVH 2EYTB 3BIKA 4PBVC 4NXSA 4Z3JA 3LDBC 3UGXA 4ZFQA 3OMIB 1QLFB 3EUDA 2X3AA 1I8AA 5FFOA 1KT2A 3DMMD 1YEIH 3OHXB 5GS0C 1X7QB 1GMEA 3WAKA 3N1GC 3O2VH 3VWJA 2H32B 1XGQA 1XH1A 3ORJA 3QPXL 1Q94B 1RJYA 2VXVL 1X5XA 1RL1A 3M17B 1XCTB 3OKKB 2WYHA 3L3GA 2WVVA 4LLUB 1NUNB 1NFAA 1DJSA 5AVXB 5D7IF 4RA3A 3AS2A 2B5IB 4ZFGH 4PV8A 4BUGA 4KXDA 4MJ2A 2IH9A 3ULUE 1QFHA 1S6NA 5CBAA 3U7WL 2BVQB 3I6GA 4UCFA 3UADA 2N59A 4MCZB 2ZUQB 4JRLA 4KNUA 4L4TE 1AJ7L 4HD5A 1BZ8A 4HALA 3MLYL 3L2LA 1T7XA 2VLRA 5KYUB 2OZ4L 3KS0H 1P69B 3A22A 2NTSP 4JKKA 4LLVB 3HJEA 3FDWA 2IXQB 2VDRL 1T04A 4MLIA 2GJPA 1UOKA 3GZOA 4HGKC 4DUVA 3EJYC 3FQTA 4LHUA 3L4WA 2XN9E 3HMXA 3EYFA 5FHAH 4M1DL 4GSRA 5I1CH 4G6AC 2R4SH 3P0GB 4YDZA 1EO8L 3U79A 1RUKL 4DF9A 5C71A 1U3HC 2DYPB 2Y6SC 4PJ7F 2W60A 4U1HA 4Z76B 2GC4C 2HG5A 1SFHA 2VDLH 1U0QA 2LVCA 1YEDA 4MQXD 1XB6A 3FQXB 3QEQA 4I1NB 3ARDD 3NTCH 2VQ1B 4OT1L 4UNUA 4GXVL 1H8LA 1NPNA 2X88A 3D9AL 1VEOA 5KANI 3PDOA 4ELKB 2UV3A 3MBED 4G6ML 4M7LT 1NC2D 3QR2A 4JO1H 2J21A 4WFFE 3MJ7B 5KAQF 1IUZA 4L05A 4MKTA 4YSEA 1A14H 2A4CA 3CX5K 3G7TA 1CLYH 4LDCA 4OBSA 5KSAD 5E08H 3A0OA 3BH8A 3BAYA 4YHIB 2JIXA 5IUSA 4JL1A 1JRHL 4NGHL 3B43A 5DJCA 3W5NA 3EBGA 5LGHL 3G5XB 5FA4A 3T0EB 2VZOA 3OLDA 4KVPA 5DJDA 5EOTB 5HDWA 4ZTOH 2Z8VC 4N0CC 4NRXA 3VD9A 5KSUA 3EF7A 2AAVA 3IPFA 1MFAL 5C08A 4F7PA 4QRPD 3IDGB 1H8NA 3D0VA 4PFEA 3RPBA 4H44C 1DBBH 4B9YA 4V1DA 4G7SB 2CLRB 5FFLA 4YMPA 3BH8B 5HI4C 2BY1A 5A3ID 3QXDB 2EDXA 3BLBA 5GRXG 5J6HB 3UTSA 4MZIA 1XT5A 4M7LH 3NJIA 2KKQA 4MA3A 1XMEB 5T5FA 2Y7SA 2I60H 3IMWA 1F41A 3O81A 4EDXB 2FZ3A 2P8MA 2VDQL 5GISL 3MRQA 1MI5E 1OSZA 4GIOA 2WSDA 2DLTA 4J3OC 5ECGA 1T21B 3QZWG 2YGNA 1T89A 4BQ6A 3F84A 1MF2L 2WXMA 3IDYB 4KPHH 4NQSB 3K5RA 3QNXB 3BUYA 5AW7B 3NN8B 2VDOH 4PRIA 1UUSA 4K23H 3QQDA 5HYFA 4R4BA 3D39B 3QEUA 5J6HA 1QRNB 1NCDH 4K8RC 3OLGA 3OHMB 4ZDHB 1O5DT 1WUNT 4F9LC 2BJML 2DQHL 5F3FA 2GIYA 5ICXB 5E1AB 1KENL 4WTWA 1DJXA 4BH8A 1OSZB 3I2CH 3WNJA 4K3GA 4PJEE 4S1SL 1BLIA 1EZUA 4ODTH 1D9KC 2FZ3B 2P8MB 4EVNA 4JFDB 3M07A 3OZLA 3NFNB 4U6VH 3RB5A 4BSVA 1TTAA 4HIXL 3DKHA 5CZXC 2X89D 2I5YL 3D85B 4X8GA 1LK3H 1BJ1H 1H56A 1ZXKA 4AW4A 2BP8A 4L29B 4E41A 3OZ9H 5J12B 3U7AA 4K7FB 1R3HA 5M7QA 4KRLB 4A2FA 2VZUA 3L3KB 3GS7A 1NSNL 2DBLH 3GIVB 3Q7JA 1A7OL 4XP1L 3WFZA 5B8CC 5I26A 4NIYE 3MO1A 3BKJL 3GSXB 1Z9LA 3BO8B 5E5UB 4NM4H 4BFJA 1MCPH 3VFMA 2Q8BH 2HTLC 2ZKHH 3UTZB 1FNHA 1E8ZA 4UMGA 3WTWA 4OLVL 4AJ0A 1KGYE 4JKPL 3HE7D 3TXAA 4YLCA 3V0VB 3DOIA 3T0DA 1X5YA 3TFBA 4EJ1C 4KJWD 1NA8A 3LPFA 3D39A 3QEUB 1S3KH 1BZOA 2YPLB 1LK2A 3K0WA 4FE9A 5JDSA 1PY4A 3LMJH 1MQKH 3P3TA 4Z1PA 1RZJL 2H6PA 4K23L 4N6RA 3ZT7A 2FO8A 2JLLA 3FSZA 5JOPD 4WCYH 1I1AD 3ENEA 1YNKL 3ZE1B 5EO9B 4YHMH 2DEWX 5ICUA 3W9DA 3AABA 4P4KA 5IVZA 3T6XA 1NMBL 5JXEC 2IPTH 2OZ4A 3UTPE 1CE6A 4MASA 1MFEH 1X7TA 2WQ8A 1G4MA 3OC8A 4IMKA 4LCCA 4FQCL 3DGGA 4GP8B 3S96B 4RZKA 1N3NB 4MD0A 3KPQB 1ASOA 2AMUA 1SXBA 3CE1A 2HG5B 4KK8D 4M56A 1R5VA 3Q2WA 4DWHA 3D07A 2Q86A 2J57A 5EZIH 2JJUA 3UC2A 4TLSA 1GTFA 1R5IB 4MCMA 4WEBL 3P3SA 4GW4B 1M7UA 2B0SH 4MA8H 5DA0B 2ED8A 4XNQA 3NIDF 2JK5A 5D7JA 5ES4B 3GJFH 1T22B 4WK0B 1U8CB 3PP4L 3P73B 4IU2A 4JFUA 4PJHF 3RUGA 3EH2A 4PS8A 4JFSA 4JY5L 4RX4D 2GJRA 4O4YL 2NOYA 3LPPA 3EH4B 3PAVA 4F15C 2G0KA 5LGKA 2K6WA 3WTSA 3U9PH 2WKOA 3ZU8A 4NQVA 4B9IA 2E7LC 3WNNA 4DKEH 3UJIL 5L4JA 4YAQB 1G7JB 1JF6A 4JKPH 5ISZA 1A7QL 3TYFA 1N10A 2XICA 2ETWA 3VXMD 2WB7A 4N0RA 1R0AL 2GK0A 1V5JA 1NC4A 4AYFA 1Q0YH 2GHZA 4UM9D 1P5UB 4XPAL 5LBSL 4UM8B 4WUUD 4Z0BH 3EYUL 2AI0L 4BQBA 4OD1L 5L8JB 4X50A 4TQPA 2PN5A 3NIGB 3V0VA 4ONGL 4XCYB 4D7PA 3KYOA 1Q94A 3B3BA 3O3DA 2EACA 3ESMA 5F0JB 4E41D 1MHCB 2ZONA 3ZE1F 1NCAH 4E9YA 2JXMA 5EFIB 1AIZA 3PP3H 4HH8A 5CNHA 4EO5A 4LNVA 1C5DA 4S2SB 3UTTE 2OXHA 3ZX1A 3KBFA 2ITCB 4J6RH 4LT7A 2QSTA 2H5UA 3NCEB 1W72H 4PS7A 3Q05A 1QABA 2AZUA 