2OAWA

Structure of shh variant of "bergerac" chimera of spectrin sh3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spectrin alpha chain, brain
publication title Structural and thermodynamic studies of Bergerac-SH3 chimeras.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 12
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2oawA00
2PTKA 4AG1C 3EHQA 2LQWA 1I1JA 1YP5A 3TSWA 1ABOA 1H92A 2PNIA 2KBTA 1U06A 2RMOA 2MOXA 1WX6A 2A36A 3KFVA 1QWEA 1PRMC 2C0IA 5GJWB 3VS1A 1Y57A 1MV3A 1ABQA 1ZUKA 1M3AA 3H0IA 5IHKA 1SHGA 1VA7A 1M8MA 2ROLA 2K9GA 4CC4B 2DMOA 2QDLA 2DX1A 1RUWA 2KRMA 1ARKA 1VYVA 4HVVA 1M30A 1M3CA 1MUZA 1ZBJA 2AK5A 2JMAA 1NYFA 1UECA 2P4RA 2CSQA 1NLOC 2DILA 4F17A 1YN8A 2V1RA 4Y92A 4OMMA 1PHTA 4RTXA 2RNAA 1NYGA 2C0TA 1WXUA 1QCFA 1ZUUA 4A63B 1GRIA 4KRTA 2YDLA 2FO0A 1OPKA 2JS2A 5L23A 1UGVA 2X3XD 4RUGA 2O88A 3VS0A 5I11A 2X3WD 2DVJA 2ED0A 2DNUA 2PZ1A 2W0ZA 1JXMA 2MCNA 1SRMA 4DEXA 3NMZC 3EGUA 3M0UA 1HSQA 1QKWA 2CUDA 4OMNA 2O2OA 1M3BA 2RPNA 1GFCA 2KR3A 1UJYA 2AZSA 4DEYA 1I0CA 3RBBB 2LJ1A 2EYXA 1G2BA 4OMLA 1N5ZA 2O31A 1GFDA 1WI7A 2EPDA 1ZSGA 4RTYA 3M0TA 2EQIA 4GBQA 3UF4A 4CC2A 1FMKA 5IHIA 2GNCA 2A08A 2JS0A 1Z9QA 4OMPA 2M51A 3I9QA 1NG2A 1T3SA 4JZ4A 4M4ZA 2EYZA 2FPFA 3O5ZA 3VS4A 2JW4A 3VS2A 1U3OA 5ECAA 4LN2A 1T3LA 2YUOA 3EG3A 1UUEA 1I07A 4J9EA 1OOTA 1SSHA 2J6KA 2CH4A 2GBQA 1UHFA 1TG0A 2KYBA 1BK2A 3PVLA 2KRSA 2DBMA 1JXOA 4J9CA 3THKA 2LMJA 3QWYA 1JO8A 5IXBA 3I5RA 2EGEA 1GCQC 1SHFA 1IO6A 1W6XA 1PKSA 2CDTA 1BB9A 4RTZA 2DJQA 4OMQA 1U5SA 5FWBA 1K1ZA 1AWJA 1AWWA 2JT4A 2J7IA 2ED1A 1UTIA 1SEMA 2NUZA 1XOVA 2CREA 4IIMA 1K0XA 1A0NB 4HCKA 2LNHB 2FPDA 1KIKA 3VS3A 1QKXA 1VYUA 2KXCA 4LE9A 3NPFA 1NEBA 4CC7A 2L0AA 3VS6A 2XMFA 3VRYA 1X6BA 2ECZA 1AVZC 3CQTA 2KT1A 4F14A 2DL4A 2W10A 2L3SA 5IXFA 2DLPA 1GCPA 4RTWA 2KRNA 3NHNA 1S1NA 2HSPA 2EKHA 4J9DA 2EBPA 4F16A 2OI3A 2HEQA 3SHWA 1CKAA 1WDXA 3H0HA 2VKNA 1EFNA 1PWTA 4K11A 2EYWA 4Z8AA 3EG1A 2B86A 2GTJA 2F2XA 2O9SA 4RTUA 3R6NA 1ZLMA 1W70A 3H41A 2L3PA 1WA7A 2J06A 2GQIA 2DRMA 2HDAA 2YUNA 1NLPC 1BBZA 2M0YA 1AWOA 4WCIA 2K2MA 1UDLA 2CT4A 3EHRA 1LCKA 2H8HA 2D1XA 2AKLA 2KGTA 2DA9A 1AZGB 4J9GA 1H8KA 1X69A 2V1QA 5IH2A 4J9FA 1OPLA 1CKBA 2BTTA 4OMOA 1Y0MA 1JEGA 2FG0A 2JTEA 2CT3A 5FW9A 2D0NA 4Z89A 2KYMA 1YWOA 2RQUA 2E5KA 2K6DA 1X27A 2O9VA 1X2KA 2ESWA 1OEBA 2SEMA 2KROA 1HJDA 3ULRB 2DYBA 1UHCA 4J9IA 1GBRA 2RN8A 1KJWA 4HVWA 1JQQA 1SPKA 1WFWA 2J05A 2LJ3A 4E6RA 4EIKA 2RQWA 2ROTA 1X2QA 1GL5A 3VRZA 3H0FA 1B3QA 1YCSB 2IIMA 3VS7A 1RI9A 4CC3A 1T0HA 2DM1A 1G83A 2LP5A 3JV3A 5I22A 4R0KA 1ZUYA 1NEGA 2CUBA 1PKTA 2BZXA 3FJ5A 2CH4W 3UA6A 3M0SA 1WXBA 3I35A 2DRKA 1K9AA 2SRCA 1H3HA 1B07A 4LUDA 2DL7A 2NWMA 2LJ0A 1ZX6A 1E6HA 5IHNA 4JJDA 2D8HA 2MIOA 3M0RA 4ESRA 2FPEA 3VS5A 1KSWA 1YNZA 2KT8A 3IQLA 2EGCA 3I5SA 3ZL7C 4HXJA 1GCQA 4JPBW 1GBQA 1AEYA 1JU5C 3NGPA 5FWCA 2OAWA 1K0SA 2YUPA 4AFQC 1AZEA 3REAB 2YUQA 1WXTA 1V1CA 2RF0A 4JJCA 4X1VA 2DL8A 2G6FX 2K79A 2J6OA 1X6GA 3TSZA 3TVTA 3A98A 3U23A 4D8KA 4AFSC 4IIOA 4JJBA 3SEMA 1W1FA 2JM8A 1KFZA 3M0PA 1RLPC 2L2PA 1J3TA 1FYNA 3UA7A 1WIEA 3M0QA 1AWXA 2GGRA 2EYYA 2F2VA 2L3QA 2BZ8A 1YWPA 2YT6A 4D8DA 2FRYA 2RQVA 2C0OA 2ENMA 4RTVA 1X43A 2LZ6B 2K7AA 2JXBA 2A28A 4JZ3A 1Z9ZA 2FEIA 1NM7A 4HVUA 2RQRA 1CSKA 2DL3A 4AG2C 3PE0A 1AD5A 1WYXA 2VVKA 4LUEA 1HD3A 2FRWA 1BU1A 2KNBB 1QLYA 1TUDA 5HCKA 4FSSA 1PRLC 2BZYA 2EVRA 2YSQA 2KXDA 2ABLA 2J6FA 1T0JA 2EGAA 4ZNXA 2RQTA 2A37A 2JM9A 1UFFA 2HCKA 3REBB 2DF6A 2HBWA 3QWXX 4AFUC 2DBKA 1AOJA 2VWFA 4LNPA 2K3BA 2LX7A 3RNJA 4J9BA 1MV0B 1K76A 1RLQC 1PNJA 2CSIA 2I0NA 5EC7A 4QT7A 2LQNA 1SRLA 1QWFA 2KEAA 3PVQA 2D8JA 2OJ2A 3LH5A 1UJ0A 4AFZC 2EW3A 1E7OA 2DE0X 4RTTA 1M27C 5GJVB 3EG2A 1E6GA 3EG0A 2AKKA 1UG1A 2AZVA 2KE9A 4GLMA 3C0CA 2DL5A 1WLPB 1VYTA 1TUCA 4J9HA 2LCSA 2F2WA 3UATA 4Z88A 1UE9A 3GBQA 1OV3A 2JMCA 2GTOA 1K4US 4ORZA
chains in the Genus database with same CATH superfamily
