2OA9A

Restriction endonuclease mvai in the absence of dna
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
246
Chain Sequence
b'MKSMSEYLNLLKEAIQNVVDGGWHETKRTGIGKTFEDLLEKEEDNLDAPDFHDIEIKTHETAAKSLLTLFTKSPTNPRGANTMLRNRYGKKDEYGNNILHQTVSGNRKTNSNSYNYDFKIDIDWESQVVRLEVFDKQDIMIDNSVYWSFDSLQNQLDKKLKYIAVISAESKIENEKKYYKYNSANLFTDLTVQSLCRGIENGDIKVDIRIGAYHSGKKKGKTHDHGTAFRINMEKLLEYGEVKVIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R.MvaI
publication title Restriction endonuclease MvaI is a monomer that recognizes its target sequence asymmetrically.
pubmed doi rcsb
source organism Kocuria varians
molecule tags Hydrolase
total genus 70
structure length 246
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2oa9A02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2oa9A01
2ODIA 2ODHA 2OAAA 3IMBA 2Q10A 2OA9A
chains in the Genus database with same CATH superfamily
5FM4A 4PD4J 2DQGL 1OCCB 2KS0A 5AZ2L 3BAJA 4NQEB 4L23A 5TFSL 4K3GA 1JHTA 5HHMB 3TGXA 3WGVB 3ZYJA 4JR9L 35C8H 3NJNA 4JJHA 4GUCA 4RFOL 2IWEA 3IJEA 3F5WA 1BBDL 1M42A 3GDBA 1NLDL 4RSYA 1IAOB 2I07B 1DVFD 4TL4A 3CZSA 4XBPA 4TM9A 5MEQB 3LNDA 2ATKB 3CVCA 3V6ZA 1RUMH 4P0DA 3UYPA 3SYQA 4XRCB 4NKQB 5TJWK 3X3FL 1MQKH 4FHJA 3TASA 4AEHH 1QTSA 1AXTL 3T8VA 2WLLB 3UZVB 2R56L 4YSCA 2HKHH 2ZCZA 5F1SA 4DESA 3NK3A 3D33A 3LKSB 5IK3B 4YL9A 3NSFA 2AW2A 3GUFA 4DCQB 2PPEA 4GT7A 4V1DA 4OZIB 1CLCA 1WD9A 3WMQA 1YQ2A 4Y4HB 1Z5LB 4ABWA 3E1ZA 3EJRA 4R8WL 3VACA 5DRWA 5FO9B 5D72L 4AITA 2AK4B 5DC9B 1D5IH 1JK8B 1TENA 2PP8A 3KCPA 3PHOA 3RNKA 2HLFC 2Z8WC 4QKXB 4NC2B 4BZ2A 5IJKA 3LS5H 1DJYA 5D5MF 2DQEH 2EUZA 3ZMRA 3O6FA 2WVTA 2BNQD 3AY2A 5D1ZB 5L0QB 3M17B 4LKXA 4RX4A 4U0QB 4WI4A 2CDFB 5I19L 5F7HA 5HHOE 3OMZA 1RZQA 2PYED 2CDEA 2YKLL 4ICWA 5E6SB 2PVIA 4AYDC 5E8NB 1JFQL 3P0YH 4K94L 3N41B 3FUIA 4FFZH 4LL9A 4N20A 4OU3A 4BSWA 5SWQB 4L8SA 3D39E 3TT3L 1GZPB 4WW1B 2BHFA 1YJDC 4DZBB 3QNZB 4AVHA 3JV0A 4NFCA 3ZKXB 1YEGL 2N7SA 4A7GA 1GZQB 3C6SA 5EN2B 4GKZB 5J1TC 2R4SL 5B8CB 1MJJA 2FO4A 4F5CA 1MHPH 1YEJL 4M6OH 4FQJH 5C08E 4HK0B 4YZFE 4MKTA 1UWYA 2K8QA 4KQ3H 4BGLA 3R0MA 3B6SA 1U91A 3TO4C 4FI7A 1OWRM 3QRBA 3KR3H 4CBZA 2XFXA 3HS0A 3BSZA 1PX4A 3Q2NA 1TOXA 4PR5B 4PJ9D 5C0GB 1PNDA 2Y3NA 3MLTA 3FB7B 4G8GE 2AJZB 2XWRA 1GSKA 1YY8B 4PJFB 1E2WA 3CFJA 5CP3H 3P9MA 2OMWB 1W0WB 3HN8A 2JB6A 3WL9A 4Z3FA 2CCVA 1S7WA 3C60D 1XZ0A 4KDVA 5BV7C 5D5ME 4WRLA 1WWAX 2HKFL 3MGOB 3UO1L 3V0AC 3VWKA 2LLLA 5C6TL 5IGXH 2OCFD 2X6BA 1FG2B 2C9XA 4YFLI 2NZ9D 3KS0J 3CFTA 3RG1C 2NDGA 1A66A 3GXNA 3PY9A 3ZUCA 3U2SB 3PNWB 3T0ED 4D0CA 3GS4A 3V6OA 2O6DA 1Y1UA 2ZG1A 2I7OA 4NQXB 4ZMXA 2ERJC 1MI5E 2O6EA 2XKNB 1N59A 3LXAA 3MNZB 4NYLB 5IB5A 4JCMA 2VUKA 3FTZA 4APXB 5GZNC 2ZWLT 3HRZC 3O3AA 3U1PA 4ISVB 5I74B 5A6MA 4HJ1A 2H32B 4XC1L 1K0ZA 5FUZL 3MRFB 1ZHNB 1XTLA 2IVFC 4DN3L 4L0YA 4NQDB 4ZW6A 3NOIA 3QRLA 4X4XA 4AV5A 1BFVL 4X6DF 1ONQA 5L6YH 4G8EB 2APXA 1J8HD 2VL4A 4HS6B 2F0CA 1LYQA 4YSDA 3TBTB 4QNPF 1HJBC 2QZ5A 4LSPH 2ZWKA 2TRYA 4WUUE 2J6WA 4V2BA 2Z1KA 5JORB 1L0QA 3V5KA 1B4LA 2H4EA 2Q7YB 3QDMD 4W9EC 3DV4A 2ICEC 3WXWL 3TM6A 3WEBA 1U4EA 1RK1B 1XCQA 4KX7A 1MWAH 5FM8A 2H2SD 1T80A 3MJ9L 4P4RB 3VO0A 3FTGB 2G3MA 1U8OA 1KJ2A 2J43A 3VMOA 2VDMB 5ISZA 3O8XB 4AQEA 4QRRD 1NWOA 1T4KB 1EXHA 4XXWC 3WXVL 5LAPA 1OP4A 3GKWH 2K4AA 2DIBA 5EZOH 4XMKH 1DE4B 1AZBA 4IRSB 3RU8L 2YOAA 4NGHL 3IDMA 3ULVF 4HUVB 2J6EL 3MV7B 1YEKH 1RZJL 2KHAA 1NBQA 4QRBA 5CKAA 4OZGB 4K23H 2OZNA 2X4SB 4E42A 3LH2L 4GG8B 5DK0B 4BFRA 4ZXBA 3FQXB 3ME0A 1DCEA 1KG0A 2BVYA 5DLMH 1WT5C 3IFPB 5EOCJ 2EH8L 2VXQL 4JN1H 5GZOD 2Y06L 4L18A 5E1GA 4OCLC 2FRGP 4YUEL 4UYPA 1RK7A 4XPHH 5DI8B 1BD2A 3HG1B 5AVUB 3SJVB 4LEOB 4B0MB 2EEAA 2BOCA 2PW1A 3IJ8A 3T2OA 4GI6A 4A6YH 2Z91B 2DLFL 4KJWC 2VISB 4X6DE 4XX5A 4X4ZA 3I3BA 5BCAA 4ZDHA 5EO0B 5GS0C 1CFNB 1C1EH 3MLYH 3NIDF 4KX9A 5E1HB 3SCMB 1U95B 3QUYC 4WV1B 1PSKH 5GS1C 3MLPA 4D9LL 4LOFA 5H2BA 4MHHG 3VMPA 2UZXA 3UDWA 2DIAA 5MEOB 2C34A 2CK2A 2KQMA 3MBEC 3B9EA 2M83A 2N59A 2R59A 5GRJH 4CC4C 4LMQI 1KOAA 3V0EA 3BAEL 3DSNB 2DD8H 4HUWA 2AQRA 4P2YA 2QADB 1DFBL 1WDAA 3MV9B 4L4VD 4PJCA 5FGRA 3RWCA 1DEEA 3C6LC 4K73A 4RVBA 4D8PB 1QUPA 1G7LA 1F3DJ 2F7RA 4PJ6A 5KYWA 3UPRA 4WEBL 1OPOA 3ULVE 4HCGA 3B7UX 3RVUC 1EEYA 4G80B 4FJ6A 3ZO9A 5AB0A 1U92A 5LAXA 4B9CA 2DKMA 4FI8A 1GOFA 4P4KB 4XVUC 2F8VA 1Q0YL 1BWMA 2VLJB 3MNWB 1IARB 3NFSH 4U6VH 4GQ9H 4C4KO 3BQUD 1J8SA 3E1F1 4WKXA 5I1HH 1O7VA 5C0EA 5D7JD 4HH9B 3U9PL 3UIYA 3ZE2B 2Z4TA 5EUOB 3FULA 1RPQA 4G8FA 3QUKB 1ECYA 4X6FB 1KXHA 3LQAL 4JG5A 5CBAA 4GRLA 3BP4A 1HSAA 4NC1E 3VA2C 3AGVA 5FYJE 3NCFB 4YHKL 1SVBA 4Q52A 1KGXA 4JRXE 3AWGA 4WY7H 2GSMB 1OF0A 4NCC1 3ABZA 2JELH 3BEVA 4OBSA 5DZJA 1YN6A 1AHWC 3Q9QA 5I17B 1RFDL 1J05B 3VWJB 2BFVH 5AUMB 3A6BL 1TXKA 3WEXB 2X4RA 3KMDA 4YHML 5FA3A 1NFIB 4N9OB 3Q06A 2F53E 2ICCA 5F21B 3R1GH 4HWBH 4DP1X 2FNWA 5CZXD 4OGAD 3BSHA 3VFNA 4EDXA 3MOAH 4MMXC 2XYBA 4N8UA 3AS2A 4M8QA 3RLSA 1C5BL 2VDKL 4DGYH 5HHQB 4OV5B 4IM8A 3U46A 4DIXA 5LNGA 2WXNA 1ZA6B 5FDYA 4CBPA 1O75A 4PWIA 1JE6A 4KNSA 4U3SB 2ENYA 1S9VB 3R7QA 2NX5D 4RZCB 4XNZC 3U0WL 1FQ9C 4JPWL 4MRBA 1HH9B 3VI3B 3MRRB 1E2ZA 2YLHA 3ZDZF 4AT6A 