2NMSA 2ZSVA 5EF1A 2ZCLL 3N50A 3QXDA 4FYQA 5IR1A 4M7ZB 1L7TH 3B2MA 3GLDA 3RKDC 5D9SB 3INUL 1UFUA 3QCVL 5T5FL 5L4MA 4PJFF 5E8OA 1I7ZB 4I18C 5DUML 4ZNCD 4PGDA 2Q5BA 2HFGL 4EVNB 1H3XA 2ATKA 4HMCA 3MREA 4Y0GA 1Q9LB 3RJOA 3QDJA 3EZ8A 4Z5RA 3ZRSA 3MLYH 1TJGL 2O5XH 2BRRL 3B4NA 3WGUB 1P5VA 2VC2H 1JF1B 3ESPA 1KFAH 4P2RE 4IBZA 4QO1A 2OBGA 2J56A 5C07D 1BA9A 5I2IA 1CE1L 1L9NA 2OV0A 2AXGA 4X9GA 3DX6B 3MBEC 4ZI8A 1A7RL 1CR9L 2HB0A 2R0KH 4WTZA 5TE4L 3OB0K 3H9HB 4GG6E 2P8LB 1YC8A 1OTUD 2R0LL 5EZLB 3QZNA 4G5ZL 5D93B 1B4JH 1XGUA 2BSED 2D9CA 5C3LD 4MDJA 1C12A 3EGSA 5HHQA 1UWEH 4AUYA 1Q90A 5AOLA 2X7LB 1GJUA 3PWNA 3QORA 4L4VD 4D3CL 4KY1L 2BWDA 1UJTA 4GAJL 4PS3A 1JPGA 2R29L 2VLME 3BUPA 2BK8A 2VZVA 5T33H 1A6VH 3PQYB 2VUKA 3IJEA 3WO4C 2JJVA 4RNRA 3V6OC 5FCUL 5ITFB 5A2KH 4BXVA 5FR3A 4X99A 2DV6A 4KVNH 2YFNA 3E6FA 4UNVA 5HVFB 4JJ5B 4JR9H 4IMLB 1NKRA 5BRQA 1UWYA 3FB6A 4JQIL 3ZYJA 4G83A 3EJYD 5AL8A 2W91A 3VO0A 2Y06H 3ZDYE 3BWUC 5CM1A 1UT1A 5EBGA 1DLHB 3QXWA 3BDYL 4L9LA 4O51A 4JRYA 4S1QL 1GKOA 3SOBL 1JN6A 4BQ9A 2N01B 2NY4B 3V4PH 4XX1G 2N0MA 3MBEA 2A4EA 3K72B 1NC4D 1NIAA 3JWNE 1GYUA 4MXQD 3THMH 5IBLD 4OFQA 1VFAA 4FXGB 4RMQA 5KBDA 3POHA 4YHIA 4L8CA 5MENA 4KUCF 1N9PA 3GXFA 4OZFG 4FZEH 4P5KB 4YVNA 2E6JA 2ID5A 2EDYA 1FNEA 1WGVA 4AH2B 2WVTA 1PFCA 3HMXH 4PLKC 4NUJB 4J2XA 5IF0A 5LNGA 3CFDA 4YHNA 3RNQB 1OPGL 3F04A 2EO7A 1RVFL 2NPLX 2QZQA 3AWGA 4Y7MA 3TCTA 4D0CB 3NUKA 5HJDA 5HGGS 3BGMA 4DPCX 2OYMA 1D5MA 2R56L 2NY0B 3TA4D 1EFXB 3AG3B 3H1ZA 3UROR 5HHMB 2BHFA 3NYKA 2DQDL 4JK0D 3E6FB 3BD4A 2ZX9A 4UQ9A 4Z76A 4PJHA 3ES6B 4IOIB 5KYXB 3DX4A 2QPFA 3DPBA 3WJLA 1KCWA 3NQIA 1EQWA 4IOFD 3VWKA 2YWZA 3B1TA 3SGKA 3PAZA 5DJYA 4TL5A 4F91B 3MRPB 4ZD3H 1E4JA 4I77H 3OLIA 3TPUB 2QR0A 2QKIC 4JFTA 3NCFB 1SEQH 2IXQA 1OAKL 1P7BA 1ASPA 4WTXA 4X6FB 2P5EA 5GSRA 3N43F 5SWZB 5CUSH 3D2UA 4NQEA 4JVWA 5F2FA 1CXFA 3HZKB 3BQUB 1SVBA 1K3IA 4JRXD 1ZA3A 3DI3B 1FE8L 5CEYB 1NTDA 4ZK8A 2UUDK 1YEKH 1L9PA 2E9GA 4IS6A 4LEEA 3TIEA 2EIMB 5J5EA 2VM9A 4DZ8A 1R75A 3K91A 3T0ED 3U83A 1EJFA 2WBJC 5DHXB 1OGAD 2VXSL 4S1RL 3E2HC 1AMYA 4TNEA 5KJ4A 2ODHA 4PJBA 4NN6C 3HS0A 5B4MD 5GSRB 2ZPKL 3GI8L 3PCYA 4HHGA 4KKCD 4NQDA 4YEEA 1CLYL 3ZUCA 1T80A 1N7ML 1IBZA 5M95B 5D1QE 3INOA 5JLZB 25C8L 3RKDD 3AY2A 4OCXL 3GZKA 3G6DH 3MRDA 2DKMA 1FAIH 2XXFA 4JFYA 1EUTA 5FO9A 4WEUD 3MRFA 2YD0A 2GJ6D 2Z3FA 2ZCZA 2K6ZA 5J6SA 1MPAH 1MQKL 4MX7A 2K1MA 3R19A 5JA9A 3R06A 4QXGL 1EFXA 3C9NA 3RVXD 2YRBA 1A9EA 4KRPB 1OCWL 3UIYA 4BFFA 3F3HA 2AEPH 4X80L 3ZDZB 5B22A 5TQ2H 5KYWA 2QVTA 1U8PB 1BEYL 1SDAB 1T6VN 5AL0A 1DVTA 2E27H 5EIVA 5J3HD 2AGJL 1G7JA 3PGFH 3BVXA 1S7SB 2XY2A 3ARZA 2AJUH 3HG3A 5B38B 1DBBL 3DROB 1QLRB 1SY6L 3DXAD 2IFGA 2Q20A 2VERA 1X4ZA 1X9QA 2A6KB 4A37A 5KSAC 4JB9H 3TIDB 4PJIE 1EMTH 3CFJA 4Z3GA 1KWKA 1V3MA 5ABZA 3MHZA 4H1LH 5EBLA 2Z34A 5A6LA 2IJ0C 3BKML 5DMIH 1FA4A 2RR3A 1A3RH 2A0LD 3QRBA 4XNQB 1EGJL 5IQ7L 1YEEH 5E94A 1CXIA 3B5HA 3LPOA 4G8GE 4XB7A 2B9AA 1I9IL 2ZG1A 3WIHA 5DFAA 4WLCA 3RGVD 4M3KB 5CJ8A 3ILPA 1CDBA 1PVUA 4Y16D 5EEZA 3SO5A 3UH8A 3H3BC 2B14A 1OK0A 2FYYA 5DGQA 3GI9H 1NCJA 4AEHL 3QJZA 1O0VA 5DD1H 4PRHA 3W1ZA 1T83A 2VAJA 4F2EA 1UGNA 3SKMA 4D0CA 5J4MA 2WO4A 3S0PA 4Z0BL 4GIAA 1E8XA 5ESAA 3GM0A 1HN1A 4GG6B 3DUSB 3WBDA 2OXHB 1XR8A 2CDFB 3ABMB 5FF6B 4KV5F 2HT3D 1C5DB 4O02L 3WFEL 2J6EH 1EYUA 3KLHC 1MCRA 3SBWA 4MAUL 3GUTB 5T1LA 1IT9H 1PKQB 3G6JB 5GRJH 3KYOB 4H13C 4BRVA 2P5EE 2NLJB 3MUHL 4POUB 4BFIA 4MNGA 3MLVL 2Z7ZA 2IOOA 5KUKA 2HLAA 2DWTA 2WLLA 2ENQA 1DVFD 3KPSD 4UIKH 4GMSH 1SHMA 3WY4A 2B7DT 3CX2A 4W9GC 2ZUUA 4KZDH 3SDCC 3RTQD 5ABDE 2BSDA 3IDIB 4PTUB 5E0QA 1W8OA 2OCFD 1NBYB 2HTLD 5KYYA 4PMFA 3UC0H 4PG2C 4WWKD 2YD7A 5J11C 3ESVF 5I30L 3D34A 1KEMH 5I1IH 4HXAH 1T3FB 2XIBA 2YKLL 1CUOA 1S7UA 4DERA 4FQCH 4IJTA 5F70A 5IREA 2E5EA 5IMMB 2YWYA 4L2LA 4X7TA 1GGUA 4FG4A 2XTJC 1FPTL 