3RKYA 3EHQA 1TTHB 3OW2S 3JB9I 4BI4A 3GOXA 2EQMA 2RHIA 2RMOA 2MOXA 1WHKA 3JCMf 1Q7YU 1QWEA 1V29B 5GJWB 4OGEA 5KYYA 3EGXB 1ZUKA 1M3AA 3H8ZA 5IHKA 4XTXA 4ZTFA 2K9GA 5J3BA 4VUBA 2DMOA 3MEVA 3ZFJA 1SKUB 2QDLA 1YJWT 1RUWA 1FXXA 2QA4A 1ZBJA 1MUZA 2R5MA 1NYFA 1YJNA 5D6WA 1UECA 2DILA 1NLOC 1S72Q 2E4HA 2EAYA 3OSVA 3CMEA 3OYYA 1YN8A 1YHQT 4M7AA 5GAN3 1QMCA 3OSSC 4Y92A 3CC4T 4OMMA 1X01A 4RTXA 2RNAA 4R56A 1M1KR 1QCFA 4M78G 4A63B 1AHJB 5GAN8 2X4WA 2YDLA 3DB3A 2FO0A 3CCJT 1OPKA 1M2OA 1VQ6A 2JTFA 3OYBA 3DLMA 3VS0A 2X3WD 3OYJA 3CCVQ 1BI0A 2PZ1A 4M7DF 8ATCB 4PJOE 4JRIA 1YI2A 4DEXA 2LCCA 3BW1A 1QKWA 3GLXA 2DTIA 3M59A 5GAOn 3OYMA 1GFDA 1N5ZA 2EFIA 4N4HA 5CVIA 3OYNA 1ZSGA 4M77B 3URGA 1FMKA 5IHIA 3DLLA 2EJGA 1QCNA 2K5LA 4E7ZA 1Z9QA 4OMPA 4M4ZA 2EYZA 2QA4T 3VS4A 1YJNT 4QVZA 1U3OA 5ECAA 2HZYA 1M90U 3CMET 1UUEA 3JCMb 3NFCA 4FYWB 4MZMA 4ZGJB 5KE3A 2MWPA 1ZA1B 2J6KA 4O5VA 4B6MA 5GMKl 2CH4A 3CCJQ 1D3BB 1UHFA 3E2UA 3CCEA 3PVLA 2DBMA 4J9CA 3THKA 1VQ5A 4A4FA 5GANj 1JO8A 2G3RA 1M5Q1 5IXBA 1C0MA 1WJRA 4C92A 4RTZA 2DJQA 1U5SA 2LRQA 1LPLA 1K1ZA 1AWWA 3L2RA 3VYHB 2KVQG 3MKDA 4XU3A 1YI2T 1UTIA 2NUZA 1KHIA 1XOVA 1TOVA 4ELZC 4HCKA 1QKXA 3S6WA 2KXCA 4CC7A 3VS6A 2YRCA 3VRYA 2QEXA 2MF2A 4AMCA 1OU8A 2P0KA 3JCMJ 3EFRA 4KUIA 2W10A 2QA4Q 4M75C 3I55Q 5GAOp 1VQ7T 3CCMQ 3A8MB 2DZCA 2QQSA 1RI0A 2HSPA 2EKHA 1N8RC 2FZKB 4C5HA 2VC8A 2CP5A 4IUUA 5I21A 1EFNA 4J7FA 3JB9H 2O9SA 1OYXA 3QXEB 4J8OA 2O01E 2COWA 3CCET 1VQ6Q 2XG8D 2EQUA 1VQ5T 3CC7A 1NLPC 5A0GA 1G8XA 2M0YA 3QG1A 4FSXA 2JZ2A 4Y28E 1OULA 1WPYA 4X9CA 2NUPB 2E70A 3OS2A 4J9GA 1Y7XA 4PLIA 4C0GA 2V1QA 4J9FA 1JJ2A 4V2SA 4M77E 3OYLA 1DJ7B 1WGSA 4EMKA 1XTDA 2CT3A 4Z89A 2FYKA 2IG0A 2QEXT 1OEBA 2KROA 2VUBA 4J9IA 4QVDA 1KJWA 4J6YA 1WFWA 3QYHB 1M4ZA 2ROTA 3H0FA 4GY5A 2GQVA 1RI9A 2JVVA 2LP5A 4R0KA 2QQ9A 4Y91A 1ZUYA 3BY7A 6AT1B 2DERA 3FJ5A 5KCHA 4C5EA 2KDSA 4DA4A 1H3HA 4LD6A 4MMKA 4A54A 2HQEA 1E6HA 3CC7T 4JJDA 5GAN6 3MJXA 4ESRA 1I8FA 1KSWA 3CC2A 2E10A 3JSCA 1YCYA 1GCQA 1AEYA 2MMPA 1WQWA 5FWCA 1K0SA 2YUPA 4XTZA 4A4GA 2D6FA 1AZEA 2F5TX 3ZEHA 2M0OA 2L5QA 1WXTA 1V1CA 4JJCA 1NJIR 4QQ6A 2KY9A 2XIDA 1Q81R 1K8AU 2WSCE 5CIUA 5GAMj 4C8QA 3TSZA 3TVTA 4EMGA 3A98A 3M56A 2H3JA 4KH0B 4JJBA 1W1FA 4OB2B 1KFZA 3M0PA 1RLPC 4JLIA 2A7YA 2KQWA 1SF9A 2YLBA 1Q82U 2LDMA 3UA7A 4C0DB 3A5ZB 2VGMA 4AT1B 2OTJA 4BE0A 2BZ8A 2FRYA 4O6JA 2EQJA 4E2FB 3CMAQ 1KD1U 2K7AA 5GANe 4LD9K 1Z9ZA 1R0BG 4HVUA 1CSKA 2QQRA 2BKDN 1VQNA 5LJ3j 4HCCA 2DD5A 2O4XA 4N4GA 4HT9A 3C4SA 3WVEB 1PC0A 1WYXA 3PMIA 1N6AA 4HCBA 3CCQA 3X28B 3TEEA 1QVFP 3MP8A 4M7DB 2ATCB 2KXDA 3M9QA 5CQYA 3EFOA 4ZNXA 2JM9A 1UGQB 3REBB 3T9NA 4BD3A 2LTOA 1UGSB 3QWXX 3WVDB 4AFUC 3PTAA 1X75C 5LJ5h 4ATOA 1AOJA 2K3BA 5KYUA 5C0MA 4GLKA 1RL2A 4UC4A 4A4KA 4J9BA 2CSIA 4QQDA 1UGPB 1JRIA 4M78A 1Y07A 2OTJT 3L2ZA 4NL2A 3DB4A 1EX4A 1WQ7A 5KCOA 3CCRA 2KEAA 2K4YA 1JB0E 2QQBA 5A0LA 3PGGA 4RTTA 4DBFA 3M53A 5HY6A 2E5QA 1E6GA 1VQNT 2KE9A 3CC2Q 5IT9E 1TUCA 3JCMe 1BIAA 3OYFA 2F2WA 4Z88A 3CCQT 1UE9A 5FU7B 3F70A 5GMKm 1K9MU 3RDVA 3QZ5B 2RK2A 3CEYA 4XTYA 3VU3C 4LDVA 1K4US 2DZ9A 1PSEA 2PTKA 2HQHA 5GAN2 4IKFA 1VQ9A 1O9SA 2LQWA 5GMKj 3SD4A 4C0FA 1MNDA 3LGLA 3HHTB 2DTOA 2E6ZA 2PNIA 2KBTA 2XHCA 1HYOA 2HSEB 1BI3A 3OB9A 1YJ9A 2YRVA 4ELYC 2DYIA 3RUXA 1PRMC 2GF7A 1SHGA 3RMSA 3EFSA 1VA7A 3CCUQ 3NTIA 4E7LA 3CCRT 5CQXA 1VQKQ 3M5AA 1RAEB 3CPFA 1PD0A 5AYFA 1U8RA 4F17A 1OQKA 5L8RE 2M1HA 3G6EQ 4DOWA 1QVFA 1VIEA 4M7DE 1FMWA 1N8RR 1WNLA 1ZHIA 1GRIA 2ZGWA 2X3XD 1W2BP 5LJ5g 1U1TA 3LWIA 3MEWA 5I11A 5J39A 2DVJA 4DBQA 4F7UB 1PCXA 2DNUA 1W4SA 3LWHA 5FLXE 2E1HA 1NE8A 3CCVA 4PNOA 1SRMA 1NZ9A 3PMTA 2QAZA 2CUDA 4OMNA 3MEUA 1VQ8Q 2AZSA 4DEYA 4HT8A 1H3ZA 1WHHA 3PNWC 3RBBB 3E9GA 1G2BA 2EKOA 4OMLA 2O31A 3CPWS 4FCYA 1WI7A 4KH1B 1YJ9T 3LLRA 3PFSA 2GCXA 4OB1B 1Q7YC 3UF4A 2CZ7B 4BE1A 3UT1A 5KYYB 4C8QF 1Q95G 3VS2A 5LJ3e 3FIFA 3CXCS 3JB9J 1T3LA 1ZBXA 1YBYA 2YUOA 1S72T 2OTLQ 3MP6A 2GBQA 2KYBA 1I81A 1BK2A 2KRSA 3HP9A 4M7AB 1FWZA 2MK5A 3I5RA 2EGEA 4L59A 3OS0A 4D6WA 1IO6A 1W6XA 1PKSA 1VQ9Q 4OMQA 5FWBA 4PK4A 5HK3A 2JT4A 3NTKA 4RKUE 2YHTA 1KC8U 3CCVT 4PJOC 1YJ9Q 1A0NB 1Y96A 2FPDA 1KIKA 3EH2A 2ZZDA 3JCMc 1G3WA 1X6BA 1P92A 1VIFA 2VV5A 2XU8A 3HSBA 2XKOC 2KT1A 3N5BB 4F14A 2LCLA 2L3SA 2DLPA 5LJ5d 1GCPA 3SWNC 3I55A 5D6YA 2EBPA 2CS7A 3MP1A 3CCMA 2HEQA 3SHWA 1IHVA 3ME9A 3ZBDA 4KGZB 1WDXA 3ASKA 2NYSA 4M78F 2AT1B 2PUOB 4XU1A 1OI1A 1M90C 2XICA 1JBMA 2GTJA 1VUBA 1BYMA 2F2XA 3HL8A 4RTUA 2CP7A 1D0XA 3JCMW 1W2BA 4N0AC 2J06A 2QG9B 2YUNA 4B9WA 4F7UE 3CCLA 1BBZA 4BACA 4RMOA 1KK7A 4M7DD 4CRIA 1AWOA 1UDLA 3EHRA 4IUPA 3TREA 1LCKA 5GMKe 2KGTA 1TH7A 2DA9A 4BDYA 