3D25A 5I18L 3AG3B 4ZOCA 5A1AA 3QDAA 1UATA 4MBOA 5IUCA 2BWDA 3B1UA 4AZ8A 2Y4SA 5ESQB 2WCSA 5IQLA 4GB9A 2R29L 1PQZB 3APDA 3Q5OA 1X6LA 1DVZA 4KDTA 5DZAA 4I2XA 4I4WB 2XXMB 4I9WE 4RRPM 5ES4B 3Q1SL 2IAMC 5I1CH 1P5UB 1FDLH 4XXCC 2FD6L 4R96A 2WZ5A 4O2CB 3TCLA 5D93C 2BK8A 2VE6B 5DU7A 4N5EC 2GJ6E 3P30H 2R7EB 3HRPA 3DHJA 3GIVA 5D2LE 4ELDA 3MLUH 1JGLH 2JVUA 4XZ4A 2ZWYA 3TO2B 3RWEA 5JHLH 5ACMA 4K8RC 1HX0A 4Z7OB 2X38A 4J8RB 4MXVE 3QQ9C 3DOIA 4UDTB 2I32A 3IEAA 4WNQB 4NUPA 1MJ7H 2ALWA 3MSPA 3KPMA 5AW6B 4DSYA 1SOQA 4M7KH 1AXIB 4BKSC 3OQ3B 3QWOA 1C7TA 5DJXB 3V5DB 1FCGA 1WAAE 3TZVA 5DD0L 1AKJB 2PTTB 3QNXB 2BVOA 3RY6A 4Z77B 1HYSC 1LK2B 3KPQB 4ZX6A 4A2LA 3FTWA 3CFKA 2J5LC 4DGUA 3HC3H 3KNBB 3TT1L 1FGNL 5J1AB 3EH4B 3AGWA 4NBXB 3OGOE 1ZPUA 1UYWH 4YN3A 1N4XH 4U0RB 2VERN 3BGMB 1B0GA 5HI3D 1G9NL 2Z31B 2DQFB 3LIUA 2WXFA 3UL4A 4AMKL 4QKTA 4MGXA 1A9VA 3ZDZE 5KJRH 1JP5A 2VAAB 4FQLH 4G43B 1P7QA 3QCUL 3ZMNA 3WKQA 5HHOD 1EFQA 4MASA 3K5SA 4N0RA 4HX1B 1JWSA 5KSBB 1ITCA 3PWPA 4PJEE 4J1UB 3WJJA 5D1XB 3TFBA 1KXVA 3X11B 1CXEA 2W1NA 5AD0B 4QXUH 2X89A 2WQRA 2YD4A 5EORL 3D39D 1LQSR 3HMXL 4HVBA 4JQIA 4JFQB 4JZJB 1I7ZB 4LIQH 2EINB 2HJKB 4JM2A 1J0IA 4MCYB 4CJ0A 1R5VB 3ALWA 4IU2B 3BXNB 5C08D 5ICYA 4DW2L 3QXTA 1MSPA 4RA3A 2KC0A 4ZMWA 3SDDD 3PDGA 1NC2D 1YEEL 4BJLA 1BJ8A 1P7BA 4IBUA 3PQYB 3ZIYA 3QULA 3L7EA 4ABQA 3ZX1A 4XWGL 4ATTA 1FUNA 5FW7A 3DX7B 3HB3D 2A9AA 3H9YA 4AGLA 1S78D 2D7OA 3T09A 2BOBA 1SJEB 4Y2DC 5HGBA 4QXWA 1IQDA 1PX3A 4HOWA 1BXAA 1CYGA 1K5NB 4WENB 5DS8B 4BQ8A 4I18B 5A2FA 3CIAA 4P2QE 1IJ9A 3C5SB 4CMMA 4HG4K 4F92B 3ULUE 2NY5C 2P8PA 3ZDXB 2BOLA 2BJMH 4JL2A 2IAAC 4QRTA 1O5PA 4DK3A 2N0KA 4NSKA 4UOJA 2JLPA 3LXBA 3NZHL 1T22B 4PGEB 3ZQWA 1CF8H 3SKOB 3H7BA 1T21A 3HZMB 5E4OA 5EFIA 3F7VA 5IROC 5IWLC 5I23A 3TPUA 1ROCA 3FOLA 1F00I 1JPGA 3GMNB 4K0OA 1J9RA 1P4BH 1QO3A 2VC2H 3DETD 3DGGA 3F12B 3KL3A 4FNTA 5F89A 1DUZA 3DRTA 1KBWA 3EIFA 4GEIA 3NH7H 4O02B 1MI5D 1RZPA 1W0YT 4RMSA 3T77A 5FIEA 1U58B 2BSEA 2DI9A 3N1MC 1OALA 3V10A 1D5BB 3S2CA 4MQXD 3FC8A 4IRJD 4AVKA 1WHOA 1MFEH 1AZUA 3CDZA 3PXJA 3OGCB 3VNZA 1YNTF 2V3DA 4OB5H 5BUPA 3VXPA 1YC7A 5DZ9A 1AGBB 3RDTA 1PLGL 5HY9A 1IKFH 2WIMA 1FWXA 4BFBD 2YXVA 4Y9FA 1A65A 1Z9OA 1H3TA 5JQ6L 4RGNC 1U8QB 4WUUD 1U8KB 1AACA 1F02I 5CSZA 2W94A 1XZWA 3BUIA 4RWYL 4Z9KB 5SWSA 3ZLQC 2BVQB 3BT2H 1FAIH 1JDCA 3FQUB 4R6UA 5IT2L 1F58L 4ZFOA 2ADFL 3QR2A 4QF1B 1C08B 5LG6A 1H3VA 1KLUA 1U8JB 4LSSL 2IPUK 2NXZD 1MY5A 3G04B 3JVGC 1KGIA 1OCOB 1UC6A 3G08A 4NBYB 3N55A 4OJAA 5KBMA 3RNQB 5IR1B 4L1HA 5JYMA 2ED8A 3QVAA 1NICA 4PV8B 1S7UB 4QRPB 5GRVK 3OKEA 1D5XB 2YBGA 4U7MA 3UAFA 3E7JA 3F6JA 1J9TA 3AU1B 4QEGA 1YO4A 3H3PL 5IB3B 5KEZA 4Q9BA 1I3GH 1IBDA 4HIIA 5FM5M 2OAAA 4QRUA 2H3KA 1G7PA 4J4PC 3NSDA 4OZFH 4DETA 1IM9B 1JI2A 2WBJD 3ZL1A 1L5GB 4OT1H 5GS2D 1CCZA 2JF1A 2AEQL 5A6LA 2HTLD 1R3LA 4K7PY 1MCFA 1WITA 3IB4A 3QAZB 5FHAH 5E5UB 3SY0A 4HGWA 4EZKA 3WAKA 4W4OA 1JHTB 1B0IA 3W81A 4ZW7A 2XQYA 2JMRA 1HHGA 5GGVH 3IJEB 3F5WB 5K93A 3IGKA 1J1PL 3N1PC 4WW2F 3UJTL 4ADIA 4XBPB 1CN4A 5FEBA 3V6ZB 2QQNL 1EHNA 2VQTA 4XC3L 3UJIH 1MCBA 3UYPB 4M02A 3CVIL 4F8PA 3LNIA 5E0QA 4QWWD 5DTFA 2PWFA 2QT6A 4E0RA 5J11C 4LLQA 3DPBA 4Z78A 2E5EA 3K4ZA 5AZ2H 3QUMH 1L6ZA 3EGXA 4PBVC 1BIIB 4V1DB 1ETB1 4HOXA 3VCLA 1TDQA 2EDQA 5E6ID 1CZ8L 3ILQC 2F2HA 5DRWB 3U4EA 4CKVX 4PJ8A 1NLDH 3DROA 3RNKB 3INOA 3KCPB 3PHOB 3N44B 4TVPL 1QFWM 3PWNA 4OM0H 1YZZA 1ZV2A 1A5FH 3SBPA 3O6FB 4UQEA 2EUVA 2FR4A 2JV6A 3ULVD 4AW7A 2EYRA 2GBTA 3NCMA 3V8OA 4PGDA 5DFVD 2R56H 4KK6C 4NFBA 2HTKD 4LKXB 3UC0L 1M9WA 2YPVA 3BPCA 2XV3A 4HUNB 1YEIH 4OGZA 4KUZL 3C08L 2CDEB 2H0EA 1J7VR 1JHLL 4NXKA 1YEHL 3PPSA 5DD1L 4EE2A 3P77B 3VFVA 1RJLA 3FTSA 2ZOLA 4HWUA 1OIOA 4R8WH 5CLYA 1EAOA 5D72H 4BSWB 1KBBA 4L8SB 2VLRB 4H26A 1GY1A 4XAWH 4FEMA 3KGUA 2XWZA 2LU7A 2PP9A 4TUUA 4KYWA 3C6SB 2O6CA 5IVXF 4ZNEA 2HG0A 1OPGH 1MJJB 2FO4B 4DWHA 3D1MC 4ZODA 5DZVA 5FYJD 5I19H 1AGEA 2GK0A 3B6SB 1U91B 2DQHL 4IJ3C 4JRXD 4FS0A 3QG7H 3ZYOA 2YAOA 1AQKL 3DMMD 2XFXB 5IREA 1KULA 3HS0B 4K94H 3H2QA 4HKZA 2GCYA 3LNEA 1KB5L 4D2NA 4OI7A 3VG0L 4X6CA 3MLTB 2F53D 1OXYA 2LABA 3ESPA 2QGDA 3CFJB 4NP4H 4PJXA 4PWHA 1A14H 2JB6B 4I13B 4I7ZC 3TONA 5BMFL 4XP4H 2ZWNA 4G6JH 4GSUA 4YSOA 3TWCH 1XZ0B 1WUZA 4G70B 1YEJH 3GIZH 4GBXC 3VWKB 1CBJA 1H3WM 1A4BA 3QJXA 4JFFE 3FT3A 1A1OA 5IBLC 1F3JB 2NDFA 1A7BA 2Y1YA 2FJSA 4F1ZA 2D9CA 4MLIA 3VG9B 2ZF9A 3JUYA 4D0CB 3WTVA 3RE0A 3RIAK 3UMTA 1UB5A 2V7NA 1T5XA 5BRZE 1BVNP 4JKMA 5AAWC 1N59B 5IB5B 4RGOL 4WHYH 4P5TD 5CFHA 3OZKA 2ZTBA 1NIAA 3O3AB 2LQRA 3LCYA 4QHMA 4X8JA 4XO9A 1MCDA 3WSQH 1A6WL 1UM6H 3NSJA 4KKZA 1AP2A 2ENPA 4F7MA 3QJUB 5LN8A 1ZT7A 2A2QT 5E9NA 4B41A 3KYMA 2IQ9L 4X4XB 1U42A 4H5SB 1ONQB 3UO1H 1YQVL 3S8WA 3D85A 3K8LA 4I9WD 1BM7A 4HJJH 3OMIB 3LQZA 1H3PL 3RFZC 2GJ6D 2WM0A 5MP6H 1N6QH 3D2UD 3V5KB 1GIGL 4A68A 3KYAA 4XT1C 3DV4B 3LB6C 4UQDA 1TEFA 2JI2A 1E28A 4YSSA 3FHEA 4IOFD 4XC1H 3SE3C 5FUZH 4I89A 4OFVA 2VB5A 3ARRA 2BVUA 4BD4A 4UNVA 1U8OB 1KJ2B 4JRLA 4AQEB 3QXAA 5ISZB 5T5FL 4JRYE 3J8F7 4BZYA 3NCEB 5AQ0A 4ANWA 3FT1A 4PP1C 1R0AH 1XH0A 3DVIA 2DV6A 2A74C 3IDMB 1EUTA 2AXJA 1WSST 1HT6A 3V52H 1CE1H 4XNYL 2WYIA 2ZXWB 