2OA9A

Restriction endonuclease mvai in the absence of dna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
246
Chain Sequence
MKSMSEYLNLLKEAIQNVVDGGWHETKRTGIGKTFEDLLEKEEDNLDAPDFHDIEIKTHETAAKSLLTLFTKSPTNPRGANTMLRNRYGKKDEYGNNILHQTVSGNRKTNSNSYNYDFKIDIDWESQVVRLEVFDKQDIMIDNSVYWSFDSLQNQLDKKLKYIAVISAESKIENEKKYYKYNSANLFTDLTVQSLCRGIENGDIKVDIRIGAYHSGKKKGKTHDHGTAFRINMEKLLEYGEVKVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R.MvaI
publication title Restriction endonuclease MvaI is a monomer that recognizes its target sequence asymmetrically.
pubmed doi rcsb
source organism Kocuria varians
molecule tags Hydrolase
total genus 70
structure length 246
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oa9A02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2oa9A01
3IMBA 2ODIA 2ODHA 2OAAA 2Q10A 2OA9A
chains in the Genus database with same CATH superfamily
1WBXB 3ZIYA 2X9YA 5C0CA 5CO1A 5KWYC 5CKGA 3GSRA 1QR1A 4UNVA 5ECGA 3VFPA 2JIXB 3L45A 4JG1H 2QQQA 3MODL 4GKNB 3KPRA 1VADB 5JPMB 3K2MC 3KG5A 3KPNA 3KXFD 1DE4B 4QIRA 1TSHA 4Q9CA 4H2CA 2VLJD 2J72A 1KTCA 2V33A 1K4DB 1XEDA 2ADYA 1KJ3H 3G6AB 4YSOA 1EAOA 4PRBA 1O6VA 3ML8A 4DGUA 1KCVH 4HYTB 3CU1A 1F97A 4U6XB 3SPVA 5J8OA 5T3XD 3TNMB 5KVEH 2VOTA 5ICXB 5DZOA 1F3DJ 1T04B 2FAUA 4GB9A 5A3IC 2VDPH 3CFJA 4OFDA 5KYXA 3DOIA 1GGTA 2DI7A 1UWXH 4MD0B 3U7YL 2BHFA 3BZFA 3FCSA 1T21B 1RIVL 1NJ9B 4QTHA 4YK4C 4YHML 3BXNB 3H6AA 4F7EB 1XGYL 3WNKA 4J4PA 4XN7A 3RI5F 1Z5LA 4KXDA 4F8OA 3B8YA 5J4MA 1S7TA 3MRKA 4AKPA 3OHXC 1A7QL 3TO4C 3NCFB 4FYRA 3MAWA 4ZUVB 2J4WH 3IDGB 1TMCB 2B8OT 5CSZB 1KN4L 3WFCH 1X5LA 1DQKA 1WBZB 2CSPA 1D7BA 4DPBX 1U93A 1K5NA 2GUYA 5GRVL 1CDHA 1I9EA 2QKIB 4PJBA 1TJIH 4JLRB 1P9MC 1X5KA 4XCCH 3FL7A 3UG5A 2OTPA 4GXFA 1M05B 5TDPA 4XPAH 1TZAA 4ATTA 2ZOWA 4HX1A 1HHIB 2YD3A 3OKKB 5C8JA 3MZTA 4FFYA 3VVWA 3BGMA 3LS5H 1JUFA 5DD0L 3FQTA 4PJCA 2IV9A 3MRRA 4JPQA 5ISZD 3BH9A 2X4TB 2H0JA 3HZKA 5J0BA 1P7KB 2BWIA 1TVHA 2QTEA 5DWPA 4NO0D 1MCBA 4AEFA 3AT0A 3C9NA 3X11B 3RTQA 5F9AC 4IGBD 5AD0A 5JOEA 1AIZA 1Y0LB 5KYWB 4AEEA 1R33A 2BZDA 2CK2A 4IOSA 3BWUC 1BLIA 1B2WH 1UCBL 1DLFH 2NR6C 3FT2A 1W2KT 1JNHA 1MCLA 3IJHB 1AR1D 2WO3B 1LEIB 4X7SL 1EXUB 4LVHC 2D4FA 4S1RH 4M7JL 5TTRA 1O7DC 5J57B 3RDJA 2QMKA 1UA3A 3G7TA 3HZVA 1F3JA 3LXAA 1PDKA 2O6CA 3MFFA 1E4XI 3ROLB 4MJIE 1CD8A 1KGUA 2I5YH 2EDDA 4X50A 5DFVD 4MD5A 4JGMA 1CICC 5TQ0H 2KKQA 3N6YA 5CEXB 3X2QB 5L8JB 2C3HA 3AT8A 4QD2E 3D2UB 1SJHB 1MFEL 3NRPA 2ED8A 5DUPH 5KSUA 1A9BB 3SCMD 4FFYL 3WE6A 5BOZG 4Z9KB 3QZPA 2PW1B 1NLBH 3V0JA 3M46A 5FYKU 3DV6B 3HTLX 1AQHA 2JXMA 2NQ3A 5J13C 4NHUA 3CDGA 3FTYA 2JJTC 1RLBA 5D1XB 2VDML 2Y24A 1UWGL 1DVSA 5EHFA 1FPTL 1NC4A 3E8UL 1JAEA 2ITCA 2Q8AL 3PFQA 1J0JA 1OARL 4IS6A 3ZQXA 1AC6A 1RZJC 2IOMA 2DQUH 3VWKB 5ESAA 1EO8H 3FQ4A 1KT2A 4MNGA 2WLLB 3HMWH 3QARA 3MLSH 2GK0A 1ZLEA 4RBPH 1UYWH 3L4UA 1QNIA 1DDHB 1KB5H 4JZOA 5CU5A 2OYKA 2WTRB 1KLFA 3H56A 3MRHA 5IHUH 2OSLA 4XNUL 1D5IH 4M62L 5AAMA 3D12B 3EH4B 1HOCA 5MENA 1W16A 1UACH 4G70B 1CF8H 1XVSA 5SWSB 3NRQA 3PU7A 1U8JA 4YSSA 4E9VA 4XNZB 2WUBL 3CBRA 1J5OH 1ED3A 2P5WD 2ZUYA 2VSCA 3O9WB 2OL3A 2XBZA 5IG7B 4UAOB 3MA9L 4V2BA 5C86A 1CI3M 2GJRA 2ALAA 4XHJC 1X9UA 2X3BA 4YUEH 2EE9A 1DYZA 5L4FA 1JWUA 2JCCE 3R19A 3A22A 1QSED 2OMYB 4OZGE 3OKMB 1QYGH 5F9OH 4JG9A 1O9WA 2LFGA 5KVGE 4GG8B 1FVDB 3GKZA 3DX8B 3ZYZA 3ISRA 1AC0A 2XNAB 3BQUB 3D25A 4P4KB 5CNHA 1TQUA 3IAGC 4P3DA 1FLTX 1HDMB 5CBEA 3S3DB 3KYAA 1A7PL 1RFDH 1HL9A 1Y1UA 5T1KD 3V4UH 2EDMA 3DTUB 4XHQA 1EMTH 1N0LB 4FLOA 1DR9A 2GT9B 4TQPA 3JVGC 2ZX9A 3W56A 4ZNCD 1E27B 1OY3B 5CLYA 5I6LA 4CNIB 3MTRA 5GGSA 4BFOA 5KYYB 1CDJA 4ES9A 3P9LA 3FRPB 5F89A 2VH5H 1ZVSA 1K3IA 1XF4A 5LNEA 2DL2A 3LEXB 1P4BH 2EIDA 1OT2A 4OZIB 1NIFA 1X44A 2VAJA 6PAZA 3NJFA 5EN3A 4HPHA 3WTWA 3BEVA 4YLBA 4EI5D 3AREC 2OI9C 5T1LD 5J6GA 4JFEE 1CXLA 4EPSA 3FTUA 5I5MA 3KBPA 3WDJA 5AB9A 2OL3L 4N3TA 3T77B 3ZU8A 2X6UA 1ZCRA 4D9LH 3VDBA 2MKLC 1CFQB 1IGFL 5FKAA 1TFPA 4LHUA 3GM0A 1HXKA 3QR0A 4JGJA 5CMAA 1MREL 2Z64C 5DJ8A 1HC1A 4AIZA 1J10A 4PJ5D 3D07A 3MOAL 4M4PA 5FUOL 1EGJH 2F61A 4MNQE 1A4JB 3LH9A 5FA4A 3QIWB 4P0DA 3C60C 1TUPA 4OJFH 4I0PD 4PJGF 4W9LC 3JZ7A 5DA0B 4PTTB 2VKWA 3OXSA 3RWJA 3DARA 4HHGA 1K8IB 2Q87A 1YG9A 1WP6A 1NGXB 3PG2A 4M8UA 4FQXB 2YA0A 2ARJB 1J9SA 2V2XA 4QWWD 1YNLH 4F20A 5BMFL 3H3PL 4WW2A 1YEGH 1ACCA 1T7YA 4G5AA 2HRGA 3WLWD 1YN6B 4OGYL 2WLHA 4GAYB 3M17A 2WXJA 2EDHA 2PR9A 5IW6B 1A3RL 3AABA 4F24A 1CGSL 4J2QA 4G82A 2AERT 5FAAA 3PAUA 2A73B 2X4SB 1U8IA 1FG2A 3FU8A 3TIDB 5ESQB 4K3DH 1K4CA 1KXVA 4JM2F 4WJ5A 4HS8L 4UQAA 4YHPA 4KXAA 4RMSA 4AJYV 3VSQA 3ZT7A 1T0NB 3D4CA 4IRJD 1CCZA 2CLVB 3GIZH 3RDTC 2FO8A 2ZG3A 4S1DC 4XZ4A 3TGXA 4Z23A 3AB0B 4FABH 1NLDH 3CSGA 3VQLA 1X5FA 4R4FL 4ZO6A 4TOYH 1KPRA 4Z7OF 2O5YH 3SDXE 1WAAF 4GKZA 4L3ED 1E40A 5AVRB 2DTMH 4UIMA 4GKSA 3TF7C 3MUUA 4GG6B 2H3KA 5D1ZI 3D09A 1EBPA 1I31A 1YQ2A 2GHZA 4CMMA 1CO1A 3BP7A 4QJ4B 4R5XA 1NBVL 2B77A 1MN4A 4NM8H 5F7WC 3SHSA 4YWGH 4X4YA 2IWEA 4HK0A 5HYJE 3AXHA 5IBUG 4AL8C 1F2XK 1FFQA 3R7QA 1EAQA 2EVJA 5CR8A 5E8EB 4Z7QF 3UZQB 4Q9RL 2BW4A 3J8F7 4Y4FD 1A25A 3WUWG 5IVXA 2XQYG 1CBJA 4LEOA 2AK1H 