3GNGA 5IH2A 1BKBA 4C92B 1CKBA 4X34A 2K3XA 2E3HA 2V8IA 3OBYA 1JJ2P 2F5KA 2E12A 1KQSP 2D0NA 2GFUA 2KYMA 5CR2A 2E5KA 1LNXA 2ESWA 3ULRB 3R6OA 3KUFA 3OMGA 4OB0B 4HVWA 2QGGA 1SPKA 2COZA 4IURA 1K73U 3I55T 2RJCA 5GAOl 2DKGA 1T0HA 3CCMT 2JUFA 2ZAEA 1G83A 5GAMh 5IAYA 3OYKA 1QVGP 2BZXA 4M7AE 2HD0A 1YITQ 3I35A 2RK1A 4KUDK 1B07A 2DL7A 1OU9A 2P84A 2LJ0A 2X35A 2PQWA 4J6WA 3LGFA 3UWNA 4MZPA 3CCLT 1VQ6T 2X4JA 3S3NA 3SB2A 4PLLA 3M0RA 2ZPEB 3RERA 2FPEA 1RAFB 4II1A 3VS5A 3IQLA 2RD1A 1N27A 4HXJA 5LJ3h 4IUTA 2MYSA 3P8DA 4LDYA 4M77C 2B8AA 4IUQA 2RH2A 3NGPA 3LYIA 3HRTA 2QI2A 2P4TA 3HTRA 3WXMB 1IXDA 3REAB 2YUQA 1MMAA 5KE2A 2DL8A 5CKDA 2G6FX 4EMKB 2ZPBB 2RI2A 3U23A 2PU9B 4AFSC 1VQPA 3SEMA 2XDDA 2JM8A 2CP0A 2L2PA 1BI2A 1FYNA 1WIEA 4M75A 2A3LA 2DEUA 2K5IA 2GGRA 4EMHA 2EYYA 2F2VA 1RABB 1YWPA 2YT6A 2DD4A 1X43A 2LZ6B 3RR6A 2DIQA 2QXFA 3CCLQ 3BDLA 2A28A 3CMAA 5J26A 3QJYA 1R77A 1RACB 3PE0A 4C92E 4KULA 3G71Q 4E7HA 3GPLA 4ZN1A 4LUEA 3CBMA 2KMTA 1BU1A 1XNIA 1KQSA 2EVRA 2YSQA 2MI6A 3S3OA 4PFPA 4PJOD 1UEBA 3JB9D 2NLUA 2OAUA 2A37A 2HCKA 2HBWA 3OQ5A 2DBKA 9ATCB 2LX7A 4J6XA 4OMFB 3RNJA 1M2VA 1K8AC 3QYGB 5GAMg 3X24B 2DK3A 4B9XA 1SSFA 4FU6A 1RLQC 4F7UG 1QVGA 4XTVA 2V8KA 5EC7A 3QZ9B 2ZCFB 3OY9A 3EAEA 4C8QB 2LQNA 1SRLA 1Q82C 4ANJA 3G7ZA 2I2LA 2KAFA 3HRSA 2PVDB 2D8JA 3L2WA 1UJ0A 4PJOG 2E64A 3JB9G 1M27C 5FROA 4FIBA 5GJVB 4JDSA 2MWOA 1KD1C 3CMAT 4JRKA 4PFOA 2MPXC 3EG0A 4M7AD 3SFMA 4GLMA 4WTOB 3C0CA 3GF5A 5LJ3g 1WLPB 1I5LA 4ZN3A 1I5OB 2O4XB 3GBQA 3OYHA 1OV3A 2JMCA 2CP6A 4DOVA 3DKMA 4RCCA 1PM3A 3OYCA 3G1JA 2E65A 4PJNA 1OZ3A 4AG1C 2BE7D 1I1JA 1PSFA 2KI7A 3MHXA 3TSWA 1ABOA 4KGVB 4XU0A 3A8OB 2XD0A 1SG5A 1VQPQ 2K57A 4M7AG 3OYIA 2JN0A 1U06A 4KT0E 3META 4NOYA 3A8LB 2L89A 2RA2A 3M57A 1VQ4Q 2C0IA 1AT1B 5KYUB 1Y57A 1ABQA 2DPPB 3PT9A 5GAN5 4FYXB 3FC3A 2ROLA 1WHGA 2BE9B 3AHUA 2JNGA 2VASA 2DX1A 2KRMA 3CCUA 1IGQA 4HVVA 1M30A 1M3CA 2AK5A 4M78B 2JMAA 5KYWA 3L2UA 1VQKA 2E41A 2QK0A 5M9OA 5D7UA 1UB4A 1TSFA 4PJMA 3JCMQ 3G6EA 3OYAA 1PHTA 1NYGA 2LC4A 5GAMd 3CC2T 1WXUA 1O75A 1ZA2B 4C92D 8AT1B 3OW2A 1UGVA 5KYNA 1EZZB 1M1GA 2O88A 1WZOA 4XQ3A 3QIIA 1K9MC 1M90R 3S3MA 2HBPA 4M77D 3V7SA 3J80E 1JXMA 2MCNA 4HKEA 3NMZC 4MDWA 1D1BA 1HSQA 2FHDA 1Q86C 2RPNA 1GFCA 3OYGA 1I0CA 3HPWA 4C8QE 1MHNA 4L6V5 1VQ8A 4C0DC 5LJ3d 3EGDA 2LT4A 4JS5A 3L2VA 5LJ5f 3M0TA 2X51A 5FRMA 4GBQA 4DBHA 2DO3A 2R5AA 3V8LA 4C92G 1F1BB 3VUZA 1M1KU 2JS0A 4E7JA 3D7SB 4NS5A 2M51A 2JTMA 3CCUT 1NG2A 1T3SA 4JZ4A 2FPFA 1VQKT 1R8OB 2JW4A 4M77G 2F1LA 2X4XA 3EG3A 3CD6Q 1WJSA 4J9EA 3JCMX 4M75F 5DY9A 2X4YA 3G6ET 2VXEA 2OTLA 4M7DC 1JXOA 2C06A 2RJEA 3BE3A 3QWYA 3FLGA 1SHFA 2CDTA 1BB9A 3C94A 3QJ6A 1AWJA 4PJLA 3FRNA 3JRZA 2J7IA 3RESA 2E6NA 3TU4K 1SEMA 2M16A 2CREA 4IIMA 2LNHB 3VS3A 1M8VA 3QHSA 1VYUA 1R0CB 4LE9A 3NPFA 1NEBA 1VQ8T 2YXYA 2L0AA 2D9TA 4HCZA 1YFNA 3EH1A 1JJ2S 4XU2A 1AVZC 4JRQA 4M78E 2EYQA 2DL4A 2CZ6B 5IXFA 2DIGA 4BE2A 5D6XA 4RTWA 2KRNA 3NHNA 1S1NA 2RJDA 5KYXA 4J9DA 4F16A 2WACA 1CKAA 5FRNA 2GFAA 3H0HA 2VKNA 4K11A 2EYWA 4Z8AA 1HXDA 2B86A 4ZTJA 5FU7C 2LQ8A 4E7KA 2KK4A 1W70A 2E3IA 2OTLT 4OGCA 4MDXA 3H41A 2L3PA 1WA7A 4FL6A 3UDCA 2CT4A 3M55A 1U1SA 2XI9A 1QP3A 4WF2A 2AKLA 2COYA 3BDUA 2IPOB 1VQ9T 1B34A 5GANh 1AZGB 1XQHA 1H8KA 2R58A 3JAME 1X69A 1TXQA 1OPLA 1ZSZB 5GAN7 2Y90A 2BTTA 1KC8C 1JEGA 2JTEA 1NPRA 2P0PA 1YWOA 2FB7A 2RQUA 2K6DA 4LXCA 3QDRB 2NUTA 1X27A 2O9VA 1X2KA 2AHJB 1Y96B 4C8QD 2LNVA 1UHCA 2VXFA 5CK9A 5KH6A 3FB9A 4RG8A 5CKFA 3RKWA 2LJ3A 4E6RA 4EIKA 2RQWA 3PIOA 1X2QA 1GL5A 3I56A 1YCSB 2IIMA 3QKJA 3VS7A 2DXBA 2DM1A 3JV3A 4JLGA 2CUBA 2V26A 2CH4W 3UA6A 3M0SA 1WXBA 1YJWA 3FEOA 3BFMA 2DRKA 2NWMA 1YITA 2PVOB 2DEQA 4X9DA 2VB6A 1YHQA 1Q82R 1LVKA 2YWWA 2HMAA 3CC4A 2F69A 1RAGB 1ZSZC 3O8VA 3P8BB 3HFNA 2RI3A 4F7UA 1KD1R 1GBQA 1JU5C 4PJJA 4E7SA 5LJ5j 2D0QB 2AIRB 4AFQC 3JCMh 3GIBA 4NL3A 4PJOA 1BCMA 2RF0A 2QTXA 4Q5WA 2JJ9A 5A2QE 2J6OA 2LX9A 5HK0A 4D8KA 1H641 2YRDA 4BDZA 2XDBA 4M78D 2M02A 3I56T 3MO8A 1J3TA 4BB7A 1K73C 3SDZA 1AWXA 1EIFA 3A1PA 2L3QA 3LH0A 4D8DA 2RQVA 3SWNA 2C0OA 1MMGA 4M7AC 4JZ3A 4C0ZA 1NM7A 1YITT 5GANg 1NBEB 3OS1A 2DL3A 1IREB 1GXIE 4N0AA 1NJIU 3G71A 1Q81U 1VQLQ 2FRWA 3EG9A 1B7TA 3LX7A 2KNBB 2LVMA 1TUDA 4XK8E 1PRLC 4FT4A 3JCMP 4ZGDB 1T0JA 4XTWA 2RQTA 1WHMA 2DXUA 2DF6A 