2OAWA

Structure of shh variant of "bergerac" chimera of spectrin sh3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and thermodynamic studies of Bergerac-SH3 chimeras.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 12
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2oawA00
1M30A 2D8HA 3NGPA 1TUDA 1K1ZA 1UG1A 1BU1A 3H0IA 3QWXX 4J9EA 2D0NA 2GTJA 2DNUA 2JW4A 1T0HA 2DLPA 2RQTA 1KSWA 2YUOA 2E5KA 4CC7A 4AFSC 2O2OA 1UJ0A 5FW9A 1ZUYA 2O31A 2ED1A 1QWEA 3NPFA 1ZX6A 2C0TA 1GFCA 1PNJA 2BTTA 3I5SA 2DL4A 4WCIA 1M27C 2AKKA 2DJQA 2HCKA 2CH4W 3QWYA 4HXJA 2RQVA 1VYTA 2HEQA 2CT3A 2O9SA 3I9QA 3PE0A 1ZUUA 2J6FA 2KYMA 4J9FA 1VYVA 2J05A 5FWCA 3EGUA 2BZ8A 2M0YA 3EG3A 2GTOA 2MCNA 4D8DA 2L0AA 2L3SA 2LJ0A 1KJWA 5L23A 2YUPA 1YWPA 2OI3A 4JZ4A 1JXOA 2FRYA 2J7IA 5GJVB 1LCKA 2J6KA 2KNBB 1GRIA 3FJ5A 2RN8A 1OPKA 1HD3A 2DL3A 1PRLC 3UA7A 2G6FX 2P4RA 1K0SA 1T3LA 3A98A 1UJYA 2FPEA 1WIEA 4RTZA 1G2BA 1AZEA 1OV3A 2FRWA 3VS6A 3H0FA 1KFZA 1G83A 2ABLA 3VRYA 2M51A 2JM9A 1E7OA 1MUZA 1SRLA 2DL8A 2W0ZA 2NUZA 4LUDA 2JM8A 1H92A 1T0JA 4EIKA 2RMOA 2KT8A 4HVVA 1VA7A 3EG2A 4IIOA 2A37A 1KIKA 1OEBA 2PZ1A 1E6HA 2K2MA 1M3BA 4Y92A 1AOJA 4HVWA 2FPDA 2MOXA 2D1XA 3REAB 2DE0X 3SHWA 2PNIA 2X3XD 1YCSB 1UHCA 3VRZA 1T3SA 1PKTA 3RNJA 2KRMA 2D8JA 4Z89A 1YP5A 1N5ZA 2DA9A 2KROA 2DRMA 3H0HA 5I22A 4RTWA 2V1RA 4AFUC 2J6OA 1U06A 2FEIA 1SRMA 1VYUA 5IHIA 4OMPA 1RLPC 1Y0MA 1AWWA 1RUWA 1MV3A 2CSQA 1I1JA 2VVKA 4J9GA 1EFNA 4CC3A 2LQNA 4J9DA 3ZL7C 3EHRA 1CSKA 1WA7A 1CKAA 4IIMA 1M8MA 1PKSA 4F16A 2CREA 1SSHA 2EYYA 2DL7A 2KE9A 2RNAA 4LNPA 3IQLA 2KGTA 1B3QA 3ULRB 2KEAA 1WXUA 1JO8A 2K9GA 2K7AA 2ED0A 5I11A 1CKBA 2I0NA 1FMKA 3UATA 3VS0A 2FG0A 1NEGA 4J9CA 2FPFA 1ARKA 1K9AA 2GGRA 4LE9A 4OMMA 3RBBB 1W70A 2L3QA 3UA6A 1YWOA 2VKNA 2LCSA 3M0SA 3I35A 2KRSA 2DMOA 1PWTA 1BK2A 2BZYA 2X3WD 1J3TA 1AWXA 4ZNXA 1NM7A 2GBQA 1AWOA 1X2QA 2H8HA 1UECA 5EC7A 4FSSA 1H8KA 4OMLA 2SEMA 1IO6A 2YDLA 1Z9ZA 1WI7A 1WDXA 2DRKA 2GQIA 2KRNA 1WX6A 2L2PA 2JS2A 1ABOA 2RQRA 1WXBA 2EGCA 1JU5C 2L3PA 5IHKA 1NEBA 2HSPA 1AEYA 2K3BA 3M0QA 4OMNA 2RPNA 2A36A 1V1CA 1Z9QA 1W1FA 2ROLA 4JJCA 2ESWA 2EPDA 2F2VA 1UGVA 3M0UA 3TSZA 3VS4A 1I07A 2DBMA 2HBWA 4GBQA 1AWJA 2F2WA 2AZVA 2EKHA 4OMOA 2V1QA 2XMFA 4RUGA 3PVQA 4ESRA 1OOTA 1HSQA 2EQIA 1X69A 4KRTA 1X27A 1M3CA 1BB9A 2O88A 1HJDA 3KFVA 1GBQA 1I0CA 2EBPA 4RTTA 2DYBA 3VS7A 1JXMA 1NLPC 1X6GA 1BBZA 4RTXA 1MV0B 1X6BA 4X1VA 4AG1C 2RQWA 1JQQA 1PRMC 1X2KA 1YNZA 5GJWB 2EVRA 2A28A 1AD5A 2PTKA 2OJ2A 1UHFA 1X43A 2JMCA 3THKA 3GBQA 3M0RA 1JEGA 2CDTA 2CUBA 1SHGA 3JV3A 2K79A 3VS3A 2MIOA 4JJDA 1ZUKA 1M3AA 1WYXA 2J06A 2JXBA 4J9IA 2ROTA 1U3OA 2CSIA 2HDAA 3SEMA 3VS5A 1OPLA 1WFWA 1Y57A 1K4US 4CC2A 2DBKA 4J9HA 2EYZA 4JJBA 3PVLA 3EHQA 2EGEA 5FWBA 2SRCA 1UDLA 2DM1A 3REBB 4Z88A 2RF0A 3O5ZA 1ZLMA 5IH2A 4F14A 2FO0A 5IXBA 2KXDA 1W6XA 1FYNA 1SPKA 4F17A 3UF4A 4DEYA 2YUQA 4AG2C 1GFDA 4JZ3A 2YT6A 3H41A 3VS2A 1SEMA 2RQUA 3VS1A 4RTYA 1WLPB 2DF6A 2C0IA 1H3HA 2A08A 4LN2A 2LJ3A 2YSQA 4QT7A 2LX7A 2BZXA 2LNHB 1XOVA 2LMJA 2DL5A 1YN8A 4J9BA 2CH4A 4GLMA 2EW3A 2QDLA 4OMQA 2F2XA 1AZGB 4HVUA 3I5RA 2EYWA 1K76A 1RLQC 1QKWA 2ECZA 1ABQA 1PHTA 1K0XA 3EG1A 1NYFA 3U23A 2DILA 3C0CA 4A63B 1RI9A 1GCQA 2K6DA 1UUEA 3TVTA 2GNCA 3TSWA 1S1NA 1QKXA 1UTIA 4RTVA 5HCKA 1GBRA 4AFQC 3M0PA 1ZBJA 1NG2A 2JMAA 1UFFA 1B07A 1SHFA 3R6NA 4M4ZA 1GCPA 4Z8AA 2JTEA 1NYGA 3CQTA 2AK5A 2LQWA 2JT4A 2KYBA 2DX1A 5IXFA 2KXCA 4ORZA 2EYXA 2LJ1A 2AKLA 4DEXA 1U5SA 2JS0A 4HCKA 1UE9A 1WXTA 1AVZC 2YUNA 4K11A 2C0OA 3NMZC 3EG0A 4R0KA 1ZSGA 1NLOC 1GCQC 3NHNA 1QCFA 4E6RA 2KR3A 2VWFA 2KBTA 5IHNA 1QLYA 2NWMA 2AZSA 4D8KA 2DVJA 4CC4B 2KT1A 4LUEA 3M0TA 1TUCA 2LP5A 3LH5A 1E6GA 1A0NB 1QWFA 4JPBW 5ECAA 1GL5A 2W10A 1TG0A 2ENMA 2EGAA 2O9VA 4RTUA 2LZ6B 2CUDA 2IIMA 2OAWA 4AFZC 2B86A 2CT4A
chains in the Genus database with same CATH superfamily
4GY5A 3NGPA 3CCSQ 1K1ZA 4M7AC 3BDUA 4BUGA 1V76A 2D0NA 3C12A 2JW4A 1T0HA 4ZGEB 3CCQA 4DOWA 4CC7A 3MKDA 2DPPB 1UJ0A 5FW9A 1I4K1 2HKNA 1KC8C 2VYTA 3NPFA 2C0TA 1GFCA 3DLLA 1S72A 2MWOA 1SKUB 2AKKA 3JCMc 1PSEA 5GANh 2EYQA 2RQVA 3G6EA 4FT2A 4PLLA 2JJ9A 1RI0A 2J6FA 1WJSA 1VQKQ 5A2QE 2DD5A 3FEOA 2VXEA 2MI6A 2M0YA 3HRTA 5J3BA 3G7ZA 1RAIB 5DLOA 3PFSA 2KDSA 3AHUA 3CMET 3QPHA 5FRNA 5HY6A 4M77D 6AT1B 2YHTA 4BY6C 4A4KA 5A0DA 1BI2A 1JXOA 2OTLQ 4ATOA 3NFCA 2KNBB 1GRIA 1VQLT 3SB2A 2RN8A 1K0SA 1PRLC 2EWNA 4D6WA 3QJ6A 1Y71A 3A98A 2FPEA 1X01A 1K9MU 4RTZA 3CMAT 2QQBA 1OV3A 2ZCFB 4A4FA 5IT9E 1G83A 2ABLA 1IHWA 1D1CA 1E7OA 1SRLA 5GAMh 2W0ZA 2Y4XA 3UWNA 2PUOB 3JB9H 1KC8U 2JM8A 5GANe 4M78E 3R6OA 1G5VA 3QBYA 2DYIA 2E3IA 3G71Q 4HVVA 1VA7A 4FCYA 2A37A 1OEBA 1M3BA 2FPDA 4M77B 3REAB 2H3EB 4LDUA 4QVDA 1YCSB 2QQSA 3G4SA 4C92E 1WHMA 3HRUA 1Q86R 4J8OA 1YI2Q 2D8JA 1YHQQ 4Z89A 2HSEB 1YP5A 1N5ZA 1M1GA 5KYNA 2NUPA 2DRMA 4C8QC 2EKOA 1IREB 4RTWA 2V1RA 1B7TA 2RH2A 1IGUA 1U06A 1YIJQ 2DXCA 1KG1A 4OMPA 1AWWA 2LQ8A 5EG2A 2LT4A 4DBHA 1TWBA 1WA7A 3GF5A 1M1FA 2ZZDA 2KE9A 2DL7A 1K9MR 4LNPA 1Q95G 3IQLA 2KGTA 3EG9A 2KEAA 1ZHIA 4IURA 1JO8A 3S6WA 4C0ZA 2XDPA 1WHLA 2K3XA 4PJOE 2I0NA 8AT1B 2NLUA 3L2ZA 3UATA 2GCXA 3VS0A 5KYUB 2FG0A 4C92C 3JCMP 1NEGA 2FPFA 3QIIA 1W2BP 4PL6A 4LE9A 1D0YA 3RBBB 2MAMA 4Y28E 2EQJA 2OAUA 5J26A 1QVPA 1PWTA 4JRQA 2BZYA 1J3TA 1YCYA 5AT1B 1NM7A 2GBQA 1X2QA 1UECA 1H8KA 1B34A 1IO6A 1M1KU 2QQAA 4EDUA 1SSFA 1WZOA 3S3OA 1VQPA 2RQRA 1Q7YC 2CZ6B 5IHKA 3OA6A 1Q82C 4OMNA 2RPNA 3G71A 3OYYA 1V1CA 1MGQA 2EJGA 3OS1A 4PJOF 5CKHA 3UDCA 4B6MA 3QDRB 3GPLA 1O9SA 2ESWA 2EPDA 4JRKA 3VS4A 1WNLA 4X34A 4UC4A 5LJ5g 1VQNA 1AWJA 3X24B 2EKHA 4OMOA 1H3ZA 3CCUA 4FYWB 1M2OA 1X69A 1M3CA 2DK3A 3CMEA 1I0CA 4KBMB 4PFOA 4HT8A 4RTTA 3VS7A 1MV0B 3V8KA 4AG1C 1JQQA 1N6AA 3G4ST 4E7IA 2A28A 5D6WA 2PTKA 2OJ2A 5GAOn 1UHFA 1X43A 3EH1A 1JEGA 3OYKA 1N9SA 3VS3A 5C0MA 3SD4A 2DEUA 4M7DG 2JXBA 3G1JA 5FU6C 2MPXC 2KY9A 1U3OA 1KC8R 1KD1U 3OS5A 3QKJA 4RKUE 4A54A 1WQ7A 2HQHA 3JB9I 4XTZA 1K4US 2DBKA 3OYBA 4JJBA 3PVLA 2LNVA 3EHQA 4M7AG 3MEUA 5FWBA 1UDLA 3REBB 4Z88A 3P8HA 3V8JA 4M75E 3OY9A 4KH0B 4II1A 4F7UA 3OS2A 1KQSS 2FO0A 5IXBA 3L42A 3VUBA 3JSCA 1W6XA 3MEVA 1IXDA 3EGDB 2X4JA 1GFDA 4Y91A 3RR6A 2P0PA 3ZBDA 4IUPA 