3IPFA 4XOBA 1Z9SA 5IHUH 3WIHH 3RUGF 5FA4B 5A6IA 3ILDA 5EDSA 1FAKT 3F7LA 1KTLA 1N0LA 3FQ2A 3G6JE 4ZXBB 3TWYA 4EI5D 3ME0B 5L4MA 5MHSE 4Z8FH 3BHBA 1GGUA 1NCDH 4NN7B 3EJCA 3ZE1B 1AANA 1OT1A 1CMOA 5IHBA 4UQ2A 4WWNA 3BPNB 4ORGA 2G75A 4WFHE 1S7XA 3ZE0B 1HI6A 1SUJA 1ACZA 2GI0A 3JZYA 4BSVB 2R4RH 4Q9QH 1MDTA 2BOCB 3N1FC 1TQSA 3LZRA 4F8LA 3EXJA 2IWKA 2XV0A 1QA9A 1A7PL 4ZDHB 7PCYA 2QQKL 3IMWA 4JO1L 2JCCA 4ZG1A 2OX5A 3B2UD 1FG9C 1LD9A 2AQ1A 2Z3FA 3FCSA 3QS2A 3H0TA 2XQ0A 2EYTA 4XCEA 1IE5A 4GMTH 3APMA 1DQVA 1OW0C 5H2BB 5ESVA 2UZXB 5KS9A 4E2OA 1Y18A 2CALA 4HDIA 1NIFA 4YDIH 2H8PA 4YE4H 2VXQH 2Y06H 1A7QH 1N67A 3ARBD 1KZQA 4HFWB 3GDCA 4F7TA 2DIJA 2HWZL 2I9LA 4EIBA 2IFFL 3K1KC 4K3JH 3TBWA 4CSSA 4J2XA 2JQAA 5C3LD 4LOUD 1N0XL 1GKOA 4M7LL 4HUWB 2XDHA 3FQ4A 4PJCB 2GTQA 5BXFA 1BLIA 2AERT 3RWCB 1TQBB 1DEEB 2J4WL 4N2CA 1W15A 5K9KA 1TQTA 1G7LB 4ODTL 3VXSB 2FLBT 3OF6A 5GJTH 4EBQL 5T3XE 3B5GA 3BFWA 5KYWB 3UPRB 1Q0XL 2R1WA 1O9ZA 4H0LC 2OYPA 2ENSA 4LVNB 1EEYB 2DJSA 4JDTH 2BNUA 4LP8A 3RUGE 3V5HB 1U92B 2N1TE 4P2QD 5LAXB 3W2DH 2XV2A 3OJDA 3SKJH 1G1CA 3ULUD 1WJ3A 3J27A 1JN6B 4KKPA 4WK4B 1XDTT 3BPLC 3FUKA 4A37A 4YQXH 2RHEA 5ID1A 3CFCL 2DW5A 4N0CD 3RB7A 1CXFA 4ONFH 4YDNA 5IQNA 3T3MB 3U79A 5C0EB 1D2OA 3ZQ9A 2VL5A 5EZIH 1XF2A 2KH2B 1DLFH 1ACXA 1L7IH 4G8FB 4I5BA 2FBJH 3CNKA 1X4YA 2ZYSA 5CBAB 1LO3H 4P5RA 5CUSL 4GRLB 1G9HA 3BP4B 1C8PA 1HSAB 2K3TA 3AM8A 2AJYL 2WLJA 4ZUSA 5J57B 3FN0H 4OCSH 3INUH 2YUVA 2P5WA 1DBBL 1SPDA 5B4MC 1XF3A 1YN6B 2DL2A 1TZOA 5D2NA 5FF6A 1JZEA 5AAMA 3PL6C 2H45A 2X4RB 2IBZX 2A4CA 3RZCB 5ETUA 5C0IA 3U9PH 1T5KA 4JFEE 3QCVL 1AGDA 1FL6A 1IAIL 4EDXB 4WWPA 3LQAH 4AJVA 1TTBA 5B7FA 2R8SL 2WN3A 3IN2A 3TO4A 2EABA 4PM1A 1IGYA 3U46B 2FX8L 4MJIA 3VGAC 5MI0B 4OZIE 5INDA 1H0DA 1YNKH 3TL5A 3VRLE 4OCXL 2ENJA 4UB0H 3MNMA 4F27A 2OR9L 3D3VE 2AK4E 2ZQKA 2OP4H 3ARDA 3QT2A 3HCVA 4RFNB 3NA9H 3TEYA 3AXLA 3QPXH 3QUZC 3CZNA 4AT6B 3D25B 4LSTH 1KIUA 2XTJC 1G1KA 2EDFA 3HE7C 3QI9D 1M2OA 4TQHA 4K3EL 4AZ8B 4C57C 4KQ0A 4U3HA 2J7LA 3QWQB 2VSCA 3NEOA 5AVXB 4N2AA 3VYNA 2ZUVA 5DZPA 4H8PA 1WWBX 1TTFA 4I2XB 4GKOA 3D07A 2A6DB 4R96B 3NIFB 3TCLB 2NR6A 1A6TA 5AVVB 3M86A 4OFQA 2CM5A 5GZNA 3WN5C 3GIVB 4FYTA 2BXYA 2GW5A 2OZ4A 3RWEB 2N1KA 2WNXA 4P99A 2VWEC 4UMSA 4YK4C 5I18H 3BIKA 3JT2A 1BYNA 4BGDA 4JVWA 5F7DA 4Z3HA 4ZPVA 1FLRL 3KPMB 2EC9U 4KI5C 2B3IA 2E59A 5E2TL 3MCG1 3RPKA 3WGUB 1N2RA 2V9QA 1OWWA 4NC0B 1E27A 3D0VB 1LEIA 3TIEA 3Q1SH 3TZVB 3SOBH 3GLDA 3CC1A 1AMYA 4IBYA 2BVOB 3EO1A 4JKPH 4O9HL 3KM2A 4PBWD 3ESOA 3CFKB 5KN5A 4K94C 5CIPA 3H4HA 3OJMB 4KH9A 5H94A 4JZNA 2OMXA 2XTLA 3KHOA 3QH3A 3X17A 2L7UA 1B0GB 4UQ9A 5EDXA 4EJ1C 3VQMA 5LUMA 4YHOL 5KS9F 3MNVA 1KEGH 3OAWA 4R7DA 2WXJA 3VTAA 4WEEA 5F0MB 4JO5A 6PCYA 5IFAL 1P7QB 4P2RB 5GGUA 1XGQA 4KMQA 3JTSA 3ZT5A 4U49A 1ZLEA 1T7XA 3PWPB 3GBML 4OZGF 5DD0H 4OLWH 5HXMA 1E50A 1I1AD 1N70A 1XMEB 2NMSA 4OUOA 4Y1SA 5DJDA 3MREA 1E5ZA 4UOQA 5HP5A 1HIML 1I8AA 5E51A 1VFOA 1WT5A 3NDZE 2L7EA 4CNIA 4HOZA 3W11D 1MCJA 4B9FA 5AZEL 2NYYC 4PRDA 1RZGA 1T0MA 2LFGA 3H42H 2EE6A 4MDJA 1N64L 1MF2L 4IBSA 4JM2B 2O4EA 3V0VB 2BXZA 2EKJA 1OK0A 4NQDE 2D2CC 5ICYB 2CCLA 2DWDA 1MEXH 4PJ5D 5CP7A 2VDOH 3L4CA 2FJHA 4MCNA 4LVOB 5FV2A 3QCUH 5TK4A 4Z7IA 1OCWL 1KSRA 3DK0A 4LZKA 3GTVA 1A3QA 3QULB 3L7EB 3EW3B 5EMYA 3P0VH 5CJ8A 1CIUA 1NCJA 2LGNA 2WMPA 5E2JA 2I9TA 1FL5A 3UP1A 1FFOA 4XI5D 4OH2A 5GS1A 5DMYA 4N22A 2X1OA 1ZGLP 2BOBB 5HGBB 5EORH 4DOHE 1VFAA 3MBEA 1PFCA 1UM4L 1BP3B 1BZ9A 2FWSA 4WVRA 3AQZA 1FZJA 3LRSA 3FKUS 3MYZA 3OJ2C 4OZFB 4CMMB 2E7DA 3DC0A 3MLWL 1AGCA 4UWQB 2OL3L 4X7SL 3CSTA 2P8PB 1PIGA 4QRTB 3RWIA 4MDRA 4U3CA 4NSKB 3RL2A 3O0RL 4JFFD 1IBYA 3C6LA 3KEDA 1SXSA 3H7BB 5CINL 1T21B 1KN2H 2OTWA 3F7VB 3QEUA 3EOAA 4M6NH 5EFIB 5LO7A 3TPUB 3FOLB 1JPGB 2AQSA 4KJPD 3MV7E 5F89B 2A77H 3DGGB 4PHZA 3VDCA 3B7TA 1DUZB 2ROYA 3B9DA 3DRTB 5BRZD 4OZGE 4HS8L 4A2FA 4OJYA 1VPOL 3T77B 3QHFL 4LLUA 4X9BA 2X5PA 2F5BH 1CLYL 2QGBA 4JK0D 3AT9A 1KCUH 4XNXH 3CDZB 4BZ1A 1M7IA 4KMTL 4MS8C 3VXPB 2JKSA 3AB0B 3RVWD 1CURA 3RDTB 4Z8FL 2FE0A 3VXMA 2VSDA 3QJOA 1AC6A 1A7NL 1EEQA 2CZNA 3OSVA 4TLSA 1U8PA 5CWSA 4M5YL 4WWOA 1GA2A 5CSZB 4JLRA 5CEZH 7CGTA 4FKEA 5SWSB 1MZZA 1OTUC 3OKYA 3GXFA 1XSOA 5I6XC 1RZJC 3SKMA 3PVIA 3F6LA 1IAKA 3MV8A 4JKWA 4ZFOB 3N40P 3NACL 4HEPG 1AKPA 3FH5A 1N8ZA 4KHTL 2X2HA 4KZCA 4AYFB 4UTBA 3G08B 3RHWF 3DX4A 3GSXA 4HA1A 3FJTA 2Z7YA 4JRYD 1II4E 4FNLL 4N2HA 3OKEB 4FG6C 4WUKH 3AFLA 1PLGH 1KCSL 3MV9E 2E4FA 3AMKA 1N5YH 4ZAKB 2VXVL 3QO1A 1ACYL 1G7PB 1U2CA 1LP9A 4K3HA 1UA6L 4AYID 1TETL 2CR6A 2NY3B 3EHBD 4RWYH 3VGDA 4K3DH 5EF3A 4PMEA 5I82A 2NNFA 1R3LB 3KG5A 4OZFG 3VFWA 3CHRA 3OTTA 1G7JA 1IGTA 4TUKH 3SY0B 5L8LB 4HGWB 1SXZA 4HWEL 3JSSA 4LSSH 3BYTA 1RUPL 5TF0A 4HZAA 1HHGB 5EU6D 3MJ8A 4W9CC 3CVDA 1WE5A 2CBQA 3ZR6A 5CD5C 1RP8A 2NQDA 3HI6H 3SQOL 1TQCC 1YA5A 3E38A 4QHKI 4HIJA 3RVTD 2G9HA 3D9AL 4KXAA 3TN0C 3VQ2C 4NERA 1CB4A 3VSTA 1IC5L 2QMJA 2JTYA 1URZA 2OR8A 3DX9A 4MFHA 5E56A 3PGFL 3P2TA 3VXOA 2A9MH 2QELA 4DZ8A 4CMHC 2P9RA 1HEHC 1P84J 4GG6A 4AGMA 4JN2A 3OKLA 5DTFB 3SO3B 2IBGA 4E0RB 1N3NA 3QWNA 4LLQB 5DQJA 3DPBB 4Z78B 2EZ0C 1W9XA 3EGXB 2C8NA 2A9CA 2IIJA 1KTCA 