1N9RA 2K2VA 1IB8A 1V76A 1C6VX 2VWFA 2Z0WA 3EGXA 2CKKA 3QUIA 4M7DG 2Y4XA 3I56Q 3X26B 1VQMA 2FVUA 4EPCA 3MCAB 1K9MR 4A4HA 1PNJA 3E9FA 4KGXB 5GAN4 1WJQA 1OX8A 3OBWA 1D09B 2HNIA 2RI5A 3L42A 1VQOA 1YJWQ 2HAXA 1RAHB 1Q86R 1KQ2A 3PVQA 2OJ2A 2IVWA 1G3TA 1VQ7A 4CI0C 4E7IA 3GP8A 4M75B 3INZA 2EJFA 3JCMV 1YHQQ 3VKIA 5GAMf 1YIJA 3C95A 3A8HB 2AKKA 3CC4Q 2DVEA 2DL5A 2ZPGB 3OA6A 1VYTA 4C92C 7AT1B 2ZPFB 3CBPA 3G71T 2FZGB 3UATA 1HK9A 3JCMg 1RAIB 2BIVA 3G4SA 1QVFS 2CZ0B 1PG5B 4ORZA 4FW2A 1KQ1A 5LJ3f 1YP5A 4M77A 4OB3B 3CPWP 1H92A 4N4IA 5GANd 3E1SA 1VQMT 1WX6A 2A36A 3KFVA 2P0QA 4BI3A 4E47A 3VS1A 1KG1A 1MV3A 4HA8A 1M2VB 3H0IA 1VQ4A 1VOMA 1TS9A 2ZPIB 1M8MA 1VQOT 4CC4B 1KHCA 1MMNA 3QSUA 1YJNQ 1ARKA 1ACMB 2DXTA 1VYVA 3J81E 5CAIA 5CCAA 3CXCP 1FMVA 2QYZA 4OP0A 3CMEQ 2P4RA 2CSQA 2LQKA 1D3BA 3V8KA 1YIJT 1PD1A 1TU0B 4Z02A 3QDFA 4YTLA 2V1RA 1WHLA 2RO0A 2EIFA 4ZGEB 2C0TA 4J83A 1N9SA 1ZUUA 3VJPA 2ZPHB 4KRTA 5LJ5e 2JS2A 5L23A 4RUGA 4OVAA 3G4ST 1QP2A 3OW2P 4DBRA 2ED0A 1YI2Q 4EMKC 2W0ZA 4MMLA 1D0ZA 1VQMQ 3E19A 3EGUA 3M0UA 3V7CA 2O2OA 1M3BA 2KR3A 1UJYA 4F7UF 2LJ1A 2EYXA 2V8JA 1VQPT 5GMKh 2EPDA 4PFZA 4RTYA 3TQ7P 1VQOQ 5AT1B 2EQIA 4PJOF 1VQ4T 4CC2A 4M75E 3JB9F 3JCMd 1VQ7Q 2GNCA 1G5VA 1KC8R 2A08A 1N8RU 4TVRA 4P5NA 3I9QA 1YIJQ 5LL6S 2RHZA 4XTUA 2DFUA 3O5ZA 1RAAB 1Q7YR 2M9UA 4LN2A 1M1FA 2FL7A 2PUKB 1I07A 4IUVA 5I2SA 1OZ2A 3H6ZA 5KYWB 3C12A 1OOTA 1SSHA 3CCEQ 3CD6A 3Q1JA 4ME7A 1VQ5Q 1TG0A 3G4SQ 2NUPA 1QCOA 2LMJA 2VGNA 2WSEE 4FT2A 4QQGA 1GCQC 2RB6A 4J5YA 1W2BS 4A53A 3CPWA 2DAQA 4M7AF 2ED1A 3HRUA 3VUBA 4MZTA 3NTHA 2DTHA 3EFOB 3X20B 1K0XA 3VV0A 1IGUA 2YLCA 2QEXQ 4C8QC 2VYTA 2XMFA 5CKBA 2ECZA 2HKNA 2RM4A 3CQTA 4BUGA 1C1AA 4FW1A 3CXCA 3L1AA 3EGDB 2RHUA 2QQAA 1M1KC 2OI3A 5DLQE 1PWTA 3RMQA 5HKCA 1G3SA 3EG1A 4LDXA 2KSSA 3CD6T 3R6NA 1ZLMA 5I2MA 3CC7Q 4QW2A 1M9SA 3V8JA 1D0YA 2GQIA 2DRMA 3TCJA 2HDAA 3RKXA 3CCSA 4EDUA 1K73R 3GNFB 2QGFB 2RJFA 5FU6B 4WCIA 2K2MA 1D1CA 2CP2A 2H8HA 2D1XA 5CKEA 1RADB 2K3YA 2DJZA 1TUGB 2L8DA 2EQKA 4KBMB 4L5GA 2QASA 4OMOA 4JS4A 1XJWB 1Y0MA 2PVGB 1QW1A 2FG0A 5FW9A 3KXTA 4C92F 3H9NA 4QVCA 3MPUB 2SEMA 1Y71A 1HJDA 4JUVA 2DYBA 4M78C 1GBRA 2RN8A 4M77F 1JQQA 5GAOq 2J05A 3LW5E 2QDYB 2H3EB 4DQ2A 3VRZA 2BUDA 4M75D 1B3QA 4CC3A 1G3YA 3AT1B 5I22A 2HL3A 1NEGA 4FYVB 1PKTA 5KYXB 2A0FB 5GAOm 1D1AA 5DLOA 3OYDA 1K9AA 2SRCA 1UGRB 4LUDA 3HKSA 2K5FA 1ZX6A 3ER0A 5FU6C 4JJNK 4PKCC 2CGHA 3CCST 5IHNA 4BY6B 3VYGA 2CZ1B 1QQJA 3PIPA 4LDWA 2D8HA 2MIOA 4JRPA 4OF1A 4BI8B 2CYZB 4M7DA 2XDPA 5GMKi 2OX7A 3QPHA 1TWBA 1YNZA 2KT8A 1MNEA 3CBOA 2EGCA 3I5SA 3ZL7C 2RHXA 4J7IA 4M75G 4JPBW 3UPUA 3OYEA 2HQXA 3X25B 1I4K1 4R55A 2L3RA 1B34B 1IRXA 2OAWA 5CO7A 3J7AF 1MGQA 2EWNA 4X1VA 1KQSS 4FYYB 1Q86U 2K79A 3A8GB 1X6GA 2NUTB 4IIOA 2FZCB 1ZQ1A 2OTJQ 3M0QA 3M4YA 1NPPA 2ENMA 4RTVA 5DM7R 3CCSQ 1BCOA 1QVGS 4C5IA 4RG2A 4BY6C 2JXBA 1VQNQ 1IZ6A 2FEIA 1QVPA 2DETA 3M4GA 2RQRA 4LDUA 4AG2C 1FX7A 3QBYA 1AD5A 1S72A 4XAXB 3CCQQ 1WHJA 2VVKA 4RCBA 1HD3A 5EG2A 1VQLA 2CP3A 1X6OA 1QLYA 1BI1A 5HCKA 4FSSA 2BZYA 2ABLA 2J6FA 5IN1A 2EGAA 3P8HA 1UFFA 5GANf 4A4EA 2DXCA 2HKQB 4FM4B 1BIBA 3FJPA 4LNPA 5GAMe 2JOYA 3M54A 1LOJA 4PJOB 1MV0B 5C6SA 2LT1A 4QKUA 1K76A 1OX9A 2X9HA 3RIRA 5A0DA 2I0NA 5GAOr 3MEAA 3FDRA 4QT7A 3CCRQ 2R57A 2QTVA 5CKHA 1QWFA 1MMDA 3HFOA 2EJ9A 1K8AR 3LH5A 2RHYA 4AFZC 2EW3A 2MAMA 1E7OA 2DE0X 1LJOA 2HL5C 1IHWA 3M58A 3EG2A 4C5GA 3OS5A 3L2QA 3OMCA 2XK0A 3QO3A 3SWNB 4C8QG 4F04B 1UG1A 2AZVA 2Y4YA 4PL6A 4J9HA 2LCSA 1NJIC 3V7RA 3KBGA 1Q81C 3CCJA 1VQLT 2WSFE 1ZSZA 2GTOA 3EG9B
chains in the Genus database with same CATH topology
2PTKA 4AG1C 3EHQA 2LQWA 1I1JA 1YP5A 3TSWA 1ABOA 1H92A 2PNIA 2KBTA 1U06A 2RMOA 2MOXA 1WX6A 2A36A 3KFVA 1QWEA 1PRMC 2C0IA 5GJWB 3VS1A 1Y57A 1MV3A 1ABQA 1ZUKA 1M3AA 3H0IA 5IHKA 1SHGA 1VA7A 1M8MA 2ROLA 2K9GA 4CC4B 2DMOA 2QDLA 2DX1A 1RUWA 2KRMA 1ARKA 1VYVA 4HVVA 1M30A 1M3CA 1MUZA 1ZBJA 2AK5A 2JMAA 1NYFA 1UECA 2P4RA 2CSQA 1NLOC 2DILA 4F17A 1YN8A 2V1RA 4Y92A 4OMMA 1PHTA 4RTXA 2RNAA 1NYGA 2C0TA 1WXUA 1QCFA 1ZUUA 4A63B 1GRIA 4KRTA 2YDLA 2FO0A 1OPKA 2JS2A 5L23A 1UGVA 2X3XD 4RUGA 2O88A 3VS0A 5I11A 2X3WD 2DVJA 2ED0A 2DNUA 2PZ1A 2W0ZA 1JXMA 2MCNA 1SRMA 4DEXA 3NMZC 3EGUA 3M0UA 1HSQA 1QKWA 2CUDA 4OMNA 2O2OA 1M3BA 2RPNA 1GFCA 2KR3A 1UJYA 