3J80E 4JZ3A 4LXCA 3H41A 1FMVA 1RACB 2E64A 3CPWP 3HFOA 4O5VA 2A08A 2RB6A 5GAN7 4M78G 2YSQA 2LX7A 7AT1B 2LNHB 1K9MC 3FIFA 3META 5KYWA 3L2VA 3JCMW 3GIBA 1AZGB 4HVUA 2DETA 3CCVQ 1QKWA 1VQ9A 5KE2A 1Q81R 1PHTA 1VQOT 3CD6Q 2P4TA 3EG1A 4DQ2A 3OYGA 4QKUA 3C94A 4IUUA 3SWNC 1RAFB 3V7SA 4PJOD 1VQ8A 5CK9A 1RI9A 2K6DA 1UUEA 3CCSA 2GNCA 2KK4A 2YXYA 2QGFB 1YIJA 4MDWA 1TU0B 1ZBJA 1NG2A 5IN1A 2JMAA 1UFFA 1B07A 3GLXA 4Z8AA 1NYGA 3CQTA 3M57A 4FSXA 3QG1A 4BE1A 4C0DC 2MK5A 4ORZA 2LJ1A 5AYFA 1WPYA 4XU2A 2RHIA 1WXTA 1VQ8T 3M5AA 5KYWB 4K11A 3EG0A 2HL5C 1FWZA 1WJRA 4PJLA 1BI3A 1O75A 1GCQC 3CCRQ 3NHNA 2XD0A 2CP7A 2FZCB 4JJNK 2KR3A 4NOYA 5CKDA 3S3MA 2VWFA 4C8QE 1I8FA 3JCMh 5IHNA 2KSSA 3Q1JA 2QQRA 1QLYA 4D8KA 1XTDA 1GXIE 1Q82U 2ZPEB 1KQ1A 1N8RU 1OZ2A 4JRPA 3WVEB 1GL5A 4MMLA 4HA8A 5GAOl 2LZ6B 1LPLA 3OS0A 1KHCA 2OTLA 2OTJT 2DEQA 1C0MA 1UEBA 1M30A 1PD0A 2EQUA 4HCZA 1TUDA 4C8QB 3OSVA 1UG1A 3H0IA 2DNUA 1KK7A 2JVVA 3EGXB 3JCMf 2M16A 5DM7R 2E5KA 4JUVA 3CCMQ 1OYXA 4RMOA 2O31A 2ED1A 4E7ZA 1W2BA 1Y96B 1QWEA 1N9RA 3EFOA 3FLGA 1YJ9T 2ATCB 4FYXB 3JAME 4KGVB 5DLQE 4BE0A 2E5QA 4WCIA 2DJQA 2WSFE 4HXJA 1VQMT 4C0DB 2R5MA 3CC2Q 2CT3A 1QCNA 3EFSA 5FWCA 1VYVA 3OYJA 4XQ3A 1VQ5Q 2DKGA 3OMGA 3J7AF 2VGMA 2BZ8A 5GAOp 2EIFA 2MCNA 4D8DA 2VASA 1QCOA 2EJFA 3VYGA 1KJWA 4M77G 5CVIA 2K5IA 5L23A 5GMKe 1H641 1YWPA 3JB9G 2OI3A 3JRZA 2DXUA 3L2RA 4M7AA 3DLMA 4B9WA 2FRYA 4LDWA 1LNXA 2D9TA 1OU8A 2J6KA 5FU6B 4A4GA 3FJ5A 1G3WA 1ZSZA 2LCCA 2GQVA 4C5GA 5LJ5e 1RAHB 1PM3A 2HMAA 5GAN2 1AZEA 1ZA1B 4HCCA 3VS6A 3OBYA 2DTHA 3E19A 3CC4A 1D0XA 3VRYA 2JM9A 1MUZA 4OVAA 3X20B 4M7AE 4M78A 3CCEA 1VQNQ 5I2MA 2L8DA 2JNGA 1T0JA 1G3SA 1FXXA 4J6XA 1S72Q 1KIKA 2PZ1A 1E6HA 2K2MA 4Y92A 1LOJA 1AOJA 4HVWA 2MOXA 1OULA 3VYHB 3G6ET 5IAYA 4QQDA 1BIAA 5FLXE 2X3XD 3CCLQ 3HRSA 1UHCA 3BE3A 1VQ5T 3EAEA 3RNJA 2KRMA 4EMHA 1TTHB 4A4HA 4BY6B 3OYMA 2F1LA 2F5TX 3H0HA 5I22A 3OYIA 4XU0A 3CC2A 4AFUC 3QXEB 1NJIC 2DERA 1RLPC 2E3HA 1V29B 1I1JA 3JCMg 3EHRA 3CCQQ 1CKAA 1PKSA 4KT0E 4MMKA 1M90U 3RDVA 5LL6S 2RNAA 2M1HA 3P8BB 2NUPB 2CP5A 3ULRB 3CCVA 1KHIA 5LJ3h 3LW5E 4OMFB 2XG8D 4M7AD 3TQ7P 4E7LA 4F7UG 3CCJQ 4M75D 5GMKi 3FRNA 1N8RC 4EMKA 4J9CA 3X25B 2RHZA 5HK0A 3JB9F 1X6OA 3LGFA 2H3JA 2VV5A 4M7AF 1XJWB 3M4YA 2JTMA 5A0LA 4C5EA 3UA6A 1YWOA 2VKNA 2BE9B 4VUBA 1KD1R 3PMTA 4FW2A 1AWXA 1AHJB 5EC7A 5HK3A 4FSSA 2SEMA 3CCRT 2YDLA 1RAEB 1Z9ZA 2KRNA 2A7YA 2L2PA 1F1BB 1YHQT 3HPWA 1QP3A 5LJ5d 1K8AU 3CCEQ 3QO3A 1WXBA 2AHJB 1JU5C 1NEBA 2HSPA 2COWA 4LD9K 1AEYA 3M0QA 2R58A 3LH0A 2NUTB 1Z9QA 2ROLA 3RMQA 3EFRA 2DJZA 4QW2A 4JJCA 4Q5WA 2F2VA 1UGVA 3TSZA 1YJNT 3JCMd 1M90R 4QQ6A 3MHXA 1KQ2A 1MMGA 1RAAB 4DBQA 4OGCA 4RUGA 4ESRA 2VC8A 1OOTA 1HSQA 1BCOA 3BDLA 4C92G 1X27A 1BB9A 2O88A 4LDVA 3KFVA 4XTXA 1MNDA 2DYBA 3QYGB 1JXMA 1X6GA 1BBZA 4HKEA 1MMDA 4BI8B 4X1VA 4JLGA 2DVEA 2LVMA 2OTLT 1X2KA 2ZPBB 4M78D 4RG2A 4PKCC 2EVRA 1AD5A 5CKBA 2GFUA 3EGXA 3OYEA 2JMCA 3M0RA 3JV3A 3CCLT 3WXMB 1K73R 3OSSC 4JJDA 3TU4K 3MJXA 2J06A 4C92F 3UPUA 2VGNA 3VS5A 4WF2A 1OPLA 3L2QA 5LJ3g 4ELYC 1RADB 1M1KR 3H8ZA 4CC2A 4PJOG 2DZCA 1YFNA 4M77E 2L5QA 1VQ6T 3CCJT 1D1AA 2SRCA 2RF0A 2K2VA 4PK4A 1LJOA 4R56A 5GMKl 3CC7Q 1IGQA 1Q86U 3INZA 3UF4A 4DEYA 2JZ2A 3TREA 4F7UF 1WGSA 2RHXA 3ME9A 1XNIA 3VS2A 2RQUA 4M7DB 3VS1A 3OYFA 3TCJA 1WLPB 1M5Q1 2QASA 1IB8A 1VQ6A 3WVDB 4LN2A 2BZXA 1XOVA 4J9BA 2DL5A 1YN8A 3MO8A 2RHUA 3A8LB 1HYOA 4GLMA 2EW3A 2PVGB 2QDLA 4OMQA 3CC7A 2F2XA 5GAN5 3H6ZA 3E1SA 1OU9A 2EYWA 4X9DA 4ZTFA 5GANj 1RLQC 2BIVA 2ECZA 4ZGJB 2P0QA 1VQPQ 1NYFA 4OB0B 1TOVA 1VQMQ 4C8QA 3TSWA 2K4YA 2WACA 1K73C 2CP2A 5HCKA 1JJ2A 4AFQC 1KD1C 2EAYA 2VB6A 5FRMA 3R6NA 1SHFA 2HD0A 2LT1A 3E9FA 4M4ZA 5GAOr 2RA2A 3VKIA 5IXFA 1Q86C 2XDBA 4N4HA 1C6VX 5GAOm 4DEXA 1U5SA 3PGGA 4HCKA 1PSFA 1VQMA 4PNOA 3OW2A 3CPWS 3CBPA 2C0OA 4R0KA 2RM4A 5GMKh 1NLOC 1QCFA 4E6RA 1QVFP 2KBTA 4Z02A 2CS7A 3N5BB 5GAMj 2XDDA 2AZSA 1M90C 4CC4B 3A1PA 4LUEA 2KI7A 2EQMA 3M0TA 4N4GA 2LP5A 2XK0A 5FU7B 1VQ4Q 1E6GA 4N0AA 2COZA 2VUBA 1TG0A 2ENMA 2PUKB 2OAWA 2MF2A 3X28B 8ATCB 1YBYA 2O4XB 1YITA 3T9NA 4PJMA 2L89A 1BU1A 1JB0E 1IRXA 3QWXX 1M8VA 1YHQA 4ZN3A 2GTJA 3ASKA 4M75C 1OX8A 2RQTA 2QEXQ 4AT1B 1KQSA 2YUOA 3CCUQ 2O2OA 1RABB 2M02A 3OYNA 3G4SQ 2PVDB 1ZUYA 2HKQB 4JS4A 1ZX6A 1PCXA 1PNJA 2BTTA 2RK1A 2DL4A 3LGLA 4BB7A 1M27C 1G3TA 1UGRB 2CH4W 3G71T 2HEQA 2MYSA 2CP0A 2QTVA 4GLKA 3V7RA 3PE0A 4M7DA 1UGQB 4C0FA 2V8KA 1D3BB 1Q7YU 1ZUUA 4DBFA 2J05A 3EGUA 5CO7A 1ZSZC 1HK9A 4M7DF 1WQWA 3M53A 2LCLA 2BE7D 9ATCB 3RKYA 2DXBA 2CKKA 2DXTA 2P0KA 2L3SA 2CP6A 3PIPA 1XQHA 4OB1B 2NYSA 1VQ8Q 1MHNA 2YUPA 2CP3A 2NUTA 4KULA 1LCKA 5D6YA 1QVGP 5KCOA 1OPKA 1HD3A 2YRCA 2DL3A 3SWNB 3UA7A 2P4RA 3HSBA 5FROA 1T3LA 4PFPA 1WIEA 5D7UA 4J83A 1D1BA 4DOVA 4KH1B 1KFZA 3JCMb 1AT1B 3GNGA 4C8QG 2YLCA 4RG8A 1Q81C 3NTIA 5GAN6 2EQKA 2NUZA 4LUDA 5A0GA 4EIKA 2RMOA 3CXCA 2KT8A 2IVWA 5C6SA 3EG2A 4IIOA 2EFIA 2FZGB 1VQ4T 2V8IA 2D1XA 1WHJA 1MMAA 2QDYB 3SHWA 3M4GA 2CZ1B 2I2LA 4XTYA 3I56A 3VRZA 2LRQA 1T3SA 1M2VA 3GOXA 4XU3A 1PG5B 3VV0A 5LJ3e 2E70A 3RIRA 2KROA 4KUIA 2RK2A 3A8HB 3FC3A 1VUBA 3CBMA 1NJIU 4FL6A 4HT9A 2J6OA 4PLIA 2FEIA 3OYDA 1SRMA 1VYUA 5IHIA 1Y0MA 5CIUA 1YITT 2VVKA 2PU9B 2O01E 4J9DA 4JDSA 3CXCP 1M9SA 1M8MA 4IIMA 2BUDA 2CREA 4PJOA 1SSHA 4C92B 2WSEE 4BI4A 2KMTA 1B3QA 1Q81U 5LJ3d 3LWHA 3LLRA 2K7AA 2ZAEA 1BI0A 2R5AA 3A8GB 1EZZB 4M77A 1CKBA 4LDYA 2X51A 4E7JA 1ARKA 1K9AA 1JRIA 1MMNA 4PJNA 1VQ6Q 4F04B 1FMWA 2LC4A 1M4ZA 3M0SA 1IHVA 4P5NA 2KRSA 1PD1A 1TH7A 1BK2A 4BI3A 1VQOQ 4ZNXA 1AWOA 2H8HA 4BD3A 4PJOB 2QA4Q 1WI7A 2DRKA 1YJWA 4XTVA 3JB9J 2JS2A 1ABOA 2Z0WA 3CCET 4JRIA 2EGCA 2A0FB 1OI1A 2A36A 4MDXA 2E65A 3CCMA 1RAGB 1N27A 2QQ9A 3M0UA 3QUIA 5CCAA 1YJ9A 1UGPB 1I07A 5GAMe 1D3BA 2HBWA 4GBQA 2F2WA 1M2VB 4KGXB 2AZVA 1WHGA 2V1QA 2XMFA 2GF7A 1BIBA 2EQIA 3RKXA 3OYCA 2KAFA 4CRIA 4FT4A 1P92A 5GAMg 1VQ9Q 2GFAA 1HJDA 1GBQA 1WHKA 1NLPC 4RTXA 1X6BA 1D0ZA 2RQWA 1PRMC 1YNZA 4J7IA 5GJWB 2RJDA 1G8XA 2XHCA 2CDTA 2CUBA 2XKOC 1SHGA 3AT1B 3EFOB 3GBQA 3L2UA 1M3AA 2Y90A 2M0OA 4EPCA 4IUQA 4M7DD 2QA4T 1OX9A 2O4XA 3CCRA 2CSIA 3M58A 1SF9A 2ZPIB 1VQKT 2RHYA 2X4YA 1WFWA 1VQNT 3KUFA 1QVFA 4F7UE 2QYZA 3VJPA 3JCMX 