3QIUA 4HC1H 3IGAA 1UA7A 2CHWA 2YPKA 4WCYL 3TU6A 3U4EB 4PJ8B 3DROB 1J1PH 2FHBA 4MD5A 1UFUA 1WD8A 3IAGC 2OI9C 2Q2EB 3PWNB 3T2PA 3DGCR 4ODHL 4Q7DA 2QQNH 3FO9A 1JPFA 3V9EA 1G84A 4G11A 2R69A 4ZO9A 5T3XD 4Y5VA 2GTZA 2VYRE 4O5LL 2EYRB 3KAAA 4L2YA 4PGDB 1BZOA 1OM3L 4X5PA 1Z32X 1VGKA 4L37A 3U4BL 1BYPA 2YWZA 3BPCB 1UM5L 1VCBC 3RVVD 1GYCA 3LKQA 3LQAC 3IDJA 4Y0GA 1G5AA 5IB1A 1Z3GH 3LHAA 1CE6A 1HXMA 5SX4H 1DZ0A 1I7RA 1RJLB 3KLQA 3OQRA 2ZOLB 3HAEA 5JO5A 5M95B 4IOSD 3SGDH 1CZ8H 1MCSA 1ZGLA 2AVFA 4WTXA 3SPVA 5L8KB 2H9GA 5H37H 5HYSA 4H26B 4JFZH 4S1QH 2UUDH 2XWBA 5I16A 4BCXA 1RZ7H 5C71A 2XBZA 1ZMYA 4FXTA 4MAYD 4UV7L 4AVIA 1Z9MA 4EZJA 3MUGB 2K6ZA 2VITA 4H20L 4ZOAA 3SGJA 2XQBH 3WV0A 2CXKA 1KT2A 4PLKC 3BD4A 1AGEB 2GK0B 2OMYA 4X6BA 4KUZH 4L3FA 1Q94A 1JHLH 2R2HA 4UT9A 3UBHA 3ZDYF 3DIDA 3L3JA 1I8LC 2B2XH 4HKZB 4L5FE 2GCYB 4OZHA 2ZSVA 2XACC 4LBAA 4X6CB 4CADA 4J6RL 1MVYA 4PJXB 3Q6GH 4LVEA 4Z7OE 1AC0A 4JFED 1BZEA 4TNVF 4OJCA 4FQXA 1E4KA 5A3ID 4E5XA 3WG7B 3WNLA 2HJLA 3MODH 3FT3B 1A1OB 3QQDB 4BCYA 3QIBD 5E9DA 5CLWA 4Y2LA 5CLXA 4BRJA 3PDOA 1U33A 1KJ3L 1UB5B 3C5JA 4NRXA 3D3VD 3WY2A 1I85A 2AK4D 1MFAL 2EIMB 4KC3B 3PCYA 2GHZA 1RJZB 3IVKA 1KLGA 1A7RL 4QHMB 5I9QC 3ZDWA 1AP2B 4F7MB 1ZT7B 3KHQA 3LKNA 2XIDA 3KYMB 5D1ZD 3FBKA 5IY5B 4OF7A 5IROA 3D85B 1MRFL 1QLEB 2Y1VA 3LQZB 5JIPA 1UD8A 2FQEA 2WO4A 2NRDA 5GIRA 5D1XE 1JZHA 2OR7A 1NBCA 1OSEA 2EICA 3LPPA 5LCVL 3ZT6A 4PY7A 1T6WA 2BERA 2R1YA 2V8MA 3ZDYE 5EEUA 3TS8A 3B3IA 3CE1A 3MYJB 5DHEA 3DXAA 1RUAL 1E28B 4C58B 4TV3A 4JG1H 1MREH 5DA4A 1A2YA 3GZOA 4FQIL 3TJPA 4W9LC 1Z0NA 3OWEA 1UXLA 1MFMA 3QXAB 3ZGIA 3CZEA 3ULVL 1G9NC 3ARPA 1YQVH 4YHYB 2YEVB 2R0WH 3PQYE 1W72L 1QLFA 1Z9SB 5EC2A 5B1BB 3D0LA 3R0NA 1KTLB 1N0LB 2ETWA 4FX5A 1A1NB 4BSJA 4JPVH 3TF4A 4I0KA 4NIYE 3TC9A 3A4AA 4LVHC 4G83A 2WXLA 4UQ2B 4ORGB 2G75B 1S7XB 1U21A 1UXMA 3D5OF 3NJLA 3OKMA 5GGQH 5D1QD 1AOHA 1HI6B 3ZDXE 1L3NA 2H0FA 3GSNL 4AIXA 4X9IA 1UZ8A 3A47A 4CJ1A 4NZTH 5FYJL 4ZW5A 4J4PA 4N90E 4QY8A 5EBWB 1CWVA 1CPUA 3G6AA 1OO2A 3GFUA 1JMXA 2J3SA 5A7BA 1NPUA 2JCCB 1IGCL 2OX5B 3Q8BA 4KRPB 1G5GA 1LD9B 2Z4QA 2A4EA 3FCSB 4JGUA 3H0TB 3AREC 2EYTB 4XCEB 5LBSL 1VADA 2Q8BL 1CICA 1NPNA 4BYHA 4N25A 5ESVB 3VB9A 1Y18B 4HDIB 2WTRA 3WFBH 2WSKA 2W0PA 1RZFH 1YYML 1NGQH 1LDPH 2MCPH 4HIPA 2H8PB 5IEKA 1WZ1L 1UCTA 1ODUA 4F7TB 1XBDA 4P9MH 2WGNB 3F7RA 2I9LB 4NQDD 1NLBL 1CLOH 1RH8A 3TBWB 4PREA 2VDPB 3QJSB 5HYJB 5BUAA 1F90L 4POZC 5BXFB 1JNNH 4DPBX 4PVLA 5I6LA 2XETA 4OUUB 1KCWA 1L9RA 4HJSA 4DT2A 4XBMA 5I1KL 5K9KB 4TNWF 2CKNA 3RILA 5GRXG 1IC7L 1A8ZA 2WXGA 3BKCL 3IE4A 2R1WB 4JM4L 2JQZA 3U7YL 2FO8A 2BNUB 4OIIH 3U25A 3H8NA 2WGXA 2MQ0A 4M61A 3D18A 4LSUH 5TDOA 3T3PB 2HWZH 1R5WB 4OKVA 3CFBA 4UINL 4HHGA 4QRPE 3WJLC 5AKSA 5E2WH 2AXGA 4M7LH 1VENA 4HMCA 1DVUA 5ID1B 3E6HA 4G7VL 1CDIA 4MD4A 4EI6A 1NQBA 1UCBL 3LKOA 1XF2B 4NJAH 3RIFK 2XSKA 4FABH 3NTCH 4I5BB 4JFDA 3CSBA 2JI3A 4XODA 6CGTA 1LO2L 1Q0XH 1MIEH 3K8KA 4WDIB 4MB1A 4Y89A 2CGYA 1H3GA 5DD6A 1HU8A 4W70A 2FT8A 4ZUSB 4M1DH 5IJBC 1NUNB 1H3UA 4MZIA 3MUHL 3QCTH 4UM8A 3EDJA 1A6UH 4W9HC 2P5WB 1XF3B 2NY7L 4U3XA 1FBIH 5D2NB 5FF6B 1EGJA 4FE9A 3U4KA 4DNLA 5FK9A 4MJ6A 5I75C 3CFCH 4NKDA 2MPVA 2DQUL 1IEHA 5EOCL 2EE3A 5ETUB 5C0IB 5HD8C 4L0PB 3FYIB 1X4XA 5IHZB 4L2LA 3GBNH 1AGDB 4K9EL 1FL6B 2ARJQ 4XCCL 3JWNG 2BZDA 5BOZG 3PP4L 1UXSA 5CUSH 1R46A 4JE0A 3O0LA 2VMEA 4WWKA 5DC2A 3TO4B 2NY1B 2X1WL 2EXWC 3WKPA 3Q2LA 2EDBA 4KK5C 1IGYB 3UO8B 2KT6A 1QTPA 3SGKC 4MJIB 1GGIH 5LHDA 2P7TA 5F0LB 1AOZA 5INDB 1H0DB 4PLJC 2Y72A 2AJSL 4JRFA 5CCJA 4QAWA 4KWUA 2WCPA 3ARDB 4QHUA 5DC4B 5DVPA 5HHPA 1YPZA 2V5RA 4ZPTA 2OMTA 3AXLB 1EMTL 1PG7H 1IZKA 4HF5L 1CI5A 3AQDA 3QO0A 3NAAH 2ZOOA 4GBXA 4LMQE 1JYNA 1WC7A 4X5RA 5DRNA 3U7WL 3O6KH 4PB9L 3GMMA 2R8SH 2BNRE 3QS3A 3VE0A 4YX2L 5BQ7A 1EERB 4P4KD 2HKAA 2LE9A 1JWMA 5IESH 3PP3K 1OEZW 5F9JA 1MJ8L 2R23A 1A6TB 3Q8CA 4WTWA 4OCXH 2YGPA 3TA4D 4XMWA 3ALPA 2UXFA 4OQ1A 5I5JA 3CV5A 4KTYA 2VLRE 4POYA 2WZAA 2ITCA 1SHMA 2MCAA 2P5EA 5L4FA 1U9KA 3ZHLA 2E47A 3QORA 3PGDA 5F7DB 5AW8B 5KVGH 4ZPVB 4GJTB 2NLJA 1NBVH 4NLAA 2AJUL 1OSPL 1KENH 1N2RB 5AOLA 2V17L 2K1MA 1KDIA 1SUHA 4GW1A 1FSKC 2FGWL 4Y1AA 3TIEB 1LEIB 5E94A 4F80A 4R4BB 3ULUL 3FQWA 3VWJD 3K6FA 3V0WH 4BFOA 5KN5B 3REVA 5CIPB 1Q9OA 3SE3A 1BJ1H 5H94B 4JZNB 2DQDL 3QH3B 4M9OA 2SEBA 1IBFA 4ODWA 3UBXA 4RSVA 3S88L 3OR7B 2OW6A 3MNVB 1AQMA 1NCWL 3H4FA 1D6VL 4JRWA 4R7DB 5LN4A 3UROR 2IDSA 1CFMA 5J5EA 4G6KH 4N2KA 4N28A 1H56A 5GGUB 5E2TH 1XGQB 3FH8A 3JTSB 2CBOA 4ZMYA 4AYBA 2BSDA 5G4MA 3WS3A 1ZTMA 2Z7WA 4AEFA 4ATWA 3EO0A 1XIWB 3BKML 5DVKA 4OLXL 2W91A 12E8H 4N0YL 1OTTC 1Q38A 3MREB 4N86A 4M43L 4A39A 4G5AA 4GXUM 4O9HH 4PRHE 3ZE1F 2VDLB 1V7NH 4CNIB 2UYLA 2VDRL 5DYOA 5I8CA 3STZA 4HUXA 4PRDB 1RZGB 1T0MB 4MDJB 3L54A 4NFDA 5DWUH 1JYVA 5I0DA 3JV4B 4R2GB 3L13A 4UTCA 2Q0ZX 1DN2A 1D2PA 4N3TA 1FJ1A 2DWDB 3I6KA 5CP7B 3B9VA 2VXTH 2FJHB 5IFAH 1YY9D 3U9WA 4ZFGL 5HDQL 2VSMB 3IJYA 3GMLA 5F9WC 5HVHC 2IBBA 4ZQTA 1PG7X 1DBJL 2VJ8A 3F2LA 3M45A 3WOVA 2WMPB 2I9TB 1FL5B 4XPFL 1FFOB 4F3FA 1EHKB 4XO3A 2WB1A 1HIMH 2ARJA 1VFAB 5CGTA 1HINL 3MBEB 5I1GL 4BEIA 4EN3D 4RISL 1FZJB 3LRSB 1N64H 1DVFC 4F58H 1AGCB 