2AZSA 4DEYA 1I0CA 3RBBB 2LJ1A 2EYXA 1G2BA 4OMLA 1N5ZA 2O31A 1GFDA 1WI7A 2EPDA 1ZSGA 4RTYA 3M0TA 2EQIA 4GBQA 3UF4A 4CC2A 1FMKA 5IHIA 2GNCA 2A08A 2JS0A 1Z9QA 4OMPA 2M51A 3I9QA 1NG2A 1T3SA 4JZ4A 4M4ZA 2EYZA 2FPFA 3O5ZA 3VS4A 2JW4A 3VS2A 1U3OA 5ECAA 4LN2A 1T3LA 2YUOA 3EG3A 1UUEA 1I07A 4J9EA 1OOTA 1SSHA 2J6KA 2CH4A 2GBQA 1UHFA 1TG0A 2KYBA 1BK2A 3PVLA 2KRSA 2DBMA 1JXOA 4J9CA 3THKA 2LMJA 3QWYA 1JO8A 5IXBA 3I5RA 2EGEA 1GCQC 1SHFA 1IO6A 1W6XA 1PKSA 2CDTA 1BB9A 4RTZA 2DJQA 4OMQA 1U5SA 5FWBA 1K1ZA 1AWJA 1AWWA 2JT4A 2J7IA 2ED1A 1UTIA 1SEMA 2NUZA 1XOVA 2CREA 4IIMA 1K0XA 1A0NB 4HCKA 2LNHB 2FPDA 1KIKA 3VS3A 1QKXA 1VYUA 2KXCA 4LE9A 3NPFA 1NEBA 4CC7A 2L0AA 3VS6A 2XMFA 3VRYA 1X6BA 2ECZA 1AVZC 3CQTA 2KT1A 4F14A 2DL4A 2W10A 2L3SA 5IXFA 2DLPA 1GCPA 4RTWA 2KRNA 3NHNA 1S1NA 2HSPA 2EKHA 4J9DA 2EBPA 4F16A 2OI3A 2HEQA 3SHWA 1CKAA 1WDXA 3H0HA 2VKNA 1EFNA 1PWTA 4K11A 2EYWA 4Z8AA 3EG1A 2B86A 2GTJA 2F2XA 2O9SA 4RTUA 3R6NA 1ZLMA 1W70A 3H41A 2L3PA 1WA7A 2J06A 2GQIA 2DRMA 2HDAA 2YUNA 1NLPC 1BBZA 2M0YA 1AWOA 4WCIA 2K2MA 1UDLA 2CT4A 3EHRA 1LCKA 2H8HA 2D1XA 2AKLA 2KGTA 2DA9A 1AZGB 4J9GA 1H8KA 1X69A 2V1QA 5IH2A 4J9FA 1OPLA 1CKBA 2BTTA 4OMOA 1Y0MA 1JEGA 2FG0A 2JTEA 2CT3A 5FW9A 2D0NA 4Z89A 2KYMA 1YWOA 2RQUA 2E5KA 2K6DA 1X27A 2O9VA 1X2KA 2ESWA 1OEBA 2SEMA 2KROA 1HJDA 3ULRB 2DYBA 1UHCA 4J9IA 1GBRA 2RN8A 1KJWA 4HVWA 1JQQA 1SPKA 1WFWA 2J05A 2LJ3A 4E6RA 4EIKA 2RQWA 2ROTA 1X2QA 1GL5A 3VRZA 3H0FA 1B3QA 1YCSB 2IIMA 3VS7A 1RI9A 4CC3A 1T0HA 2DM1A 1G83A 2LP5A 3JV3A 5I22A 4R0KA 1ZUYA 1NEGA 2CUBA 1PKTA 2BZXA 3FJ5A 2CH4W 3UA6A 3M0SA 1WXBA 3I35A 2DRKA 1K9AA 2SRCA 1H3HA 1B07A 4LUDA 2DL7A 2NWMA 2LJ0A 1ZX6A 1E6HA 5IHNA 4JJDA 2D8HA 2MIOA 3M0RA 4ESRA 2FPEA 3VS5A 1KSWA 1YNZA 2KT8A 3IQLA 2EGCA 3I5SA 3ZL7C 4HXJA 1GCQA 4JPBW 1GBQA 1AEYA 1JU5C 3NGPA 5FWCA 2OAWA 1K0SA 2YUPA 4AFQC 1AZEA 3REAB 2YUQA 1WXTA 1V1CA 2RF0A 4JJCA 4X1VA 2DL8A 2G6FX 2K79A 2J6OA 1X6GA 3TSZA 3TVTA 3A98A 3U23A 4D8KA 4AFSC 4IIOA 4JJBA 3SEMA 1W1FA 2JM8A 1KFZA 3M0PA 1RLPC 2L2PA 1J3TA 1FYNA 3UA7A 1WIEA 3M0QA 1AWXA 2GGRA 2EYYA 2F2VA 2L3QA 2BZ8A 1YWPA 2YT6A 4D8DA 2FRYA 2RQVA 2C0OA 2ENMA 4RTVA 1X43A 2LZ6B 2K7AA 2JXBA 2A28A 4JZ3A 1Z9ZA 2FEIA 1NM7A 4HVUA 2RQRA 1CSKA 2DL3A 4AG2C 3PE0A 1AD5A 1WYXA 2VVKA 4LUEA 1HD3A 2FRWA 1BU1A 2KNBB 1QLYA 1TUDA 5HCKA 4FSSA 1PRLC 2BZYA 2EVRA 2YSQA 2KXDA 2ABLA 2J6FA 1T0JA 2EGAA 4ZNXA 2RQTA 2A37A 2JM9A 1UFFA 2HCKA 3REBB 2DF6A 2HBWA 3QWXX 4AFUC 2DBKA 1AOJA 2VWFA 4LNPA 2K3BA 2LX7A 3RNJA 4J9BA 1MV0B 1K76A 1RLQC 1PNJA 2CSIA 2I0NA 5EC7A 4QT7A 2LQNA 1SRLA 1QWFA 2KEAA 3PVQA 2D8JA 2OJ2A 3LH5A 1UJ0A 4AFZC 2EW3A 1E7OA 2DE0X 4RTTA 1M27C 5GJVB 3EG2A 1E6GA 3EG0A 2AKKA 1UG1A 2AZVA 2KE9A 4GLMA 3C0CA 2DL5A 1WLPB 1VYTA 1TUCA 4J9HA 2LCSA 2F2WA 3UATA 4Z88A 1UE9A 3GBQA 1OV3A 2JMCA 2GTOA 1K4US 4ORZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTK A;  4AG1 C;  3EHQ A;  2LQW A;  1I1J A;  1YP5 A;  3TSW A;  1ABO A;  1H92 A;  2PNI A;  2KBT A;  1U06 A;  2RMO A;  2MOX A;  1WX6 A;  2A36 A;  3KFV A;  1QWE A;  1PRM C;  2C0I A;  5GJW B;  3VS1 A;  1Y57 A;  1MV3 A;  1ABQ A;  1ZUK A;  1M3A A;  3H0I A;  5IHK A;  1SHG A;  1VA7 A;  1M8M A;  2ROL A;  2K9G A;  4CC4 B;  2DMO A;  2QDL A;  2DX1 A;  1RUW A;  2KRM A;  1ARK A;  1VYV A;  4HVV A;  1M30 A;  1M3C A;  1MUZ A;  1ZBJ A;  2AK5 A;  2JMA A;  1NYF A;  1UEC A;  2P4R A;  2CSQ A;  1NLO C;  2DIL A;  4F17 A;  1YN8 A;  2V1R A;  4Y92 A;  4OMM A;  1PHT A;  4RTX A;  2RNA A;  1NYG A;  2C0T A;  1WXU A;  1QCF A;  1ZUU A;  4A63 B;  1GRI A;  4KRT A;  2YDL A;  2FO0 A;  1OPK A;  2JS2 A;  5L23 A;  1UGV A;  2X3X D;  4RUG A;  2O88 A;  3VS0 A;  5I11 A;  2X3W D;  2DVJ A;  2ED0 A;  2DNU A;  2PZ1 A;  2W0Z A;  1JXM A;  2MCN A;  1SRM A;  4DEX A;  3NMZ C;  3EGU A;  3M0U A;  1HSQ A;  1QKW A;  2CUD A;  4OMN A;  2O2O A;  1M3B A;  2RPN A;  1GFC A;  2KR3 A;  1UJY A;  2AZS A;  4DEY A;  1I0C A;  3RBB B;  2LJ1 A;  2EYX A;  1G2B A;  4OML A;  1N5Z A;  2O31 A;  1GFD A;  1WI7 A;  2EPD A;  1ZSG A;  4RTY A;  3M0T A;  2EQI A;  4GBQ A;  3UF4 A;  4CC2 A;  1FMK A;  5IHI A;  2GNC A;  2A08 A;  2JS0 A;  1Z9Q A;  4OMP A;  2M51 A;  3I9Q A;  1NG2 A;  1T3S A;  4JZ4 A;  4M4Z A;  2EYZ A;  2FPF A;  3O5Z A;  3VS4 A;  2JW4 A;  3VS2 A;  1U3O A;  5ECA A;  4LN2 A;  