3HL8A 4J9HA 2ZPHB 1VQOA 2MWPA 5KYYA 3X26B 4XTWA 3CD6T 4BACA 5IH2A 2QA4A 4C0GA 2LQKA 1FYNA 1SPKA 4F17A 4QQGA 2AIRB 2YUQA 1W2BS 3HTRA 2YRDA 1VQLQ 1NJIR 3V7CA 4R55A 3HP9A 3LX7A 4FM4B 2YT6A 4C5IA 2OX7A 3CMAQ 1JJ2P 2E12A 5GANf 1H3HA 4DA4A 3QHSA 4QT7A 5CKEA 4A4EA 3RMSA 2LMJA 5GAMf 1C1AA 1YJ9Q 3CC4T 3CEYA 1Y96A 4EMGA 2CH4A 1UB4A 4B9XA 2C06A 2PQWA 3MCAB 3CC2T 3I5RA 1K76A 1VIFA 2DZ9A 2HBPA 5GAN3 1VQLA 2RI5A 2IPOB 4J6WA 5KH6A 4KUDK 4TVRA 3L1AA 5LJ3f 3C0CA 2ZGWA 1TUGB 1GCQA 1K73U 3OW2P 1QKXA 4J7FA 1VQ5A 3A8OB 1GBRA 3JCMQ 2K3YA 4MZPA 2FHDA 2A3LA 2AK5A 2HQEA 2JT4A 2DX1A 2RD1A 4PJJA 4M7DC 2JS0A 4ZGDB 2MMPA 1AVZC 4E7HA 4C8QD 3URGA 3G6EQ 1Q82R 2DAQA 4LD6A 3EGDA 1VQ9T 4AMCA 3EH2A 1R0CB 1BI1A 3CC4Q 2DD4A 2QK0A 2ZPFB 3OB9A 2JTFA 2NWMA 2XI9A 4E7KA 3I55T 2DVJA 2KT1A 3LH5A 1NBEB 4JPBW 3OQ5A 5GMKj 2W10A 4FU6A 2K5FA 3OMCA 2EGAA 2RJCA 4NS5A 4M77F 1Y07A 3PTAA 4RTUA 3RKWA 2CUDA 2IIMA 4AFZC 4IUTA 1EX4A 2B86A 2DO3A 1R8OB 2X4XA 3CCST 4FIBA 1N8RR 2D8HA 1R0BG 3CMAA 1VQPT 5I2SA 1YJWT 4J9EA 1VQ7Q 5KYXB 4RCBA 2DLPA 1KSWA 4L6V5 4IUVA 4AFSC 2CYZB 5LJ3j 2HNIA 3I5SA 4ELZC 5L8RE 2HL3A 4J6YA 2FZKB 4PFZA 2HCKA 2X9HA 3QWYA 4L59A 2P84A 1VYTA 3C95A 4NL3A 2O9SA 3I9QA 1YI2T 3P8DA 3TEEA 4M75B 2RJEA 2KYMA 2CZ0B 1HXDA 4J9FA 3S3NA 2E41A 2FVUA 3FJPA 1YI2A 3FDRA 2D6FA 3EG3A 1YIJT 2GTOA 3ZEHA 2K57A 2L0AA 3PT9A 2LJ0A 5KYYB 2QTXA 1ZA2B 4JZ4A 4E47A 3CBOA 3FB9A 1QW1A 2KVQG 3I55A 2J7IA 5GJVB 5KCHA 4YTLA 5KE3A 3A8MB 2G6FX 4JLIA 4V2SA 1UJYA 3GP8A 4BDYA 3M55A 1G2BA 5I21A 4BDZA 4MZMA 3M56A 2FRWA 3F70A 2V26A 4XK8E 2DTOA 3H0FA 3O8VA 5GAN4 4JS5A 2M51A 3JCMV 2DL8A 3MEWA 3OYAA 3QZ5B 1I5LA 2VXFA 3L2WA 1H92A 3OW2S 3CPWA 1K8AC 1ACMB 2RI2A 2RI3A 1QQJA 1SG5A 3RESA 1OQKA 2YLBA 2F5KA 4O6JA 3I55Q 3ER0A 3HHTB 3CPFA 1QVFS 5M9OA 2FYKA 3OBWA 2DE0X 1NPPA 4EMKB 2PNIA 5J39A 4WTOB 2OTJQ 4MZTA 1PKTA 1VQ7A 3LWIA 4PJOC 5GMKm 2DA9A 3EG9B 1YJWQ 1QVGA 1VQ7T 1I5OB 4ZTJA 4QVCA 4FYVB 1YITQ 1NZ9A 2PVOB 4LDXA 1RUWA 1MV3A 2CSQA 3UT1A 4J9GA 1EFNA 4CC3A 2Y4YA 2LQNA 3ZL7C 4EMKC 4M7DE 1CSKA 2RJFA 4F16A 1B34B 2EYYA 5FU7C 5CQYA 1WXUA 2K9GA 1NPRA 2ED0A 5I11A 4E2FB 3KBGA 1FMKA 3JB9D 2IG0A 2KQWA 1UGSB 2YWWA 1I81A 3GNFB 3LYIA 3E9GA 1VIEA 2GGRA 4OMMA 5KYUA 1W70A 2L3QA 3PIOA 2XU8A 1KQSP 2LCSA 3I35A 2DMOA 3QYHB 3I56Q 2X3WD 4HCBA 4M78B 4FYYB 1ZSZB 4A53A 4OMLA 4C92A 1BCMA 1WDXA 2GQIA 1R77A 4N0AC 4FW1A 1WX6A 4QVZA 4M7AB 3V8LA 5LJ5h 5CR2A 2QG9B 3CCLA 2L3PA 1U1TA 2QAZA 3J81E 2K3BA 2OTJA 2JOYA 4OP0A 1TS9A 2X35A 5CAIA 3PMIA 2E6ZA 1JJ2S 1W1FA 1G3YA 1S72T 2DIQA 2X4WA 4C8QF 2E10A 3RUXA 4M75A 2DBMA 3I56T 2LDMA 4M77C 1ZBXA 1ZQ1A 3PVQA 3M54A 3JCMe 3QDFA 4KRTA 3SFMA 2F69A 5GAOq 2EBPA 5DY9A 1IZ6A 2WSCE 4L5GA 4OGEA 1U1SA 5GANg 5CKFA 3CMEQ 4OB3B 3A5ZB 3CCMT 3QSUA 2JUFA 3RERA 3CCVT 4XTUA 5GAMd 4ZN1A 2ZPGB 2E1HA 5D6XA 3THKA 5KYXA 2LX9A 5GANd 2K79A 2MIOA 2K5LA 1BYMA 1ZUKA 1WYXA 2HAXA 3QZ9B 1W4SA 4J9IA 2ROTA 3MP1A 3BW1A 2RO0A 3NTHA 2HDAA 2DTIA 2LTOA 3SEMA 3SWNA 3DKMA 1YJNA 3C4SA 4XAXB 1Y57A 3H9NA 3SDZA 2EYZA 3JCMJ 4ME7A 2EGEA 2QI2A 2DM1A 3VU3C 3O5ZA 1ZLMA 3CCQT 2XIDA 4F14A 4C92D 1FX7A 5LJ5f 2KXDA 1U8RA 2FL7A 3MPUB 3NTKA 3DB4A 2M9UA 3BFMA 4AG2C 1VQ4A 1TXQA 2EJ9A 5HKCA 2QXFA 1SEMA 2QEXT 2YRVA 4RTYA 1DJ7B 1PC0A 2DIGA 2DF6A 3E2UA 2C0IA 4OF1A 2HZYA 1LVKA 4RCCA 1Y7XA 2LJ3A 3D7SB 2V8JA 2QEXA 3OYHA 4CI0C 3M9QA 2E4HA 4C5HA 2QGGA 2BKDN 4F7UB 1JBMA 2CZ7B 3CD6A 1MNEA 1TSFA 4M75G 2COYA 1ABQA 2G3RA 1X75C 1K0XA 3CC7T 2DFUA 3CXCS 3MP8A 1K8AR 3U23A 2DILA 3HKSA 2AT1B 2L3RA 3VUZA 4A63B 4OB2B 2HQXA 3TVTA 3BY7A 1VQKA 1S1NA 1UTIA 4RTVA 1WHHA 4E7SA 3M0PA 3MEAA 2B8AA 1GCPA 2JTEA 2LQWA 2KYBA 3KXTA 4X9CA 2E6NA 3CCUT 1D09B 2KXCA 2EYXA 2R57A 2AKLA 2FB7A 1QVGS 1M1KC 4XU1A 1YJNQ 1UE9A 3PNWC 2YUNA 1Q7YR 3NMZC 2D0QB 4IKFA 3M59A 4KGZB 1RL2A 1ZSGA 3DB3A 4M78C 3CCJA 2JN0A 1BKBA 1QP2A 1QMCA 3ZFJA 4J5YA 5CQXA 4ANJA 5LJ5j 4DBRA 3OYLA 3MP6A 5GAN8 4M75F 4N4IA 1EIFA 3QJYA 1VOMA 1TUCA 1NE8A 1QWFA 2XICA 1A0NB 4NL2A 5ECAA 1OZ3A 1WJQA 2O9VA 2CGHA 3HFNA 4BE2A 4M78F 2CT4A
chains in the Genus database with same CATH topology
1M30A 2D8HA 3NGPA 1TUDA 1K1ZA 1UG1A 1BU1A 3H0IA 3QWXX 4J9EA 2D0NA 2GTJA 2DNUA 2JW4A 1T0HA 2DLPA 2RQTA 1KSWA 2YUOA 2E5KA 4CC7A 4AFSC 2O2OA 1UJ0A 5FW9A 1ZUYA 2O31A 2ED1A 1QWEA 3NPFA 1ZX6A 2C0TA 1GFCA 1PNJA 2BTTA 3I5SA 2DL4A 4WCIA 1M27C 2AKKA 2DJQA 2HCKA 2CH4W 3QWYA 4HXJA 2RQVA 1VYTA 2HEQA 2CT3A 2O9SA 3I9QA 3PE0A 1ZUUA 2J6FA 2KYMA 4J9FA 1VYVA 2J05A 5FWCA 3EGUA 2BZ8A 2M0YA 3EG3A 2GTOA 2MCNA 4D8DA 2L0AA 2L3SA 2LJ0A 1KJWA 5L23A 2YUPA 1YWPA 2OI3A 4JZ4A 1JXOA 2FRYA 2J7IA 5GJVB 1LCKA 2J6KA 2KNBB 1GRIA 3FJ5A 2RN8A 1OPKA 1HD3A 2DL3A 1PRLC 3UA7A 2G6FX 2P4RA 1K0SA 1T3LA 3A98A 1UJYA 2FPEA 1WIEA 4RTZA 1G2BA 1AZEA 1OV3A 2FRWA 3VS6A 3H0FA 1KFZA 1G83A 2ABLA 3VRYA 2M51A 2JM9A 1E7OA 1MUZA 1SRLA 2DL8A 2W0ZA 2NUZA 4LUDA 2JM8A 1H92A 1T0JA 4EIKA 2RMOA 2KT8A 4HVVA 1VA7A 3EG2A 4IIOA 2A37A 1KIKA 1OEBA 2PZ1A 1E6HA 2K2MA 1M3BA 4Y92A 1AOJA 4HVWA 2FPDA 2MOXA 2D1XA 3REAB 2DE0X 3SHWA 2PNIA 2X3XD 1YCSB 1UHCA 3VRZA 1T3SA 1PKTA 3RNJA 2KRMA 2D8JA 4Z89A 1YP5A 1N5ZA 2DA9A 2KROA 2DRMA 3H0HA 5I22A 4RTWA 2V1RA 4AFUC 2J6OA 1U06A 2FEIA 1SRMA 1VYUA 5IHIA 4OMPA 1RLPC 1Y0MA 1AWWA 1RUWA 1MV3A 2CSQA 1I1JA 2VVKA 4J9GA 1EFNA 4CC3A 2LQNA 4J9DA 3ZL7C 3EHRA 1CSKA 1WA7A 1CKAA 4IIMA 1M8MA 1PKSA 4F16A 2CREA 1SSHA 2EYYA 2DL7A 2KE9A 2RNAA 4LNPA 3IQLA 2KGTA 1B3QA 3ULRB 2KEAA 1WXUA 1JO8A 2K9GA 2K7AA 2ED0A 5I11A 1CKBA 2I0NA 1FMKA 3UATA 3VS0A 2FG0A 1NEGA 4J9CA 2FPFA 1ARKA 1K9AA 2GGRA 4LE9A 4OMMA 3RBBB 1W70A 2L3QA 3UA6A 1YWOA 2VKNA 2LCSA 3M0SA 3I35A 2KRSA 2DMOA 1PWTA 1BK2A 2BZYA 2X3WD 1J3TA 1AWXA 4ZNXA 1NM7A 2GBQA 1AWOA 1X2QA 2H8HA 1UECA 5EC7A 4FSSA 1H8KA 4OMLA 2SEMA 1IO6A 2YDLA 1Z9ZA 1WI7A 1WDXA 2DRKA 2GQIA 2KRNA 1WX6A 2L2PA 2JS2A 1ABOA 2RQRA 1WXBA 2EGCA 1JU5C 2L3PA 5IHKA 1NEBA 2HSPA 1AEYA 2K3BA 3M0QA 4OMNA 2RPNA 2A36A 1V1CA 1Z9QA 1W1FA 2ROLA 4JJCA 2ESWA 2EPDA 2F2VA 1UGVA 3M0UA 3TSZA 3VS4A 1I07A 2DBMA 2HBWA 4GBQA 1AWJA 2F2WA 2AZVA 2EKHA 4OMOA 2V1QA 2XMFA 4RUGA 3PVQA 4ESRA 1OOTA 1HSQA 2EQIA 1X69A 4KRTA 1X27A 1M3CA 1BB9A 2O88A 1HJDA 3KFVA 1GBQA 1I0CA 2EBPA 4RTTA 2DYBA 3VS7A 1JXMA 1NLPC 1X6GA 1BBZA 