1TCRB 3K8MA 3RWIB 5CMAA 1ND0A 4HLZG 3RL2B 3S34H 5B39A 2APBA 2G2PA 3C6LB 4KTDL 3D6GA 4O00A 5JHAA 1B2WL 3AITA 2XIIA 2OTWB 1JXGA 3QEUB 3EOAB 3ESNA 4PCKA 2E8ZA 3O9WA 4YGAB 2C3WA 2W60A 1JRHI 3EOTL 1NL0L 1FVDA 2Y5EA 4GXUN 2CUIA 2IANE 4TSCH 3MMEA 3H55A 5DHVH 1HKLL 4S1RL 4GFTB 1SHSA 4WNJA 4LDCA 1OAQH 3F7QA 4YFEA 4LLUB 2NOYA 4I87A 4LPTA 3ZE1E 1FPTL 2H1PL 4RAUA 2LR4A 2CBTA 3SKNA 2AANA 3QJRB 1M7IB 4X4MA 3ZE0E 1YUKB 3IDNA 1QWUA 4M8UA 3FO2A 3BGFB 2EADA 3MLZL 3HUJF 2DYRB 3QZWA 4LL1A 3O0RH 2HRGA 1SYSB 5CINH 2IDQA 4PY8I 3E9TA 1VJSA 4QOKD 3SPCA 2HYMA 1NUGA 2E27L 3ZBMA 5CWSB 4XHJD 1JL8A 4JLRB 4I9XA 5IV2A 2ALAA 4KROD 2M1KA 3EJTA 4HS8H 2DICA 4KJQD 5I1LA 1SY6A 3SKMB 3MV8B 1VPOH 1BFTA 3GB7A 43CAA 3FONA 1CLYH 4FQCL 3MUUA 3WE1A 1N8ZB 3GSXB 4KVNL 1KBPA 4MQ7A 2B9AA 2BIIA 2X6CA 5B1AB 2XWXA 4G5ZL 4CU6A 2KL6A 4YNYA 4PRPA 1CD0A 1OE3A 2WXPA 1NDMB 1L0YA 2XX0A 4ZSOA 3PQYD 4B9GA 1G9EA 4B9IA 1M9SA 3QO1B 5D7IA 3K0WA 3VXSE 1GAFH 2XRAL 4M5YH 1LP9B 4D7PA 2WKOF 1GOHA 3TJHD 4Y19A 3GTTA 4HK3N 2ID5A 1B6UA 4ZS7L 3VFWB 1G7JB 1IGTB 1ETJA 1MG3C 4R5XA 4JHWL 1BLNA 3HNSL 3QZOA 1ADQA 3GQFA 3ARGA 5JXED 4PJ9C 4HPYL 2DWXA 2VLME 5DUJA 1KGUA 1OE1A 4B96A 1W8EA 2APSA 3MJ8B 1OVZA 2Z65C 3E2HB 3LRLA 4FFVD 1R34A 2G0KA 3FN9A 3QUZA 1KCSH 3TCXA 4HIJB 4N90D 4JY5H 2G9HB 3VD2A 1RZKL 3HUJE 4EDWH 3QSKB 1FYTB 1ACYH 4PGBA 3DYOA 4H88H 1NDGA 1HOEA 3DX9B 5A2JH 1NJ9A 3U1SL 1TETH 3VXOB 4DZ8B 4E9WA 4GG6B 1WBXA 4JN2B 3OKLB 3CDCA 1N3NB 1PKQA 5DQJB 1SEBA 1TQWA 5C07B 2ICWI 3K5RA 1PYWA 3QIUB 5D93B 5K1NA 4XP6L 1LEKA 4OF8A 1PS3A 3BUQA 3N91A 3UBXI 4ALAH 1AR1B 4JHAH 1FN4A 2YPKB 2YPLA 4Y5XC 4D7BA 5IMLA 4NZRL 4B95C 1KJVA 3W0WA 1P69B 3SQOH 1IGML 2KYIA 4GW4B 4R7VA 1QOKA 4JJ5B 4NWUH 3LPFA 3D9AH 3FO9B 1JPFB 1T1YA 4LB8A 4BBWA 3B9KD 4Y5VB 3OPZH 2GTZB 2YGVA 3GGWA 3NSCA 3M7OA 5FO7A 1VGKB 4L37B 1E3FA 3I9AA 1TLKA 2OTUA 3LKQB 2VXUL 4PTUA 2BS9A 4UU9A 3GSOA 3IDJB 4DVBB 5IB1B 1PZAA 4FFYL 1CE6B 1HXMB 3L4WA 1I7RB 1K3ZA 1QATA 2J2ZA 7TAAA 1LGVA 3HAEB 3QHZL 1HWGB 2F15A 4KKNA 4QRPD 5JO5B 3QQNA 1ZGLB 2H2SC 4M7ZB 2IAMD 4E36A 1OAYL 2WO3B 5DUPL 3LKRA 3SPVB 5AKRA 1URLA 1DBML 1FNEA 4Q9RH 2H9GB 3EO9L 3L3HA 4N5ED 4F7CA 2R2EA 4JB9H 4P46D 2XWBB 3VXRA 3ZTEA 5I16B 3EJSA 1ES0A 1ZTXE 1X5YA 2E9WA 5D4IA 1WWWX 4O5LH 2VITB 2C9PA 3LD8C 3U4BH 2MPAH 4LIQE 4Z7QF 1PLCA 3BYYA 4X8XA 1TJHH 2OMYB 4LLYA 4X6BB 2NY0D 4ELKA 1NIBA 1Q94B 3LEVH 4BKTC 2AAVA 2R2HB 2Z8SA 3NZ8A 1TNMA 3NIFE 2FJGA 1W8NA 1PLBA 3L3JB 4LCYA 4OZHB 2TSAA 5GZOC 2ZSVB 1EDHA 1JZDC 4HJEA 5T5NG 5HPOA 5KVFL 1EO8L 2WNKA 3L1GA 2XY2A 1U8IB 3NGBC 3W3BA 4FQXB 3GI8H 4UV7H 4E41A 5H4YA 4ZMTA 1TEYA 2EIEA 2NNAA 4DP7X 4E5XB 2HJLB 1D7DA 4IW4C 5EOQL 2XVKA 3S7GA 2QSCL 3VUAA 5E9DB 4HMEA 3O4OB 3T65B 1X3DA 1QRNA 3V0HA 4AG4L 1RJCA 4GUOA 1F6AA 3PDOB 1MZYA 3C5JB 4NRXB 4AY0A 4Z3TA 1QFUH 4QPEA 3CXFA 4FQ2L 2JIXA 3UTTA 1T0NB 3V4PA 2NXYC 4J6RH 1EHAA 4AMWA 3IVKB 1ZS8A 1ZSHA 1KLGB 3DUUA 4X99A 5LGYA 5KVDH 4ZQKB 1HVXA 2XN1A 2QPDB 3LKNB 3UOAB 3W5NA 2H6PA 3FK3A 1ILSA 2BNRD 4RX4D 3N06B 1P6WA 4P2RE 1ET8A 4QTIL 5MENE 1RIUL 3EYFA 3HAEG 5B1KA 3WUWA 3PWPE 2H6UA 5GIRB 2WK2A 3DTDA 2F5AL 2BIPA 3OKKA 2V7HA 4WO0A 4Z7QE 5J89A 2EVJA 2KLSA 1KJ3H 4CSPA 4IQHA 1ZANL 2R1YB 2XY1A 1HWWA 5LXVA 4ELMA 3PRZA 2VLRD 3B3IB 3OKDA 5AVWB 1MFDL 4CGUB 1HK6A 2L3BA 3KW8A 3JT0A 1F4XH 1A2YB 4LRIC 5BO0D 2NT1A 5BVJA 3KWWA 2EC9T 4ZMQA 6FABL 3MJ9A 5T3XL 1BMGA 1JHKL 4BHUA 1F1GA 4P3CL 4XAKE 5E6RB 2DYPA 3LH9A 4GO9A 4FQ1L 1AIFA 3FT9A 3QDGA 1S5IH 4AGNA 2MCMA 5BVPL 1HCZA 1QLFB 1IEBA 1SGKA 1H8NA 2J6EA 2WLMA 3LKPA 5EC2B 4MZRA 5B38A 4TSBL 3D0LB 2X9YA 3RAJH 1HWHB 3PWUA 2IOMA 3Q48A 1MAKA 4P59H 4CAGA 3FCBA 3NIGF 4Y9GA 4FTVA 3T4YA 2PKDA 5DJZA 3LIZH 5ELIA 3GWJA 1L7TH 4GAAA 2B1AL 4QGTA 1UZ8B 3AZUA 3RTQC 2XUWA 3WI9A 1DCLA 3T1WA 2V2XA 4OGAC 3COOA 1CD1A 3G5XB 2OA9A 1WFNA 2DJUA 4QY8B 3TV3H 1MOEA 5I73B 2B8OT 3G6AB 2YK1L 3WO4B 1J1XL 3RX7A 2Z4QB 4PRHD 5AW4B 1VADB 5FO8A 3QJHA 1CICB 3FU5A 4YDLC 4KNQA 1OL0A 4KI5F 1A0QL 2KQNA 4LHJB 1KXQE 5C0AD 4NZUH 2WTRB 4HGKC 4XPTH 3NBNA 3F7PC 5C0BA 5IEKB 3OHXC 4LSRL 3UG3A 2YC1A 3AG4B 4P3WA 5JMOC 1GYWA 1PVHA 2CU9A 2CIIB 1U8LB 5SX5K 3UCRA 3E6FA 1BVLA 4MXQD 1N68A 1ZIBA 2DBLH 5J3HD 2EECA 3IDYC 4ODSH 2HVJA 5CN2A 2FX9H 2Q87A 5I6OA 5I66A 3VFPA 2VTFA 2RAMA 4UT7L 2XZCH 2G60H 5JOFA 1AD0A 5SWSE 1UA3A 2X4TB 5HDLA 5J11B 1RHHB 2HG5A 5T3ZH 3CK0L 4YC2B 2XWEA 3WS6C 3IRPX 3KS0H 4OLVL 3PFQA 3T4AC 2EUWA 1Z3RA 2FX7H 4FJYA 5CCGE 1WZ1H 3MBWA 4M61B 1TJGL 3D18B 4NP9A 5TDOB 4EIUA 1UH3A 3CFBB 3FCGA 3NIGE 5TE7H 3VI4A 5IZ7A 2Q3XA 1PZ2A 1LL1A 3WNKA 2AXGB 1TVHB 5CU5A 1YECL 1PF3A 2CKBL 1F90H 1EZSA 3ARYA 3UGUA 1TTGA 3E6HB 3DO7A 3P3YA 4MD4B 4EI6B 1DBAL 2HB0A 1WAEA 1FV1A 2IAND 4JFDB 4XMUA 1M05A 1DQLL 1G94A 1G87A 2VXSL 4ZXBD 4L8BB 5CU9A 3FO0H 3EYSL 4JM4H 5JIDA 4OBRA 5DD6B 3U7YH 4UM8B 4KVCH 1R1CA 5CJXA 4NAQA 1IT9H 4GSDL 3ARTA 3ZZLA 1NUFA 2W92A 2YBRA 1A1MA 3SDXA 3QWRA 5IW6A 3RJDA 4WI7A 5I8OL 2E76C 1WV7T 4X98A 5HI3C 1QPKA 3A24A 4MJ6B 4NHCH 4Z7UA 3N42F 3VFSA 1BYOA 4F2FA 2VQUA 1QPPA 4NKDB 1EAQA 3ILQD 5DDHA 1BQ5A 1J9CT 3CCHA 4OJDH 4PW4A 4UTAH 5J6HA 4RETB 1EJFA 3STBA 5L2KB 4K71C 1MLBA 4LPUA 4ONHA 4N5UA 3KJ6H 1VACA 1LO2H 3GKZA 