1T3L A;  2YUO A;  3EG3 A;  1UUE A;  1I07 A;  4J9E A;  1OOT A;  1SSH A;  2J6K A;  2CH4 A;  2GBQ A;  1UHF A;  1TG0 A;  2KYB A;  1BK2 A;  3PVL A;  2KRS A;  2DBM A;  1JXO A;  4J9C A;  3THK A;  2LMJ A;  3QWY A;  1JO8 A;  5IXB A;  3I5R A;  2EGE A;  1GCQ C;  1SHF A;  1IO6 A;  1W6X A;  1PKS A;  2CDT A;  1BB9 A;  4RTZ A;  2DJQ A;  4OMQ A;  1U5S A;  5FWB A;  1K1Z A;  1AWJ A;  1AWW A;  2JT4 A;  2J7I A;  2ED1 A;  1UTI A;  1SEM A;  2NUZ A;  1XOV A;  2CRE A;  4IIM A;  1K0X A;  1A0N B;  4HCK A;  2LNH B;  2FPD A;  1KIK A;  3VS3 A;  1QKX A;  1VYU A;  2KXC A;  4LE9 A;  3NPF A;  1NEB A;  4CC7 A;  2L0A A;  3VS6 A;  2XMF A;  3VRY A;  1X6B A;  2ECZ A;  1AVZ C;  3CQT A;  2KT1 A;  4F14 A;  2DL4 A;  2W10 A;  2L3S A;  5IXF A;  2DLP A;  1GCP A;  4RTW A;  2KRN A;  3NHN A;  1S1N A;  2HSP A;  2EKH A;  4J9D A;  2EBP A;  4F16 A;  2OI3 A;  2HEQ A;  3SHW A;  1CKA A;  1WDX A;  3H0H A;  2VKN A;  1EFN A;  1PWT A;  4K11 A;  2EYW A;  4Z8A A;  3EG1 A;  2B86 A;  2GTJ A;  2F2X A;  2O9S A;  4RTU A;  3R6N A;  1ZLM A;  1W70 A;  3H41 A;  2L3P A;  1WA7 A;  2J06 A;  2GQI A;  2DRM A;  2HDA A;  2YUN A;  1NLP C;  1BBZ A;  2M0Y A;  1AWO A;  4WCI A;  2K2M A;  1UDL A;  2CT4 A;  3EHR A;  1LCK A;  2H8H A;  2D1X A;  2AKL A;  2KGT A;  2DA9 A;  1AZG B;  4J9G A;  1H8K A;  1X69 A;  2V1Q A;  5IH2 A;  4J9F A;  1OPL A;  1CKB A;  2BTT A;  4OMO A;  1Y0M A;  1JEG A;  2FG0 A;  2JTE A;  2CT3 A;  5FW9 A;  2D0N A;  4Z89 A;  2KYM A;  1YWO A;  2RQU A;  2E5K A;  2K6D A;  1X27 A;  2O9V A;  1X2K A;  2ESW A;  1OEB A;  2SEM A;  2KRO A;  1HJD A;  3ULR B;  2DYB A;  1UHC A;  4J9I A;  1GBR A;  2RN8 A;  1KJW A;  4HVW A;  1JQQ A;  1SPK A;  1WFW A;  2J05 A;  2LJ3 A;  4E6R A;  4EIK A;  2RQW A;  2ROT A;  1X2Q A;  1GL5 A;  3VRZ A;  3H0F A;  1B3Q A;  1YCS B;  2IIM A;  3VS7 A;  1RI9 A;  4CC3 A;  1T0H A;  2DM1 A;  1G83 A;  2LP5 A;  3JV3 A;  5I22 A;  4R0K A;  1ZUY A;  1NEG A;  2CUB A;  1PKT A;  2BZX A;  3FJ5 A;  2CH4 W;  3UA6 A;  3M0S A;  1WXB A;  3I35 A;  2DRK A;  1K9A A;  2SRC A;  1H3H A;  1B07 A;  4LUD A;  2DL7 A;  2NWM A;  2LJ0 A;  1ZX6 A;  1E6H A;  5IHN A;  4JJD A;  2D8H A;  2MIO A;  3M0R A;  4ESR A;  2FPE A;  3VS5 A;  1KSW A;  1YNZ A;  2KT8 A;  3IQL A;  2EGC A;  3I5S A;  3ZL7 C;  4HXJ A;  1GCQ A;  4JPB W;  1GBQ A;  1AEY A;  1JU5 C;  3NGP A;  5FWC A;  2OAW A;  1K0S A;  2YUP A;  4AFQ C;  1AZE A;  3REA B;  2YUQ A;  1WXT A;  1V1C A;  2RF0 A;  4JJC A;  4X1V A;  2DL8 A;  2G6F X;  2K79 A;  2J6O A;  1X6G A;  3TSZ A;  3TVT A;  3A98 A;  3U23 A;  4D8K A;  4AFS C;  4IIO A;  4JJB A;  3SEM A;  1W1F A;  2JM8 A;  1KFZ A;  3M0P A;  1RLP C;  2L2P A;  1J3T A;  1FYN A;  3UA7 A;  1WIE A;  3M0Q A;  1AWX A;  2GGR A;  2EYY A;  2F2V A;  2L3Q A;  2BZ8 A;  1YWP A;  2YT6 A;  4D8D A;  2FRY A;  2RQV A;  2C0O A;  2ENM A;  4RTV A;  1X43 A;  2LZ6 B;  2K7A A;  2JXB A;  2A28 A;  4JZ3 A;  1Z9Z A;  2FEI A;  1NM7 A;  4HVU A;  2RQR A;  1CSK A;  2DL3 A;  4AG2 C;  3PE0 A;  1AD5 A;  1WYX A;  2VVK A;  4LUE A;  1HD3 A;  2FRW A;  1BU1 A;  2KNB B;  1QLY A;  1TUD A;  5HCK A;  4FSS A;  1PRL C;  2BZY A;  2EVR A;  2YSQ A;  2KXD A;  2ABL A;  2J6F A;  1T0J A;  2EGA A;  4ZNX A;  2RQT A;  2A37 A;  2JM9 A;  1UFF A;  2HCK A;  3REB B;  2DF6 A;  2HBW A;  3QWX X;  4AFU C;  2DBK A;  1AOJ A;  2VWF A;  4LNP A;  2K3B A;  2LX7 A;  3RNJ A;  4J9B A;  1MV0 B;  1K76 A;  1RLQ C;  1PNJ A;  2CSI A;  2I0N A;  5EC7 A;  4QT7 A;  2LQN A;  1SRL A;  1QWF A;  2KEA A;  3PVQ A;  2D8J A;  2OJ2 A;  3LH5 A;  1UJ0 A;  4AFZ C;  2EW3 A;  1E7O A;  2DE0 X;  4RTT A;  1M27 C;  5GJV B;  3EG2 A;  1E6G A;  3EG0 A;  2AKK A;  1UG1 A;  2AZV A;  2KE9 A;  4GLM A;  3C0C A;  2DL5 A;  1WLP B;  1VYT A;  1TUC A;  4J9H A;  2LCS A;  2F2W A;  3UAT A;  4Z88 A;  1UE9 A;  3GBQ A;  1OV3 A;  2JMC A;  2GTO A;  1K4U S;  4ORZ A; 
#chains in the Genus database with same CATH topology