4RTXA 1MV0B 1X6BA 4X1VA 4AG1C 2RQWA 1JQQA 1PRMC 1X2KA 1YNZA 5GJWB 2EVRA 2A28A 1AD5A 2PTKA 2OJ2A 1UHFA 1X43A 2JMCA 3THKA 3GBQA 3M0RA 1JEGA 2CDTA 2CUBA 1SHGA 3JV3A 2K79A 3VS3A 2MIOA 4JJDA 1ZUKA 1M3AA 1WYXA 2J06A 2JXBA 4J9IA 2ROTA 1U3OA 2CSIA 2HDAA 3SEMA 3VS5A 1OPLA 1WFWA 1Y57A 1K4US 4CC2A 2DBKA 4J9HA 2EYZA 4JJBA 3PVLA 3EHQA 2EGEA 5FWBA 2SRCA 1UDLA 2DM1A 3REBB 4Z88A 2RF0A 3O5ZA 1ZLMA 5IH2A 4F14A 2FO0A 5IXBA 2KXDA 1W6XA 1FYNA 1SPKA 4F17A 3UF4A 4DEYA 2YUQA 4AG2C 1GFDA 4JZ3A 2YT6A 3H41A 3VS2A 1SEMA 2RQUA 3VS1A 4RTYA 1WLPB 2DF6A 2C0IA 1H3HA 2A08A 4LN2A 2LJ3A 2YSQA 4QT7A 2LX7A 2BZXA 2LNHB 1XOVA 2LMJA 2DL5A 1YN8A 4J9BA 2CH4A 4GLMA 2EW3A 2QDLA 4OMQA 2F2XA 1AZGB 4HVUA 3I5RA 2EYWA 1K76A 1RLQC 1QKWA 2ECZA 1ABQA 1PHTA 1K0XA 3EG1A 1NYFA 3U23A 2DILA 3C0CA 4A63B 1RI9A 1GCQA 2K6DA 1UUEA 3TVTA 2GNCA 3TSWA 1S1NA 1QKXA 1UTIA 4RTVA 5HCKA 1GBRA 4AFQC 3M0PA 1ZBJA 1NG2A 2JMAA 1UFFA 1B07A 1SHFA 3R6NA 4M4ZA 1GCPA 4Z8AA 2JTEA 1NYGA 3CQTA 2AK5A 2LQWA 2JT4A 2KYBA 2DX1A 5IXFA 2KXCA 4ORZA 2EYXA 2LJ1A 2AKLA 4DEXA 1U5SA 2JS0A 4HCKA 1UE9A 1WXTA 1AVZC 2YUNA 4K11A 2C0OA 3NMZC 3EG0A 4R0KA 1ZSGA 1NLOC 1GCQC 3NHNA 1QCFA 4E6RA 2KR3A 2VWFA 2KBTA 5IHNA 1QLYA 2NWMA 2AZSA 4D8KA 2DVJA 4CC4B 2KT1A 4LUEA 3M0TA 1TUCA 2LP5A 3LH5A 1E6GA 1A0NB 1QWFA 4JPBW 5ECAA 1GL5A 2W10A 1TG0A 2ENMA 2EGAA 2O9VA 4RTUA 2LZ6B 2CUDA 2IIMA 2OAWA 4AFZC 2B86A 2CT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M30 A;  2D8H A;  3NGP A;  1TUD A;  1K1Z A;  1UG1 A;  1BU1 A;  3H0I A;  3QWX X;  4J9E A;  2D0N A;  2GTJ A;  2DNU A;  2JW4 A;  1T0H A;  2DLP A;  2RQT A;  1KSW A;  2YUO A;  2E5K A;  4CC7 A;  4AFS C;  2O2O A;  1UJ0 A;  5FW9 A;  1ZUY A;  2O31 A;  2ED1 A;  1QWE A;  3NPF A;  1ZX6 A;  2C0T A;  1GFC A;  1PNJ A;  2BTT A;  3I5S A;  2DL4 A;  4WCI A;  1M27 C;  2AKK A;  2DJQ A;  2HCK A;  2CH4 W;  3QWY A;  4HXJ A;  2RQV A;  1VYT A;  2HEQ A;  2CT3 A;  2O9S A;  3I9Q A;  3PE0 A;  1ZUU A;  2J6F A;  2KYM A;  4J9F A;  1VYV A;  2J05 A;  5FWC A;  3EGU A;  2BZ8 A;  2M0Y A;  3EG3 A;  2GTO A;  2MCN A;  4D8D A;  2L0A A;  2L3S A;  2LJ0 A;  1KJW A;  5L23 A;  2YUP A;  1YWP A;  2OI3 A;  4JZ4 A;  1JXO A;  2FRY A;  2J7I A;  5GJV B;  1LCK A;  2J6K A;  2KNB B;  1GRI A;  3FJ5 A;  2RN8 A;  1OPK A;  1HD3 A;  2DL3 A;  1PRL C;  3UA7 A;  2G6F X;  2P4R A;  1K0S A;  1T3L A;  3A98 A;  1UJY A;  2FPE A;  1WIE A;  4RTZ A;  1G2B A;  1AZE A;  1OV3 A;  2FRW A;  3VS6 A;  3H0F A;  1KFZ A;  1G83 A;  2ABL A;  3VRY A;  2M51 A;  2JM9 A;  1E7O A;  1MUZ A;  1SRL A;  2DL8 A;  2W0Z A;  2NUZ A;  4LUD A;  2JM8 A;  1H92 A;  1T0J A;  4EIK A;  2RMO A;  2KT8 A;  4HVV A;  1VA7 A;  3EG2 A;  4IIO A;  2A37 A;  1KIK A;  1OEB A;  2PZ1 A;  1E6H A;  2K2M A;  1M3B A;  4Y92 A;  1AOJ A;  4HVW A;  2FPD A;  2MOX A;  2D1X A;  3REA B;  2DE0 X;  3SHW A;  2PNI A;  2X3X D;  1YCS B;  1UHC A;  3VRZ A;  1T3S A;  1PKT A;  3RNJ A;  2KRM A;  2D8J A;  4Z89 A;  1YP5 A;  1N5Z A;  2DA9 A;  2KRO A;  2DRM A;  3H0H A;  5I22 A;  4RTW A;  2V1R A;  4AFU C;  2J6O A;  1U06 A;  2FEI A;  1SRM A;  1VYU A;  5IHI A;  4OMP A;  1RLP C;  1Y0M A;  1AWW A;  1RUW A;  1MV3 A;  2CSQ A;  1I1J A;  2VVK A;  4J9G A;  1EFN A;  4CC3 A;  2LQN A;  4J9D A;  3ZL7 C;  3EHR A;  1CSK A;  1WA7 A;  1CKA A;  4IIM A;  1M8M A;  1PKS A;  4F16 A;  2CRE A;  1SSH A;  2EYY A;  2DL7 A;  2KE9 A;  2RNA A;  4LNP A;  3IQL A;  2KGT A;  1B3Q A;  3ULR B;  2KEA A;  1WXU A;  1JO8 A;  2K9G A;  2K7A A;  2ED0 A;  5I11 A;  1CKB A;  2I0N A;  1FMK A;  3UAT A;  3VS0 A;  2FG0 A;  1NEG A;  4J9C A;  2FPF A;  1ARK A;  1K9A A;  2GGR A;  4LE9 A;  4OMM A;  3RBB B;  1W70 A;  2L3Q A;  3UA6 A;  1YWO A;  2VKN A;  2LCS A;  3M0S A;  3I35 A;  2KRS A;  2DMO A;  1PWT A;  1BK2 A;  2BZY A;  2X3W D;  1J3T A;  1AWX A;  4ZNX A;  1NM7 A;  2GBQ A;  1AWO A;  1X2Q A;  2H8H A;  1UEC A;  5EC7 A;  4FSS A;  1H8K A;  4OML A;  2SEM A;  1IO6 A;  2YDL A;  1Z9Z A;  1WI7 A;  1WDX A;  2DRK A;  2GQI A;  2KRN A;  1WX6 A;  2L2P A;  2JS2 A;  1ABO A;  2RQR A;  1WXB A;  2EGC A;  1JU5 C;  2L3P A;  5IHK A;  1NEB A;  2HSP A;  1AEY A;  2K3B A;  3M0Q A;  4OMN A;  2RPN A;  2A36 A;  1V1C A;  1Z9Q A;  1W1F A;  2ROL A;  4JJC A;  2ESW A;  2EPD A;  2F2V A;  1UGV A;  3M0U A;  3TSZ A;  3VS4 A;  1I07 A;  2DBM A;  2HBW A;  4GBQ A;  1AWJ A;  2F2W A;  2AZV A;  2EKH A;  4OMO A;  2V1Q A;  2XMF A;  4RUG A;  3PVQ A;  4ESR A;  1OOT A;  1HSQ A;  2EQI A;  1X69 A;  4KRT A;  1X27 A;  1M3C A;  1BB9 A;  2O88 A;  1HJD A;  3KFV A;  1GBQ A;  1I0C A;  2EBP A;  4RTT A;  2DYB A;  3VS7 A;  1JXM A;  1NLP C;  1X6G A;  1BBZ A;  4RTX A;  1MV0 B;  1X6B A;  4X1V A;  4AG1 C;  2RQW A;  1JQQ A;  1PRM C;  1X2K A;  1YNZ A;  5GJW B;  2EVR A;  2A28 A;  1AD5 A;  2PTK A;  2OJ2 A;  1UHF A;  1X43 A;  2JMC A;  3THK A;  3GBQ A;  3M0R A;  1JEG A;  2CDT A;  2CUB A;  1SHG A;  3JV3 A;  2K79 A;  3VS3 A;  2MIO A;  4JJD A;  1ZUK A;  1M3A A;  1WYX A;  2J06 A;  2JXB A;  4J9I A;  2ROT A;  1U3O A;  2CSI A;  2HDA A;  3SEM A;  3VS5 A;  1OPL A;  1WFW A;  1Y57 A;  1K4U S;  4CC2 A;  2DBK A;  4J9H A;  2EYZ A;  4JJB A;  3PVL A;  3EHQ A;  2EGE A;  5FWB A;  2SRC A;  1UDL A;  2DM1 A;  3REB B;  4Z88 A;  2RF0 A;  3O5Z A;  1ZLM A;  5IH2 A;  4F14 A;  2FO0 A;  5IXB A;  2KXD A;  1W6X A;  1FYN A;  1SPK A;  4F17 A;  3UF4 A;  4DEY A;  2YUQ A;  4AG2 C;  1GFD A;  4JZ3 A;  2YT6 A;  3H41 A;  3VS2 A;  1SEM A;  2RQU A;  3VS1 A;  4RTY A;  1WLP B;  2DF6 A;  2C0I A;  1H3H A;  2A08 A;  4LN2 A;  2LJ3 A;  2YSQ A;  4QT7 A;  2LX7 A;  2BZX A;  2LNH B;  1XOV A;  2LMJ A;  2DL5 A;  1YN8 A;  4J9B A;  2CH4 A;  4GLM A;  2EW3 A;  2QDL A;  4OMQ A;  2F2X A;  1AZG B;  4HVU A;  3I5R A;  2EYW A;  1K76 A;  1RLQ C;  1QKW A;  2ECZ A;  1ABQ A;  1PHT A;  1K0X A;  3EG1 A;  1NYF A;  3U23 A;  2DIL A;  3C0C A;  4A63 B;  1RI9 A;  1GCQ A;  2K6D A;  1UUE A;  3TVT A;  2GNC A;  3TSW A;  1S1N A;  1QKX A;  1UTI A;  4RTV A;  5HCK A;  1GBR A;  4AFQ C;  3M0P A;  1ZBJ A;  1NG2 A;  2JMA A;  1UFF A;  1B07 A;  1SHF A;  3R6N A;  4M4Z A;  1GCP A;  4Z8A A;  2JTE A;  1NYG A;  3CQT A;  2AK5 A;  2LQW A;  2JT4 A;  2KYB A;  2DX1 A;  5IXF A;  2KXC A;  4ORZ A;  2EYX A;  2LJ1 A;  2AKL A;  4DEX A;  1U5S A;  2JS0 A;  4HCK A;  1UE9 A;  1WXT A;  1AVZ C;  2YUN A;  4K11 A;  2C0O A;  3NMZ C;  3EG0 A;  4R0K A;  1ZSG A;  1NLO C;  1GCQ C;  3NHN A;  1QCF A;  4E6R A;  2KR3 A;  2VWF A;  2KBT A;  5IHN A;  1QLY A;  2NWM A;  2AZS A;  4D8K A;  2DVJ A;  4CC4 B;  2KT1 A;  4LUE A;  3M0T A;  1TUC A;  2LP5 A;  3LH5 A;  1E6G A;  1A0N B;  1QWF A;  4JPB W;  5ECA A;  1GL5 A;  2W10 A;  1TG0 A;  2ENM A;  2EGA A;  2O9V A;  4RTU A;  2LZ6 B;  2CUD A;  2IIM A;  2OAW A;  4AFZ C;  2B86 A;  2CT4 A; 