5G4NA 1UXSB 2LTQC 4KMLB 4WWKB 1PCXA 2IG2H 2FK9A 2JKXA 5C0RL 1WFTA 2FJFA 3CFDB 1TYRA 3FFCE 1I8LA 2P7TB 1GHFL 4S11A 1G7HA 2IO5A 2Y36L 4NJ9L 4WTZA 2NY7H 1NC4D 1XV8A 4OW6A 4ALAC 4MNQA 1K8DA 1WBZA 3CN0A 3CVHA 3SDYH 4L3CA 5B7MA 4QHUB 5HHPB 1GKEA 1YPZB 4TULL 4YR6A 2E86A 2OMTB 3UCQA 5EOCH 4KGJA 2YD0A 3VXSD 5E08L 1HNGA 2WINA 1FL3A 1FE8L 4LGPB 3RDJA 3SDDC 4H1LA 5DJCA 4GBXB 4IDJH 1WC7B 5DRNB 5JPNC 3IT8D 1J10A 2R29A 3GMMB 3HB3C 3ZGHA 3VE0B 5BQ7B 4N1CA 3PP3H 1KTBA 1XMWA 3QB7C 2FIRT 4K2UH 1S78C 3CFQA 1KUMA 2H26A 2VLMD 3WY4A 5AOMA 5IOPA 4CVWA 2O72A 2P48B 4J3TA 1G4RA 1YMME 1TZGH 2MTAA 3SDCD 2R23B 4AQ8C 4KZDL 1KCRL 4BHUI 3ASNB 3RJQB 4FQHA 4KVPA 3BH9A 5L8JB 1HCFX 4ZUTA 2ITCB 3PGCB 1EMTH 4ENEC 3LXCA 4HF5H 3QORB 3PGDB 1J1OL 3LH8A 5DEGB 3HBZA 3U7WH 2NLJB 5E23A 2BZ7A 2CGRH 3DETC 4LEEA 4IRZL 2AEIT 2IDUA 4GW1B 4ZMAT 1VGEL 5E94B 4ZO7A 5CJQH 4LASH 4G8IA 4JX0A 1OAZH 4KKLD 1MNUL 5GRYA 3FQWB 4DAGL 3SQRA 2VDML 4MQXC 4MXWL 4IRJC 4GSXA 3REVB 2Q7NA 4NHUA 1Q9OB 2ICWB 1NSNH 4U6YA 2UXTA 3RZCD 4PJXE 5TE6H 2DQIL 4L9LC 2SEBB 4AW4A 4ODWB 1FFNA 3UBXB 3I9GH 3LOWA 5CGBA 1A9EA 3AUWB 1PZ3A 4JFPA 2ADYA 5D8JH 1FC1A 3F58L 3X14A 5A2IH 2BVEA 1T89A 2KI6A 2V17H 3QEQA 3WS3B 4GRWH 2F74A 4KKCD 3EO0B 1RJYA 4D9RE 4KH2A 3ULUH 4R0LC 5J6SA 1X5JA 2FT7A 2NXZC 4M1GL 2PPFA 1QNZH 1T04A 1NFDA 3HMXA 3WTUA 1USZA 5DYOB 5I8CB 3STZB 2WJ7A 4HUXB 3GM8A 2WLZA 4KKBD 4NQCA 2GG1A 4KJYA 1ZAGA 1NAML 2NY4C 4HUMB 4MAUH 2B16A 1QSFE 1D6VH 1FJ1B 3I6KB 4N0UA 5FLVA 3WY1A 2WC7A 3JWOH 1JPSL 2FWLB 1KPUA 5TTRA 2HTLC 2OQJA 4I8DA 3DARA 3IJYB 3GMLB 4FADA 2P43B 2HVKA 5IJDC 5A43C 1BM3H 1RVFH 2OSXA 3F84A 4PP1D 3CMOL 2FL5A 3V0IA 4LNVA 1I9IL 4WJ5A 5E7FA 4EZLA 3EDFA 5TQ2L 3PIQA 1MRDH 3WCYA 1PMYA 4NI3A 2ADIA 3P0GB 2LU4A 5DHMC 5FW6A 4NNPH 3GEFA 1JGDA 3UZEA 3EXLA 4HCFA 2WUCL 1UWEL 3IU3A 5CMAB 4NO3A 1ND0B 2IWFA 5T33L 1PEZA 3B2XA 2H3XC 1S7SA 3L3GA 4GQRA 5F93C 2WUBL 2K0RA 2MQCA 3O9WB 4QWWC 3REWA 4ZFGH 3N43B 1AZVA 5HDQH 2W60B 1DLHA 1FVDB 3NUKA 4JDZA 1EH9A 3ELQA 4Z7NF 1TZHA 3MMEB 4JL1A 4XPFH 3GXUB 4BFIA 2IH3A 4CW1A 4HUKB 4QHKJ 2JJUA 5FGBC 4HG4J 4O58L 5I8KH 4PJBF 3UBXG 4BM7A 1HINH 3VDAA 5E6IC 1C12A 4D94A 2G2RA 3O2VL 2D9QB 4RAUB 5F1IA 4MTMA 3SKNB 2D8KA 2E9JA 4RAVA 5BS0A 3BPLB 5F6IB 3IDNB 3HE6D 3V7MA 2J72A 3KLAA 1T03H 5JW3L 1GR7A 1WFMA 2Y7OA 1P7QD 3QDJE 4P2RD 3QZWB 4C56A 3SEPA 3EJQA 1Q90A 3DX3A 3KBEA 4HJUA 5MEND 3ULVC 3DHMA 4L1TA 3X1EA 3PWPD 1INDH 5CFAA 2HTKC 4LCWA 3WDJA 5AVZB 1NAKH 4XVSH 1NL0H 2QTVA 1ZWIA 3CVBA 1JVOA 3U6XA 5IV2B 2X89D 3QW9A 2UZIL 2D7TL 2IFGA 3KE0A 1L9MA 1RLWA 5I1LB 2VM9A 4X5XB 2CIKA 2CJUL 2JNZA 4GLRI 4YBLC 2Y6SD 3GB7B 1JF1A 3IXAA 3FONB 4F2EA 3JWNE 4FJZA 2VZ1A 2KPWA 2VMJA 2AKRA 1RV6X 2FEEL 5TPWH 3GBEA 1GTFA 5HYJE 2CHZA 3CD4A 4YNYB 4XAKD 4PRPB 2XN9A 3FTYA 3AACA 3BZFA 5I5RA 3IFNL 4NC1C 4PJHA 5D7IB 3HR5A 5GGTH 1BQKA 5J7CC 3ZW3A 3DOHA 1X9UA 5ILTH 4Y19B 4NIKB 1SEQL 1T7WA 4X9YA 2HP4A 5C09A 4MMZA 1SDAB 2JKWA 1SHXA 2XJLA 3DMMC 4Z7NE 1KEMH 1PTZA 4UAOC 1J0KA 4FQCH 1U0QA 4PJBE 1FVCA 3WHE1 3ARGB 3KEHA 1PBYA 4KVNH 3VFGL 4AIOA 2RCSH 3NFNA 3F7YB 3GRWL 5C2BL 2VDNH 2QPFA 4G5ZH 4M00A 4ETQA 3G6DL 2HAZA 4OI8A 3ARQA 2YAMA 4KGLA 3QUZB 4TNFA 3AVEA 2GIMA 3DURA 2OSLA 3PL6D 5CCKH 5CZRA 5MEPA 1EJ6A 3LVTA 3DV6A 1QFWH 1NDGB 2QQLH 1NJ9B 4L5FL 4YS4A 3EGDA 2C4FU 1PKQB 4ZI8A 4ZS7H 5ITBL 2Q6WA 3BN9D 1SEBB 3L5WA 2YRLA 3HPLA 1PYWB 2FGZA 2H41A 3V4VH 4DERA 3KWXA 3NG5A 1LEKB 2P5WE 3HNSH 4HWZA 3FSAA 4WZ9A 2G3NA 4P5TC 4ZFZB 1I1RA 1O5DT 1FN4B 5IMLB 3NCJH 2AQNA 1OTSD 1KJVB 3W0WB 3AABA 2A3TA 3QUXD 4HQQL 2MEJB 5KBLA 3PHAA 4OCRH 5F96L 1T1YB 2V9UA 4PYHA 3QQ4A 4KTEL 4DQAA 3MFFA 4IHBA 2A1WH 4HKJA 2YGOA 5DD5L 4F33A 4LFHG 4U31A 5ESAA 1A3RL 2XTJD 3BVVA 3H9HA 5FO7B 3HE7D 2OTUB 4J2QA 4PTUB 4UU9B 3GSOB 3C87A 1CG9A 3DJZA 4U1JA 2EDXA 4XP6H 2J2ZB 1P7HL 1IQWL 2Y23A 3DJRA 3L3IB 4HJTA 4H44C 3U1QA 1XGYL 4YHZL 3LKRB 1FNEB 2PMZA 4ZAKD 1H6UA 3ZQXA 3L3HB 3RGBA 4F7CB 2R2EB 1CL7H 4D0DA 1LE9A 3VXRB 4UOZA 1LNUA 4DP5X 1QLRA 2QL1A 4M4PA 4B3EA 1ES0B 2NZ1A 1OM9A 2CJ3A 4DKEH 2D03L 4K9EC 5DMIL 3JVFC 4UI2A 2YD5A 1F42A 3BJLA 2YMXL 4Y5YC 5FCSH 4PJ7F 4ELKB 1LEGA 1VZIA 4L29A 4G72B 4KI5D 4PS7A 2YFOA 1ZT4A 2HT4C 3UG4A 3NZ8B 1QNIA 3ZHFA 2FJGB 2BVPA 3PAYA 4LCYB 2WLKA 1X7QA 4I0CC 2CA3A 4HBCH 3MJ6A 3ZXAC 3MLXH 5DUPH 4XNQA 1KB5A 4YSEA 1DBMH 3EO9H 4KK8D 4BQCA 2EH7H 1ILUA 3IFOA 4Q58C 4YDVA 4E41B 5HSFA 4GEJA 2C9SA 3KPSA 1CGSL 3ELAT 4P2OD 4KU1A 2NNAB 3GRBA 3X1GA 4DEPC 3KVPA 2CLRA 4CVUA 4N68A 3B2UC 3O2DL 2B39A 4XBEL 1JG9A 1KGJA 3BGAA 5EBMA 3SDAD 3BWAA 3FFCD 5C3TA 3ASOB 1QRNB 1F6AB 1QFWI 1FZOA 4M7JH 3OBAA 2QFRA 4PJ8D 3EFDL 4JGJA 1BV8A 4Q6IC 3ARBC 2KLTA 3CBRA 4HKXA 3ZHDA 2JIXB 1M7XA 3EADA 3TH4T 2X3AA 3V4PB 3HPJA 5IIEA 1J5OH 2QPUA 3MNDA 1ZS8B 4X99B 3DUUB 1EXUA 4LOUC 2J71A 35C8L 5I8EA 4PJIA 4PI2A 2OULB 2NYYD 4GQZA 4R5VA 4AJYV 4O02L 4TQIA 2H6PB 4NCC2 3MFGB 2YA0A 3MA9H 1QHOA 4MNGA 1H19A 1AE6H 3L4UA 4BXSV 4MNHA 4BFKA 4QCIA 3EYFB 2CXGA 1RUML 1MQKL 4AEHL 4AG4H 3OKKB 2W0KA 1YMMD 2V7HB 3K4AA 1UACH 4KY2A 4PJ7E 3X2QB 2VR5A 1M56B 2OYLA 2P3YA 4PJHF 4K7PH 3ULUC 4DKTA 4ELMB 2VN5A 2WN2A 4J3XA 3RIKA 3OKDB 2XN2A 4YVUA 1HL9A 1XF1A 3KWWB 1Y1DA 5CEZE 3X1BA 3C8HA 