 3RKY A;  3EHQ A;  1TTH B;  3OW2 S;  3JB9 I;  4BI4 A;  3GOX A;  2EQM A;  2RHI A;  2RMO A;  2MOX A;  1WHK A;  3JCM f;  1Q7Y U;  1QWE A;  1V29 B;  5GJW B;  4OGE A;  5KYY A;  3EGX B;  1ZUK A;  1M3A A;  3H8Z A;  5IHK A;  4XTX A;  4ZTF A;  2K9G A;  5J3B A;  4VUB A;  2DMO A;  3MEV A;  3ZFJ A;  1SKU B;  2QDL A;  1YJW T;  1RUW A;  1FXX A;  2QA4 A;  1ZBJ A;  1MUZ A;  2R5M A;  1NYF A;  1YJN A;  5D6W A;  1UEC A;  2DIL A;  1NLO C;  1S72 Q;  2E4H A;  2EAY A;  3OSV A;  3CME A;  3OYY A;  1YN8 A;  1YHQ T;  4M7A A;  5GAN 3;  1QMC A;  3OSS C;  4Y92 A;  3CC4 T;  4OMM A;  1X01 A;  4RTX A;  2RNA A;  4R56 A;  1M1K R;  1QCF A;  4M78 G;  4A63 B;  1AHJ B;  5GAN 8;  2X4W A;  2YDL A;  3DB3 A;  2FO0 A;  3CCJ T;  1OPK A;  1M2O A;  1VQ6 A;  2JTF A;  3OYB A;  3DLM A;  3VS0 A;  2X3W D;  3OYJ A;  3CCV Q;  1BI0 A;  2PZ1 A;  4M7D F;  8ATC B;  4PJO E;  4JRI A;  1YI2 A;  4DEX A;  2LCC A;  3BW1 A;  1QKW A;  3GLX A;  2DTI A;  3M59 A;  5GAO n;  3OYM A;  1GFD A;  1N5Z A;  2EFI A;  4N4H A;  5CVI A;  3OYN A;  1ZSG A;  4M77 B;  3URG A;  1FMK A;  5IHI A;  3DLL A;  2EJG A;  1QCN A;  2K5L A;  4E7Z A;  1Z9Q A;  4OMP A;  4M4Z A;  2EYZ A;  2QA4 T;  3VS4 A;  1YJN T;  4QVZ A;  1U3O A;  5ECA A;  2HZY A;  1M90 U;  3CME T;  1UUE A;  3JCM b;  3NFC A;  4FYW B;  4MZM A;  4ZGJ B;  5KE3 A;  2MWP A;  1ZA1 B;  2J6K A;  4O5V A;  4B6M A;  5GMK l;  2CH4 A;  3CCJ Q;  1D3B B;  1UHF A;  3E2U A;  3CCE A;  3PVL A;  2DBM A;  4J9C A;  3THK A;  1VQ5 A;  4A4F A;  5GAN j;  1JO8 A;  2G3R A;  1M5Q 1;  5IXB A;  1C0M A;  1WJR A;  4C92 A;  4RTZ A;  2DJQ A;  1U5S A;  2LRQ A;  1LPL A;  1K1Z A;  1AWW A;  3L2R A;  3VYH B;  2KVQ G;  3MKD A;  4XU3 A;  1YI2 T;  1UTI A;  2NUZ A;  1KHI A;  1XOV A;  1TOV A;  4ELZ C;  4HCK A;  1QKX A;  3S6W A;  2KXC A;  4CC7 A;  3VS6 A;  2YRC A;  3VRY A;  2QEX A;  2MF2 A;  4AMC A;  1OU8 A;  2P0K A;  3JCM J;  3EFR A;  4KUI A;  2W10 A;  2QA4 Q;  4M75 C;  3I55 Q;  5GAO p;  1VQ7 T;  3CCM Q;  3A8M B;  2DZC A;  2QQS A;  1RI0 A;  2HSP A;  2EKH A;  1N8R C;  2FZK B;  4C5H A;  2VC8 A;  2CP5 A;  4IUU A;  5I21 A;  1EFN A;  4J7F A;  3JB9 H;  2O9S A;  1OYX A;  3QXE B;  4J8O A;  2O01 E;  2COW A;  3CCE T;  1VQ6 Q;  2XG8 D;  2EQU A;  1VQ5 T;  3CC7 A;  1NLP C;  5A0G A;  1G8X A;  2M0Y A;  3QG1 A;  4FSX A;  2JZ2 A;  4Y28 E;  1OUL A;  1WPY A;  4X9C A;  2NUP B;  2E70 A;  3OS2 A;  4J9G A;  1Y7X A;  4PLI A;  4C0G A;  2V1Q A;  4J9F A;  1JJ2 A;  4V2S A;  4M77 E;  3OYL A;  1DJ7 B;  1WGS A;  4EMK A;  1XTD A;  2CT3 A;  4Z89 A;  2FYK A;  2IG0 A;  2QEX T;  1OEB A;  2KRO A;  2VUB A;  4J9I A;  4QVD A;  1KJW A;  4J6Y A;  1WFW A;  3QYH B;  1M4Z A;  2ROT A;  3H0F A;  4GY5 A;  2GQV A;  1RI9 A;  2JVV A;  2LP5 A;  4R0K A;  2QQ9 A;  4Y91 A;  1ZUY A;  3BY7 A;  6AT1 B;  2DER A;  3FJ5 A;  5KCH A;  4C5E A;  2KDS A;  4DA4 A;  1H3H A;  4LD6 A;  4MMK A;  4A54 A;  2HQE A;  1E6H A;  3CC7 T;  4JJD A;  5GAN 6;  3MJX A;  4ESR A;  1I8F A;  1KSW A;  3CC2 A;  2E10 A;  3JSC A;  1YCY A;  1GCQ A;  1AEY A;  2MMP A;  1WQW A;  5FWC A;  1K0S A;  2YUP A;  4XTZ A;  4A4G A;  2D6F A;  1AZE A;  2F5T X;  3ZEH A;  2M0O A;  2L5Q A;  1WXT A;  1V1C A;  4JJC A;  1NJI R;  4QQ6 A;  2KY9 A;  2XID A;  1Q81 R;  1K8A U;  2WSC E;  5CIU A;  5GAM j;  4C8Q A;  3TSZ A;  3TVT A;  4EMG A;  3A98 A;  3M56 A;  2H3J A;  4KH0 B;  4JJB A;  1W1F A;  4OB2 B;  1KFZ A;  3M0P A;  1RLP C;  4JLI A;  2A7Y A;  2KQW A;  1SF9 A;  2YLB A;  1Q82 U;  2LDM A;  3UA7 A;  4C0D B;  3A5Z B;  2VGM A;  4AT1 B;  2OTJ A;  4BE0 A;  2BZ8 A;  2FRY A;  4O6J A;  2EQJ A;  4E2F B;  3CMA Q;  1KD1 U;  2K7A A;  5GAN e;  4LD9 K;  1Z9Z A;  1R0B G;  4HVU A;  1CSK A;  2QQR A;  2BKD N;  1VQN A;  5LJ3 j;  4HCC A;  2DD5 A;  2O4X A;  4N4G A;  4HT9 A;  3C4S A;  3WVE B;  1PC0 A;  1WYX A;  3PMI A;  1N6A A;  4HCB A;  3CCQ A;  3X28 B;  3TEE A;  1QVF P;  3MP8 A;  4M7D B;  2ATC B;  2KXD A;  3M9Q A;  5CQY A;  3EFO A;  4ZNX A;  2JM9 A;  1UGQ B;  3REB B;  3T9N A;  4BD3 A;  2LTO A;  1UGS B;  3QWX X;  3WVD B;  4AFU C;  3PTA A;  1X75 C;  5LJ5 h;  4ATO A;  1AOJ A;  2K3B A;  5KYU A;  5C0M A;  4GLK A;  1RL2 A;  4UC4 A;  4A4K A;  4J9B A;  2CSI A;  4QQD A;  1UGP B;  1JRI A;  4M78 A;  1Y07 A;  2OTJ T;  3L2Z A;  4NL2 A;  3DB4 A;  1EX4 A;  1WQ7 A;  5KCO A;  3CCR A;  2KEA A;  2K4Y A;  1JB0 E;  2QQB A;  5A0L A;  3PGG A;  4RTT A;  4DBF A;  3M53 A;  5HY6 A;  2E5Q A;  1E6G A;  1VQN T;  2KE9 A;  3CC2 Q;  5IT9 E;  1TUC A;  3JCM e;  1BIA A;  3OYF A;  2F2W A;  4Z88 A;  3CCQ T;  1UE9 A;  5FU7 B;  3F70 A;  5GMK m;  1K9M U;  3RDV A;  3QZ5 B;  2RK2 A;  3CEY A;  4XTY A;  3VU3 C;  4LDV A;  1K4U S;  2DZ9 A;  1PSE A;  2PTK A;  2HQH