#chains in the Genus database with same CATH topology
 4GY5 A;  3NGP A;  3CCS Q;  1K1Z A;  4M7A C;  3BDU A;  4BUG A;  1V76 A;  2D0N A;  3C12 A;  2JW4 A;  1T0H A;  4ZGE B;  3CCQ A;  4DOW A;  4CC7 A;  3MKD A;  2DPP B;  1UJ0 A;  5FW9 A;  1I4K 1;  2HKN A;  1KC8 C;  2VYT A;  3NPF A;  2C0T A;  1GFC A;  3DLL A;  1S72 A;  2MWO A;  1SKU B;  2AKK A;  3JCM c;  1PSE A;  5GAN h;  2EYQ A;  2RQV A;  3G6E A;  4FT2 A;  4PLL A;  2JJ9 A;  1RI0 A;  2J6F A;  1WJS A;  1VQK Q;  5A2Q E;  2DD5 A;  3FEO A;  2VXE A;  2MI6 A;  2M0Y A;  3HRT A;  5J3B A;  3G7Z A;  1RAI B;  5DLO A;  3PFS A;  2KDS A;  3AHU A;  3CME T;  3QPH A;  5FRN A;  5HY6 A;  4M77 D;  6AT1 B;  2YHT A;  4BY6 C;  4A4K A;  5A0D A;  1BI2 A;  1JXO A;  2OTL Q;  4ATO A;  3NFC A;  2KNB B;  1GRI A;  1VQL T;  3SB2 A;  2RN8 A;  1K0S A;  1PRL C;  2EWN A;  4D6W A;  3QJ6 A;  1Y71 A;  3A98 A;  2FPE A;  1X01 A;  1K9M U;  4RTZ A;  3CMA T;  2QQB A;  1OV3 A;  2ZCF B;  4A4F A;  5IT9 E;  1G83 A;  2ABL A;  1IHW A;  1D1C A;  1E7O A;  1SRL A;  5GAM h;  2W0Z A;  2Y4X A;  3UWN A;  2PUO B;  3JB9 H;  1KC8 U;  2JM8 A;  5GAN e;  4M78 E;  3R6O A;  1G5V A;  3QBY A;  2DYI A;  2E3I A;  3G71 Q;  4HVV A;  1VA7 A;  4FCY A;  2A37 A;  1OEB A;  1M3B A;  2FPD A;  4M77 B;  3REA B;  2H3E B;  4LDU A;  4QVD A;  1YCS B;  2QQS A;  3G4S A;  4C92 E;  1WHM A;  3HRU A;  1Q86 R;  4J8O A;  1YI2 Q;  2D8J A;  1YHQ Q;  4Z89 A;  2HSE B;  1YP5 A;  1N5Z A;  1M1G A;  5KYN A;  2NUP A;  2DRM A;  4C8Q C;  2EKO A;  1IRE B;  4RTW A;  2V1R A;  1B7T A;  2RH2 A;  1IGU A;  1U06 A;  1YIJ Q;  2DXC A;  1KG1 A;  4OMP A;  1AWW A;  2LQ8 A;  5EG2 A;  2LT4 A;  4DBH A;  1TWB A;  1WA7 A;  3GF5 A;  1M1F A;  2ZZD A;  2KE9 A;  2DL7 A;  1K9M R;  4LNP A;  1Q95 G;  3IQL A;  2KGT A;  3EG9 A;  2KEA A;  1ZHI A;  4IUR A;  1JO8 A;  3S6W A;  4C0Z A;  2XDP A;  1WHL A;  2K3X A;  4PJO E;  2I0N A;  8AT1 B;  2NLU A;  3L2Z A;  3UAT A;  2GCX A;  3VS0 A;  5KYU B;  2FG0 A;  4C92 C;  3JCM P;  1NEG A;  2FPF A;  3QII A;  1W2B P;  4PL6 A;  4LE9 A;  1D0Y A;  3RBB B;  2MAM A;  4Y28 E;  2EQJ A;  2OAU A;  5J26 A;  1QVP A;  1PWT A;  4JRQ A;  2BZY A;  1J3T A;  1YCY A;  5AT1 B;  1NM7 A;  2GBQ A;  1X2Q A;  1UEC A;  1H8K A;  1B34 A;  1IO6 A;  1M1K U;  2QQA A;  4EDU A;  1SSF A;  1WZO A;  3S3O A;  1VQP A;  2RQR A;  1Q7Y C;  2CZ6 B;  5IHK A;  3OA6 A;  1Q82 C;  4OMN A;  2RPN A;  3G71 A;  3OYY A;  1V1C A;  1MGQ A;  2EJG A;  3OS1 A;  4PJO F;  5CKH A;  3UDC A;  4B6M A;  3QDR B;  3GPL A;  1O9S A;  2ESW A;  2EPD A;  4JRK A;  3VS4 A;  1WNL A;  4X34 A;  4UC4 A;  5LJ5 g;  1VQN A;  1AWJ A;  3X24 B;  2EKH A;  4OMO A;  1H3Z A;  3CCU A;  4FYW B;  1M2O A;  1X69 A;  1M3C A;  2DK3 A;  3CME A;  1I0C A;  4KBM B;  4PFO A;  4HT8 A;  4RTT A;  3VS7 A;  1MV0 B;  3V8K A;  4AG1 C;  1JQQ A;  1N6A A;  3G4S T;  4E7I A;  2A28 A;  5D6W A;  2PTK A;  2OJ2 A;  5GAO n;  1UHF A;  1X43 A;  3EH1 A;  1JEG A;  3OYK A;  1N9S A;  3VS3 A;  5C0M A;  3SD4 A;  2DEU A;  4M7D G;  2JXB A;  3G1J A;  5FU6 C;  2MPX C;  2KY9 A;  1U3O A;  1KC8 R;  1KD1 U;  3OS5 A;  3QKJ A;  4RKU E;  4A54 A;  1WQ7 A;  2HQH A;  3JB9 I;  4XTZ A;  1K4U S;  2DBK A;  3OYB A;  4JJB A;  3PVL A;  2LNV A;  3EHQ A;  4M7A G;  3MEU A;  5FWB A;  1UDL A;  3REB B;  4Z88 A;  3P8H A;  3V8J A;  4M75 E;  3OY9 A;  4KH0 B;  4II1 A;  4F7U A;  3OS2 A;  1KQS S;  2FO0 A;  5IXB A;  3L42 A;  3VUB A;  3JSC A;  1W6X A;  3MEV A;  1IXD A;  3EGD B;  2X4J A;  1GFD A;  4Y91 A;  3RR6 A;  2P0P A;  3ZBD A;  4IUP A;  3J80 E;  4JZ3 A;  4LXC A;  3H41 A;  1FMV A;  1RAC B;  2E64 A;  3CPW P;  3HFO A;  4O5V A;  2A08 A;  2RB6 A;  5GAN 7;  4M78 G;  2YSQ A;  2LX7 A;  7AT1 B;  2LNH B;  1K9M C;  3FIF A;  3MET A;  5KYW A;  3L2V A;  3JCM W;  3GIB A;  1AZG B;  4HVU A;  2DET A;  3CCV Q;  1QKW A;  1VQ9 A;  5KE2 A;  1Q81 R;  1PHT A;  1VQO T;  3CD6 Q;  2P4T A;  3EG1 A;  4DQ2 A;  3OYG A;  4QKU A;  3C94 A;  4IUU A;  3SWN C;  1RAF B;  3V7S A;  4PJO D;  1VQ8 A;  5CK9 A;  1RI9 A;  2K6D A;  1UUE A;  3CCS A;  2GNC A;  2KK4 A;  2YXY A;  2QGF B;  1YIJ A;  4MDW A;  1TU0 B;  1ZBJ A;  1NG2 A;  5IN1 A;  2JMA A;  1UFF A;  1B07 A;  3GLX A;  4Z8A A;  1NYG A;  3CQT A;  3M57 A;  4FSX A;  3QG1 A;  4BE1 A;  4C0D C;  2MK5 A;  4ORZ A;  2LJ1 A;  5AYF A;  1WPY A;  4XU2 A;  2RHI A;  1WXT A;  1VQ8 T;  3M5A A;  5KYW B;  4K11 A;  3EG0 A;  2HL5 C;  1FWZ A;  1WJR A;  4PJL A;  1BI3 A;  1O75 A;  1GCQ C;  3CCR Q;  3NHN A;  2XD0 A;  2CP7 A;  2FZC B;  4JJN K;  2KR3 A;  4NOY A;  5CKD A;  3S3M A;  2VWF A;  4C8Q E;  1I8F A;  3JCM h;  5IHN A;  2KSS A;  3Q1J A;  2QQR A;  1QLY A;  4D8K A;  1XTD A;  1GXI E;  1Q82 U;  2ZPE B;  1KQ1 A;  1N8R U;  1OZ2 A;  4JRP A;  3WVE B;  1GL5 A;  4MML A;  4HA8 A;  5GAO l;  2LZ6 B;  1LPL A;  3OS0 A;  1KHC A;  2OTL A;  2OTJ T;  2DEQ A;  1C0M A;  1UEB A;  1M30 A;  1PD0 A;  2EQU A;  4HCZ A;  1TUD A;  4C8Q B;  3OSV A;  1UG1 A;  3H0I A;  2DNU A;  1KK7 A;  2JVV A;  3EGX B;  3JCM f;  2M16 A;  5DM7 R;  2E5K A;  4JUV A;  3CCM Q;  1OYX A;  4RMO A;  2O31 A;  2ED1 A;  4E7Z A;  1W2B A;  1Y96 B;  1QWE A;  1N9R A;  3EFO A;  3FLG A;  1YJ9 T;  2ATC B;  4FYX B;  3JAM E;  4KGV B;  5DLQ E;  4BE0 A;  2E5Q A;  4WCI A;  2DJQ A;  2WSF E;  4HXJ A;  1VQM T;  4C0D B;  2R5M A;  3CC2 Q;  2CT3 A;  1QCN A;  3EFS A;  5FWC A;  1VYV A;  3OYJ A;  4XQ3 A;  1VQ5 Q;  2DKG A;  3OMG A;  3J7A F;  2VGM A;  2BZ8 A;  5GAO p;  2EIF A;  2MCN A;  4D8D A;  2VAS A;  1QCO A;  2EJF A;  3VYG A;  1KJW A;  4M77 G;  5CVI A;  2K5I A;  5L23 A;  5GMK e;  1H64 1;  1YWP A;  3JB9 G;  2OI3 A;  3JRZ A;  2DXU A;  3L2R A;  4M7A A;  3DLM A;  4B9W A;  2FRY A;  4LDW