1KPRA 1I7UA 1OE2A 3ZT7A 3VQ1C 4N0CC 3KL5A 4QXTA 1C9SA 3OV6A 3I6GA 5LNDA 5T5FA 1D5IL 2JCWA 3PFUA 1LQBC 2DYPB 2BNQA 3LS5L 4JZOA 1OK8A 4QTIH 1IIKA 1AIFB 1RIUH 2DQEL 2IPTH 2WBWB 2X9WA 5E8PA 4Q2ZA 3QDGB 5K9JL 4JG0H 3T9WA 2PYEA 1IEBB 1KF9B 3LKPB 1QRKA 5FW8A 2B15A 5B38B 5KBDA 1HCVA 3HJEA 5I6XB 1MPAH 2Z34A 3L48A 4OZ4A 3I02A 1LO5A 5H4ZA 5EZJA 2BC4A 2IALA 3OSKA 3MRLA 2D31B 3DYMA 4XP1H 4HULB 1EZVY 4NN5C 5HYIA 3O81A 3OB8A 5DJZB 2LW3A 3P0YL 3L4XA 1WIOA 5DZLA 4UQBA 3WFZA 1WO2A 1U3HD 2WYZA 3CU1A 4FFZL 4ENZA 1OZTG 2VR3A 3IRCA 1F4HA 5B1CA 2V2XB 5HDWA 4WGWB 5A7EA 1CD1B 3ES6A 5DJAB 1CD8A 4FQ1H 3L3KA 2N7AA 3WJMA 3HOGA 2MRYA 5F3BA 2LAAA 1MHPL 1EVUA 3AQYA 4M6OL 4MMYA 4TSBH 3DJSA 3ZTDC 4UAHA 3IWUA 5FO8B 2FECI 3QJHB 2DOCA 5HGAA 4KQ3L 4IGBC 5DEFA 4PJ9A 3NMEA 4R4ND 4PV9A 5C0BB 4OVUA 2YC1B 1QSFD 4ZRGA 4FXGC 4JHUA 3C60A 3IRZA 2IH1A 1JGUL 1FNHA 5JW4Q 1BJMA 3E6FB 3QI9C 1BVLB 3L3OC 4KY1H 2BFGA 4F9PC 5T5NF 4JMXA 2D4FA 3UAJA 5HDBF 5HHVH 3PHQA 4FG6D 4XHQA 2HVJB 5I66B 3VFPB 1V3MA 4YHNB 2VN6A 3B2PA 2ZYHA 3FYEB 1BXVA 1AD0B 5JOFB 3T0EA 1OSYA 1AO7A 2HG5B 3U7AA 1A22B 3ERXA 5E95B 1X5LA 5G2NA 3MV8E 5TH2A 2ZPKH 3EJZD 5DGQA 1H15A 1WRFA 3IJHA 3MBWB 4G7SB 4UILH 4LLVA 3RIAF 3VI4B 3W82A 4K7PX 4IBWA 1KACB 5B3SB 4LLWA 2LU3A 2DMKA 2FT6A 2YRPA 3FZUD 3IFLH 1SXNA 2A83A 4QGYA 4AKPA 4UIMA 1U2HA 2B1OA 3L2NA 3H9SB 1FV1B 1T6VN 2O5ZL 1M05B 3C09B 3TN0D 5L6YL 4AIEA 4IHOB 4UM9D 2PCYA 3CK0H 4AK2A 4PJGB 3QDMA 4OLVH 2XPYA 3MN8A 1TR7A 4FGMA 2EVGA 4LSPL 2EE0A 1I8MA 3BZ4B 3IMRA 3QEHA 3UAAA 3Q2WA 1TJGH 2YBRB 4JPKL 1A1MB 3SDXB 3QUHA 3QDJD 5IW6B 3WFCL 1H6TA 4X98B 2F6AA 3VFSB 4Z7UB 4QRRA 4ANKA 1E8WA 3ZRSA 1MWAL 2FQDA 1I8KA 3CCHB 4IKJA 1Z9LA 1DBAH 3KPRE 4BUQA 5J6HB 1BBJB 1FYTE 1IKNC 2YQ3A 5B22A 5SV4A 1MLBB 5HDBE 4ONHB 1YC8A 1VACB 2VXSH 4GG6E 3EYSH 3GKWL 3BD5A 1I1AC 1ZSDB 5KBKA 1VKXA 1FLTX 2Q86A 2E46A 3FUJA 5C07E 1B3IA 4DGVH 3F62A 2VDKB 2FJFB 1N8OE 3PJLA 3W11C 2YD7A 5ALBH 1G7HB 5GZOA 2HLEB 4K23L 1X7SA 3ETSA 2DKUA 4WW2C 4Z5RA 2C9VA 4A7UA 7FABH 5HYJD 3DPDA 4MNQB 1K8DB 1WBZB 3CVHB 3P02A 4L3CB 2FVNA 1GL4B 4RH4A 1K5WA 4YR6B 1M6OA 3MZTA 4RRPG 4JUSA 4JN1L 1BIHA 2YXMA 2XWJA 1ZGLM 1AYRA 2WINB 1FL3B 3LQMA 4ZUWA 4H1LB 5DJCB 2ZCHH 3EFFA 2JB5H 5ITFA 1SLVA 1RZKC 3HKZA 5FPIA 3EYOA 1QW8A 2XNAA 1E3ZA 1P53A 3L95A 2E3VA 4P9HH 4N3UA 3GLEA 2YQBA 1TUPA 4NBZB 4XI5C 5I0VA 3C5XA 3ATAA 4ZT1A 1QHQA 2H26B 1C1EL 3MLYL 1KWGA 5IOPB 2PCPA 1GHFH 2UXVA 4JO3L 4PLKD 2DM4A 2Y36H 4NJ9H 1C7SA 3KPTA 5IVNA 4FKHA 3MR9A 2WIIA 1VCAA 4P5MA 4S0HA 1JNHA 5HVWA 2BSBA 2DWYA 2HA1A 3BUYA 4FQHB 5IM7A 3BH9B 3S96B 4M5ZH 4L4VA 4ZUTB 1MVFA 4HUCA 2B9BA 2ZOUA 1JZIA 5GRJL 1E6JH 3L9BA 3P69A 3IBOA 1CVSC 4PG9A 2DD8L 1QR1B 3OM3B 3OLIA 4CN4A 2YSSB 5DURB 4QMEA 2K8MA 2CMRH 4XN9A 4YHPA 5FUOH 2P5WD 3AY4A 3OZLA 4JKNA 1XGPA 2H32H 3BVNA 4G8IB 3FF8A 4LT7A 5T1KD 3SY6A 1KJ2L 1X9RA 4KZDH 2AK1H 4OZHE 2A9NH 1S9WA 4MVBC 3W1ZA 3KGRA 4FI6A 4NHUB 4U6YB 3BQUA 1IV8A 2OW7A 4OFIA 1V7MH 1MFUA 1TTCA 5GSVA 3RVWC 2Y2TA 2W0LA 5FCUH 1FFNB 5D7JA 5DVLA 2NY2D 1A9EB 4U6VL 2PTVA 4JFPB 1FRGL 5D7SH 3D0AA 3OC5A 4BWUA 4PW3A 1SN2A 4U1GC 5JUEL 3X14B 5F7EH 2AQPA 1J87A 4JFOA 2UY7A 5I1HL 3KBPA 1IE4A 2NY1D 3KL0A 5E03A 2IDCA 2XTSA 1IEAA 3QEQB 4WTZG 1I9JH 3DK2A 5DJYA 4Z7VA 5F72S 1MG2C 1RJYB 2BS8A 2X4QA 4DAGH 3BO8A 1Z0MA 1WFOA 4N8CH 3ARDD 1T04B 1SDDA 3F64A 3FFDA 1UUSA 1NFDB 4PY8J 4H1LG 2C1PB 2NTFA 4KJYB 4NQCB 4WY7L 1ESOA 3A67L 2DN7A 4PHXA 4ZX4A 4XMLL 2DZEA 3DO3A 1PPIA 3F58H 5DSCA 4N0UB 1AS7A 2AEWA 3R7RA 1KPUB 4GNKB 4HWBL 4GSQA 2OQJB 1RL1A 4M4RB 1KN4L 5KSVA 2HVKB 2EDTA 2NR6D 3MOAL 5K9QI 4WJ5B 2JJSC 3R4RA 4ZO6A 4H8WL 4M1GH 2RIKA 2CE6A 3OKOA 3BWZA 4YDJA 3PIQB 3OHXA 4J3OH 4DGYL 4HAGA 2ADIB 3GJFA 4YLQT 2WQUA 4ZD3H 1JGDB 3TA3B 2CWRA 1Y0LA 3IU3B 1B4JL 3M46A 4U1KA 3IJ7A 4NO3B 3UTPE 3U0TA 1AVAA 5KW9H 1M7UA 1S7SB 3L3GB 4AWJC 3UZQA 2UWEA 3REWB 3ARFB 5E0FA 1DLHB 5D9SA 2NYZA 4JDZB 1UT9A 1C5DA 2VDNB 1TZHB 4DTGH 4BFIB 4BFGA 5EU5A 1MFNA 2IH3B 3WS6A 4CW1B 1IVTA 4R7XA 1AZRA 3T4AA 1C12B 2WANA 4DKFL 2G2RB 5IW3A 5EIIA 3ETBJ 2EYSA 4FL4B 5D96B 4TLKA 5BS0B 4RAVB 5IHLB 1UWXK 1SVZA 3P30L 3KLAB 1P6FA 1WGOA 4XNAA 3MLUL 2EXTA 1CI3M 1JGLL 1CYWA 5AVTB 2ICWJ 5T33H 5JHLL 3TVMD 1W16A 3V4VB 4BRVA 3CX2A 5AALA 1Y6MR 4LCWB 1XIWD 1KELL 1RI8A 1I1YA 2AJXH 2DWTA 3D8MA 3BFQG 2AC0A 4Y2OA 2P24A 4R7LA 4AE1A 1SJVA 2HT3D 3PXLA 4JNXA 1PFOA 1ZT1A 1EYUA 4O58H 2CIKB 2I7SA 3IXAB 3WD5L 5JW5A 4W93A 3FNKA 4R7NB 2BHYA 5CEZD 1ZXKA 4R2GD 2NY6C 1FVEA 4OSUH 2AKRB 4U05A 4YHIA 4APQD 2FSEA 4O2EA 2COVD 4OQTH 5ACLA 1ZHKA 3HC3L 1SOKA 4YIQB 3C5ZA 5JW3H 4MAYC 3WE6A 5IJVA 2XN9B 4UT6A 1JZ5A 1UYWL 1KYFA 1N4XL 3BZFB 1V55B 1DJSA 5HHOA 1WHPA 1CGYA 2EUXA 2YN3A 4N2OA 1AAJA 3HR5B 2MOVA 1TT6A 3CSFA 4JQXC 3OL2A 4OGXH 1V3JA 1IFHH 2JTDA 5KJRL 4FQLL 4MYPA 5C09B 3NP3A 4MMZB 2VQ4A 4IBVA 2CJUH 3D39A 4BE5A 4I77H 3EAKA 1FFTB 1DR9A 4ZUUA 3SSGA 1FVCB 2HMID 5EB9A 1ZTXL 3NRQA 2ZXEB 2A99A 2VGLM 1NCNA 4XGZA 4ETQB 2YJLA 1OZUA 1C5CL 5C08A 3VGBA 3P4NA 4NRZA 1JXFA 4LIQL 3UYRL 4CDHA 2CLZA 3DURB 2OSLB 3SDDA 1NC2A 2VKXA 5F7LB 3IFNH 3U6XS 2NPLX 1E6OH 3DV6B 4I48A 2CO6A 5E8OA 1A6AA 3T8XB 5LLIC 4YXLH 4AGPA 3WTXA 4WEMB 3L5WB 5L2KD 3SBWA 