3VWJD 2ZUVA 4LO9A 4U05A 1OCOB 1N59A 3WLBB 3FF7A 1A0QL 3JV5A 5JNYA 4HX1B 3IMUA 2VISA 3WXWL 3VRIA 3QUMB 5FUOH 1XX9C 5IP4A 3OSKA 4KY1H 1KLUB 1TU2A 1XGRB 3CVBA 4JJ5A 1I4FA 1PBYA 5HI4D 2OXGB 5DURB 1OF2B 1NMCC 4AYFB 4P3CL 4XPHH 2LLLA 3H9SB 2A6JB 5LQBL 4PJEA 1K8IB 1D6EA 3VFRB 1ZT4A 4WFEE 2G2NA 3EAKA 4WJG3 1PZUB 1AGBA 1RPQA 1YNTB 3T3PB 1NAKL 3W39B 2ADJA 2YLHA 4ZX3A 3VFSB 3GXNA 1JPGB 5C0BD 1EXGA 1UM6L 3KPNB 1YYML 4XCCL 2B08A 2CDGA 3R0MA 3JBG7 4HXBL 4K7PY 4KXZI 1MRCL 3PP4H 4OLYH 2H6OA 2WANA 3WTUA 3SDDC 3VTTA 3WFDH 1HCFX 4OSUL 4JS7A 2FJGA 1KJMA 4F7EB 4ZQKA 2XXGA 2WHVA 5E6IA 1MFNA 3PWJB 3VI4B 2JSFA 1M7XA 1GZHA 4OZFB 5EA0L 2HLEB 3Q8CA 1MLCA 1NGPH 3QWRD 3BQVA 4FAAB 4TOYH 2JFCA 3QFDA 1EAJA 5L8LB 2RTTA 5DHVH 5CD5C 2XWJA 4YO0B 5GRVL 2H1PL 2FK9A 1Q9OB 4GPVA 2BNQD 4YDLB 4Z7AA 2LAGB 2AS5M 2E8ZA 3ASWA 4PJGE 3TJEL 1ACYH 5EPMA 4I1PA 2AQTA 5IEKA 1OP4A 3DXAB 2NY6B 2ZOTA 2WGNB 1NC4B 3D6GA 2OCJA 2ZSVB 4GFXA 3HRZA 3BRDA 3KPSB 5BRZB 2YOAA 3VAEA 1INEL 5F7DA 4MMZA 4UIMB 1F2XK 2RFXA 2ED6A 2P5WB 1YQVL 1M1SA 4M5YL 3F7LA 1B2WH 2QGEA 3IPEA 1FJ1B 3OC5A 5EDXA 3TM6A 3ARGA 2A9MH 2WLYA 1F6AA 2Y9RT 4JZOB 3QUKA 5LAPA 3LQAL 3O3EA 3ZTNL 5E99H 1RUML 3ZLQC 2Y72A 5I76A 3JVFC 1CBVH 3CN3A 3N5AA 3VA2C 35C8L 5GSVA 3V0FA 4UOZA 3TP4A 5C09A 3IB4A 2NX5A 4NC0B 1UXWB 1JWSB 4KKNA 5DA4A 1KG0B 3BP6B 5DQDL 4RGOL 1VFUA 4QRFA 3FO1B 3RVWD 1MFAH 2WXPA 1IM3A 5EORL 2DQCH 5DJ6B 3ZPDA 4F27A 4FFTA 2IAMB 4AIXA 1SOSA 4LRNH 2Y6SD 1YPZF 2YPKA 3T77A 35C8H 4MD0B 4AGQA 3MLWL 2DD8L 2XA3A 4FQXC 4DW2L 4NN5C 4ZUTA 3CLFL 4JE0A 5AAMA 1CGYA 3SKNB 4TOYL 3CFBA 3SJVA 3VGDA 1GIGH 1XR9B 2Y07L 1A6TA 5E2VL 2YS4A 5E9DB 1T22A 5CGBA 2MIZA 5GGTA 3R0NA 2JK5B 3QIWD 5C0CE 1BQRA 3NSCA 5IROC 3BP6A 1GYVA 4WTQA 1J8HD 1OB1A 2YZ8A 2WP3T 1TFHA 2ZP8A 4YNYB 2BNQE 2DTSA 2R1YA 1I53A 1LEIB 2NUPB 4B9KC 3WV0A 4WU7B 1P6WA 1DQDH 4WO4B 1CG9A 4XOCA 3OKKA 1ZRUA 3P77A 4FJZA 3E8UL 4ALAC 4L3EB 3BPCA 3P54A 1MY7A 1R3KB 5MEPB 4YQXH 3RDTC 1EAOA 3F62A 3QPKA 3WLBA 5DFVD 1HINL 2N1TE 4I1RA 1ND0A 2WN3A 4ZSOB 2VR3A 1ID5I 4QRSA 1DDHA 4XP6H 2XN9D 2WLMA 1MW2A 2O5YL 3MBXL 3ZQXA 4PH8A 3QI9B 4K15A 3LRKA 3LRLA 1A6PA 3WIFB 1KB3A 4TUOA 3EYOB 4MJ4A 4JGMA 2P5WD 2UWEF 1R3HB 3NMEA 1TPXB 1T6WA 1FVDB 3H53A 4QRQA 1PKQE 5GZNC 3KLDA 2WJ5A 2CUAA 3KPRA 2BNRE 5DO2D 4YIQA 4P2RA 2BSRB 5HVWA 5KSUB 2Q9OA 4U3XA 5E4EB 4KKBC 4M48H 5C0AB 5LGHH 1OM3H 3ZIYA 3TO4D 2ERJB 4A39A 3R1GH 1GS6X 3PWPB 3QS3A 5AWNH 3W9EB 1QYGH 3GIVA 4OF5A 4WFFD 1A7PH 5CGYD 3RFZA 1NCTA 1CLZH 4I8DA 2BZCA 3BP4B 5D8JH 1QLEB 2UUDH 2DL2A 3L9RB 2MTPA 4PB9H 3ISYA 3L9YA 4N25A 3H2QA 5K33A 4A7GA 3L3JB 2IDCA 1DBKL 5HDLA 5I16B 2B15A 2WD0A 2ZCHH 3CZGA 5C09D 2EINB 2J8UA 1QACA 3LNFA 4Y9FA 1HXMA 4RZCB 3O6MH 1ZE3H 2Y3NA 3CZFA 1O7SA 4YHLH 1BF8A 3MRKA 4B6ZA 5GGRA 4NC1C 4QRPE 5SWSE 4QI3A 4AG4L 4R7NA 3WIIL 3ZE2F 3UEQA 2E7BA 1S8DA 4OIIH 2VRQA 3IRCA 1RSFA 3BPOC 4Q14A 3S37L 1PSKH 2YA1A 3G5VA 5C0IB 1N8ZA 3TCLB 2WQSA 4Z77B 3HB3D 5FHAL 5F72S 3KYKL 1LNUB 5FDYA 1NPUA 1M1XA 4GRLC 3GMRA 1YEJH 3DURB 3B1UA 4MNQA 1BYNA 2FEDD 3GBNL 1CDIA 1SJVA 2EXYC 1L0XA 4WW2A 3J2PA 3VFPB 1RIUH 1HU8A 5EC2B 4YX2L 3LNDA 4KWUA 4G6AD 4OM0H 3IFNH 4AYGA 3AJ7A 5ANME 1SRDA 4UINH 3S5LA 4GBXB 3SDYL 2ZG3A 3MLRH 4LCWD 3RPIA 2HFEB 5DZAA 2HX7A 4P46A 4RMUA 3WLWD 3E1F1 3NIFF 4A55A 5I0YA 3FT2B 4AGMA 5HYJA 5TQ0H 3NBNA 4QGYA 4NWUH 4AQOA 1B0GB 1VZHA 5IVXA 2V5YA 3MOAH 4IRJD 4FXKC 3CFQA 1QSFA 4IEFA 4LSTL 4JDEB 1EHNA 1OWRM 1EAQA 1DQTA 3EFDH 2PKDA 3PV7A 1TETL 4KH2A 4OZHA 3TBSB 3B56A 4A6YA 5DHEA 3KWXA 1DVFB 3EOTL 3GJEA 3UZEA 1SMAA 5MEQB 5E95B 4XN4A 1P4IL 2R4RH 1WA1X 1VEMA 3FSVA 4U6VL 1JCVA 3VGEA 5D1XD 3S36L 5TGBB 2DMHA 2ZOOA 2OK0L 1J5HA 4E9XA 3F05A 2C9UA 4AWJC 1GS7A 1H0DA 2EXTA 2HWZH 3M8OL 4KKZA 4AQEA 3PDOB 3CZJA 4ELKA 1KCRH 4L4JA 4DO6A 3BKMH 3CMOL 5F0LB 5IJBC 1OGAB 5IG7B 2W0LA 5D7IB 4POZC 4N1EA 3NK4A 1I1YA 1DN2A 