3QQDB 3MFGB 3U4AA 5JORA 2DJMA 3R1GH 1X3DA 2MHAB 1QBMH 1UZ8A 3LKRA 2WNGA 2WBJA 4K9JA 2NY3D 5B38A 2VLRD 4FNSA 5E2UL 1NC2B 3MLTB 3RB5A 1FH2A 4HCRA 4JRYA 4NCDA 3G9AB 3VG9C 4R90L 3E9TA 4CVUA 4X6EB 3RY4A 2UXTA 1IT9H 1CT8B 1MPAL 1DQJB 1PVHA 2G60H 3MCLH 5T5NG 2WK2A 1E6JL 5HPMB 3ULUH 1PVUA 1TQTA 4IKNA 5I1KL 2XTSA 3RY5A 5GJTH 1BZEA 5DEFB 5C0AA 1CLOH 1SXSA 2VE6A 4I85A 4KJWD 5FFLA 3PQYD 3AXLB 2WQWA 2PCYA 1SMDA 4XNYH 1G7PB 3ZKND 3N50A 4GJTB 2FYYB 3RJDA 3WHE0 3TYGH 1TNMA 3KBEA 43C9B 3LDBB 1MLCA 2XQ0A 4N2LA 1E8XA 1R5VB 3KGUA 1G6RH 5GSRB 3S37H 1M7DB 1MG2C 3BKCL 3CVHA 1FVCB 2DL9A 4RFEB 5C0BA 1F4XL 2XIDA 3QUMA 1F11A 5DWUH 4ZW5A 1XGPB 2XC8A 3WBDA 4EIGB 4JFZH 4NN6C 1KLUB 1GGBH 2ZWKA 2NY4C 3CK0H 4GT7A 1HHKA 5FO7B 4CC1A 2CD0A 1F1AA 4O02H 1E9PA 4HCRL 3OB0H 4QRFA 1QLEB 4LLAA 1T80A 1AMXA 4A6YH 5KS9B 3KM1A 1AZUA 3D0AA 2EABA 1TMQA 5D5MF 2DMCA 4U0QB 2QHLA 2AEQH 3BGAA 1ZGLA 1RUML 2DWDB 5EO1A 2YPVH 3O81A 4Z7VE 1E3ZA 4ALAC 4EDWL 1JGUH 4Q58C 4F5CA 3MJ6A 3QJQB 4MQ7A 2DAVA 1A6WL 2XQBL 3KEDA 3LQAL 4I87A 4WUKL 4AJ0A 3HVNA 4AC4A 1T66C 4HHWA 3IDYC 4BCYA 4KROC 5C0NC 4IBSA 4HCIA 1ZAGA 3UX9B 4XP6L 4MXWL 4FLQA 1KIPA 5BXFB 1GSKA 2A1WL 3CVHL 3IPBA 2R0ZH 4KNQA 3V4PH 3IK2A 3HG1D 1PW3A 3QUML 2PYEA 1IKFH 3ZE1E 4HZAA 2VDLL 3ARVA 3MBEC 4M6AA 3LHPH 3QXVA 3AY4C 4NKQB 4H4NA 3B5GA 1JYXA 4OI8A 4OFYA 5HYEA 1XCQA 4P2OD 3H2WA 3GMPA 4KDWA 2L3BA 4PJ9B 5KSBB 5E03A 4S1QH 3D85B 1A9EA 3T6VA 4X42A 3GUFA 4LVNC 5B7MA 5E4AA 5JPNC 4FQHB 1M2OA 5DJCB 3VWJC 3D69B 1GR7A 4LLVA 4HALA 1XH3A 2G5BB 2GBUA 4G6AC 4MVBC 5JDJA 2VISB 3MBXH 2WZPD 5D9SA 2LLGA 3OWEA 1KJMB 4GSUA 2ZG1A 3MNWB 4R7DB 1C08A 4JM2A 1BVOA 3DC0A 1ETJA 4TNFA 4NPJA 4L3AA 2Z92B 4GMSH 5IFAH 2LLLA 4L4VD 4WGWB 2EC9U 3PWVB 1R47A 2G30A 4PRHE 4OU3A 4EVNB 3FSAA 3RKPA 3MOBL 4XVSL 5L2KE 3CX5K 4LSSL 2CDEA 1NGPL 3QXUA 4S1SH 5DRNA 3SJVB 1WAAA 4P3CL 4JJOA 1T5XB 4IJTA 1I1YB 4G7RB 4RMWA 1AAJA 4Z6AT 1GC1H 1D5ZB 4BKLA 3NDYE 3ECBA 4EIUA 1X5GA 2APXA 2JI1A 4UQIM 1FYTA 4C83A 1CF1A 4NNXB 3N85L 4O58L 4HWUA 2ITFA 5F7YC 1B2YA 5HJGA 1PY4A 4PJEA 5JW4R 4E41E 2XQYK 4WI3A 2KYIA 1YEJL 4JKNA 4TLKA 2I60H 1DQIA 4FNPA 4N2FA 3F8UB 1IFHH 1E5YA 1HZHH 1LDPL 5F7FA 3LH2H 4FOMA 3RWHA 1P4LB 5CR1A 2BNRA 4IKLA 4M3KB 4ZMLA 4ODVL 4U3SA 4ANKA 3ULUD 1G9NC 1KCBA 1XMWA 1MCCA 1WAEA 2XN9A 4QLRA 1BYPA 3L3OB 4UT7H 4DTGL 3L3IB 4G83A 4ZMYA 5HGGS 1KCUL 3U79A 1KXTA 3P4NB 3T4AA 1M6OA 4BFGA 3QDJB 3KCPA 3JWDH 4P07A 1ZIBA 3D2TA 5CCKL 3CZUB 2WUCL 3MUHL 2H32B 1ID5I 4Y7OC 5IEHA 4LEEA 43CAA 4F7PB 3VXNA 4M8VA 1RHFA 4XI5C 5IBTH 4K8RC 4Q6IC 3UAJA 2H3NB 2VN3A 2XG4A 2EYTB 3KYOA 3MV11 4HQQL 1NDGA 1S9VB 3SKOA 6PCYA 4MB3A 1OTSD 4JFPB 3NJXA 4BKSC 4UV4H 2O6DA 1V3MA 2AQNA 4X0NA 3UBGA 3MYZA 2CLRB 4YHKH 2AEIT 1YEEH 4PW4A 5EV7A 4LHQB 3VFVA 1E3XA 1Y18A 1RHHA 3U83A 4J8RB 5C0FA 3GB7A 3QRFM 3INOA 3LVTA 5SX4H 4W9KC 3ZZLA 5BW7C 1ZOXA 5MHSD 4A04A 3BPOB 3CQFA 1BG1A 2DMKA 4POZD 3VXUB 2OP4H 5E9DE 3W0WB 4E2OA 4LNRA 3UYPB 3PYCA 4XOEA 5D1ZB 1OHZA 2CKBB 4HFWB 2AJYL 1RZFH 1C12B 3AAZA 3EO9H 4G8IB 2HKFH 4DUXA 3NACL 1G5GA 1ADQA 2LABA 1SXNA 4U7KA 2CDGB 2GTWB 5EOCJ 1UXMA 2QQNL 5IHZB 2HFGH 5KSAC 1YNKL 5GHWL 4PD4J 3EYSH 3H0TB 3T5WA 3RVTC 3VD7A 3NP4A 5CP7B 4DKEH 2WAQA 4HA1A 1U8OB 1UG9A 4N2GA 2EDOA 3SPHA 4EJ1C 2BRQA 5AAMC 4FXTA 4NYLB 2CHNA 1VEMA 2VLKA 3QI9D 4DVRL 3HBZA 1TQBB 3NJGA 2I24N 4ZAKD 3QEHA 3NSJA 1BVZA 3SE4A 2X4QA 4IBTA 2OA9A 1CGVA 2VT0A 3DTXA 4JHUA 3UYRL 3J7HA 4ZJ9A 1X9RA 5ID1A 3MRBA 3HE7D 1KYDA 2KMWA 4JY6B 4M7KH 3EOBB 1BHGA 3G5VB 1OP4A 4U49A 1HKFA 1HNGA 1B90A 2VSMB 2DQCH 3M1BA 1IGYB 2MQGA 2PMZA 3DO7B 2MCAA 3JTTA 5D96C 1DFXA 4OQ1A 2X6CA 5B8CC 4ODHH 2OSWA 1RK1B 4J3WA 1ADQL 3S35L 4ZFGH 2EDEA 5F6HJ 3MV8D 5FHAH 1QUPA 4Y9BA 3VFOB 4M5ZH 3MNVA 2BDNH 2VDOL 5E5UB 2JELL 1IM3D 5DJ0B 4LPWA 1SHMA 3D3VA 3LXCA 1ORQB 3CWGA 4L8CB 4AQEA 1ET8A 1ID2A 4NBZB 2QSCL 4RMQA 1NKOA 2WGNB 4ONHB 5JQIB 4AENA 4JNXA 2IWKA 4PTUB 3T8MA 2YN5A 4JQIH 3NJHA 3MJGX 4ADJA 2IDCA 1F42A 1LQSR 5ANMA 2YPLA 2Y7MA 4L1LA 4X99A 3JYCA 1VCBC 5DFTA 1IC1A 1WSST 3AS2A 3VGDA 1CL7L 2Y0SA 2Z91A 4MAYB 2R23B 3IE9A 4U1HA 2J12B 4D8OA 4M7LL 2R0LL 2CXKA 3U4EA 3BT2L 4RH4A 3Q9QA 2K4AA 1NPUA 4G1MB 4MA3A 1DBJL 1WV7T 2IDQA 5A2BA 2VERA 4QMEA 1O9VA 5AWNL 4M1DH 5HHVH 2OMZB 5I30L 1RAMA 4U31A 5I6XC 4M6ML 3LRMA 5GS0C 5I1IL 2ADFL 1H3TA 4JFFA 4NZDA 1ZTXL 1X5MA 1WT5C 4ORGB 1ND0A 2WZAA 3BUYA 3PF2A 4G9FB 3QYCA 4HKZB 2BFVL 4JCWA 1I3GL 5FCUH 5TE4H 3TA3A 2CO7B 3GNMH 4KJQC 2RIKA 4OFKA 2VUKA 3QJUB 1QLFB 5A16A 2Y9RT 4X6FA 4MA8L 4NBXB 3RWDA 3C6EA 5FHBH 4YSEA 1NBZB 1XR8A 1V27A 5KJ4A 4YSCA 3QUYC 3OMIB 2P5EB 3WTTA 1OAQL 2IH9A 2EXTA 1AR2A 3HG2A 1H6EA 1WH0A 2TRYA 4TUOB 2DIAA 3HPLB 1PSKL 1TTGA 1S9YB 2HP4A 2Y5QA 4H1LB 1IE5A 1OANA 3BSGA 4Z7AA 1FJ1B 5GIRA 2ALWA 3F7KA 5I1DA 1JYNA 4RISL 3UCQA 2A2QT 3TT1L 3HLAA 4O51A 4H2AA 2OKMA 4OCXH 4L8BB 1Q90A 3AU1B 4NFCA 1UATA 5BZDA 5ICYB 5ADOH 4EI0A 1TO4A 3EOYG 1EZSA 1G7HB 3GXNA 5ENWB 1AO7B 4B9JA 1TPXB 1QQDA 1FDLH 3BP4B 2GY7B 2IF7A 5HHXL 3LV3A 2FLMA 4YSUA 1S5HA 1TCMA 4PI0A 1FH5H 5DD1L 1JI2A 4MS6A 3EFOA 1GS6X 2ZOLB 3K4AA 4KUZL 5I9QB 3ATFA 1V3LA 1MF2L 4HIJA 5D1QE 1HQ4B 3MV9B 3H42H 5D71H 2XV2A 1D9KD 4KY1L 4RAUB 1EZUA 1A1OB 