A;  1LNX A;  2D9T A;  1OU8 A;  2J6K A;  5FU6 B;  4A4G A;  3FJ5 A;  1G3W A;  1ZSZ A;  2LCC A;  2GQV A;  4C5G A;  5LJ5 e;  1RAH B;  1PM3 A;  2HMA A;  5GAN 2;  1AZE A;  1ZA1 B;  4HCC A;  3VS6 A;  3OBY A;  2DTH A;  3E19 A;  3CC4 A;  1D0X A;  3VRY A;  2JM9 A;  1MUZ A;  4OVA A;  3X20 B;  4M7A E;  4M78 A;  3CCE A;  1VQN Q;  5I2M A;  2L8D A;  2JNG A;  1T0J A;  1G3S A;  1FXX A;  4J6X A;  1S72 Q;  1KIK A;  2PZ1 A;  1E6H A;  2K2M A;  4Y92 A;  1LOJ A;  1AOJ A;  4HVW A;  2MOX A;  1OUL A;  3VYH B;  3G6E T;  5IAY A;  4QQD A;  1BIA A;  5FLX E;  2X3X D;  3CCL Q;  3HRS A;  1UHC A;  3BE3 A;  1VQ5 T;  3EAE A;  3RNJ A;  2KRM A;  4EMH A;  1TTH B;  4A4H A;  4BY6 B;  3OYM A;  2F1L A;  2F5T X;  3H0H A;  5I22 A;  3OYI A;  4XU0 A;  3CC2 A;  4AFU C;  3QXE B;  1NJI C;  2DER A;  1RLP C;  2E3H A;  1V29 B;  1I1J A;  3JCM g;  3EHR A;  3CCQ Q;  1CKA A;  1PKS A;  4KT0 E;  4MMK A;  1M90 U;  3RDV A;  5LL6 S;  2RNA A;  2M1H A;  3P8B B;  2NUP B;  2CP5 A;  3ULR B;  3CCV A;  1KHI A;  5LJ3 h;  3LW5 E;  4OMF B;  2XG8 D;  4M7A D;  3TQ7 P;  4E7L A;  4F7U G;  3CCJ Q;  4M75 D;  5GMK i;  3FRN A;  1N8R C;  4EMK A;  4J9C A;  3X25 B;  2RHZ A;  5HK0 A;  3JB9 F;  1X6O A;  3LGF A;  2H3J A;  2VV5 A;  4M7A F;  1XJW B;  3M4Y A;  2JTM A;  5A0L A;  4C5E A;  3UA6 A;  1YWO A;  2VKN A;  2BE9 B;  4VUB A;  1KD1 R;  3PMT A;  4FW2 A;  1AWX A;  1AHJ B;  5EC7 A;  5HK3 A;  4FSS A;  2SEM A;  3CCR T;  2YDL A;  1RAE B;  1Z9Z A;  2KRN A;  2A7Y A;  2L2P A;  1F1B B;  1YHQ T;  3HPW A;  1QP3 A;  5LJ5 d;  1K8A U;  3CCE Q;  3QO3 A;  1WXB A;  2AHJ B;  1JU5 C;  1NEB A;  2HSP A;  2COW A;  4LD9 K;  1AEY A;  3M0Q A;  2R58 A;  3LH0 A;  2NUT B;  1Z9Q A;  2ROL A;  3RMQ A;  3EFR A;  2DJZ A;  4QW2 A;  4JJC A;  4Q5W A;  2F2V A;  1UGV A;  3TSZ A;  1YJN T;  3JCM d;  1M90 R;  4QQ6 A;  3MHX A;  1KQ2 A;  1MMG A;  1RAA B;  4DBQ A;  4OGC A;  4RUG A;  4ESR A;  2VC8 A;  1OOT A;  1HSQ A;  1BCO A;  3BDL A;  4C92 G;  1X27 A;  1BB9 A;  2O88 A;  4LDV A;  3KFV A;  4XTX A;  1MND A;  2DYB A;  3QYG B;  1JXM A;  1X6G A;  1BBZ A;  4HKE A;  1MMD A;  4BI8 B;  4X1V A;  4JLG A;  2DVE A;  2LVM A;  2OTL T;  1X2K A;  2ZPB B;  4M78 D;  4RG2 A;  4PKC C;  2EVR A;  1AD5 A;  5CKB A;  2GFU A;  3EGX A;  3OYE A;  2JMC A;  3M0R A;  3JV3 A;  3CCL T;  3WXM B;  1K73 R;  3OSS C;  4JJD A;  3TU4 K;  3MJX A;  2J06 A;  4C92 F;  3UPU A;  2VGN A;  3VS5 A;  4WF2 A;  1OPL A;  3L2Q A;  5LJ3 g;  4ELY C;  1RAD B;  1M1K R;  3H8Z A;  4CC2 A;  4PJO G;  2DZC A;  1YFN A;  4M77 E;  2L5Q A;  1VQ6 T;  3CCJ T;  1D1A A;  2SRC A;  2RF0 A;  2K2V A;  4PK4 A;  1LJO A;  4R56 A;  5GMK l;  3CC7 Q;  1IGQ A;  1Q86 U;  3INZ A;  3UF4 A;  4DEY A;  2JZ2 A;  3TRE A;  4F7U F;  1WGS A;  2RHX A;  3ME9 A;  1XNI A;  3VS2 A;  2RQU A;  4M7D B;  3VS1 A;  3OYF A;  3TCJ A;  1WLP B;  1M5Q 1;  2QAS A;  1IB8 A;  1VQ6 A;  3WVD B;  4LN2 A;  2BZX A;  1XOV A;  4J9B A;  2DL5 A;  1YN8 A;  3MO8 A;  2RHU A;  3A8L B;  1HYO A;  4GLM A;  2EW3 A;  2PVG B;  2QDL A;  4OMQ A;  3CC7 A;  2F2X A;  5GAN 5;  3H6Z A;  3E1S A;  1OU9 A;  2EYW A;  4X9D A;  4ZTF A;  5GAN j;  1RLQ C;  2BIV A;  2ECZ A;  4ZGJ B;  2P0Q A;  1VQP Q;  1NYF A;  4OB0 B;  1TOV A;  1VQM Q;  4C8Q A;  3TSW A;  2K4Y A;  2WAC A;  1K73 C;  2CP2 A;  5HCK A;  1JJ2 A;  4AFQ C;  1KD1 C;  2EAY A;  2VB6 A;  5FRM A;  3R6N A;  1SHF A;  2HD0 A;  2LT1 A;  3E9F A;  4M4Z A;  5GAO r;  2RA2 A;  3VKI A;  5IXF A;  1Q86 C;  2XDB A;  4N4H A;  1C6V X;  5GAO m;  4DEX A;  1U5S A;  3PGG A;  4HCK A;  1PSF A;  1VQM A;  4PNO A;  3OW2 A;  3CPW S;  3CBP A;  2C0O A;  4R0K A;  2RM4 A;  5GMK h;  1NLO C;  1QCF A;  4E6R A;  1QVF P;  2KBT A;  4Z02 A;  2CS7 A;  3N5B B;  5GAM j;  2XDD A;  2AZS A;  1M90 C;  4CC4 B;  3A1P A;  4LUE A;  2KI7 A;  2EQM A;  3M0T A;  4N4G A;  2LP5 A;  2XK0 A;  5FU7 B;  1VQ4 Q;  1E6G A;  4N0A A;  2COZ A;  2VUB A;  1TG0 A;  2ENM A;  2PUK B;  2OAW A;  2MF2 A;  3X28 B;  8ATC B;  1YBY A;  2O4X B;  1YIT A;  3T9N A;  4PJM A;  2L89 A;  1BU1 A;  1JB0 E;  1IRX A;  3QWX X;  1M8V A;  1YHQ A;  4ZN3 A;  2GTJ A;  3ASK A;  4M75 C;  1OX8 A;  2RQT A;  2QEX Q;  4AT1 B;  1KQS A;  2YUO A;  3CCU Q;  2O2O A;  1RAB B;  2M02 A;  3OYN A;  3G4S Q;  2PVD B;  1ZUY A;  2HKQ B;  4JS4 A;  1ZX6 A;  1PCX A;  1PNJ A;  2BTT A;  2RK1 A;  2DL4 A;  3LGL A;  4BB7 A;  1M27 C;  1G3T A;  1UGR B;  2CH4 W;  3G71 T;  2HEQ A;  2MYS A;  2CP0 A;  2QTV A;  4GLK A;  3V7R A;  3PE0 A;  4M7D A;  1UGQ B;  4C0F A;  2V8K A;  1D3B B;  1Q7Y U;  1ZUU A;  4DBF A;  2J05 A;  3EGU A;  5CO7 A;  1ZSZ C;  1HK9 A;  4M7D F;  1WQW A;  3M53 A;  2LCL A;  2BE7 D;  9ATC B;  3RKY A;  2DXB A;  2CKK A;  2DXT A;  2P0K A;  2L3S A;  2CP6 A;  3PIP A;  1XQH A;  4OB1 B;  2NYS A;  1VQ8 Q;  1MHN A;  2YUP A;  2CP3 A;  2NUT A;  4KUL A;  1LCK A;  5D6Y A;  1QVG P;  5KCO A;  1OPK A;  1HD3 A;  2YRC A;  2DL3 A;  3SWN B;  3UA7 A;  2P4R A;  3HSB A;  5FRO A;  1T3L A;  4PFP A;  1WIE A;  5D7U A;  4J83 A;  1D1B A;  4DOV A;  4KH1 B;  1KFZ A;  3JCM b;  1AT1 B;  3GNG A;  4C8Q G;  2YLC A;  4RG8 A;  1Q81 C;  3NTI A;  5GAN 6;  2EQK A;  2NUZ A;  4LUD A;  5A0G A;  4EIK A;  2RMO A;  3CXC A;  2KT8 A;  2IVW A;  5C6S A;  3EG2 A;  4IIO A;  2EFI A;  2FZG B;  1VQ4 T;  2V8I A;  2D1X A;  1WHJ A;  1MMA A;  2QDY B;  3SHW A;  3M4G A;  2CZ1 B;  2I2L A;  4XTY A;  3I56 A;  3VRZ A;  2LRQ A;  1T3S A;  1M2V A;  3GOX A;  4XU3 A;  1PG5 B;  3VV0 A;  5LJ3 e;  2E70 A;  3RIR A;  2KRO A;  4KUI A;  2RK2 A;  3A8H B;  3FC3 A;  1VUB A;  3CBM A;  1NJI U;  4FL6 A;  4HT9 A;  2J6O A;  4PLI A;  2FEI A;  3OYD A;  1SRM A;  1VYU A;  5IHI A;  1Y0M A;  5CIU A;  1YIT T;  2VVK A;  2PU9 B;  2O01 E;  4J9D A;  4JDS A;  3CXC P;  1M9S A;  1M8M A;  4IIM A;  2BUD A;  2CRE A;  4PJO A;  1SSH A;  4C92 B;  2WSE E;  4BI4 A;  2KMT A;  1B3Q A;  1Q81 U;  5LJ3 d;  3LWH A;  3LLR A;  2K7A A;  2ZAE A;  1BI0 A;  2R5A A;  3A8G B;  1EZZ B;  4M77 A;  1CKB A;  4LDY A;  2X51 A;  4E7J A;  1ARK A;  1K9A A;  1JRI A;  1MMN A;  4PJN A;  1VQ6 Q;  4F04 B;  1FMW A;  2LC4 A;  1M4Z A;  3M0S A;  1IHV A;  4P5N A;  2KRS A;  1PD1 A;  1TH7 A;  1BK2 A;  4BI3 A;  1VQO Q;  4ZNX A;  1AWO A;  2H8H A;  4BD3 