2AJXH 3TA3C 4KHXH 4WEEA 1CYGA 1BLNB 4H5SA 4IOSA 1MOEA 2AQ1A 1N2RB 4NUGL 3PQYD 4N8PA 1UD4A 5GZOC 3C08L 2A6DA 3OKEA 2UWEB 3RDJA 3RG1C 2Q3AA 4TUJB 4N5ED 4H7VA 2Z8RA 3Q3GA 3DK2A 1XF5B 1XGYH 1T4WA 2BSSA 4TVPL 1KN4H 4A6YH 2PXYB 1IBGL 3L1EA 2K9FB 4X6DB 1ORSA 1B9ZA 2IV9A 5I8OL 2KI6A 1SY6A 1NIFA 5A1AA 3M17A 3B7SA 1OAYL 2AZAA 3PG2A 3P4NB 1KACB 4ZUWA 4EE2A 3OXSA 1GVIA 1NDMB 4BZ2H 2VDPH 4BZYA 3ZQWA 4PY8J 2XWTA 3TTSA 1YRKA 4L37A 5F71A 1ZLWK 5AAWA 3L8QA 4J3WA 5EO1B 5E5LA 1HXYB 5L2KE 1H19A 1E65A 3ZE0E 4ODHH 2QPEB 4WV1A 1UACH 1ZHKA 4X6BA 5GRVK 2AJSH 1E4XI 3HG2A 4TUUA 2F8OA 1KFGA 5F3BB 3IN0A 3DUHA 5AVZB 4B95C 3MTRA 1JDCA 2FTAA 2VXTH 1MCSA 3LEVH 4A67A 1QQDB 3HZ3A 4OZHB 4HAGA 1H3PL 1P53A 4R5XA 4UT9L 15C8H 1J0HA 1KYAA 1WZLA 1KB5L 3EGXB 4LP8A 2ZKXA 4LLDA 4QHMA 3D12B 3KPOB 5C0NC 1MJUH 5DD6A 3RWCB 5TGBA 2V9QA 3DJZA 3MRIA 4ZO9A 5IMLA 1GYCA 4JM4L 3MRDB 1R3JB 4LARL 1TYJA 5T1MB 4YOKA 1EO5A 4K3JL 1JZIA 3HE6B 4RESB 2JQZA 1FFQA 5DD3H 1XL6A 3CFKA 3ARFC 4WJ5B 1E9PA 2DYSB 1EJOL 3J8F7 5GGQH 3U1SH 4OZGA 1NMAL 3MR9A 4R4NC 3UERA 1MH5B 4DKTA 5K69A 3MRGA 5C0EA 1B0RA 2QADB 4OUOA 4X6DF 4F7KA 2MRYA 3QWNA 4MZ2A 1U4FA 4PQXA 5KOMC 1FG2A 4GRMB 1BFSA 2F19H 4XHJC 2R23B 3NDYE 4GBXA 4JZJB 1QA9A 4XAWH 2XA8H 3RIFK 4N22A 1WHOA 3IGAB 1KIQB 3QUYB 3TC9A 4YUEL 5CU5A 5F6HJ 1E2WA 3QJFB 3MRJA 4Y9CA 1WCBA 4ZNEA 2XBDA 5TE7L 2XZQL 5HHPB 2ZYRA 3RY5A 5J9PB 1L9MA 4I18A 3INUH 3TJHC 2A6IA 1QRNE 3LZPA 1DEEA 2VDLB 1JNNH 2ZSWA 4MQSB 5HDBF 4F9PC 3TU6A 3OV6A 1WYJA 2G3XA 2IQAA 4O2CB 1DVFC 3Q01A 2HWZL 5GGUB 1IGFL 3KPTA 5BUAA 3BH9B 5T3XD 3S37X 3QQ9C 5LAXB 3SE3C 1TQBC 3D09A 4HBCL 5KS9F 1BX2A 3J7HA 4JRYE 3QRFM 2R27A 5KVDH 4KK6C 3BP4A 4JZJA 2C3VB 4FFZH 1BQLL 2VLRE 4K5OA 3DOSB 3ULVH 2F58H 2ZYHA 3F7VA 3S88H 4JO5A 4OGZA 3MLUH 1RJCA 4PV9A 1UWGL 1UYWH 3LNEA 4Z5RB 2FJFB 3MGOA 4TN9A 4YHYC 5CILH 1S7TB 3OM3B 1XZ0B 4BE5A 4OZGB 4G5ZH 1VCAA 5GRYA 1F4XL 3AW5A 2VDKL 5DGRA 3JWOH 3OR6B 5DZNA 3QG7H 1KN4L 3QJUB 4A6YL 32C2B 2CE6A 4QRQB 3WS6C 2BSCA 1CFSB 2CGRH 5DVKA 5HTSA 2WWOA 5ESQA 4Y2DA 4HFWA 5G4MA 2WW8A 2HMIC 1JXGA 2ZF9A 2ZICA 1ZV9A 2HJFB 3RDTA 1DO6A 2HFTA 5IESL 4LCWA 1RZ8A 3QEQE 3D4YA 1JN6B 2XTSA 2DQDH 3L4XA 3M7OA 5JIKA 3CPUA 3TVMC 5IJVA 1FVCA 1WS8A 2CH8A 4WDIA 4Q6KA 3H55A 5I24A 3P3RA 4UT6A 4ZW7A 3GGWA 1OV8A 1IGJA 5GZND 2JB6A 3QO0A 4UZUA 1C7TA 4Y4HC 2HKHL 4JLRA 4UM8A 4MXVE 3AUVA 2ZXQA 1ACCA 3I02B 4NX0A 2O4EA 1TQUA 5TK2A 1NIBA 1HQRB 4OCRH 3SOTA 2NY1B 5LLIC 3B8YA 2UY6B 1OIOA 4BKSC 1MHHA 4FFYA 5IQ9B 4JFXA 2KDGA 1Q1JL 4RZCA 3NA9H 4L37B 1HE8A 2PF6A 1T03H 3LV3A 5GHWH 4XVUD 4V1DE 4L4TB 1ETJA 4MBRA 2X6MA 1IZJA 1HSAB 3EO0A 2WWNA 2HX8A 4OB5L 2C9XA 3CN4A 5JYLA 1F4AA 2YOCA 4NN7B 4QY8A 4W9EC 3FUJA 5FWQA 1XGZA 3K6NA 1CGVA 4HUUB 3ARXA 3PNWB 4MNHB 4QLWA 4AT6B 3QJTB 2I9TA 4OZGE 4MB4A 1IC7H 2ZTBA 4PJGA 2A83B 2Y3AA 3IFNL 3SJVB 5KWYC 2Z8WC 4OJEH 2PUQT 3P4MA 4L1SA 3I85A 3T09A 3I3BA 3S96A 1URIA 5I1GH 4O58H 4NDMA 3CVIH 4A7VA 5J6GA 4HMDA 5IM7A 4JFPA 2GK2A 3CDGB 4GAJH 3MRNA 4F1SA 5FFGA 1HDMA 1JV2B 5DDHA 3L3DA 1EZVX 5KVGH 2QJDA 2VR7A 2NXYD 3MLTB 4L0PB 1J1PH 4EOWH 4M4RA 4ZTEA 5K9KA 4MZ3A 1T4KB 5DRZB 3SKOB 2EEFA 3JTTA 4JG0H 1HINH 5AW8B 4E5XA 4YBQD 3HNTH 2BJMH 4ENZA 4PPTA 2OSLB 4KTEH 1HH6A 3C5ZA 1R34A 1S9WB 1RERA 1NDGA 1VACA 2D03L 4FNLL 4DPBX 5JHBA 4DHLA 1HS6A 4RMTA 1ANUA 4FNLH 3BYTA 4NPYB 2AVGA 4WY7L 4HJIA 2QBWA 2ICEA 1YN7A 4HCRL 3TYFB 1UJ3A 4WI9A 3GMPB 4BCYA 3FBKA 3STLB 3TJHD 2BHZA 4H8WL 4J3TA 1QFWI 4BDVA 5KVDE 1L6XA 1IIKA 2KZ1B 2DQEL 3QIBB 4KMTH 2X6VA 4TSCL 4YDJB 4XH2A 4XMXA 4M8VA 4CA4A 4P99A 3N1QC 4L3AA 1QFPA 3DDFA 3I9AA 3KPNA 4PRAA 5IV2B 3K6SA 5DJ2B 5D2NA 1LD9A 1UTDA 5D70L 2UXVA 5AVQB 4YXHH 4RGNC 3JV0A 4BELD 1YN7B 1W72A 1BBJA 4O58L 2NX5B 1VIWA 3KJ4B 3RGBA 2UYLA 1A1NA 5D72L 5JW3L 1K9TA 3W11D 4EI0A 1RZKH 1T1ZA 5SX5K 1ZVSB 2PO6A 5I6LA 4G71B 5EU5B 2CPUA 4ZTPH 5C07A 4E42A 