4TKWA 4ZSOA 4AUUA 3BPNB 1PNDA 1AE6L 1JN6B 2H5UA 2Y2WA 3LEVH 5GRVK 3ZE0E 1MAMH 3QPQC 2JIXD 2W38A 3FSWA 3HC3L 2FEEI 4UNUA 4NAJA 4YE4H 3CFEA 4NWTL 4JJ5A 5KOMC 3TZVC 3QQ9C 1ILSA 3NCJH 3C5ZC 2BVPB 3CHRA 3APFA 4R2GB 4YQXL 3RG1C 1ZXQA 3OKNA 6CGTA 5T3ZL 2E5EA 3ZY7A 4L48A 2QZ5A 2TAAA 1JF1A 2XTJD 2B1AL 1AFVL 1YY8A 4QCIA 4OZHE 2EXYC 4YDLC 5EZLB 2EIZB 3MLWH 5C2BH 2QGCA 4RGMC 1BJMA 1DVFA 1C5DB 3DPBA 3QZBA 5GRYA 5FPIA 1P1VA 4PVBA 3KM2A 3ZHLA 3MGOB 4HWEL 3LQAC 2Z31C 3UTTE 2C9AA 2FX9L 4M6NH 5I75B 5MP6H 3APNA 4PR5A 1SF3A 3QNZB 5IIEA 4FQCH 1R75A 2Y3NA 1DP0A 4TTDD 3DGGB 4NBYB 4NZ8A 2OJZL 5ELIA 3TJPA 5LQBH 1DVXA 1NIBA 3ZE2B 1QFWL 4FFZH 4OLUL 2NXZB 3ABMB 3GEWB 4FXLA 4JY5L 4TUUA 5LBVA 2P8MA 1RCYA 3B34A 5AB0A 3CIAA 3KL5A 2VERN 3CHPA 4R8WL 5IV2B 2YGOA 1XO8A 5I0WA 4GXVL 5JHDD 1MHPL 3RWGA 1W0YT 5GZNA 1C5BL 3GYRA 1KGJA 1WISA 1OSPL 4OLVL 4K73A 4ONGH 4PJFB 3F6JA 5IJVA 1E4HA 2CLZA 1PIFA 2F8OA 1VDGA 2GEEA 2W94A 3D18B 3EDJA 3OAZH 1U91B 2VSKB 1NCDH 2F5BH 3BKJH 1M9SA 3WV0A 4DP1X 4MTMA 3FU9A 5D8JH 4ZO7A 4UAHA 3PPEA 5EFIA 1JD7A 2EDKA 4N90E 5G55A 1LE5A 1OOAA 4OSUH 1DJGA 4EN3C 2YGPA 2R27A 1W0WB 4JFYB 3LZRA 3D33A 2MFNA 3IVKB 4FZEH 4YAQA 3L3KA 4V1DE 2CIKB 4Z7WE 2DMBA 2L0DA 2JV6A 3RIAF 4DPCX 4JRXB 5FB8A 2COVD 2RCSH 3VE0A 4R6UA 2PR4H 1R34A 2H6OA 3OHXB 1W72A 4K23L 1LHZA 4QRRA 3P77B 2J6WA 4XWOC 3CPLB 4HPYH 1BF2A 3IMRA 1HKLL 3QIBC 4XNAA 1M57B 1ZHNB 3ARGA 1URIA 4UT9L 5GRZA 4G6KH 3GEFA 5EULV 4Y5VC 2DB8A 3MLPA 4NPYA 1NCHA 3Q1EA 4NJAL 2ERJC 1NAKL 1D2OA 4BQ6A 5DRZB 3CFMA 2O61A 4N2OA 1N7MH 1E43A 1PX3A 5CXPA 6TAAA 1KULA 1OAYH 3D2UD 4WW1B 1KENH 4KHTL 1KOAA 4QHKI 2QADC 4OLWH 3VJ6A 1UXSB 4N6QA 2EUWA 3NJLA 3LRLA 2OXGB 2XXFA 1UVQA 1HL4A 2BVUA 4F7CB 4C56B 4B53A 2C9RA 5FO9A 4B9CA 2EDJA 4KHXL 4K9EH 4KX8A 4RMRA 5IROA 3UEZA 4XO3A 2LVEA 1SVZA 4A68A 4F92B 1JNJA 1PAZA 2MOQA 4ZOEA 5FUCC 5JHDE 2R4SH 1XF1A 2FBJH 3K72B 5SX5H 5AW2B 3VXRE 2AGJH 1OALA 2H6UA 2Z4QA 3JZYA 3TCTA 3VWKD 1IGJA 2X9WA 5HY9A 2D0HA 2E7HA 4LARH 3DX0A 1MCPL 5C0IB 1HILA 1RZGA 2JCCF 1HYSD 1SM3L 4MNHB 5I0XA 4F33B 3IXTA 5GISL 4LVHB 4QTIL 1W72L 4OZGF 4M6OH 4KK6D 5TQ2H 3IF1B 4ILDA 3VI4E 2PPFA 4KK8D 3GSQB 2AXJA 1N8OE 1I85A 3UGEA 1PFOA 4ONFL 1IGIL 3BN9C 1VKXA 2NZIA 3SDYH 4HEME 2AXGA 1WWBX 2DI8A 1XGTA 5FKPA 2WKOA 3O11A 4CW1B 2GJ6B 3SBQA 3GHEH 5DSCB 3GMQB 3MJ8A 4WHTB 4ZODA 3O3DB 1QZNA 3KDMB 4G43B 2YPKA 3L13A 3MTXA 3O9WD 1DSYA 3OAYH 3KD4A 4QY8A 4XMWA 3MRJB 5J13B 4P2QE 1Q9WB 5KEZA 4NQCB 1OW0A 2DEYX 3NEEA 2B4CL 3F7YB 32C2A 4YZWA 5EOQL 3I6KB 3M45A 3GXUB 4N6RA 1FIGL 3MACL 8CGTA 4LU5H 1NCBL 3BQUD 3LN4B 4P4KD 3K6FA 1LP9E 3T4AC 1PYWA 2P8LB 1ZPUA 5J9PA 4MA7L 3DHUA 3Q8CA 2WXQA 1NMBH 4M8QA 4N9OB 1U8LA 3V95A 2DQEH 5DK2B 3O6FD 3DVFA 5BO0D 1UFGA 3FCTB 1A8ZA 2VLLB 2R69A 5AVTB 3ALXA 3GZKA 1YJDL 1AY1H 2AVGA 3UAJC 2MCPH 3DBXA 4NDMB 2A4CA 2F19L 4Y4HA 4AYEC 1KTJA 4UOJA 3RI5K 4JHBA 4MMXA 5CIPA 4MQSB 1PZ5B 2EUZA 2CRIA 1CXFA 4UOW1 1Q72L 4WO0A 3UTSE 2NY7H 1XF3B 1FN4B 1MNUH 3CZNA 3EKCA 4N0UB 5I16A 4GOSA 3RBGA 3N1GC 4I1RA 4JL2A 4WY7L 5DTFB 4LASH 2WPGA 4MMZC 4D9RE 4IBUA 3QFDA 1QLEH 5B39A 4EZJA 1BFSA 1YC7A 3NSDA 3OKEB 2IPTL 4A2MA 3RE0A 3N40F 3Q5YA 1TQCB 2NXYD 5TDOB 1KBWA 2EYSB 5F2FA 3DWTA 4BFFA 2XZQH 2PXYC 3L1GA 2E7CA 2E9JA 5IR1A 1Z1WA 3DYOA 1IAMA 2RFXB 3O3AB 5EOCH 4E36A 4AEHL 1F86A 4HDIA 4MMYA 1MCIA 3CC5A 3RGHA 2VITA 1UD3A 4FQIH 5CCHE 4KRLB 1INDL 3GGWB 4G1EB 4EAEA 4FQXD 4RMTA 3SDXF 2C34A 3F5WA 4NHCH 2H1XA 4FXKC 2R69L 1UWFA 1XGUB 2G5UA 3ECVA 4NQVB 2HN7A 1O6SB 2KHAA 3BJLA 3SKUD 1V7ML 3ARDC 1JVOA 4KAQH 3VXME 5C7XL 4OCWL 4XO4A 1ZWIA 4A2EA 1JHKH 2VWEC 4WFFD 3S5YA 1AGBA 2OI9B 1DQQA 4JHZA 1MRCL 4PJIB 3VD1A 3MRIB 5GGQH 4JFDB 4OCRL 3MXWH 3I75B 4CADB 1CU4H 4ZUUB 1A2YB 1RJYA 3E6FA 3TL5A 2EECA 3T0EB 4A2LA 1NKRA 5EPMB 4KKLD 2OMWB 3T9WA 4FHKA 1F56A 5DFAA 5EO0B 1J0HA 2AJZA 3PGDB 5E6RB 2NUPB 4AKOA 4KK9C 5JIQA 5M95B 2G3XA 1Q1PA 5F7DB 3EO0B 1U8PA 3C60B 3ZBMA 2HH0H 3EGDB 3EIFA 5ISZA 4MA1B 1QSFB 3HZMB 4LLUA 3T6QC 2FLRT 1ROCA 3D0VB 4KKBC 3I85A 4LLWA 3DOSA 4GY4A 3DHPA 3QORC 4FI7A 4BUQA 3FOMA 4IGBA 4G6JL 3WE1A 3L1OH 1KTDB 15C8L 3WTSA 5C0EA 4R0LA 2F7QA 2Q7NA 4JW3A 4UNTA 4YZFE 3GMRB 1L6ZA 1OPOA 4JO2H 3LXUX 3VXTA 4ZOCA 1U2HA 2BIOA 2KZBA 2D7OA 3HG5A 4M00A 3CDZA 4TVPH 4UQ3A 2YKLL 1WFOA 1NIEA 1E7VA 1NEZA 2QHRH 2WINA 4DVBA 3VRJA 2OCCB 4N3UA 3B2UD 4JO5A 1GY2A 2J1YA 4LPUA 4AQ8A 3QULA 1ZK5A 3QJRB 5AW1B 2FNWA 4H8WH 3V5HB 1IEAB 4YSQA 2JCCA 3HI5L 5I17B 4DSYA 1NC2D 3H9ZA 4OZGA 5DFWH 1ETA1 4L4TB 4FA6A 1PG7H 4JQXA 2XWEA 2YAEA 2H6PA 4F8NA 4BSWB 1TQSA 2JMRA 2A0LD 2AJSH 1PLGL 3BMWA 1FL6A 4CMHB 3L8QA 3F00A 1Q9LB 1EEUA 5IB2A 4WTXA 1DCLA 4WGVB 4DK5A 4G7QB 2Y7QA 3FAXA 4UYPA 3MMEA 4QXTA 4JRFA 3TA3C 3ULSA 8FABA 1U95A 3SYCA 2KQMA 4CVWA 1N70A 4HLZG 2XVGA 5I8OL 1RURL 1VGKB 5EH1A 2D0FA 3T65B 2FO4A 2MPAL 2LAGB 4NO3A 5B1AB 4JX0A 4BH7A 4MRBA 2OSYA 1DJYA 3WNMA 5ADPH 4OD1H 3WEBA 1W0VA 4JFEA 5MEOB 3P30L 3VYPA 2XV3A 4AT6B 4DF9A 2VO5A 4X6DE 3FQWB 2XRAL 1HEJC 3FBKA 4JDZB 1F45A 4PREB 3OC8A 1CFNB 4ETQB 4JAMB 1EZLA 1PLAA 1XB6A 3VYNA 5DMKA 1EFQA 3IDIB 1AIFA 5I26A 3CX5J 2BSDA 5CP3H 3P73B 5F1IA 2ZCLL 1BZ9B 3EFFB 1BZDA 4RAVA 5K93A 3HRPA 4M1CD 4WEEA 2EEBA 2XZAL 