5EO9A 3HPLB 2FTAA 1RERA 3MLRH 4WI3A 4KZ0A 5AVYB 3LYRA 1XTMA 5CJOH 3ZMEA 4AQ8A 4HWZB 5KVGE 3DVNA 3EDKA 5M94B 3P4OA 2GI7A 1BWWA 1N6UA 5D5MA 4H13C 2B4CH 3GRWH 1HJCA 2X3BA 3G6DH 3P73A 2K9UA 2YAFA 2V8LA 4PLJD 3NQIA 5D1ZC 1SQMA 4B9PA 2MJWA 4EXKA 1QFOA 2VLLA 2B14A 2BJML 5L2KE 1GGBL 3QQ4B 4P8QA 4Q4EA 3MFFB 4YWGL 5EEZA 4HKJB 4F33B 5ESAB 1CF8L 3L81A 3H9HB 1CF1A 1MI5A 1PEWA 3MV8D 5FKPA 1E9PB 4GAJL 5IJCC 3KLHD 1CG9B 2VSKB 1P4BL 2VC2L 3X3GL 1NMCC 2WO2B 1HNYA 3DRQA 4U1JB 3NZSA 4E9LA 3IK2A 4WO4D 2DWEA 2CA4A 2AZUA 5A2LH 4PJAF 4POUB 4CILA 1ZA3A 3WNOA 1AS6A 1OKEA 5B8CC 4B6ZA 2FBOJ 1YPZE 4L9LA 4HQQH 3GMQA 2I60H 1HEZB 3LEXA 4D0DB 1ZXQA 1MFEL 1LE9B 5BZWA 4OB5L 2GY7B 1LNUB 1QLRB 4EN2A 1D5ZA 3GMOB 1NKGA 4WUUA 1WS7A 4Z6AT 4JFVA 1LWRA 4CC0A 5I76A 1F2XK 4N2GA 4JQIL 5AWNH 4Z3GA 4NPYA 2NQ3A 4L29B 5EBGA 1ZT4B 3WKYA 1RU9H 1XB3A 2BVPB 2J55A 4X5WA 3EJUA 3U9UA 1X7QB 2WWMC 3ZOAA 4QYOB 1XGYH 3RB5A 4YAQB 4PIBA 4XNQB 1KB5B 4YHZH 5INCA 1UADC 2EDWA 1KB3A 3RGVA 2VH5L 3Q7JA 3KPRD 4OIBA 1FYTD 4GFXA 1VESA 4JBSA 3IFOB 4YDVB 3QRFM 1MIML 1L9QA 4NOBA 4BA0A 2WBJA 4D9QD 2CLRB 1NH6A 2YZ1A 5DMIH 4ZJ9A 3ZTNH 3BZEA 3CPLA 5C07D 2YMXH 1I3GL 1HC1A 1SJMA 5EBMB 3BWAB 3B7YA 3BRFA 4WHTA 1AR1D 4OT1L 1FZOB 3Q0HA 4P23D 4IK6A 3KPOB 1QABA 4Y4KB 2GITA 4RDQF 4HKXB 1BMWA 5FHAL 2HX8A 3MGTA 4RA0C 4G82A 2WCGA 3HPJB 1G4MA 1UJTA 2XV6B 4R4FL 1EXUB 2E74C 4X6DA 5BZDA 1XGTA 1MFCH 5I8EB 3GXPA 2YXFA 4JY4A 4OFPA 1DVYA 4G9FE 5G4OA 3VFMA 3P40A 1F97A 5EEVA 2ITFA 4MNHB 4QCIB 3MROA 1GJIA 1QQDA 4XBEH 3UJIL 1K4CA 3K46A 2DDQL 4HEMA 2J12B 2KPNA 1PD1A 3HZVA 5FGBA 3EFDH 4OD3H 5LCVA 4YPJA 5E6IA 3VA6A 4R9HA 1RIHH 3P11H 3KJ4B 3HKFA 3LDBB 3O8XC 3QUML 4KFZC 5SWZD 5E6ZA 4M6MH 3ARVA 3WNJA 4IRSC 1F45A 1KPRB 1I7UB 2AVGA 2WLHA 4QXTB 3SZKC 2X44D 4TRPH 1WIPA 3I6GB 2K7QA 3QK0A 4O02H 4B3VA 3APNA 4AI7A 3ALXA 3C6EA 4OM0L 2BNQB 5D55A 4JZOB 4ZFOL 3SKUD 1KTJA 5E8PB 3PV6A 1A5FL 4NX0A 4WSGA 1JF6A 4Q2ZB 2AXHA 1X5FA 2X0WA 4YZFF 1W72A 2VIRA 2PYEB 3E3QC 1F56A 4MA1B 5AFAA 4CGTA 4OZ4B 5EOTA 1HXKA 3I02B 1B4RA 5EZJB 3QHTC 1SZNA 1YEIL 2GVYA 2BC4B 3MRLB 2DTMH 5CBEA 2PWGA 1AZZC 2YUWA 3NJFA 1HHIA 1BQUA 3OAYK 3SQBA 2E7HA 4DQOH 3GSNA 5E4EB 4G6AC 1FIEA 3SCMC 3NPSB 3ES6B 2PN5A 4WV1C 4XAWL 1E67A 3HC4H 3L3KB 3FOMA 3S3CB 5K9JH 1KYDA 2H0PA 5F3BB 1OPGL 4JRXA 1T83A 1TZAA 4MJ4A 1KBGH 4MMYB 4XB8A 1SBBA 1PJWA 5AYUH 5HGAB 3I75A 4JKKA 3HNTH 3SODB 4PJ9B 1D7BA 4PV9B 3QG7L 2QADC 4HH8A 3QZBA 4HALA 4W4NA 4Y1TA 4X4ME 1SN5A 5I0XA 1JV5A 3C60B 3LN4B 4LRNH 1QVOA 1A4CA 1KGYE 1TYEB 3HN3A 2XJKA 4NP4L 1A14L 3LRKA 2P44B 1DUYB 2CJTA 4XP4L 2P80D 3PHQB 1V3LA 4G6JL 4DO4A 2GTWA 3IJ9A 3LZPA 4LAQH 2XHNA 4XMVA 3TWCL 1HE8A 4AL8H 3FU9A 2DEWX 3QIWA 1TZIA 3GIZL 4P4KC 3T0EB 3BX7C 3PUCA 4UZGA 1AO7B 3K2MC 1S2EA 2EVHA 2XQYK 2ZCLL 5TH2B 2CRIA 1B9ZA 4FMVA 1H15B 3T0XA 4P5TA 1QBBA 3MRGA 3KLLA 5CLZA 3A3YB 3FU0A 3UTPD 4LPXA 4LLVB 2VZ3A 5B3NA 1E3XA 1JGUH 2Y1AA 4B9KC 3QNFA 4PRPE 5FC9A 2X40A 5LVEA 4LLWB 2PXYA 1JWUA 4NDMA 4UV4H 1E5BA 3WSQL 1UM6L 5KSAA 3QP3A 4Y8AA 1XR8A 3P2DA 4LAJH 1NCCH 1M6UA 1URIA 1OV8A 1RMFH 4PN6A 3UTSE 4H2CA 4AGOA 4AM0Q 4Y19E 1E5UI 2GJ6A 1LO0L 2V5TA 4HT1L 1OB0A 3D2UA 2QVTA 3DSFH 5BZZA 1U4FA 3QDMB 4HJJL 3DVFA 3O3EA 4BZ2H 3VWJC 1HDMA 1K9TA 1RIVL 1I8MB 2A7BA 4NWTH 4B50A 5FHBH 2OCJA 3QEHB 1CXHA 4WEUD 4IEFA 5MP6L 1N6QL 4QHLB 2GK2A 4MB4A 3GI9H 5CO1A 3II1A 3RA7H 3I2CH 3CH8A 3V4UH 3U4AA 2VM3A 2Q9OA 1P2CB 3ILPA 2Q5BA 4U7KA 4MJ2A 3W37A 3F00A 4WU7A 1ZS2A 1UFGA 2O5ZH 2K7PA 4NQUA 3GHEH 4J23A 4UQAA 1H8SA 1CICD 4Y5YA 5E5LA 3DX2A 4EI5A 4XNDA 2ZAGA 4GY4A 1R0AL 1VKXB 2Q86B 1J0JA 2W9EL 4LPVA 3V52L 1CE1L 3WIHL 3AT0A 4TQEH 5IHUL 4ZS6C 2X88A 3JTTA 4I3SH 3U2JA 2UY6B 5ENWA 4Z5RB 4JPKH 4OF5A 4U33A 4H8UA 3WFCH 1NCDL 5C9JA 1M6OB 1QAWA 2WZPD 2OTPA 4F57L 1F1AA 3HI5H 2XWJB 1MCQA 1RP9A 4OCYL 3UIZA 5MERA 3EFFB 5DVMA 5ITFB 1YY9C 5JA9A 3EYOB 3GF8A 1P5UC 2R4RL 2XNAB 3BSZH 3K6OA 3L95B 4Q9QL 2V2TA 3CQFA 1I9EA 2GIXA 5K39B 3MX0A 1F6LL 1M53A 5K9QG 4M3KB 4ZMVA 2YOCA 3T0AA 5KVDE 4LKCA 2X1PA 4HFUH 2PCPB 3G5YA 1X5AA 4EN3C 3TIDA 4Q6IA 3FUDA 3ARBA 1EVTC 4GMTL 1A3LH 2DTSA 3MR9B 2WIIB 2W07A 3IU4H 4P5MB 1JNHB 4PG2C 3FTVA 3BUYB 5IM7B 3GM0A 3NA4A 1MHHA 1QLEL 2GKIA 2H7WA 2BSSA 2MWCA 4L4VB 4YDIL 2DQCH 4YE4L 1A7QL 3VXRE 2EVFA 2BVTA 4N6QA 4K3JL 2C4FT 3MRPA 4L8DA 2ITDA 4PG9B 4X7TA 1AQ8A 3K91A 1ZLWK 5GXBB 1NZRA 1J12A 3HBGA 4YHPB 2ILLA 2FB4L 2QV4A 3NCYP 1XGPB 5GJTL 3BVNB 1JV2A 4P2QA 2O5YH 4UZUA 2QBWA 5FV1L 4JO3H 5K9OA 4U0RC 1SJHA 3CN2A 4GUPB 2BSTA 2D3LA 3TNNA 4JDTL 4JG9A 1S9WB 1EZUA 4EF3A 3BQUB 1OGAE 1C16A 1H5BB 3W2DL 3DIVA 1ML0A 3SKJL 2MHAB 3I6LE 4GW5A 4EO5A 5D6CA 2KLRA 1INEL 1XD0A 3PREA 5D7JB 5KUKA 2NXYD 4FCHA 3VM7A 3D87B 4YQXL 5D1XC 3U30B 4XHJC 4JFOB 2UY7B 1D6EB 1T1WA 2F8IA 1XD1A 1MCHA 1QHPA 1X5ZA 2ZUWA 3BLPX 1IEAB 4KROC 4ONFL 4Z7VB 5EZIL 4JE4B 2NUTA 5I6NA 1QRNE 1DLFL 1L7IL 4KJQC 5TGBA 1ET5A 4JZJC 2FBJL 4MB5A 3RIFF 2X4QB 4AV4A 4YJZL 3BO8B 3CZGA 1KJ2H 1LO3L 2N7BA 3ZHNA 3P9WB 3IAQA 1N19A 3FFDB 2GJZA 2XBTA 4LHUA 4XVTL 3SZ6A 3FN0L 2JWYA 4OCSL 5K5YA 3FT4B 3INUL 5CHNA 2NTFB 5CN3A 1D9KD 1PW3A 5HDRA 4Q6YA 4Z7WF 2YR3A 1RY7B 2A4ZA 1FRGH 5DSCB 5JUEH 2AJVH 1OGSA 1I1CA 1JNLH 3TJH