5I19L 5FK9A 3VFVA 4WGWB 4FX5A 4NBZB 4J7RA 1S3KL 1KTJA 4KJYA 4ODTL 1INQB 4E5XB 3MRKB 1NEZG 3WUWG 4F7CA 2YK1H 2QELA 4RQQA 4FGMA 4Z95L 1Z5LA 5FPIA 2ARJA 1P84J 2H3NA 3HG1D 4PLJC 3HI6L 2DQHH 3BW9B 2CKNA 1PAMA 3C5SB 4KRPC 1DJYA 4HKXB 1IQWH 3JUYA 2J8HA 5TJWK 2WXJA 3C8KA 3KPRE 3IDNB 2UZIH 2KDYA 1LWJA 4JHZA 1YJDC 2H3KA 3AUWB 4P2QA 3V79C 5IB3B 5JHDB 1D5IH 2B0SL 2BNUB 2X9XA 3QXVA 4UUJA 4IRJB 5DHDA 3GKZA 5CXPA 2DWXA 3GTTA 5C08B 4F7PB 5EB9A 1BZDA 4L23A 3FQUB 5C0AA 5ISZE 2C9VA 3DUUB 2DLFH 1Y0LA 5HSFA 1CXLA 3LRSA 4RA0C 1LMIA 4AK2A 1I8LC 4ZAKC 1LLAA 3FTYA 1DEDA 1CYWA 3AG2B 3U1SL 4HA1A 4O02B 4KVCH 4CSZA 4N9GA 5A2CA 1I8UA 4B60A 1OGTB 3EOBA 3IU3B 4WCYL 4E9LA 2CO4A 3L3HB 1G7PB 2W95A 1NFDA 3QIBA 5C0DB 2RFXB 3PPEA 4U6HA 2PWHA 2ICES 5EV7A 4KHXL 5EOQH 4JGNA 5T1DH 3KXFA 3VM5A 2WQAA 4P5TD 5AW2B 1KTDB 1CK0L 1IT9L 4KK5C 4AL8H 3IDYC 4RQQB 3HC0B 3PWUB 4HH9B 2LW3A 1LO2L 3O6LL 3OAYK 4DQOH 4OCYH 3RVVC 3VXTA 5BQ7A 1QLEL 4GKLA 4MTMA 1B2WL 1FYHB 2OXGA 4DGYL 4QY8B 1NPJA 1QAWA 2QPSA 2V17L 4KROD 4XWGH 4HCGA 1FZOB 2H32H 4WUKL 1UWGH 3MCG1 3BUYB 4R5TA 3EH5B 3ARWA 4R7XA 4XP1H 4HT1H 2OKMA 4HC1A 4Z9KB 1V55B 1D9KB 2Q76A 1MRFL 1YY9C 2H2PC 2J5LB 5C7ZA 1HDMB 4X4MA 1TG8A 4KK9D 1W2KT 4IKJA 1PLCA 1IKFL 4MS8D 4Z7UE 4U1KA 3UOAB 3I9PA 3RX9A 1BYPA 3L3DB 5DEJA 3V4VA 3US1A 2X6CA 4HHAA 3K1DA 1FN4B 4IIQB 2XDHA 2PWGA 3HZVA 3SEPA 5I5IA 1HNFA 5JIIA 4AQAA 2HX9A 1JGVL 2GB2A 5HHXH 2W88A 3MNVB 4PCTA 3QUXD 1NCOA 5IFHH 1UZ6E 1VRSA 3O0RH 5FGCB 1XGYL 1IGMH 5E1GA 1YNTA 2W9EH 2FX7L 1JSYA 1G9MC 3EBHA 4G9FB 1SDYA 5F89B 2WUBL 2JIXD 1JGUH 4IGBB 5BZWA 4C56A 4MQTB 4F1ZA 5IJDC 5F44A 5BOJA 3OB0H 4I3SL 3T0EA 4Y4KA 3M45A 4MB3A 3MV8D 3N1MC 2G5BA 1AG6A 1K8DA 4NNPL 4H2CA 3O0RL 4IBSA 1CFSA 4I2XB 1UM6H 1QKZH 2R56H 3VXMB 3CMOH 3D4ZA 3ABLB 4MVBC 4ODBD 3FPXA 2R2HA 5IMLB 3MBXH 4NAQA 2YXWA 4X6EA 5ACZB 4R2GC 4WI6A 1UWXK 3PHOA 1KOAA 5MERA 3TPKA 5I6XB 4NXKA 2HKHH 2G30A 2MCAA 4RRPA 3H9ZA 1KV3A 1PD0A 2A6IB 4GSUA 1M4KA 1A1OB 2WBJA 3DX7B 2J88H 3HVNA 4KK8C 1LP9F 5MENE 4WV1C 1Z9MA 1KUMA 2K4WA 3U9UA 4NSKA 1VLXA 1VF5C 4YSDA 4QWWC 1SLWA 3IDMB 4TSBL 1DVUA 2MNWA 3PGCA 4M9OA 4KJPD 3LRMA 3ARDB 2W60B 2LTQC 4JFYB 4W4OC 1WIPA 3ZKMD 3NPSC 4ICWA 3CFTA 2F9BT 2UZYB 1E4WH 3LN5B 3IS0X 4X5LA 1AP2A 3FTVA 1OW0C 2K6YA 3GBML 2GJJA 3OAZK 4ZMAT 5CP7A 3PF2A 5HHOB 3V10A 3S6CA 4OFIA 4DGWC 4JQIH 2B9BA 2BNRB 1WV7T 1XF4B 2OI9C 1X3DA 2WKGA 4IJ3C 3UBXB 1WS7A 2X41A 3D7PA 5TF0A 3FU5A 3ZRCC 3UGUA 1IO4C 1E9QA 4YGVA 1ADQH 4KX9A 3VXRA 3GTNA 3BKYH 4OM1L 1V7MH 1OE3A 1I7UB 2ADIA 3M6DA 4G9FE 4FKEA 3JXAA 2NT0A 4FG6C 1R3LA 2YD1A 3RNKA 3PHQA 1ZY9A 4J8RA 1UWEL 2A6JA 1CBVL 5MI0C 1AXTL 1CL7L 2VQUA 4JAMA 1A47A 2Y4SA 1RXLA 3BH4A 3HPLA 3W0WD 4WW2F 3UYOD 4MS6A 5I0VA 4UBDD 5HGAA 3X13B 5DVLA 2X0UA 1JNNL 4TQHA 4WSKA 5GGUA 3N40F 1YHPA 3DK0A 4XNMA 3ZRFC 1DSFL 1IFHL 2G0LA 4YXLL 4AMKH 3LKOB 2NY2C 3U4BH 4U33A 3SYQA 5EBLB 2XYBA 4CKQA 3Q06A 4FQXB 3AY4C 3UYRH 1DO5A 3F58L 1UENA 1ZAGA 5LG6A 3LKQA 1F90H 5ICYB 2OJEB 4M7ZC 2JCCA 3N55A 4UDUA 1H15B 1S7RA 3E0GA 4PJBE 1SDDA 2QSQA 1CDHA 3EDJA 5JPMB 4Z7UA 1SXSA 3S5LG 1NIEA 1WVZA 4QJ4B 4Z78A 2CD0A 4ZPVA 1ADQA 4NQQA 1IGCH 3BCFA 3Q1SL 5AYQA 2W0PA 1ILUA 3DHMA 4ODSH 1QYGL 5IIEB 5K9JH 1UB6B 4HFUH 2XTJD 2GBUA 1TJXA 4UDTB 5C0AD 1R33A 3ULUC 1RZKL 2AANA 2QGCA 2ZUYA 5I6OA 3LKPA 2HFEA 4JQIA 5FGCE 1IEAA 1I7UA 2ADIB 2OMNA 3CFKB 1AZCA 5HPMB 5T1LB 4YFLF 3ZT5A 2FLBT 4WHTA 4XB3A 3V4PL 2JCWA 1PGRB 2LOEA 2IO5A 3E6HB 4Y5YC 5D93C 3STZB 4L8SB 3TS8A 3TF4A 2Y6TE 3OR7A 1IGYA 1ZTMA 4MAZA 4R7DB 5HJ3A 2ZAHA 3IKCA 4QRRA 3GEWB 1JHLL 5I82A 4IGBC 4AYDC 3S5ZA 1EDYA 3CZSA 4F58H 4PLNC 3T2PA 2BSSB 3HR6A 3CH1A 3LX9A 2CLVB 1KGWA 1DZ0A 2O5YH 4HKBA 3B8SA 4HS6B 2VW7A 1SXZA 1YMHA 1BJ8A 3ILQC 4EBQH 1HQRA 5BS0D 2IIJA 5JZ7C 5ETUB 3AS3A 5CEXA 4WY7H 3VFGL 1S9KC 4NPKA 5AW9B 3DIDA 2ATPB 2XV6B 1S7WA 5ITFA 1FLRL 4R90L 5AAPA 