1XXFC 2JSFA 3ZE1F 5KVGL 3VX1A 2A38A 3K6SA 3KH4A 4NQSA 4DP6X 2DLEA 2V17H 1SEBB 1EEZB 3ZZ1A 5AENA 4RAHA 3IMVA 1NOLA 4CC0A 1B0GB 1WGVA 4MDIB 3AMKA 4X0KA 5HSFA 3T3MB 4KKAD 3SDDB 4G8FB 1Q8MA 3VFWA 1FUNA 3WXWL 1UD6A 2CKBH 3NTCL 3K5SA 3L2NA 4G8GB 4QYOB 1QSEA 4RMVA 2ZJSL 5FOBA 4OIAA 4TUJA 2H9GB 2P80D 5L9DL 4PY8I 4FCAA 4JKPH 1L0QA 3DGDA 5FGBA 1LO0L 2VSDA 2WYIA 2DEWX 5HHPB 4XCNB 3V6OE 4CC4A 4UQ2B 4HIEA 3LPWA 2J3SA 4S2SA 4EDXB 2YRZA 4OIIL 2HT2D 4OD2A 3TBVA 1EEYA 5C0JB 4NZTL 2EDRA 2GFBA 1E8YA 4BCXA 1QKZH 1YVLA 2EDFA 4KPHL 2PCFB 3ILQC 2NY4B 2ZKWA 4HJEA 4PJ9D 4WKZB 2CJUH 3QE5A 4JG1L 2UYLB 2XKUA 3D85D 5FYLE 4GAAA 5EC1B 4KQ4H 3SDXA 1NCAH 2AF2A 3UG3A 2FJFB 3DO3A 4R5VA 4XAKD 1IGMH 1E90A 5KJ7E 3VACA 3WXVH 1J8SA 3L6FB 2QSQA 2ZKYA 1RY7B 3UTQB 1KTBA 1VJSA 2GI7A 4EIZC 3LKQB 5T33H 1GOHA 4KI5D 4L29B 2AV1B 4QF1B 4WFGD 1G7IA 3OZLA 4RX4D 4L3CA 4X7TB 2VDPL 4PJ5A 2WCSA 4KROB 3BSZA 1FBIH 3QPXL 1HHJA 4U1NB 2OMVA 5FW8A 4ANUA 1PD6A 5J6HA 2RHEA 1R4XA 2O61B 4DO6A 3TIEB 5I1CH 1S7WB 4W4OC 2E7BA 2JK5A 1P4IL 2FK9A 2OJEB 2DQIH 2HG0A 4X80H 5C0CB 5DZAA 4DETA 2BK8A 3D9AH 4CVZA 2O5XL 5CJQL 3GSRB 1QR1B 2R39A 1XGQA 3VFPB 1BAGA 3QG7L 3FO1A 3RIFF 3KPRB 5SWZE 3WEAA 1UJ3C 4TVPD 3KPNB 4MLSA 3ZL2A 4ZMXA 3EDFA 3BC9A 3WFCL 3LRSB 1T83A 5GZNC 4HIPA 4LVNB 3JQOB 4ESJA 3P3UA 1R3HA 4PWKA 3SPVB 1G9ML 1KIRB 2BC4B 4IBQA 4XCCL 5JPNB 1AHWA 2QLVB 5JIHA 3AACA 4K5OA 4OUUA 3KWUA 3CFJB 4K15A 1QEWA 1ACYH 2F53E 3BZFB 4WTZA 3FCSB 4HMEA 3ZSSA 3QC5X 4QTHB 3BSZL 2CHDA 3EYQC 4CSTA 5A2AA 1FCCA 2WYTA 4FQQA 1Z5LB 3CXDL 4OUOA 4Y1AE 1S7TB 1MCNA 2BHUA 3KVQA 3MRKB 5CEYA 9PCYA 1VCAA 4XB3A 1TXKA 3D6GA 4IJ3C 1Z6JT 3B9DA 4PJDE 5AFAA 1E4WH 5DF0A 1XT5A 5CZXC 5E8PA 3V7AG 3CLEH 1IVTA 1UQSA 1CE1L 1U93B 1K5NB 2XU9A 4ZUTA 3QHZH 4M4RA 4PJBB 4Y2OA 4Y9CA 3FT3A 2BSCA 5IMMA 1UM5L 4H1LH 5EEWA 4Y4FA 3R4RA 5TDPB 3ZTNL 1EO5A 1JPSH 4KH2A 3BGMB 4MXVE 1JUFB 3LPFA 3FQTB 4Y5XC 1NDTA 4F7TA 4PJCB 4QHKJ 1ZT4A 4Z7VA 4M5YH 3BH9B 2NY2B 5FO8B 3HZKB 1YPZE 2FEDD 1DL7L 3KLDA 3DJSA 2VLRA 2VZ1A 1DO5A 2HRPL 3O2WH 5DUPL 5IROC 1NLBL 1TVHB 2VDMB 3C9NB 3I6GA 3V0HA 4PSPA 5GS1B 1D7FA 5D7HA 5AD0B 3QWRD 3VXUD 3W0WD 4TQIA 3KJ6H 3HFMH 2ZCKH 5E8NA 5JMRA 3CZSA 2VM4A 2FZ3A 3FT2B 2PYFA 5D2LA 1JNHB 4X9GA 3ARQA 3OM3B 1NTDA 2K3HA 5E8DL 1EO8L 2N7SA 5IFHL 1V10A 2WWKT 4ELDA 5F1NA 4PSRA 4HKBA 3HMWL 4EZKA 3HZVB 1F3JB 1KUMA 1YRKA 1BBJB 3RA7L 1PDKB 2WKLA 4XTRD 3MFFB 5TF1H 3DIFA 1W15A 4V11A 4PCKA 5MEQA 4N5ED 2GVYA 2LVCA 1M7IA 4HJTA 4L9LA 1IJ9A 1SHSA 1XD1A 1I85C 4JUSA 2XHNA 4NZJA 1HINH 1D5IL 4QEGA 3RNQB 4JKLA 4P9HH 3SE9H 3S88H 5B1JC 2AXWA 4MXQC 3B7UX 4PS4L 3V6BR 5GZOA 5DZPA 3RFZC 1OZTG 1CF8L 1I1AC 1JV2A 2HX9A 4PWGA 4PV1C 4N2EA 2OYLA 4NHUB 3CDGB 4CILA 5AOZA 1OW0C 4MFHA 1G84A 3IN2A 1DN0A 2HLFC 1NC4B 3B83A 4PAZA 2ITCB 2ITDA 3HZYA 4J3UA 2IGTA 3LY6A 3GLEA 3RPBA 2UZPA 1DANU 5E9NA 1J12A 4YUEL 4F2ME 1M2VB 4PRHA 5ESAB 3DUSA 5HDQH 2F74A 3CZKA 1HEHC 4PIBA 1L9MA 1ROWA 1KT2B 4WWID 1GZHA 1KC5H 1QRNE 1S5IH 3NA4A 4MNGB 3RVUD 5L2KA 5EEZA 5DVNA 3AS0A 5FYKE 1NZRA 1E6OL 2XIBA 2WN2A 3NPSB 5FEBA 3S5LG 4HEPG 2GK0B 3FB6A 4XNDA 3CCHA 1MELA 4H26B 4JZOB 3CFBA 3CQPA 3GSUA 1MHEB 1T1YA 2V5YA 1KLFB 1RFDL 5IQMA 3MRHB 3V4UL 3VFNA 4UTAH 3LPGA 4KKQA 5B7EA 2Q6WA 2FJGA 1A7OH 1BDYA 1QUNA 4Y4HC 3ISWA 4ODSH 4MMXC 3ZKXC 2RQ8A 1HOCB 4WFHE 3TU6A 5IQLA 5DVMA 2D0GA 3X13A 5CZRA 4E41A 4XXCA 5INDA 5FC9A 4P23A 4UV7H 4DK6A 3HG1A 4GUCA 1U8JB 4YHZH 4BWWA 4XVUD 1ED3B 5E99H 4MAYD 4KVCH 1GMIA 4BZ2A 2OL3B 5A6LA 2A6IB 3CXHK 3L1EA 3WEXA 4X5XA 1NBYA 3GTVA 2UZYA 3QQNA 1JWUB 2OYMA 3G6JE 4QHLA 1EO7A 3BW9A 1TETL 2ICWA 3PDOA 2XBTA 2EH7H 4LSTL 5AL0A 1BA9A 1HXMA 4F8TA 2E9GA 2G3ZA 5GGVY 1OVZA 3D25B 5B8CB 5CBEB 3EF7A 4G9FD 1IFGA 3FQRA 2FCBA 2H0EA 3WENA 1IC5H 5BZZA 5EBGA 1S7VB 4PV9A 5GGSB 1OE2A 2BVEA 3B9AA 3NJVA 1ORSA 3P9LB 4XX1E 1ZV9A 5F89B 3TP4A 4J27A 1XF4B 4PG9A 5SWQA 4M9OA 1N5YH 3WCYA 1BMGA 2P5ED 1F3RB 4JQVA 1BFOA 3BEVB 4YIQA 3HR6A 4GXUN 5J6GB 2J2ZA 1NPJA 3TFKD 1ZLVK 3PWUA 2YRPA 3L95A 4BZ2L 2HUEA 4P59L 4WO4C 4WWNA 4JHAH 3E2HC 2AEPH 5FKAB 3LIZH 3LZNA 4U2YA 2OR7A 4KBPA 3ZE0F 3CH8A 2VN5A 5E9DA 4JY4A 5CMAB 4CSSA 4M43H 3BUDA 5DJ8B 1SJVA 4P46C 4AIZB 1KGCD 4I48B 5I6XB 3GIZL 2X38A 5FA4B 4BSVA 2GIYA 1ASPA 1AO7D 4FABL 1D6EA 1NLDL 5AKSA 3FKUS 3RWJB 3OXSB 5CJOH 5CCGE 2IOIA 2VB5A 1SN0A 1P6AB 3CTTA 4NN5B 4YPGA 3QDAA 1YQVH 3L3GA 2V2XB 4W9CC 2J88L 2EKSA 4NZUH 3EH2A 4OZHF 3MV9D 5H35A 1DSWA 2O30A 3OGCB 1SLUA 2BH0A 3D06A 5DYOA 1KN2H 3RU8L 3X1BA 3M17B 4DKTA 3HFFA 1X4XA 1PG7W 2X2JA 4YWGL 3ZW3A 1XIWA 5F6IC 1U8IB 4RZCB 3IAPA 5DUBA 4D94A 4WJ5B 1K4CB 3Q43A 5DS8A 3RGVA 1OB1A 1JWSA 3K74B 4AQ8C 4YHPB 1C8QA 1X5HA 4R2GD 2I9LA 3MVSA 3LKSA 4N2NA 2DTSA 4EO5A 1SY6H 1L7TL 1SQ2N 4JQXC 1IQDA 1UH4A 2FWSA 4L2LA 3RL2B 5C71A 1KPRB 4O02A 1PZUB 3MGTA 4GKZB 4G9DA 1FF5A 4A6YA 4XP1H 3K0WA 5L6YH 1H3XA 4C55A 1R3KA 3RQ3A 5DJZA 3KPPB 3NA9H 4UIMB 4A1RA 4IOFD 3BP7B 4A7SA 2E9BA 5GJTL 1L7IL 4X4YB 1CLOL 3AITA 1A3LH 4HK0B 3UJJH 5JOPD 3GMNA 4HH8A 4BFKA 4N8UA 4XNYL 2OCFD 1RK0A 3CLFH 1ZIAA 3DETC 3Q48A 3ZK0A 3UIYA 3L4TA 5IVXB 4LEOB 5F9DC 3DYMA 5JORB 4KFZC 3MRQA 4HFUL 4J3BA 4Z7WF 2W9DH 2WLMA 5ILTH 3TZVB 3S37L 3LKRB 2WBJB 