A;  4PJO B;  2QA4 Q;  1WI7 A;  2DRK A;  1YJW A;  4XTV A;  3JB9 J;  2JS2 A;  1ABO A;  2Z0W A;  3CCE T;  4JRI A;  2EGC A;  2A0F B;  1OI1 A;  2A36 A;  4MDX A;  2E65 A;  3CCM A;  1RAG B;  1N27 A;  2QQ9 A;  3M0U A;  3QUI A;  5CCA A;  1YJ9 A;  1UGP B;  1I07 A;  5GAM e;  1D3B A;  2HBW A;  4GBQ A;  2F2W A;  1M2V B;  4KGX B;  2AZV A;  1WHG A;  2V1Q A;  2XMF A;  2GF7 A;  1BIB A;  2EQI A;  3RKX A;  3OYC A;  2KAF A;  4CRI A;  4FT4 A;  1P92 A;  5GAM g;  1VQ9 Q;  2GFA A;  1HJD A;  1GBQ A;  1WHK A;  1NLP C;  4RTX A;  1X6B A;  1D0Z A;  2RQW A;  1PRM C;  1YNZ A;  4J7I A;  5GJW B;  2RJD A;  1G8X A;  2XHC A;  2CDT A;  2CUB A;  2XKO C;  1SHG A;  3AT1 B;  3EFO B;  3GBQ A;  3L2U A;  1M3A A;  2Y90 A;  2M0O A;  4EPC A;  4IUQ A;  4M7D D;  2QA4 T;  1OX9 A;  2O4X A;  3CCR A;  2CSI A;  3M58 A;  1SF9 A;  2ZPI B;  1VQK T;  2RHY A;  2X4Y A;  1WFW A;  1VQN T;  3KUF A;  1QVF A;  4F7U E;  2QYZ A;  3VJP A;  3JCM X;  3HL8 A;  4J9H A;  2ZPH B;  1VQO A;  2MWP A;  5KYY A;  3X26 B;  4XTW A;  3CD6 T;  4BAC A;  5IH2 A;  2QA4 A;  4C0G A;  2LQK A;  1FYN A;  1SPK A;  4F17 A;  4QQG A;  2AIR B;  2YUQ A;  1W2B S;  3HTR A;  2YRD A;  1VQL Q;  1NJI R;  3V7C A;  4R55 A;  3HP9 A;  3LX7 A;  4FM4 B;  2YT6 A;  4C5I A;  2OX7 A;  3CMA Q;  1JJ2 P;  2E12 A;  5GAN f;  1H3H A;  4DA4 A;  3QHS A;  4QT7 A;  5CKE A;  4A4E A;  3RMS A;  2LMJ A;  5GAM f;  1C1A A;  1YJ9 Q;  3CC4 T;  3CEY A;  1Y96 A;  4EMG A;  2CH4 A;  1UB4 A;  4B9X A;  2C06 A;  2PQW A;  3MCA B;  3CC2 T;  3I5R A;  1K76 A;  1VIF A;  2DZ9 A;  2HBP A;  5GAN 3;  1VQL A;  2RI5 A;  2IPO B;  4J6W A;  5KH6 A;  4KUD K;  4TVR A;  3L1A A;  5LJ3 f;  3C0C A;  2ZGW A;  1TUG B;  1GCQ A;  1K73 U;  3OW2 P;  1QKX A;  4J7F A;  1VQ5 A;  3A8O B;  1GBR A;  3JCM Q;  2K3Y A;  4MZP A;  2FHD A;  2A3L A;  2AK5 A;  2HQE A;  2JT4 A;  2DX1 A;  2RD1 A;  4PJJ A;  4M7D C;  2JS0 A;  4ZGD B;  2MMP A;  1AVZ C;  4E7H A;  4C8Q D;  3URG A;  3G6E Q;  1Q82 R;  2DAQ A;  4LD6 A;  3EGD A;  1VQ9 T;  4AMC A;  3EH2 A;  1R0C B;  1BI1 A;  3CC4 Q;  2DD4 A;  2QK0 A;  2ZPF B;  3OB9 A;  2JTF A;  2NWM A;  2XI9 A;  4E7K A;  3I55 T;  2DVJ A;  2KT1 A;  3LH5 A;  1NBE B;  4JPB W;  3OQ5 A;  5GMK j;  2W10 A;  4FU6 A;  2K5F A;  3OMC A;  2EGA A;  2RJC A;  4NS5 A;  4M77 F;  1Y07 A;  3PTA A;  4RTU A;  3RKW A;  2CUD A;  2IIM A;  4AFZ C;  4IUT A;  1EX4 A;  2B86 A;  2DO3 A;  1R8O B;  2X4X A;  3CCS T;  4FIB A;  1N8R R;  2D8H A;  1R0B G;  3CMA A;  1VQP T;  5I2S A;  1YJW T;  4J9E A;  1VQ7 Q;  5KYX B;  4RCB A;  2DLP A;  1KSW A;  4L6V 5;  4IUV A;  4AFS C;  2CYZ B;  5LJ3 j;  2HNI A;  3I5S A;  4ELZ C;  5L8R E;  2HL3 A;  4J6Y A;  2FZK B;  4PFZ A;  2HCK A;  2X9H A;  3QWY A;  4L59 A;  2P84 A;  1VYT A;  3C95 A;  4NL3 A;  2O9S A;  3I9Q A;  1YI2 T;  3P8D A;  3TEE A;  4M75 B;  2RJE A;  2KYM A;  2CZ0 B;  1HXD A;  4J9F A;  3S3N A;  2E41 A;  2FVU A;  3FJP A;  1YI2 A;  3FDR A;  2D6F A;  3EG3 A;  1YIJ T;  2GTO A;  3ZEH A;  2K57 A;  2L0A A;  3PT9 A;  2LJ0 A;  5KYY B;  2QTX A;  1ZA2 B;  4JZ4 A;  4E47 A;  3CBO A;  3FB9 A;  1QW1 A;  2KVQ G;  3I55 A;  2J7I A;  5GJV B;  5KCH A;  4YTL A;  5KE3 A;  3A8M B;  2G6F X;  4JLI A;  4V2S A;  1UJY A;  3GP8 A;  4BDY A;  3M55 A;  1G2B A;  5I21 A;  4BDZ A;  4MZM A;  3M56 A;  2FRW A;  3F70 A;  2V26 A;  4XK8 E;  2DTO A;  3H0F A;  3O8V A;  5GAN 4;  4JS5 A;  2M51 A;  3JCM V;  2DL8 A;  3MEW A;  3OYA A;  3QZ5 B;  1I5L A;  2VXF A;  3L2W A;  1H92 A;  3OW2 S;  3CPW A;  1K8A C;  1ACM B;  2RI2 A;  2RI3 A;  1QQJ A;  1SG5 A;  3RES A;  1OQK A;  2YLB A;  2F5K A;  4O6J A;  3I55 Q;  3ER0 A;  3HHT B;  3CPF A;  1QVF S;  5M9O A;  2FYK A;  3OBW A;  2DE0 X;  1NPP A;  4EMK B;  2PNI A;  5J39 A;  4WTO B;  2OTJ Q;  4MZT A;  1PKT A;  1VQ7 A;  3LWI A;  4PJO C;  5GMK m;  2DA9 A;  3EG9 B;  1YJW Q;  1QVG A;  1VQ7 T;  1I5O B;  4ZTJ A;  4QVC A;  4FYV B;  1YIT Q;  1NZ9 A;  2PVO B;  4LDX A;  1RUW A;  1MV3 A;  2CSQ A;  3UT1 A;  4J9G A;  1EFN A;  4CC3 A;  2Y4Y A;  2LQN A;  3ZL7 C;  4EMK C;  4M7D E;  1CSK A;  2RJF A;  4F16 A;  1B34 B;  2EYY A;  5FU7 C;  5CQY A;  1WXU A;  2K9G A;  1NPR A;  2ED0 A;  5I11 A;  4E2F B;  3KBG A;  1FMK A;  3JB9 D;  2IG0 A;  2KQW A;  1UGS B;  2YWW A;  1I81 A;  3GNF B;  3LYI A;  3E9G A;  1VIE A;  2GGR A;  4OMM A;  5KYU A;  1W70 A;  2L3Q A;  3PIO A;  2XU8 A;  1KQS P;  2LCS A;  3I35 A;  2DMO A;  3QYH B;  3I56 Q;  2X3W D;  4HCB A;  4M78 B;  4FYY B;  1ZSZ B;  4A53 A;  4OML A;  4C92 A;  1BCM A;  1WDX A;  2GQI A;  1R77 A;  4N0A C;  4FW1 A;  1WX6 A;  4QVZ A;  4M7A B;  3V8L A;  5LJ5 h;  5CR2 A;  2QG9 B;  3CCL A;  2L3P A;  1U1T A;  2QAZ A;  3J81 E;  2K3B A;  2OTJ A;  2JOY A;  4OP0 A;  1TS9 A;  2X35 A;  5CAI A;  3PMI A;  2E6Z A;  1JJ2 S;  1W1F A;  1G3Y A;  1S72 T;  2DIQ A;  2X4W A;  4C8Q F;  2E10 A;  3RUX A;  4M75 A;  2DBM A;  3I56 T;  2LDM A;  4M77 C;  1ZBX A;  1ZQ1 A;  3PVQ A;  3M54 A;  3JCM e;  3QDF A;  4KRT A;  3SFM A;  2F69 A;  5GAO q;  2EBP A;  5DY9 A;  1IZ6 A;  2WSC E;  4L5G A;  4OGE A;  1U1S A;  5GAN g;  5CKF A;  3CME Q;  4OB3 B;  3A5Z B;  3CCM T;  3QSU A;  2JUF A;  3RER A;  3CCV T;  4XTU A;  5GAM d;  4ZN1 A;  2ZPG B;  2E1H A;  5D6X A;  3THK A;  5KYX A;  2LX9 A;  5GAN d;  2K79 A;  2MIO A;  2K5L A;  1BYM A;  1ZUK A;  1WYX A;  2HAX A;  3QZ9 B;  1W4S A;  4J9I A;  2ROT A;  3MP1 A;  3BW1 A;  2RO0 A;  3NTH A;  2HDA A;  2DTI A;  2LTO A;  3SEM A;  3SWN A;  3DKM A;  1YJN A;  3C4S A;  4XAX B;  1Y57 A;  3H9N A;  3SDZ A;  2EYZ A;  3JCM J;  4ME7 A;  2EGE A;  2QI2 A;  2DM1 A;  3VU3 C;  3O5Z A;  1ZLM A;  3CCQ T;  2XID A;  4F14 A;  4C92 D;  1FX7 A;  5LJ5 f;  2KXD A;  1U8R A;  2FL7 A;  3MPU B;  3NTK A;  3DB4 A;  2M9U A;  3BFM A;  4AG2 C;  1VQ4 A;  1TXQ A;  2EJ9 A;  5HKC A;  2QXF A;  1SEM A;  2QEX T;  2YRV A;  4RTY A;  1DJ7 B;  1PC0 A;  2DIG A;  2DF6 A;  3E2U A;  2C0I A;  4OF1 A;  2HZY A;  1LVK A;  4RCC A;  1Y7X A;  2LJ3 A;  3D7S B;  2V8J A;  2QEX A;  3OYH A;  4CI0 C;  3M9Q A;  2E4H A;  4C5H A;  2QGG A;  2BKD N;  4F7U B;  1JBM A;  2CZ7 B;  3CD6 A;  1MNE A;  1TSF A;  4M75 G;  2COY A;  1ABQ A;  2G3R A;  1X75 C;  1K0X A;  3CC7 T;  2DFU A;  3CXC S;  3MP8 A;  1K8A R;  3U23 A;  2DIL A;  3HKS A;  2AT1 B;  2L3R A;  3VUZ A;  4A63 B;  4OB2 B;  2HQX A;  3TVT A;  3BY7 A;  1VQK A;  1S1N A;  1UTI A;  4RTV A;  1WHH A;  4E7S A;  3M0P A;  3MEA A;  2B8A A;  1GCP A;  2JTE A;  2LQW A;  2KYB A;  3KXT A;  4X9C A;  2E6N A;  3CCU T;  1D09 B;  2KXC A;  2EYX A;  2R57 A;  2AKL A;  2FB7 A;  1QVG S;  1M1K C;  4XU1 A;  1YJN Q;  1UE9 A;  3PNW C;  2YUN A;  1Q7Y R;  3NMZ C;  2D0Q B;  4IKF A;  3M59 A;  4KGZ B;  1RL2 A;  1ZSG A;  3DB3 A;  4M78 C;  3CCJ A;  2JN0 A;  1BKB A;  1QP2 A;  1QMC A;  3ZFJ A;  4J5Y A;  5CQX A;  4ANJ A;  5LJ5 j;  4DBR A;  3OYL A;  3MP6 A;  5GAN 8;  4M75 F;  4N4I A;  1EIF A;  3QJY A;  1VOM A;  1TUC A;  1NE8 A;  1QWF A;  2XIC A;  1A0N B;  4NL2 A;  5ECA A;  1OZ3 A;  1WJQ A;  2O9V A;  2CGH A;  3HFN A;  4BE2 A;  4M78 F;  2CT4 A; 