5LCVL 5I6XC 2CR6A 3G08B 2F5AH 1JZ3A 1JGDA 4B5EA 4FFYL 4TPRH 4EKXA 5F3BA 4PBDA 3SQOL 4DH2A 4UV4L 3F6IA 3HC4L 1RZGB 3I3DA 1XD1A 5D7IE 4M93B 4JRXA 4FEIA 4WI0B 3OXSB 1DYZA 3C60D 3OKDA 4N8CH 3VMOA 3PLYA 1JZ5A 2NT1A 2J1KA 3LQAC 4IRJC 2AK4B 5DS8B 4H20L 2LTQB 3EBIA 3FXIC 2BCKA 4KRNA 5BCAA 3NK3A 4FFVC 3E6HA 4TPRL 3WAJA 5L2JA 4TQEL 1U3JA 1NMBH 2R83A 4X7EC 3T8MA 1DN0A 5DQJA 5CN3A 3EO9L 3LY6A 2VJ0A 3BKYL 3KH4A 1DBKH 4OM1H 4CBPA 2K0RA 4G7VL 2CBTA 4QT5A 4KUCD 1RZGA 1U33A 3VD5A 3FULA 5H8DA 3U0PB 3PRZA 1OAXH 3O41B 5EEVA 1GYAA 5CCGE 3QK0A 2XRAL 3MLXL 3DC0A 4RIRA 5CZKA 2COVD 4OFPA 1NAKH 1R5WB 4ZMXA 4HC1H 5K9OA 1JWUA 4YBLC 1HNYA 4N0FA 4MDIB 3OQRA 5HBBA 4BINA 4WQOA 1RZIA 3GJFA 4JPKH 4L4VE 4QRTB 2X6AA 4EN3B 3MCKA 4YK4C 4W9LC 3IVKA 1T20A 1F1AA 5LBGA 3TZVB 4DK5A 3DURA 4MNQB 4ONOA 1Z2KA 3OAZH 2EDWA 3GIZL 4XNDA 3NOIA 4WUKH 3SGJA 3TV3H 4CRPA 4XWGL 4AQ1A 5ENWB 4LLQA 5IW1A 3TBSA 5IMOB 4ZFFA 1A7QH 5IB5A 4APQA 2Z65C 2H47C 1IKNA 2BMKB 5IHHA 4KMTL 5HD8C 1KEML 1JWMA 1I3RB 1HX0A 2APXA 1J9SA 2DIBA 5LN4A 4JRWA 3DVGB 3SDYH 3QDMA 3HE7A 3SE4C 4BSWB 2P47B 2WQUA 2ZWYA 4OKDA 2UVEA 2DZEA 3MROA 4PTTA 1PLGL 3GRWH 2CK2A 3QC5X 5A7BA 1NEZB 4GBXC 3ESOA 4HPYL 1NBZA 5DRXA 5B3NA 2CHZA 3A24A 4X4XB 3QNZB 4YUEH 1HWHB 4XPBH 1MW0A 4P2CG 3GHBH 2C1PB 5CJXA 3PFQA 1L3NA 1NWOA 2K3TA 1JGUL 2AFNA 2VDOL 3DTXA 3L9RA 4LHUG 3AREC 4XBPA 3WN5C 2IH3B 3QA3A 2PO6D 3U4AA 2ZXAA 2WOBA 3IFOB 4KXBA 1TPXC 4P06A 4ENED 1JWSA 2JI2A 1U58B 4YS4A 3CFEA 1WBZA 2G2PA 3LZOA 2R39A 4HUWA 2JTDA 1U8IA 1FYTD 1SHSA 2VSCA 2XKNA 3SE6A 3UAJA 4GXUN 3WNIA 5JHAA 1LQSR 5ADOL 1G6RH 4I3GA 2P26A 5DD3L 1YA5A 3DETC 2GUOB 3K2UL 5D1XC 2QQLH 3EF4A 3DX7A 1P7KB 2VZTA 5F6IC 2V33A 1EGJA 2GJ6B 5C6TL 3EXJA 2EH7L 5HGBA 3CD4A 4N3UA 4OLWL 3WIHL 3SYOA 2XFXB 1HH9A 4N2EA 4RAUA 2D4DA 1P9MC 1Z9OA 5HYJD 1OB1B 4LSSH 3AC0A 1MEXL 3QCTH 1HXYA 2WUCL 3ROLB 3ZY7A 1UXMA 3VXPB 1DBJL 1YY8A 4K94C 3GF8A 1O6SA 4Y2DD 1K85A 5CZVL 5EEWA 1S5HB 1CFTA 4OCLC 5F1IA 1Y1DA 3CFBB 2CHNA 4HIIB 4N1HB 5F9WC 3ZL2A 5D2NE 4LEBA 1AIFA 1CVSC 3QCUL 5TE7H 4KNTA 1XF4A 4HV8A 1V27A 4YVUA 2RCSH 1E4KC 3WHXA 5E8EB 3M1CA 4PP2B 1IVTA 3GSOB 3ZKND 4Q9CA 5EOQL 3VFMB 1WBYB 2PXYC 4O02A 3SN6N 3NCJH 4HWUA 2XX0A 3H0TA 5PCYA 2CSPA 4G6MH 4TRPH 1FH2A 4PRDB 3QO1A 5ALCL 5CCJA 3FUEA 4F7EA 1L7TL 4HSCX 2A9NL 3UX9B 3HG1E 3ALXA 4HUVA 3CAFA 2LE9A 3IDUA 2DWEA 1N3NA 1LO0L 2O30A 2DTML 4HUNB 1Q4NX 1X6NA 1LO0H 2DQUL 1I8IB 1MJJA 2JKIS 2BDNL 1BHGA 3LIUA 1FIGL 3ZE2E 1UHVA 1ZPLA 2PPEA 1TTGA 4HEPG 1WAAF 4L1HA 4YDKL 2IADB 1MVFA 1TJHL 3WFDL 1KZQA 2ZZUT 4XN7A 5FB8A 5ICXA 1Y18B 3B9AA 4Z0XB 5E03A 2DH3A 2EEAA 2HA1A 3OLEA 2R2HB 4AEEA 1KGCD 4XVJH 5C08E 2JKSA 1VADB 4AENB 2ZNXA 1JZJA 3WMPA 2VDNB 3T0BA 4GUOA 5DEGA 2IPKA 3G5ZB 3FRUB 5JIMA 1N0LA 3BAJA 3O3EB 1MW1A 1J05B 12E8L 3ISRA 2K9UA 2WQXA 4F20A 5T3ZL 1PZSA 3FQRA 1NEUA 4LSQH 1U8LB 3UTSE 5HYQA 2CALA 3TOPA 4KAQL 3QG7L 1OARL 2J44A 2OCCB 3PWPA 4JN1H 3BT2H 1KPUB 2TRHA 4LSRH 5L4IA 4C56B 1IE5A 2J1YA 2ADYA 3VD0A 1R9FA 1PD6A 2FSDA 3JTSB 2A9NH 5IHUH 2OX5B 4XCFL 2G75A 4POYA 1A6UL 2AW2A 3KLKA 1S7UB 3ATBA 5HD8D 3QEGL 1EX0A 2IADA 1JV2A 5DDHB 4AEIL 2BP8B 4L29A 3FSAA 2PPDA 3IU3A 4AEIH 7FABH 1O6TA 5AG9A 5I8CB 1WA2X 4TVUA 4YLQT 3QPXH 3SKNA 5E00B 3VE0A 2DF3A 2HPTA 3QISA 5C2BL 3WEBA 1UXLA 2YEZA 3O9WD 5IHUL 4JFDA 4Q9RL 1TLMA 3GK8L 5T5NF 4S2SA 3S9DB 4N2GA 2WXGA 1IQDA 2X40A 2FIRT 1QEXA 1M1XB 1MHPH 2E56A 4LL1A 3WKQA 5DS2A 4QRSB 2EUWA 3QXAA 4WWKB 4JUTA 4FA8A 3I50H 4W9JC 4AE0A 2D0GA 1HC1A 3QO1B 4H8PA 5D7LD 3MJ6A 3AREB 5INCA 3F12B 1D6EB 3VFRA 1KEGH 1ITCA 1YG9A 1TKWA 3H9SA 4NPYA 3ARSA 1A4JA 5H37H 2YD6A 3K46A 2JNZA 4ENEC 4Y5VB 3FB7B 4DCQB 1ZCRA 5EIIA 2VN7A 4G5AA 2GI0A 2YD3A 2VISB 1G7QB 2EVFA 1T03L 3VW3L 2MJWA 1NZRA 1T5XA 1EV2E 2G60L 1DDHB 3CZNA 1UT9A 3VG9C 1V8HA 1BFTA 3TEXA 1WO2A 5CMAA 4L5FE 5D1XB 2XPZA 3MODH 5SX4H 3SKMB 1R3KA 5MEPA 