3E3QE 5I1EL 3V4PA 5B38B 2G5RA 4P5TC 4OLEA 3QI9A 3VRLE 2AITA 3LRHA 3MRCA 2PPAA 2HB0A 4HXAL 1IU1A 4JFZL 4JRYB 4A55A 3BZEA 3CK0L 1CL7I 2EDYA 2E4TA 1XTMA 1LO4L 5JW4M 4N8CL 4O02L 3PWPB 4MDRA 4YDLB 4A6YL 5TGBA 4HKXA 5JIMA 1COBA 2R56L 5A3ID 1JZDC 3LS4H 4NQDB 3QZMA 5C0AB 4ACPA 1S78C 2VE6B 3L3HA 3CDFA 3QCTH 4OGAD 3B2VH 5DD3H 4NWUL 4XNXH 2HJFA 4ZTPH 1CFVH 3EFDH 3C5SA 4HBQA 1KEMH 3CN3A 2Y1VA 1IC4L 5EF2A 4PY8J 1MLCB 3HMXH 1X7TA 4TL4A 3CVHB 3MV7E 2EUVA 1TEGA 5C0BB 1A65A 4I1NB 3QUMB 1F11B 2NNFA 4CSPA 2FSDA 2W1NA 1XMEB 4QHMB 2VDLB 5D72L 4G6MH 5E6ZA 1LGVA 3ESOA 1OP5K 1C1EH 1HL5A 4C59B 1XAUA 3AS3A 3V4PL 3EJPA 3CDYA 2ZYHA 1U3YA 4K7PH 1HHKB 3UBXG 1E9PB 2J71A 5DD5H 2DF3A 3PHAA 4V33A 4U6YA 5EC2B 1U2YA 3VI4F 2FEJA 1ZGLB 1G9MC 4JZNA 4YBLC 1VGEH 1H19A 5EO1B 4C56D 5IOPA 1VZGA 2WGXA 4RFNC 3UDWA 1DQMH 3THMH 2XCMC 1KELH 2WXOA 4YDIH 1YEKH 5ITFA 1L6XA 4MQ7B 3F7RA 4MJJA 3D87B 3UJIL 3VGAC 1XDTT 3T8XA 7FABL 3MU3A 5FUZL 2AMUA 3G5ZA 4LL1A 3HJEA 4P5KA 5B3SB 1XSKA 3F58H 2LV4A 4XPBL 3UP6A 1BZ7A 1WFTA 1KIPB 3TEZA 2EEXA 5DEGA 5TPWH 3SBWA 2PYEB 1KJ2L 4JDTL 4GO9A 4PJGB 5FCSH 4ANWA 3PFUA 4GEJA 4Y5VB 1XCQB 2ERJB 3NMEA 2R1XA 1NMAL 3GMPB 4YHIA 2QDWA 5F3BA 3HHSA 4LCUB 1AACA 2ICCA 1A9EB 2B3IA 1GC1L 4MSWA 2OZ4H 1F13A 2WVUA 4YDVA 4OZHA 2GJ6D 2N1KA 5DK0A 1AHWC 4OCYH 2CA3A 3V6FA 1QBBA 5KVFH 4LLVB 1XH3B 2FQFA 4L1SA 4NQCD 1U6AL 2EC9T 1DZ0A 3B9KC 3NT0A 2BIIA 3FNKA 1ZMYA 2IIJA 3PGCB 5D9SB 2X12A 3GSWB 3T4YA 5K9QI 2M2DA 3QEQD 1LWRA 1IFHL 1HZHL 1C08B 4A37A 4JM2B 3WTXA 1GHFH 3NBNA 4Y1TA 4GW5A 4PJ6A 2YA2A 3WG7B 3GJEB 4LCWE 3VFTA 4O5LH 4W6WB 4LF3A 5F1KC 1BPVA 3S3JA 1SHWA 2XVKA 3S3BB 4P2YA 3SGEI 4AL8H 4JO4H 3POCA 4Z7OB 2MSPA 5DRNB 4U1MA 5D4IA 1QFWI 1D9KA 3I02A 3VO0A 4OLYH 3KLLA 4FHBD 1IMHC 3HEIB 1FYTB 4Y9EA 3TASA 5J6SA 4OZFG 4X4MA 4K2UH 1F58L 3FO9A 4QT5A 1PAMA 4PJEB 3I6LE 2E7DA 3LNFA 1O7DE 4UV4L 3QFJD 4Z7QB 1HS6A 1Y6MR 4RGNE 1UA6L 3RWHB 4YHKL 5IIEB 5E70A 2XPZA 1OK8A 4XHJD 2BNRB 3TF4A 3AG1B 1ECZA 3CZFB 1JHTB 4V1DA 4U3SB 2BVYA 2X1QA 2XN9B 5BRZE 5KVDE 1HH9A 3NIFE 3AGWA 3T0AA 1SUJA 4WWOA 2OR9L 4YXLL 5TE7L 4DQAA 1DN2A 2DQTH 3ZDYE 1KXTB 3T4AB 1M6OB 3SKNA 1IBGL 1NBQA 3EH3B 3KCPB 2OP4L 2R2HA 4OVVA 1NWOA 1AKPA 1SJXA 2FB4H 3QO1B 5KJRH 2PWFA 3O6KL 5F0PB 3REVA 5KG9B 5IEHB 4RRPA 1T21A 3BAJA 4LLYA 3PLYA 2AKRA 1ITBB 2HFGL 2N4IA 5F71A 3A6BH 2XG4B 3HNVH 3KYOB 2NX5E 5I6PA 1NDGB 3X1EA 3SKOB 4DKEL 2JKLA 4XH2A 3RIAK 4KKNA 4R4BA 3RY6A 3MODH 3WHXB 3WO4C 3IDGA 2Z8WC 2JLLA 3I50L 4NS0A 4YDKL 3VI3A 4JFDD 4KJYA 1N8ZA 4JQIA 4FX5A 3VFVB 1Z9SA 1Y18B 1RHHB 5C0FB 3GB7B 3T0ED 5I8CA 4F9LA 1R24A 2AVFA 4I9XA 5KUKA 4LP5A 3VD2A 5JHDA 3VXRA 4DP7X 2BY1A 2Y07L 3GC3A 2FBRA 3OKKA 5IZ7A 5FM5M 1F4YL 2DPKA 4ALAH 2OMUA 4LNRB 4M7KL 3FH8A 1WVZA 4BE6A 1MEXL 3C60D 4B9PA 4KKZA 3VFMA 1LQBC 1NEPA 1JNLL 4ODXA 2BCKA 4U0RC 3QUHA 3AAZB 4JREC 2DQCL 3CJJA 3P69A 1HNYA 1UT2A 3QFJE 4WAFA 2CM5A 3QRLA 2WYZA 2WQ8A 3FAWA 5HHQA 4D0CA 2VDOB 5D5MB 2WBWB 3L17A 3NZSA 4ZFGL 2XUWA 4FXKB 1GSMA 4J3SA 5FHAL 5JHMA 1T20B 2OJ1A 2BDNL 4QKXB 1A7QH 3IJHA 3II2A 1GOFA 2IALB 2VLKB 4HEMA 4LAQL 4PVLA 4F58L 1OGAB 1KN4H 4JDVA 1TDQA 3QEHB 1DQLL 2X4QB 2Y3AA 4NEHB 4LFHD 1YMME 2CDFA 2KL6A 2B15A 4P23C 4ZX3A 2D7QA 4K94L 5HVHB 1KEGL 4JQIL 3DTXB 4P2QA 3US0A 4HIQA 4UZGA 3W9EA 2HT3C 3F6LA 5ID1B 1MJ7L 3MRBB 4ZQTA 4P2RB 3L1FA 1QI5A 4PLJD 1AQ8A 2PVIA 1IAKA 3IS0X 3KPMA 5DD0H 4X6DF 4L4TD 3RDTD 1CDYA 4S1DD 4K5LA 1A6VH 2W60A 3FUMA 3M1BB 2HSIA 1LP9A 2ZUTA 2QSTA 5IQOA 5I19L 1OT4A 3RAJL 5CJ8A 5D93C 3JTTB 5EU4B 4M1DL 1CJYA 3QJZA 3DV6A 2ARJQ 1Z0NA 2C1PA 2K8QA 4NI6A 1ZPLA 2E47A 3GO1H 1UCBH 2X6MA 2XX0A 2YC1B 1G87A 3MNVB 2DBJA 5IJKC 1FAKT 3D3VB 3W11D 3ESNA 4IKIA 5DUML 3VWKA 4AQEB 5FCUL 4M7JH 4AENB 2C3WA 3UTSA 3QS2A 3PRZA 5HYSA 5HJBA 3FK3A 5D7LE 5ANMB 2YPLB 1DDHA 2IMMA 4KMLB 4MJ6A 5FHBL 4HZLA 4FLHA 5J5EA 5J89A 3FHAA 1FE8L 1THAA 5CLTA 3QDGE 3U4EB 1LM8V 1MFEH 1SXBA 4FMFA 1R5WA 1KV7A 3NIGE 5GGRB 3ZL1A 1I8MA 4IBWA 3QNXA 4EXKA 4DGWC 1VFAA 1RMFL 4AIOA 5EUOE 4JHVA 2X2UA 2VDMH 4JFFB 1FPTH 2VXUL 3S4SA 1G9NH 2Q8AH 4EKXA 2OW7A 3BEWA 3BUPA 3SDDD 3KLQA 4NSKB 2Z7WA 3BUYB 4NN7B 4PW9A 4MRCA 4IU2B 4Q52A 1YCSA 2XI9A 3AG2B 3BFOA 4G8GD 3TA3B 1FDLL 2L4OA 2XY2A 3CPUA 4WNSA 3S0PA 3PP4L 2YEVB 3JWNE 3NCYP 4X6CE 1FVDA 1H5BC 2B0SL 4PN6A 4I88A 3VXMA 5JXAH 2ENSA 5A16B 3TN0C 3ZTDC 3IJEB 3SY0A 4X6FB 1HDMA 1FL3A 3RWDB 3P4MA 4IDJL 3UGXA 2V3DA 1XR8B 3H42L 2VZTA 4K8RH 1OL0A 4WU5B 4OZ4A 3O6FA 4XNUH 1N0LA 4M62H 5EF1A 4PJ7A 2WXNA 4LPVA 3DMMA 3CBKB 4FFZA 3RGVC 4CNIA 2ADGA 2NQDA 3EHBC 3EOTL 5E2JA 3FO2A 1MAML 1RIHL 4Y16A 2NY4D 2J1ZA 2XICA 4YE4L 4N5UA 4OZIA 2Z9TA 4XOBA 2YMTA 5CU9A 3HLAB 2WUBH 4XNMA 3JUZA 3RVWC 1SXZA 2CCWA 3LN5A 2FJSA 3ZHFA 3MA9H 3BCFA 2IADB 2APBA 1F4AA 2WQUA 4OH2A 5BZDB 5I1GH 3VX0A 1I75A 5E5MA 4XWGL 3U46A 1AQKL 1QQDB 1SDAB 2WSPA 3EXLA 3LV3B 5CGTA 1JBJA 1S5HB 2AJVL 3EFOB 3ZKMC 2IANE 4U7SA 1MXDA 3HE6A 3MLWL 1T66D 4LKXA 4OV5A 2MMXA 2YQ3A 4KROD 4HIJB 2TSAA 5IKCA 1F6AA 5C0ND 4O9HL 3DX4A 3FULA 2Q8BH 3CMOL 3KE0A 4PTTA 1FQ9C 2MRYA 3VQMA 1IBDA 5C0CD 1BAWA 2L7EA 3U6XS 2BVTA 1IBHA 4FQXA 2H2PC 4ESKA 2ARJA 2AXFA 4W9JC 4ABQA 1RPKA 3CFEB 4FFZL 2XPYA 3P2DA 4JJ5B 2KPNA 3KPRD 