#chains in the Genus database with same CATH homology
 1M30 A;  2D8H A;  3NGP A;  1TUD A;  1K1Z A;  1UG1 A;  1BU1 A;  3H0I A;  3QWX X;  4J9E A;  2D0N A;  2GTJ A;  2DNU A;  2JW4 A;  1T0H A;  2DLP A;  2RQT A;  1KSW A;  2YUO A;  2E5K A;  4CC7 A;  4AFS C;  2O2O A;  1UJ0 A;  5FW9 A;  1ZUY A;  2O31 A;  2ED1 A;  1QWE A;  3NPF A;  1ZX6 A;  2C0T A;  1GFC A;  1PNJ A;  2BTT A;  3I5S A;  2DL4 A;  4WCI A;  1M27 C;  2AKK A;  2DJQ A;  2HCK A;  2CH4 W;  3QWY A;  4HXJ A;  2RQV A;  1VYT A;  2HEQ A;  2CT3 A;  2O9S A;  3I9Q A;  3PE0 A;  1ZUU A;  2J6F A;  2KYM A;  4J9F A;  1VYV A;  2J05 A;  5FWC A;  3EGU A;  2BZ8 A;  2M0Y A;  3EG3 A;  2GTO A;  2MCN A;  4D8D A;  2L0A A;  2L3S A;  2LJ0 A;  1KJW A;  5L23 A;  2YUP A;  1YWP A;  2OI3 A;  4JZ4 A;  1JXO A;  2FRY A;  2J7I A;  5GJV B;  1LCK A;  2J6K A;  2KNB B;  1GRI A;  3FJ5 A;  2RN8 A;  1OPK A;  1HD3 A;  2DL3 A;  1PRL C;  3UA7 A;  2G6F X;  2P4R A;  1K0S A;  1T3L A;  3A98 A;  1UJY A;  2FPE A;  1WIE A;  4RTZ A;  1G2B A;  1AZE A;  1OV3 A;  2FRW A;  3VS6 A;  3H0F A;  1KFZ A;  1G83 A;  2ABL A;  3VRY A;  2M51 A;  2JM9 A;  1E7O A;  1MUZ A;  1SRL A;  2DL8 A;  2W0Z A;  2NUZ A;  4LUD A;  2JM8 A;  1H92 A;  1T0J A;  4EIK A;  2RMO A;  2KT8 A;  4HVV A;  1VA7 A;  3EG2 A;  4IIO A;  2A37 A;  1KIK A;  1OEB A;  2PZ1 A;  1E6H A;  2K2M A;  1M3B A;  4Y92 A;  1AOJ A;  4HVW A;  2FPD A;  2MOX A;  2D1X A;  3REA B;  2DE0 X;  3SHW A;  2PNI A;  2X3X D;  1YCS B;  1UHC A;  3VRZ A;  1T3S A;  1PKT A;  3RNJ A;  2KRM A;  2D8J A;  4Z89 A;  1YP5 A;  1N5Z A;  2DA9 A;  2KRO A;  2DRM A;  3H0H A;  5I22 A;  4RTW A;  2V1R A;  4AFU C;  2J6O A;  1U06 A;  2FEI A;  1SRM A;  1VYU A;  5IHI A;  4OMP A;  1RLP C;  1Y0M A;  1AWW A;  1RUW A;  1MV3 A;  2CSQ A;  1I1J A;  2VVK A;  4J9G A;  1EFN A;  4CC3 A;  2LQN A;  4J9D A;  3ZL7 C;  3EHR A;  1CSK A;  1WA7 A;  1CKA A;  4IIM A;  1M8M A;  1PKS A;  4F16 A;  2CRE A;  1SSH A;  2EYY A;  2DL7 A;  2KE9 A;  2RNA A;  4LNP A;  3IQL A;  2KGT A;  1B3Q A;  3ULR B;  2KEA A;  1WXU A;  1JO8 A;  2K9G A;  2K7A A;  2ED0 A;  5I11 A;  1CKB A;  2I0N A;  1FMK A;  3UAT A;  3VS0 A;  2FG0 A;  1NEG A;  4J9C A;  2FPF A;  1ARK A;  1K9A A;  2GGR A;  4LE9 A;  4OMM A;  3RBB B;  1W70 A;  2L3Q A;  3UA6 A;  1YWO A;  2VKN A;  2LCS A;  3M0S A;  3I35 A;  2KRS A;  2DMO A;  1PWT A;  1BK2 A;  2BZY A;  2X3W D;  1J3T A;  1AWX A;  4ZNX A;  1NM7 A;  2GBQ A;  1AWO A;  1X2Q A;  2H8H A;  1UEC A;  5EC7 A;  4FSS A;  1H8K A;  4OML A;  2SEM A;  1IO6 A;  2YDL A;  1Z9Z A;  1WI7 A;  1WDX A;  2DRK A;  2GQI A;  2KRN A;  1WX6 A;  2L2P A;  2JS2 A;  1ABO A;  2RQR A;  1WXB A;  2EGC A;  1JU5 C;  2L3P A;  5IHK A;  1NEB A;  2HSP A;  1AEY A;  2K3B A;  3M0Q A;  4OMN A;  2RPN A;  2A36 A;  1V1C A;  1Z9Q A;  1W1F A;  2ROL A;  4JJC A;  2ESW A;  2EPD A;  2F2V A;  1UGV A;  3M0U A;  3TSZ A;  3VS4 A;  1I07 A;  2DBM A;  2HBW A;  4GBQ A;  1AWJ A;  2F2W A;  2AZV A;  2EKH A;  4OMO A;  2V1Q A;  2XMF A;  4RUG A;  3PVQ A;  4ESR A;  1OOT A;  1HSQ A;  2EQI A;  1X69 A;  4KRT A;  1X27 A;  1M3C A;  1BB9 A;  2O88 A;  1HJD A;  3KFV A;  1GBQ A;  1I0C A;  2EBP A;  4RTT A;  2DYB A;  3VS7 A;  1JXM A;  1NLP C;  1X6G A;  1BBZ A;  4RTX A;  1MV0 B;  1X6B A;  4X1V A;  4AG1 C;  2RQW A;  1JQQ A;  1PRM C;  1X2K A;  1YNZ A;  5GJW B;  2EVR A;  2A28 A;  1AD5 A;  2PTK A;  2OJ2 A;  1UHF A;  1X43 A;  2JMC A;  3THK A;  3GBQ A;  3M0R A;  1JEG A;  2CDT A;  2CUB A;  1SHG A;  3JV3 A;  2K79 A;  3VS3 A;  2MIO A;  4JJD A;  1ZUK A;  1M3A A;  1WYX A;  2J06 A;  2JXB A;  4J9I A;  2ROT A;  1U3O A;  2CSI A;  2HDA A;  3SEM A;  3VS5 A;  1OPL A;  1WFW A;  1Y57 A;  1K4U S;  4CC2 A;  2DBK A;  4J9H A;  2EYZ A;  4JJB A;  3PVL A;  3EHQ A;  2EGE A;  5FWB A;  2SRC A;  1UDL A;  2DM1 A;  3REB B;  4Z88 A;  2RF0 A;  3O5Z A;  1ZLM A;  5IH2 A;  4F14 A;  2FO0 A;  5IXB A;  2KXD A;  1W6X A;  1FYN A;  1SPK A;  4F17 A;  3UF4 A;  4DEY A;  2YUQ A;  4AG2 C;  1GFD A;  4JZ3 A;  2YT6 A;  3H41 A;  3VS2 A;  1SEM A;  2RQU A;  3VS1 A;  4RTY A;  1WLP B;  2DF6 A;  2C0I A;  1H3H A;  2A08 A;  4LN2 A;  2LJ3 A;  2YSQ A;  4QT7 A;  2LX7 A;  2BZX A;  2LNH B;  1XOV A;  2LMJ A;  2DL5 A;  1YN8 A;  4J9B A;  2CH4 A;  4GLM A;  2EW3 A;  2QDL A;  4OMQ A;  2F2X A;  1AZG B;  4HVU A;  3I5R A;  2EYW A;  1K76 A;  1RLQ C;  1QKW A;  2ECZ A;  1ABQ A;  1PHT A;  1K0X A;  3EG1 A;  1NYF A;  3U23 A;  2DIL A;  3C0C A;  4A63 B;  1RI9 A;  1GCQ A;  2K6D A;  1UUE A;  3TVT A;  2GNC A;  3TSW A;  1S1N A;  1QKX A;  1UTI A;  4RTV A;  5HCK A;  1GBR A;  4AFQ C;  3M0P A;  1ZBJ A;  1NG2 A;  2JMA A;  1UFF A;  1B07 A;  1SHF A;  3R6N A;  4M4Z A;  1GCP A;  4Z8A A;  2JTE A;  1NYG A;  3CQT A;  2AK5 A;  2LQW A;  2JT4 A;  2KYB A;  2DX1 A;  5IXF A;  2KXC A;  4ORZ A;  2EYX A;  2LJ1 A;  2AKL A;  4DEX A;  1U5S A;  2JS0 A;  4HCK A;  1UE9 A;  1WXT A;  1AVZ C;  2YUN A;  4K11 A;  2C0O A;  3NMZ C;  3EG0 A;  4R0K A;  1ZSG A;  1NLO C;  1GCQ C;  3NHN A;  1QCF A;  4E6R A;  2KR3 A;  2VWF A;  2KBT A;  5IHN A;  1QLY A;  2NWM A;  2AZS A;  4D8K A;  2DVJ A;  4CC4 B;  2KT1 A;  4LUE A;  3M0T A;  1TUC A;  2LP5 A;  3LH5 A;  1E6G A;  1A0N B;  1QWF A;  4JPB W;  5ECA A;  1GL5 A;  2W10 A;  1TG0 A;  2ENM A;  2EGA A;  2O9V A;  4RTU A;  2LZ6 B;  2CUD A;  2IIM A;  2OAW A;  4AFZ C;  2B86 A;  2CT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...