5F6IB 1E30A 2L3BA 4HS8L 4RBPH 5J7CC 4NFDA 4DEPB 2DW5A 2HLFD 4NKOB 4X6CF 1FZOA 3BIBX 2OMXA 1RZJC 1JK8B 2NUPA 3FB7A 4GLRI 2EYRB 4Q6YA 3T4AA 2A99A 1ZVSA 2PO6B 1X5JA 2CO1A 1CDUA 2CR0A 2X9WA 2IF7A 3E3QE 1OCCB 3FU3A 4KO9A 3A4AA 1FCGA 3LHAA 3MA7A 4I4WA 5DF0A 2V2TA 1GGTA 1L9SA 3LVEA 4A2MA 3EYFB 3L48A 1RULH 1UA6H 2X9YA 3OG6B 4M1CC 4BEIA 3MKKA 5IESH 5IKCA 7FABL 4W81A 2HZHA 1NCWH 3GMOB 5E5RB 4L2YA 4ZTOL 3LB6D 4V1DD 2LHAA 3FSOA 1ZHBA 3FB8A 1OP5K 3L45A 1BQHG 5E0FA 4I77L 3AG1B 3LOWA 1UOVA 2N7AA 3QJHB 2Z0UA 4IKKA 3TONA 5LDSA 5K59F 2EAEA 1KCUH 2A0LC 1GSMA 4MAYD 4JL2A 4IDJH 3V8OA 3LV3B 3ZKMC 3FF8A 1XAKA 2XV2A 4JPIA 4ZTPL 5I19H 2J7LA 4FFZL 2Y1AA 1KJVB 3FU8A 5EU7C 1KLUA 1XGRA 3L3OB 1FFPB 4AYEC 3PGFL 1EHAA 5LUMA 5D1ZD 2CMRL 1QOKA 4YXLH 4M3JA 5TH2A 4BWUA 5JNYB 3SPGA 4IYKA 4DVBA 4X4YB 3CIQA 1BX2B 2B1HL 2DLEA 4IRSD 4ETQA 1F4YH 1QBLH 1W6WA 3GMNB 4PUBH 4HOZA 2XWDA 5F9AC 4LEXH 2R8SH 4PJXA 2OR7A 3D4GA 4S1DD 5FA4B 5F88B 4FABL 1XCWA 1PG7H 1ROWA 3UC0L 2XPGB 3F83A 4PJCB 3F00A 3QVAA 3PS6A 4QNPF 5HHME 1KB5B 1A6TB 2BP3A 2L7EA 1QWNA 1QATA 5BJTB 2GJZB 4MGXA 1A65A 1DQIA 3L7EA 3VXRE 4NQCD 4NUMA 4NO0B 5TDOA 1DUYB 1D5ZA 2R2CA 1DQDL 4LDLB 4XH2B 6FABH 4G1MB 3HNSH 4P3WA 2DJ4A 4JKWA 3WKMH 5I23A 3MJ7A 2E9WA 5EMYA 1QHOA 2CDGB 5BVPH 3UDWC 4MYWB 5GGVY 3X1BA 3OXRB 5F7EL 3CFCL 2QT6A 5HHVL 1MLCB 3TGXA 5DT1L 3ATAA 2ENJA 4U1SB 3V5HB 4ERSL 5C6PB 2BWQA 1MZYA 3CK0L 3VJ6B 3BGAA 3NGBB 1AGBB 1OKEA 2GKIA 4HS3B 2ICEB 3B5GA 4HU8A 4J6RL 3M1BB 4CMHB 4YL9A 4NQXB 4WU5A 5AVSB 3R1GL 3U0WL 1CDGA 3MI6A 5D2LE 3D2UB 4NQEB 1C8QA 2FRGP 3KE0A 5D4HA 2MH4A 3C2SA 1AQDB 3LKSA 2E7HA 4X4ZA 4R4ND 1A6ZB 4YC2C 1FLRH 4R90H 3IF1B 1PX8A 4W68A 3G6AA 3IMBA 3V0EA 3A6OA 5DJ8B 4FG6D 3DGDA 3PAUA 1G87A 2NXZC 4NO2A 1BM3L 4DN3L 2YAFA 2KHAA 4PY7A 3HB3B 1T3FA 4UZSA 1SOQA 3NJVA 4KUZL 3VSQA 2VDMB 2AQPA 1KZYA 4XE0A 4G59C 5C0AE 3EO1A 2WO2B 3VQ1C 3ARED 1MXDA 4U7KA 4MCZA 1YQ2A 4WI4A 2KLSA 3HW7A 3I6KA 2R7EA 3IDIA 2YN5A 4OZGF 2NDFA 5F1SA 2ERJC 4NM4L 1SXAA 4J3OF 2G4GA 4BKLB 4Z7WF 3U1QA 2Y7NA 2F1EA 1JPSL 2VABA 1JGIA 1JPEA 2G5UA 3OKMB 2X1PA 5C2UB 3H4FA 2VDNL 3IRPX 5FW8A 3KR3H 2MNJB 2KLTA 4RDQG 4DP9X 2VDPL 1KCVL 1FHGA 1IMHC 2H7WA 1PLGH 3B7YA 3ARRA 5F7FA 3HN3A 5AKVA 1BEYH 2A5UA 4Y1AA 2A6KA 2PTUA 2ZCLH 3FH5A 1O9ZA 4GI8A 5IWLA 3PE9A 3ZMRA 2P45B 1WK0A 2P28B 4NUQA 4U1JB 4UT6L 1XZ0A 2VLLB 1KBVA 4ZW3A 4DP8X 3JWDL 3O3AA 1J0IA 3MRLA 2Y69B 5FYKL 3GXDA 1IEAB 4Y5XB 1ZT4B 4NUGH 4F2FA 3OKEB 5DMGC 4XXWA 5E8PA 3D3VB 3RFRA 3UTPD 4XXWC 4WW2C 2XSKA 4BD4A 1I3RA 2W07B 2V5TA 2WN2A 4X8JB 3QIWA 1W9XA 4MMZC 1BGXH 3ZHFA 2YXFA 1NFIB 3OPUA 2W59A 3F6JA 4L1LA 3L4VA 5D7LB 5FHBH 3SE9H 4AGLA 4Y19B 3CZEA 2IC2A 1OP3K 2E9IA 5E70A 4AQ1B 2CIIA 2CLZB 4GAAA 4A7QA 1FVCB 3TH2T 3W0WB 4R6UA 1QASA 1S9XB 3U6RB 3DHJA 1ES0A 1QBBA 5HI3D 1TO4A 2FGWH 2WIIB 4AL8L 2IGTA 1G7HB 3AXHA 1INEH 3D85D 1AZUA 4MDRA 3CSBA 2I32A 1KXTA 1T6BX 1KIQA 3P30L 4DJMA 3GB7B 3LS5H 3KYNA 2GVYA 4NZTH 4H25B 2BZ7A 3A3YB 2CAKA 3L3IB 3P02A 4NM8H 3GBEA 3QDJD 2IDTA 1KNOA 2W0KA 4DT2A 2B4CC 4PVBA 1CU4L 2ESVA 4UU9B 1KIRB 3KWVA 4LAQL 1U8NB 1WIOA 3X1FA 4EMZA 2Z8SA 2YKKA 3EJQA 5KG9A 5IB4A 3D50A 1DN0B 1M7DB 4Z7NE 1TZOA 5L2JB 1KJ2L 2XI9A 2C9PA 3U46A 3ULUD 1HOEA 5FIEA 43CAB 3Q13A 5FO9B 1IAII 3MBEB 1OGAA 4HWBL 5FA3B 1MRCH 1BMWA 2EVJA 2A9DA 4RH4A 4YFDB 3Q8AA 4O2CA 3U2SB 3FTZA 4F33A 4M4PA 2IH8A 1Y7VA 1JTTA 2CIIB 1AE6H 3I75A 1QW8A 3RL2B 4I18B 3KWTA 4NQDD 4OF7A 1LMKA 3AAZB 5KW9H 3W38A 2VMDA 3ARFD 3MV8E 2F7OA 2WQWA 3DSFH 3HEIB 3K1KC 4PJDE 4IMLA 5D7KE 1DFBH 4CN1A 4XWOD 2MKWA 1S8DB 1T83C 4W9CC 4ZAKD 4Z7VA 5I0ZA 4OJAA 3CFDB 1ZWIB 4K5MA 4YHNB 2GTZB 2AF2A 1EJOH 1NCNA 3ISWA 4PB0H 5CHNB 4NNPH 2BNQA 2NXYC 1YUHA 5IOKA 3T1FB 4YAQA 3EYUH 5DJZB 1DEEB 3L08A 4G6FB 2ATKB 1N6QH 4DP7X 4NZRH 1M6UA 3MGTB 3FQYA 2CGYA 2GG1A 4Y16B 3II3A 3IAGC 4AMXA 5F9JA 4HFUL 1MELA 3MV7D 1SFDA 