5ERWA 3ES6A 4ZS6C 3UMTA 3DX9A 1UB5B 3KPLB 5IW6A 1JL8A 3OKNB 4JN2B 3DXAE 3WGUB 4BDVA 1WCQA 1JF1B 4PJDF 1NL0L 2QGDA 1LWJA 4PP1C 4XC3L 1KTKE 3DI2B 1IGFH 1YY8B 2JKNA 3ZR5A 3F7PC 3D4GA 2XXMB 1V3KA 2KPWA 4QCIB 5AKVA 3SKMB 3QG6B 3S5ZA 4EUPG 2SODB 2X70A 2YXVA 4G6AD 4MVBD 3TVMA 3OV6A 1DVFB 3MOAH 5FUOH 1NCDL 2QV4A 4Y4KC 3DPBB 1L0YA 3BKJL 3QXDA 3DOHA 4N2BA 1O7SA 4M29A 1E42A 7PAZA 4MXVF 1MI5E 4PR5B 1Z9LA 1YPZF 4RFOL 4J4PD 4P04A 1U41A 4W9GC 2YUZA 3BD5A 3FUHA 3S34L 1ET5A 2V5TA 5BMFH 5H8DA 2P44B 5IESH 4OGYH 4XBPA 4LOUC 2P8MB 3MLXL 4FP8H 4JJHA 5BVJA 2RCSL 3I3BA 4AYGA 1A3RH 1HESA 2X3AA 5JMOC 3WAJA 4KXZI 3D1MC 3K1KC 1WYJA 1GGUA 5FO2A 3UZQA 2A83B 3LMJL 2RB8A 3OMNB 3FB8A 3RWGB 4HS8H 5C09D 2CLZB 2IH3A 3QQDA 3QPKA 4TSBL 5C3IA 3KLHD 2MHAA 2Y23A 4YPJA 1N7ML 3BH8A 3LIUA 4ZXBA 1OAYL 2NY2D 4TULL 3RILA 2J8UE 4Y19E 4DOHE 3UDWC 3VSTA 4ES8A 3LB6D 2ZKHL 1CIDA 5EFIB 5FF6A 4R4FH 3ATAA 5CKAA 5GS0H 5D1QC 1LMKA 3WEOA 2YIHA 2QQKH 1OSZA 3RHWF 2NSQA 3EG9A 3A5VA 3ATDA 3LRGA 4IOSD 1KTLB 4X6EA 2JH2A 4YAQB 3L3KB 1MIEL 4P57B 4BK5C 3OLIA 3DX3A 3V6OA 1NINA 3U1SL 5FB8B 5I15H 5C0DA 1PD1A 5C0GA 3VE0B 1NBVH 3BISA 1JZIA 3SSGA 3X3GH 3ZRCC 2KBGA 2J55A 1J1XL 1W72B 2LT9A 4LARL 4QRRB 2QT6A 4HMDA 4XI5D 4YHOL 3ARGB 4K8RD 2A77L 3O4LD 3SEPA 3UADA 3B56A 5EUKB 4NPYB 3BIBX 2WWKO 1ZVHA 4M93C 2MOVA 2WM0A 1A4BA 3TH4T 5FECA 2EDTA 1E2ZA 3BJ91 3QRBA 4Z7UE 1SFHA 3ROOA 5EBLA 2K7PA 5KBKA 1BOYA 3VJ6B 3OKLB 5F70A 1XCWA 4ADGA 5A43C 4Y5XB 3KZ8A 5E2UH 4ZX5A 2Y6SC 1UVQB 3GHPA 3ESVF 3RIKA 3UTOA 1KYOK 5FO9B 3GHEL 4WHCA 3DA0A 1DVTA 1ONQA 2IFGA 2OLDA 3OPZL 2VR9A 2BSSA 2UY6B 1NC4D 5F7BA 3DJRA 2X9ZA 1E6JH 3R06A 4MCNA 2E7MA 5I1KH 1XSIA 2Z4QB 5I18H 3F85A 5C09E 4QJ3B 1IGJB 1KXQE 5HY9B 4FULA 2CR3A 5ICZA 1A02N 1GS8A 3L7FA 4LU5L 1RZGB 3QQXA 3G6JF 2FNBA 3IXTB 5KSAD 2BZCA 4BWUA 5H94A 5FR3A 3FU5A 4ZQKA 4HT1L 4D0BB 1A22B 5SWZA 3EJQA 2BX5A 4G7VL 1IC7H 2H47C 1CD1A 1NMBL 1ANUA 5BCAA 1BYNA 1AGDA 5KW9L 1LO5A 1BZ8A 3L4CA 5LAXA 3CLWA 3BKCH 3RURA 5FYLL 3SPJA 2BO0A 1F4XH 1MRDL 2D3LA 3AQDA 4X7DC 5ACZA 1RUKL 4L0PB 3QWOA 3DRQA 3QZLA 1BQRA 3ELAT 4B7IA 2AXGB 1XGTB 5FKPB 2HFEA 2NDFA 1N18A 1MFVA 2Y72A 3O11B 3SE6A 1B4RA 3MJ8B 2FR4A 5D7KD 3RFZB 4QY8B 3HHRB 4HCRH 3BVWA 1MNUL 5SWSE 1P6FA 3RIFK 1QAWA 2F53A 2DQJL 4PJ9A 3O4LE 2L7JA 4WI4A 4DHLA 2G3MA 1RUMH 1S9WA 4G71B 1RP8A 3ARSA 4NUJA 3BVNA 4E9YA 4N6RB 2X1WL 1MCDA 3JYBA 3Q2WA 1A3QA 4Y1AA 1A6WH 3LQAH 1MW2A 1WS8A 1PYWB 4L23A 2VXSL 4YHYB 5J9PB 4M02A 4NJ9H 2VISA 1OF2A 1JE6A 1ZSDA 3CSFA 2B7DT 3EH1A 4KKPA 4PJDA 4M8QB 1U8LB 1KJMA 5IEKA 4IRSA 1REIA 2H2SC 1J5CA 3WD5L 4XP6H 2N01B 4MXWH 1G7MA 3M86A 2QMJA 4C54A 1TR7A 3DBXB 3UZEC 3CVHH 4Y4HB 5EEUA 1J8HE 5JZ7C 4MMXB 1UM4H 5CIPB 2VDLH 5KN5A 3RY6C 1D5BA 1K0ZA 4XZUA 1H8NA 5HGAA 2Z93A 2Y22A 5I16B 4BFRA 1YPZA 3GBML 1IKNA 4KAQL 4K94C 4YFLI 4C4BA 4PYGA 3CVIL 3IJYA 3QAZC 1Z5YD 2ID5A 2V7NA 3MA7A 3PDGA 4FRWA 4XMLL 4I9WD 2YLHA 3TEUA 1FFTB 5B39B 1D5ZA 4F9LC 5DQDL 5CSBA 3MXWL 4ISVA 3NCCB 2OYPA 4YX2L 2RAMA 1ZGLM 5T8IA 1U21A 1OV8A 1KB3A 1F41A 4FTVE 3SDAC 4OJAA 5IR1B 5I0ZA 1ASOA 1MFNA 5LO7A 4HDIB 4MMYB 1JTPA 3A47A 3CC5B 4AUJA 2VITB 2IO5A 3FH5A 3NCMA 1P4LA 4J3TA 3I3EA 3WMQA 1JZ8A 1ML0A 1FNEB 1SJEA 3AM8A 4U3CA 3MQIA 2BJML 4M61A 3SB3A 2WMPA 5IFJA 3MUY1 4MJIB 1TKWA 3F5WB 4KJQD 3NSCA 3X3FL 3MOBH 5C6PB 4PBXA 5DHEA 1CTOA 3DPDA 3UABA 4LSSH 2HN7B 4NIYE 4NB7A 4L1BA 1NGPH 3M7FB 1WZKA 3QUYD 1ZWIB 3OKDA 4I3GA 3GXFA 4PCYA 1AGBB 1DQQB 1YUHA 2EDQA 4ODTL 2LR4A 5EOTB 1WA1X 3QUXC 4MYWB 5D7IE 1RJYB 3E6FB 2C9QA 2EYTA 3N85H 1U92A 2MNJB 4WO4B 3PP3K 5JXEA 4OKVA 4XOCA 2QGBA 1S9VA 4UDUA 1YYLL 3GTTA 4NT6A 1EA9C 9CGTA 1YEJH 4H8WL 4PB9H 2F2HA 4WSGA 1N6QH 5I74C 4POUB 1LDPH 1TJXA 1QRNA 1KCRH 2X28A 1U8PB 3PHOA 4X2UA 3SE3A 1QR4A 1PG7L 3QP3A 5ISZB 3VRLF 1MFBH 4LLUB 3VG0L 1MY5A 4LLWB 4UIKL 3DOSB 2FECL 4PJ8C 3OG6B 5E7FA 5AAWA 3CFCL 5L8LB 3QJFA 5D4JA 3FFCE 3FOMB 2IDSA 3QWRA 1BYOA 5LWYL 5CCKH 4PWHA 5C0EB 2R1WA 1JGVL 2WUCH 1JZ6A 5AW4B 3GQFA 4Q74A 4J39A 1C12A 2A6DB 3VXTB 3P02A 3DV4A 3EAKA 3B3BA 3U4KA 5IHZA 1ZGLP 4Q0XL 1RUAL 4FKKA 1NICA 3I84A 1MAKA 2ZKXA 5DHYB 4UQ3B 2ZOTA 3GSOB 4JM4L 5IM7A 4HQQH 2WINB 1NEZB 1R0AL 4DVBB 3TZVD 3VRJB 4WV1C 2UWEE 1L9PA 1ZJBA 3GM8A 1JVLA 3QULB 2Z7UA 5TD4A 1NGZA 1NIDA 2JCCB 2X42A 3G6JA 4NYLA 4OZGB 4AYFA 4JRYD 3QCUL 3VB9A 2H6PB 3HJ0A 4ACTA 2CA4A 5EIVA 4M9PA 1S7SA 1I7TA 4X6BA 3VAEA 3D05A 1T7WA 2ATAA 1BEYH 2K1MA 3L3DA 1FL6B 3PWPD 5FYKL 1USZA 2EXYD 1AJ7H 5MERA 5FYJU 5AZUA 5KANI 2V17L 4P8QA 2BWDA 2VZ3A 5DDHA 5IB2B 1A66A 4NQDD 5C0AD 4AW4A 2Y7QB 4ATWA 3C2SA 3PAVA 4FNQA 3VQ2C 5HYIA 3MMEB 4F27A 4QXTB 8FABB 3ULSB 1U95B 1JPEA 1PZDA 4H8UA 2D7MA 4LOVA 2BVOA 5JYMA 2FO4B 2F7IA 2HFFA 4P5SA 3LPOA 3IFPB 4NO3B 5GHWH 1B3IA 4A66A 4QUOA 4BH7B 5CAYB 3HS9A 3RYMA 4Z1PA 1W0VB 4JFEB 2H41A 4HJJH 3H7LA 5J56B 1KYUA 4KZCA 4WWKC 2WCGA 4DVRH 1JXGA 5GS3A 1MCJA 3V7MA 5DMKB 1AIFB 3WYRA 5IVOA 2YO3A 1S8DA 3BWAA 5F1IB 4PTUA 4RAVB 4B0MB 5JLZA 1NCWL 3UYRH 4UCFA 1ZD6A 3K6SB 5KBMA 2CJUL 2WVVA 3A4EA 2JKIS 3HI6L 1C16B 4TLSA 2D3NA 3GS0A 2R23A 2Z0UA 1U33A 2QPDB 5I76B 4JPVL 4X0KB 3K4ZA 2ICWI 5B1KA 4OZFB 2WXPA 3VFWB 4BM7A 1WUZA 5SV3A 4EN3D 2AQQA 2COQA 3HE6C 4D9QD 1QSEB 1QW8A 1OO2A 3QDHA 2VDPB 4WI2A 3S35H 3WO3B 5FOBB 4H20L 4TUJB 1MVYA 2NYZA 4CU6A 1GZPA 1CGTA 4X8XA 4URTB 3APMA 1DQVA 1XWVA 4BKTC 2VDOH 2ODHA 2JELH 3L4XA 1WZAA 2P28B 1FBIL 4ZFOA 3ETTA 2YZ1A 2LGNA 1GGCL 4HIEB 4F57L 2QSCH 4S2SB 2Q76A 4NM4L 2DH3A 4XWOD 5I1CL 2BOCA 3QIBD 4OD2B 3TBVB 1EEYB 2GFBB 3SYAA 3CHXA 3X1FA 3D9AL 2D2CC 4F8LA 2N1TE 3ARFC 4BQ9A 1GVIA 2B3RA 3S36X 4FN0A 4KO6A 3IWUA 4PS3A 4DP9X 2G9HA 2OAAA 1BFVL 4G8EB 3BFQG 1CL7H 2GJZA 3SDXB 1XBRA 4M7LH 2A74A 2R0LH 4CU8A 1AHKA 4Q6KA 5K69A 4B9KC 1M6UA 3T6XA 1FC1A 1DBJH 1MVFA 1X5XA 5TH2A 3WIIH 4XCYA 4RFNB 5AWNH 3IYLW 2V9TA 4OFIA 4NUGL 1NDMA 5IWLC 3IB4A 4CGTA 5IF0A 2ADFH 5ABZA 2HVKA 1CGYA 1ZTXH 1G7IB 5HYJB 4JM2D 4Z78A 2FT7A 5ICYA 4WCYH 2E9WA 4OCMC 5FA3A 4IBVA 1HHJB 2YGNA 2OMVB 1NCUA 2CKNA 2BFVH 3QCVL 5ENWA 2OK0L 1I3GH 1L9QA 4LAJH 1BX2B 3NZ8A 4WK0B 1Y6KR 2JK5B 5I1AB 5FFOA 4A7QA 4ZFOL 3DGCR 2ZOLA 4CVZB 1V8HA 3NIFF 4DERA 1X4ZA 1XGQB 4NXKA 2VXTH 5D2NA 4MA8H 5DC2A 5AW6B 3FO1B 1KB9K 1HQ4A 3ZDYF 4AYMC 4FLRA 1YUKB 4D9QE 3ZDWA 5K1JA 4JZJA 1E4WL 3W57A 3BN9D 3ZRSA 1PSKH 3GDBA 5I71C 5C07E 2Z1PA 3TFBA 1UXWA 4NOFA 3OXRA 5CSGA 4A39A 3QYMA 1GIGL 1YDPA 2ATPB 4RISH 2IPUG 1R3HB 3TT1H 1YECH 1AHWB 1YMHB 1DUYA 1W6LA 4JPIA 1AXSA 4QR7A 3WY1A 4OUUB 4GW4A 4DGYL 1JPSL 3U36A 4XP4L 2WIIA 1E67A 4M5YL 5E5RB 2Q3AA 3G5WA 3HBQA 1L6PA 2XIIA 3RPKA 5HHXH 4QO1A 4KTEL 2NSMA 2YEQA 5DD1H 4N26A 2FT8A 2YS4A 4FQQB 4KUZH 1F1DA 1MCWM 3PREA 3PDDA 2V2WA 3ARYA 4ZMTA 2EE3A 3C8HA 3MV7A 2I07B 1LO2H 3QA3A 1WFMA 3HFML 2ZCKL 5CEYB 1D3CA 3HS0A 3VSUA 2XYCA 3QDJE 3SBPA 5E8PB 4P9MH 3WI9A 1AE6H 4AK2A 1UQSB 3QNZA 3UAJD 1K2DA 3O0RL 3VA2C 2F8IA 4ZUTB 4M4RB 3WNIA 4G11A 3FT3B 5D7JA 35C8H 3HAEG 3GI8H 4L8SA 5TF1L 3IDXL 2X9XA 4UTAA 4Y4FB 3QC6X 4YQXH 2VIRA 4Z7VB 4F7TB 4WI7A 1ZT4B 5T3ZH 1ZLVH 2AK4E 3SE9L 4BGLA 3S88L 2B1AH 2E6JA 1MCRA 2VLRB 4GEIA 1M4KA 3P3YA 1XGRA 3ZHKA 4B6ZA 3C6LA 1XR9A 4LLMA 4UNIA 2IFFL 3D18A 1B4TA 1U91A 3NN8A 4XAWL 3WGVB 1UGNA 2GCYA 5E8NB 3GRGA 2FZ3B 5D2LB 2PYFB 3ALPA 4HWEH 1HU8A 1BG9A 3ZE1B 4HZ1A 4UMSA 3O41A 5H37G 4DPRA 1JDCA 3SGEH 1W0WA 2XLLA 3QXWA 4JFYA 5DI8A 1KC5L 5F1NB 2R29A 3IVKA 2OJZH 3LXBA 3DIFB 3IDMB 1QFWH 1Z32X 1Z3GL 4OLUH 4XP9L 3C8DA 5MEQB 1QFWM 2NTFA 4JY5H 5CFHA 5DJDA 1M7IB 3RVVC 1GOGA 4Y2DA 5EG6C 4N25A 2ZUXA 3ARDD 1OGAD 3RX9A 3HUJE 4E9TA 4FAAB 4QGTA 1JNNL 4UTAL 3Q7JA 1YN7B 3FCBA 5F0LB 3TO4A 1SRDA 1A3ZA 3CPLA 2K6YA 3L4YA 3ISYA 1DANT 2ZX7A 1MHPH 2K8MA 4OLVH 1OSPH 3PY9A 1JV2B 2ZWLT 3HNSH 5G4OA 5AW5B 3SQOL 4P2RD 1CDCA 1P9MA 1DN0B 2RGSA 4EN2A 3PNRB 1AZRA 2ITDB 1MHCA 3HZYB 4LCWA 4KK9D 2MEJB 1TTCA 4N20A 3LYRA 4MB5A 2K70A 1YY9C 4PRHB 2F8VA 3DUSB 2J25A 4XMPH 2F74B 1NGYB 4U0RB 3STLA 3B6SA 3NIGF 3OKOA 5L2KB 1OTUC 4KKBD 3TURA 5E00A 3IXAA 3CN1A 3IPFA 3FB6B 3QORD 4GAFB 3CCHB 2NYKA 5EUOF 2V37A 3WSQL 1I53A 3EGSA 4N8PA 4IRSC 2R29L 3CFBB 3GSUB 1NCGA 3D3VD 1QASA 1T1YB 3VDCA 1YNTF 1NAMA 3O6LH 5E9AA 1HWGB 2G9KA 3VFNB 2NR6A 3EH5B 1YEDA 1I9JL 3BDBA 4K23H 2Q6WB 3BUBA 1CFMA 1QUNB 3MR9A 1HCYA 1HKLH 1MQKH 2GYSA 4OD3L 4UT9H 3X13B 4E41B 3KGRA 1PGRB 4LHJB 4DGIL 5INDB 4P23B 3VSVA 5L88H 3HG1B 4DP8X 2NZ9D 1PZAA 1IKNC 3V55A 2VABA 4GI6A 1KFAL 3OC5A 4Z8FL 2XFGB 4WWPA 3MDJA 4DCQA 5EB9A 1HL8A 3WEXB 5EU7C 4X5XB 1NBYB 1CICA 3GZPA 1EJ8A 4RA0C 2UZYB 4APQA 5I1AA 1FCGA 5IBLC 1OM3L 1IO4C 4M1GL 4WFED 4QHLB 3BW9B 2BWQA 2ICWB 4CW1A 2GJ6A 5DSCA 5LG6A 4KHXH 3HZ3A 3M88A 1HXMB 1SY6A 1DTUA 3FTXA 1EUTA 2VTFA 4G43A 4JFFD 5D93B 1C8PA 3BWSA 1X5ZA 1Q9WA 4NQCA 5SX4I 4XN4A 4R26H 2VR8A 4F9PC 5C97A 3AM8C 3FQRB 5GJSH 1AR1C 3I6KA 3TA3D 4MCZA 3QEQA 1MDAA 1Q0XH 1MCPH 2NX5A 1NAML 1N19A 2V2TA 1SM3H 4PV9B 5GISH 4QTIH 1W72H 1ORSB 4ADIA 4AGNA 1YQVL 5HHOB 4KUCF 4PG9B 5GXBB 5SWQB 1RUPL 2D73A 1KZQA 4YC2C 1QA9A 1JFQL 1BFOB 5DK2A 3WY2A 1KN2L 4N1HB 2XA8H 4UQCA 3C75A 3NZHH 3PWUB 3SCMC 3HOGA 4IBLT 3L95B 3BPCA 1CQYA 1OP5H 5JXEC 4GUPA 4UB0H 2X6VA 3MLRL 5KVDL 3FB5A 1W6WA 5T3ZD 1WC7B 5E9DB 4PG2C 4JY4B 1A7RH 1WWCA 1FO0A 2YUVA 1B6DA 4L9DA 1SY6L 4BSVB 4KNUA 3C09B 5EOQH 3QFJA 2LQRA 2XWTA 4E5XG 1B0RA 1FIGH 4HIHA 3MACH 5F7NC 3G5XB 3WUWA 3FB7B 2XQYA 4PFEA 2EYSA 5TK2A 3TTSA 5AAWC 4YPGB 4XP1L 2A9MH 5L6YL 1YYMH 2YJQA 3L3GB 4MA7H 1RZJL 2EKSB 3NA9L 4NQED 2GK2A 4XMUA 4WFEE 4YDNA 3RX5A 3MHZA 3OLEA 5EU5A 3B43A 2GW5A 3IE4A 3DVGA 4EZLA 5DYOB 5FWQA 4ZO9A 1YMMA 2EXWC 2ZXWB 3FU7A 3FTGB 1DBBL 1A3LL 1XIWB 4G1EA 3II3A 3QSKB 2F19H 5EZOL 5DUBB 3NFPA 3HMXA 4XN2A 5DS8B 3T3PE 3RGVB 1OB1B 1JWSB 3EHBB 3ILDA 4QXUH 2HMID 3ILQD 2P5PA 2I9LB 2IH1A 2ORBL 3LKSB 2DYPA 2X1PA 2W9DL 3ZXAC 1BQHG 1NFDE 3H9SD 5ILTL 5B7FA 1I3UA 1PX8A 4W81A 2OMXA 4WY7H 4EOWL 1C9SA 2AEWA 1IQDB 3AREA 1FO0L 2EDWA 1JZ3A 4PJIA 4NKDA 4O02B 4OF6A 4XMZA 1URLA 3MGTB 4QOKD 4ZUUA 5FLVA 1A2YA 2CUMA 4G9DB 4A6YB 2F54E 4NX0A 1R3KB 4PUBL 1OOWA 5DJZB 2OMWA 4PRPE 1Z3RA 2V8MA 1FSKB 4TTGA 4M56A 5BUAA 1PQZA 1W8OA 4Y9FA 5EO0A 4AEHH 4Y2LA 2PWDA 5JQHC 3U0PA 3WL9A 2J8UF 1WFNA 1FIEA 3CSBA 1MWOA 1INDH 3V7AE 2PWEA 3QCTL 1AZCA 4HGKC 3GXPA 3GMNB 5D7LA 1RK0B 2NNAA 5CHNA 4ZTPL 4PS8A 2R69H 1KEML 3SYPA 3N1FC 1I82A 3VA6A 1BIHA 1FNFA 4HUWB 3II1A 3MRQB 3UEQA 3HMXL 3QDGA 4EI5C 1V7MH 4L8DA 2ZONA 5EZJA 5C7XH 4N1EA 4OCWH 1OE1A 