3N41F 4DQOL 3MRPA 2Y06L 3L4ZA 5AW6B 3UL4A 2NNAB 3TIEB 1RLBA 4G42B 1A14L 1QTSA 4HK0B 1MVUA 2OMVA 2AC0A 3O11B 5D96B 3FB5A 4U0RC 5CGYC 3SB3A 2JKXA 3EGXA 3ARBC 4ANUA 5J06A 1C1EL 3VQMA 5ID0B 4P2RB 1FFOB 3RUGE 3TCXA 5SWZA 2YZ1A 2J88L 3LQZA 3P9LB 3CWGA 4HOMA 4IRZH 1FYTB 1UD6A 2RA1A 2NY4C 2QTVA 4A7GF 3ZDYB 4RGND 1H0DB 1J5CA 4P59H 3W5MA 4J3UA 3ZE2B 2XKUA 5GQBA 1TXKA 3ETSA 3ASNB 4ZO7A 1SGKA 1FZJB 1RUKH 4K3EH 4N1CA 5DTFA 3MODL 1NGWA 2B1HH 5C6WH 4OI9A 5I1CL 1XEUA 2CBPA 3X11B 4ZMOA 5JW4M 2NY3C 4NQDB 1WWBX 2B2XL 4FXGA 1VDGA 3K2KA 2NYKA 1D5BA 1NCIA 2QADC 4FFWC 4KMQA 2GC7C 5E51A 2KT6A 3K72A 1HHGB 1AGEA 1T7YA 2VAAA 1NBQA 2O6DA 4PHXA 1WZ1H 2D4FA 4Z7IA 3L5WA 5SWSA 3QUZB 1JDAA 1RUPH 1XF5A 3PWVA 1VGEL 4IJ3B 4NUJA 3S34H 4IS6B 1RMFL 2UWEA 2JF1A 1KEGL 1GC1C 5F1KC 4MHHG 4U1LB 2Q7AA 4LAQH 3TBYA 3VXNA 5JMOC 2K8MA 5I15H 1HQ4A 3A4FA 1KY7A 1NDMA 1WEJH 2E74C 1IBHA 2GBAA 2CA3A 3NSXA 3NZSA 4FMKA 3VFNA 1G7HA 3S2CA 4M5ZH 4XI5C 4E0RA 1KGCE 3FTWA 2RAMA 3CBKB 4M43L 3GYRA 1FFNA 3L9BA 1NOAA 4QMEA 3DYPA 2G9HB 5CMAB 5T1KD 2TAAA 3IMRA 2GQHA 2YAMA 2RQ8A 3UACA 3P0YL 2CXGA 3L9EA 3P0YH 4DFIA 2X70A 1DSYA 5FYJD 2LVEA 4LKCA 3R7QA 1P7QD 2HTKD 3BAKA 1AI1L 3T6VA 3CH8A 3GXTA 4PGEB 3X1NA 1IB5A 2QLVB 4ZOBA 3O3DB 5I30H 2YXVA 3ULVE 4MXQC 3BPCB 4YL4A 3HE6D 4CC4C 5K1VA 3BGMB 3L3OA 2OMYB 3CXHJ 3GMQA 2DQ6A 5AB2A 4XHQA 2AJ3A 4Q4EA 4QXGH 5GS0H 1RAMA 4I5BA 1H3UA 1EDQA 3F64A 1ECZA 4CVXB 3FU7A 1B3IA 3B5TA 4MKMA 5E8DL 3B2UC 3BO8A 2OL3L 5D71H 5CAYB 1TTCA 3KYMB 2YARA 1DDTA 4WHYG 4JDZB 5D72H 1KIUB 2O6CA 4C8XA 1MCQA 5EBMB 3VGFA 3EO9H 2WINA 4I9WE 2R2EA 2ZAIA 4GRWF 3N44B 2BIHA 3FYIB 4JG1L 2FAUA 4XO3A 4KJYB 4KOBA 3ZL4L 1QSFB 4IEFB 4MAUH 4CC0A 2I7OA 2WXKA 2J55A 3DECA 2H1LM 1R5IA 4TXVB 4R8WL 2ILLA 4K94H 1A1NB 2VXSH 5IBTL 3SQOH 3RURA 2VLKE 2Z31C 3I6LE 2AEQL 2K4AA 2XOTA 4QAWA 2QMKA 2CBQA 1CE6B 4KQ4H 3GSVA 4MAYA 4ZRGA 5HVGB 4F8PA 2WINB 1XSKA 2E4FA 4M93C 4AYID 3TBCA 4OFYA 1TITA 3AT9A 3ZK0A 5EBMA 4P57B 5EU3B 4JZOA 3UZVA 4NWTH 2E59A 4IHOA 5F9DC 1UZGA 2WV3A 2XT1B 1NAMH 2KERA 5KEZA 4M6OH 4U1KB 3FONB 1QBML 2ZQKA 5TF1L 1IEHA 1HXMB 3QZMA 2NCMA 1FNLA 5KSAB 2AJ3B 3A67H 3IXAB 2PW1B 2X4OA 4I0PD 4Y4KC 4DN3H 1MJJB 1FZMB 1L9RA 3GHPA 4ZMZA 2AABH 4X0KB 2VXUH 4JFFB 1DSWA 3RUGB 4J3OD 3SZ6A 3SGEI 2ZXGA 1UFGA 2V3FA 1WWCA 5BW7C 4QF1B 4TULH 3IT8D 1A4JB 4PRPD 4LIQE 5HYEA 3P4OB 3REWB 4GINA 3M1BA 2A1WL 4Y2OB 1FNSH 3N85H 1XTLA 1LTXA 2K3HA 1HIMH 1TUPA 3VVVA 4ZSOE 4EI6B 4J39A 3MPCA 5A7EA 3QIBD 3P69A 4P0DA 5LWYL 3QR1A 3BGFB 4XE5B 4PWJA 2W94A 5C8JA 5JUEH 3KYAA 4KVCL 3U0WH 3BQUC 1P7QB 5K39B 2G2RA 4AX3A 4BGLA 2RH0A 4G82A 4UT6H 4QOKB 1Z66A 4X80H 3PFUA 2J12B 2FE0A 1JZ6A 1MKFA 3RWDA 3O6FB 4H8WH 4MA7H 4ALAL 4HW6A 4MJIB 1PZ5A 3T3MB 3UTTD 4YFEA 2VIRB 4N5UA 2DDQL 3RILA 1Y6KR 4TRPL 5KVEL 5IFAL 4DP1X 2FL5A 4UIKL 5A6MA 3ZDYF 4GS7B 5CN2A 4K4KA 1HESA 1SJEB 3CFNA 2JWYA 4FHKA 3S3CB 3TURA 4ORZC 3RWJA 4TUKL 4OI8A 3WD5H 3ZVVA 2DMKA 5KVFL 2ESVD 2Y22A 2FJHA 5GRJL 3RDTD 2OTWA 5TH2B 1GOGA 3BKCL 2OW6A 4PJEB 2DQGH 1PG7L 4ZQKB 5HJBA 3SPCA 3TZVC 3QIUB 3UBHA 3D08A 3HAEB 2FJGB 3HN8A 1J1XL 4I3RH 3V6FA 1AACA 2EQDA 4JANB 2Y07H 5GXBB 3MCYA 4ABUA 3TWCH 4Y9GA 2HJKA 5FUZL 4P2QD 2O1AA 5D4JA 1U58A 2WXHA 5F7DB 5GZNA 3WIHH 1TVDA 3BEWB 4WWID 1UM5L 3GFUA 1ZD6A 5AB1A 1TVBB 2VLJD 5I1JH 4E2OA 4D8PA 3VXQA 4XNAA 1R4XA 2EH8H 4K9EL 2B1OA 1JXFA 3AMLA 5FDWA 1BOYA 2ZOLB 1F1GA 3HHSB 4GQPH 4X6CE 2VLMD 2YD8A 3NDZE 4H1LA 4ZODA 3NACL 4GQ9H 4RGNB 3SO3B 4QRPA 4QYOB 1MI5D 1E67A 3CGTA 5C07B 2FEDC 2QGDA 1CJYA 5D7JB 4MCYA 4MZRA 5I1AB 2AVFA 2NW2B 3LQAH 4M6AA 3ZTNH 3QUXB 3VUAA 2CO2A 4APQC 1PDKA 1E3XA 3QARA 2OR9L 1AKJB 1JV5A 4K9EC 5DUBB 5K9QI 1UURA 2EYRA 3FQTB 3ZKQD 4TYUA 1VFMA 3N9GL 4XR8C 2LQRA 3QAZC 4BFOA 1AGDB 4ZUTB 2E9BA 1AS7A 1DUZB 4RSYA 3SBPA 4NENB 1NLBH 4UAOB 2JQMA 5T3ZE 3CU1A 3HFFA 4R26L 3VXQB 5CEZH 1QUPA 5BV7H 2OMTA