1URZA 5I73C 3V4PB 1BD2E 4WUUD 2WXMA 3MRLA 4GFXA 4NQEE 2QVMA 3QZWG 3MRCB 4G6ML 5GZND 1XV8A 4HK3J 4OCRH 5G5DA 5BOJA 3BZEB 1C1EL 3MREA 1P53A 3GKWH 2YD7A 3V0VA 2ARWA 1R3LB 2B2XL 1YNTA 2W0LA 2DM3A 4ZMAT 5ACMA 3OAYK 4FHJA 1OGTA 1LILA 4WKXA 5DD5L 4PJFE 3QIUA 2OZ4A 5TGBB 4HKXB 4I0PC 4Z7UF 2ZXEB 1KPVA 3EJRA 4TNVK 3RDTA 3O4OC 4X6CA 2ICWJ 3L3HB 1UZ6E 5TE6L 4BEIA 5TK4A 1DQML 3WJJC 4MJ5A 1HYRC 1KELL 2P1YA 4YDIL 1YEKL 3EYQD 4JFHE 4QWWC 5DHVB 2EDNA 3C5SB 2GJJA 3PIQB 3U4BL 3UIZA 2M8XA 5FOJA 1Q9LA 5HYQA 1WFUA 3PPSA 4G6JH 2ENYA 4B27A 2AMGA 15C8H 1NMCC 3GT6A 3WS3A 4QRRD 3W9DB 2VDRL 3TA4D 3NSFA 4Z0BL 3F58L 3QBTB 3ARGD 3JV0A 1KJ2B 3WY4A 2F58L 4EQ3A 1VGKA 4TYUA 3AG3B 5E4EC 1ZJAA 1IGCL 4AOFA 1X7SA 5MEOA 2E6PA 2F7PA 2PKDA 4GP8B 4LRNH 4AT6A 3BZ5A 4IRJC 3VMNA 3RX8A 5HVWA 4S10A 4U6YB 4JDZA 3HI5H 1CFNA 1OF0A 1TYEB 4JZNB 4MQXC 3BAYA 1OP3K 3D50A 5IOPB 4O2FA 1IL1A 3D0LA 2IANA 5IROD 5GRJL 4OY9A 4F1SA 1PLGH 3BGFC 1BZOA 3HN5A 5JIDA 4GBXC 1J9TA 1S3KL 3MX0A 3U7WL 1DBAL 1JRHL 1PU0A 1XEUA 3T8XB 3JWOC 4Y5YC 1MHHA 2VR5A 1SLXA 2DWXA 3FYEB 3CN4A 3G5ZB 3GBEA 3GJFA 5IP4A 2XBDA 3T0VA 4S0SD 4P5KB 1HVXA 1GHFL 4J23A 3ZE0B 2NSXA 1BZ7B 1EV2E 5I8OH 3VWKC 1A4KA 2VZUA 1A6PA 1RURH 2YAHA 2IBGA 2MPAH 5DEGB 4G8GA 3E3QC 4HIIA 1TQVA 2W92A 3TEXA 2CO4A 1RSFA 5DVOA 5LXVA 3DXAA 1BAFH 2XRAH 2BERA 2NLJB 4MHHI 2WQVA 2R1XB 3JTBA 4YVNA 5F3BB 3HHSB 1CMOA 3FF8A 1ZEAH 3V0GA 2EO9A 3KWVA 4MSWB 4YDVB 1UOKA 4OZHB 4HVBA 1JV5A 4MXQD 2DWSA 1MCWW 1JPFA 5C08E 1ZLDA 4ZX4A 4H0IA 5DK0B 1N2RA 3A23A 3H4FA 3FTVA 1I1AD 3FH7A 4K2UL 3V6FB 3WELA 1WA2X 4ZD3H 1T5KA 3X1NA 3ZKQD 1XGZA 4NLAA 3UTTB 5CCJA 2AZAA 1E8WA 2WD0A 2ZF9A 3QHTC 3T4YB 1MI5A 1RIUL 1FGVL 1PKQE 3FN0H 4CN4A 3NCBB 3D8MA 4GW5B 4TS6A 1UB6A 1OD7A 3FTSA 2ZP0T 3VFTB 2VQ1A 2DQGL 3FTWA 3NTCH 2A5UA 2G2RA 1IAOB 1WE5A 3ZUCA 4OCSL 4LF3B 2AV1A 5L9DH 3FT9A 4LLQA 1AGFB 5FK9A 2X5PA 1LO0H 3I3DA 4U1MB 5KJRL 4U1NA 5JHAA 2XETA 2V7HA 3I02B 4Y4HD 4OIIH 1S7WA 5D7JC 2ZE0A 4PWJA 1SLWA 2AV7A 4NZTH 1FA4A 3A6BL 3SPCA 4LB8A 3ECUA 4KPHH 3HNVL 1GJWA 3FO9B 4QT5B 2J8UA 1A47A 4Y19A 5BUGA 2R2BB 3L54A 3MBEA 4KU1A 3AY4A 3P3SA 3VTTA 1CXHA 5IT2L 3RWCA 4AM0Q 4B0MM 4Z3HA 1JOIA 4E9XA 3LRSA 1EXHA 5IQ7H 3Q13A 4UINL 4FNLL 4V1DB 2H1LM 3C6LC 3EDEA 2XTJB 5EN2A 1JMZA 1HH9B 1MW1A 1NUDA 2EYRA 1BQKA 5D7IF 1KIRA 2BC4A 3OHMB 5JPNA 2ENPA 2VYRE 4OZFH 2XWJA 3VWJA 3SKNB 3ZSTA 4ALAL 4PEEA 2R2HB 1ZLSH 4UTCA 1SVBA 3QPXH 2IDTA 5EBWA 2QQLL 1JF5A 3REVB 4MJID 2OTUA 3NH7H 3OL2A 4LLYB 5HPOA 2AKRB 2QR0A 1P4IH 2Q2LA 5F88B 3X14A 2JVUA 3AADB 4K7FA 4Z7UA 2O5XH 5CJQH 4IKJA 4YHNA 3H2QA 4Y2DC 4HBCH 2OZNA 3FOLA 4A2HA 1F6LL 4HP5A 4UOW0 3QG7H 5BV7L 4XH2B 2WLYA 4R4BB 1F4HA 3IEAA 1UOWA 1QRKA 1THCA 3VI3B 2ZIDA 4KJYB 4GG6F 5J11C 1N8ZB 5KBDA 3U0TA 3QAZB 1U3HC 1Z9SB 5AG8A 4WO4D 1VERA 5I8CB 5BQDA 1R24B 4YXKL 1B88A 5JHDB 1BVKA 1G9MH 3VXRB 5J1TC 1TSRA 5EZPA 5E95B 4WK4B 4ZMWA 3CZGA 4P46D 3A6OA 5C09A 5TFSH 3B8SA 4WENB 4B9FA 2JKSA 2UWEF 1KXQA 2OMUB 2YD5A 3SDAB 1LDSA 1CYXA 1D7DA 5D4HA 3VFMB 1CDBA 1A6VL 4ODXB 2BCKB 5FO8A 2BS8A 1AOHA 1DDTA 4BFIA 3QJSB 5GSVA 1CK0H 3BSZH 3UL4A 1F5WA 2XJLA 1Q1JL 5JHBA 1QSFE 1OWRM 5HHQB 1NFKA 4D0CB 3CXDH 4GAGL 3OZKA 1OB0A 3BUTA 4OJEH 5AZEH 1PZ3A 5K33A 3GO1L 1JF6A 4EZMA 2EIBA 3F05A 1KMGA 2KLSA 1H8SA 4UTBH 3P11H 1UHVA 3CFQA 2HAZA 4JDVB 3VTAA 3V4VH 1CE1H 3NCWA 1N0XL 4ZYKA 2CDFB 2BS9A 3LVEA 3QJTB 1BZQK 1BBJA 5CJXC 2WC7A 4MAUL 4P2QB 4Q6IA 4RGNC 3W9EB 3QUXB 1CD0A 3O4LA 4BZYA 1H9DA 1CYWA 1UM5H 1LXMA 2AABL 3N1MC 1U30A 3ESPA 1ZHKA 2LU4A 4K71B 1IRAY 4XNQA 3ZTNH 1IAKB 3KPMB 3BO8B 4APQC 1P1ZA 1F90L 3HNTL 4N2DA 3RNQA 3WNLA 5LKNA 2W60B 1ZY9A 1DL7H 2KZWA 3A24A 1O7VA 2EP6A 3FU0A 1LP9B 3K6OA 1I7ZA 2HRPH 3D34A 3GIVA 2HVBA 3KPSE 1AG6A 1JCVA 5BW7A 2C1PB 1ILUA 4QRUA 3LNGA 2YXFA 5I5JA 4AM0A 1G9NL 1IZJA 2OMTA 3MRMA 2Y36H 4RIRA 4HWZA 2DOCA 1DBKL 4RGOL 1M2VA 1IFRA 3OZ9L 5E8DH 5C9JB 5IFHH 3SOBL 5J12C 1U3JA 3GPSA 3S8WA 3UTSB 1A9VA 1AKJA 1VFUA 4ODUA 2VLME 3PV6A 3RA7H 4JFED 3DETD 5HYSB 3CH1A 1T4KA 5KSAA 5JXAL 1JXKA 3O45B 4H26A 4XE5B 3BCDA 3EZJB 5F9WB 4MJ6B 1MHEA 4PV8A 3U9PL 1WA0X 4HZLB 4K8RL 4JFQA 3R18A 1W8NA 2EO7A 4P5TD 3HPJB 3RUGA 4R4NC 1BVLB 1R5WB 4NC1E 1KB9J 3AXIA 3MNDA 4PS4H 4MNQD 1S7QB 1I8MB 3QNXB 2BP5M 1VFAB 3BLKA 5DMJB 2VN6A 4GXUM 3W2DL 4CVXA 5E2VL 1HT6A 3IJSA 1J9CT 2CMRL 1JZHA 3S4SB 1WZ1L 4Z7IA 2A6IA 1BV8A 5I1GL 3BEWB 4DFHA 5IW1A 1LNUB 1SMOA 1PF3A 4XB7A 1S78D 4GIPD 3DX7A 3WFZA 2DIJA 5AVQB 2ETWA 1E6OH 1O0VA 1XL4A 4JN1L 3VXMB 2CO3A 1SQMA 4R96A 5F6HI 3SODB 3SY0B 5B8CA 1T1ZA 2MPVA 1FL3B 3P4MB 1MJ8L 3UAAA 5FGCE 3ASNB 2VR6A 5HDLA 1JFHA 2Q8BL 4OZ4B 2BSRA 3O6FB 5BUPA 3ZL4L 1QFUL 5D7IA 1QO3A 4PJ7B 3U1QA 4OQTH 1AGEA 3DMMB 2BP3A 1J5DA 1Y1DA 1S7VA 1U9KA 2ADGB 3FO2B 4ZDHA 2LE9A 4Y16B 5DK3A 4BHUA 1IEHA 2N0MA 2CR0A 4XNMB 4F15B 4ZT1A 2K6WA 3TWYA 1PJ9A 1TU2A 4EF3A 1OCCB 4UBDC 3LN5B 4YSRA 2DW5A 2FL5A 3FJTA 4HJ1A 2BOLA 2QVIA 5E5MB 3KDPB 2Q7YA 4TNWF 3NIDB 3U46B 1TETH 3EJYD 5E4IA 1KBGL 1VRSA 4LSTH 3VXSE 3FFCA 1OGSA 1HZKA 2NXYB 2X0WA 1FVEA 2QDVA 3IKCA 3HE6B 5HYJD 4LKXB 4OV5B 1KLGB 2WKGA 3UAEA 2AQ2A 3WKQA 4I48A 5I23A 5IKCB 1F6AB 2CZNA 2VDKH 4GS7C 2Z4TA 3BQVA 2FECI 1WT5A 1NUFA 3TBBA</