A;  5GAN 2;  4IKF A;  1VQ9 A;  1O9S A;  2LQW A;  5GMK j;  3SD4 A;  4C0F A;  1MND A;  3LGL A;  3HHT B;  2DTO A;  2E6Z A;  2PNI A;  2KBT A;  2XHC A;  1HYO A;  2HSE B;  1BI3 A;  3OB9 A;  1YJ9 A;  2YRV A;  4ELY C;  2DYI A;  3RUX A;  1PRM C;  2GF7 A;  1SHG A;  3RMS A;  3EFS A;  1VA7 A;  3CCU Q;  3NTI A;  4E7L A;  3CCR T;  5CQX A;  1VQK Q;  3M5A A;  1RAE B;  3CPF A;  1PD0 A;  5AYF A;  1U8R A;  4F17 A;  1OQK A;  5L8R E;  2M1H A;  3G6E Q;  4DOW A;  1QVF A;  1VIE A;  4M7D E;  1FMW A;  1N8R R;  1WNL A;  1ZHI A;  1GRI A;  2ZGW A;  2X3X D;  1W2B P;  5LJ5 g;  1U1T A;  3LWI A;  3MEW A;  5I11 A;  5J39 A;  2DVJ A;  4DBQ A;  4F7U B;  1PCX A;  2DNU A;  1W4S A;  3LWH A;  5FLX E;  2E1H A;  1NE8 A;  3CCV A;  4PNO A;  1SRM A;  1NZ9 A;  3PMT A;  2QAZ A;  2CUD A;  4OMN A;  3MEU A;  1VQ8 Q;  2AZS A;  4DEY A;  4HT8 A;  1H3Z A;  1WHH A;  3PNW C;  3RBB B;  3E9G A;  1G2B A;  2EKO A;  4OML A;  2O31 A;  3CPW S;  4FCY A;  1WI7 A;  4KH1 B;  1YJ9 T;  3LLR A;  3PFS A;  2GCX A;  4OB1 B;  1Q7Y C;  3UF4 A;  2CZ7 B;  4BE1 A;  3UT1 A;  5KYY B;  4C8Q F;  1Q95 G;  3VS2 A;  5LJ3 e;  3FIF A;  3CXC S;  3JB9 J;  1T3L A;  1ZBX A;  1YBY A;  2YUO A;  1S72 T;  2OTL Q;  3MP6 A;  2GBQ A;  2KYB A;  1I81 A;  1BK2 A;  2KRS A;  3HP9 A;  4M7A B;  1FWZ A;  2MK5 A;  3I5R A;  2EGE A;  4L59 A;  3OS0 A;  4D6W A;  1IO6 A;  1W6X A;  1PKS A;  1VQ9 Q;  4OMQ A;  5FWB A;  4PK4 A;  5HK3 A;  2JT4 A;  3NTK A;  4RKU E;  2YHT A;  1KC8 U;  3CCV T;  4PJO C;  1YJ9 Q;  1A0N B;  1Y96 A;  2FPD A;  1KIK A;  3EH2 A;  2ZZD A;  3JCM c;  1G3W A;  1X6B A;  1P92 A;  1VIF A;  2VV5 A;  2XU8 A;  3HSB A;  2XKO C;  2KT1 A;  3N5B B;  4F14 A;  2LCL A;  2L3S A;  2DLP A;  5LJ5 d;  1GCP A;  3SWN C;  3I55 A;  5D6Y A;  2EBP A;  2CS7 A;  3MP1 A;  3CCM A;  2HEQ A;  3SHW A;  1IHV A;  3ME9 A;  3ZBD A;  4KGZ B;  1WDX A;  3ASK A;  2NYS A;  4M78 F;  2AT1 B;  2PUO B;  4XU1 A;  1OI1 A;  1M90 C;  2XIC A;  1JBM A;  2GTJ A;  1VUB A;  1BYM A;  2F2X A;  3HL8 A;  4RTU A;  2CP7 A;  1D0X A;  3JCM W;  1W2B A;  4N0A C;  2J06 A;  2QG9 B;  2YUN A;  4B9W A;  4F7U E;  3CCL A;  1BBZ A;  4BAC A;  4RMO A;  1KK7 A;  4M7D D;  4CRI A;  1AWO A;  1UDL A;  3EHR A;  4IUP A;  3TRE A;  1LCK A;  5GMK e;  2KGT A;  1TH7 A;  2DA9 A;  4BDY A;  3GNG A;  5IH2 A;  1BKB A;  4C92 B;  1CKB A;  4X34 A;  2K3X A;  2E3H A;  2V8I A;  3OBY A;  1JJ2 P;  2F5K A;  2E12 A;  1KQS P;  2D0N A;  2GFU A;  2KYM A;  5CR2 A;  2E5K A;  1LNX A;  2ESW A;  3ULR B;  3R6O A;  3KUF A;  3OMG A;  4OB0 B;  4HVW A;  2QGG A;  1SPK A;  2COZ A;  4IUR A;  1K73 U;  3I55 T;  2RJC A;  5GAO l;  2DKG A;  1T0H A;  3CCM T;  2JUF A;  2ZAE A;  1G83 A;  5GAM h;  5IAY A;  3OYK A;  1QVG P;  2BZX A;  4M7A E;  2HD0 A;  1YIT Q;  3I35 A;  2RK1 A;  4KUD K;  1B07 A;  2DL7 A;  1OU9 A;  2P84 A;  2LJ0 A;  2X35 A;  2PQW A;  4J6W A;  3LGF A;  3UWN A;  4MZP A;  3CCL T;  1VQ6 T;  2X4J A;  3S3N A;  3SB2 A;  4PLL A;  3M0R A;  2ZPE B;  3RER A;  2FPE A;  1RAF B;  4II1 A;  3VS5 A;  3IQL A;  2RD1 A;  1N27 A;  4HXJ A;  5LJ3 h;  4IUT A;  2MYS A;  3P8D A;  4LDY A;  4M77 C;  2B8A A;  4IUQ A;  2RH2 A;  3NGP A;  3LYI A;  3HRT A;  2QI2 A;  2P4T A;  3HTR A;  3WXM B;  1IXD A;  3REA B;  2YUQ A;  1MMA A;  5KE2 A;  2DL8 A;  5CKD A;  2G6F X;  4EMK B;  2ZPB B;  2RI2 A;  3U23 A;  2PU9 B;  4AFS C;  1VQP A;  3SEM A;  2XDD A;  2JM8 A;  2CP0 A;  2L2P A;  1BI2 A;  1FYN A;  1WIE A;  4M75 A;  2A3L A;  2DEU A;  2K5I A;  2GGR A;  4EMH A;  2EYY A;  2F2V A;  1RAB B;  1YWP A;  2YT6 A;  2DD4 A;  1X43 A;  2LZ6 B;  3RR6 A;  2DIQ A;  2QXF A;  3CCL Q;  3BDL A;  2A28 A;  3CMA A;  5J26 A;  3QJY A;  1R77 A;  1RAC B;  3PE0 A;  4C92 E;  4KUL A;  3G71 Q;  4E7H A;  3GPL A;  4ZN1 A;  4LUE A;  3CBM A;  2KMT A;  1BU1 A;  1XNI A;  1KQS A;  2EVR A;  2YSQ A;  2MI6 A;  3S3O A;  4PFP A;  4PJO D;  1UEB A;  3JB9 D;  2NLU A;  2OAU A;  2A37 A;  2HCK A;  2HBW A;  3OQ5 A;  2DBK A;  9ATC B;  2LX7 A;  4J6X A;  4OMF B;  3RNJ A;  1M2V A;  1K8A C;  3QYG B;  5GAM g;  3X24 B;  2DK3 A;  4B9X A;  1SSF A;  4FU6 A;  1RLQ C;  4F7U G;  1QVG A;  4XTV A;  2V8K A;  5EC7 A;  3QZ9 B;  2ZCF B;  3OY9 A;  3EAE A;  4C8Q B;  2LQN A;  1SRL A;  1Q82 C;  4ANJ A;  3G7Z A;  2I2L A;  2KAF A;  3HRS A;  2PVD B;  2D8J A;  3L2W A;  1UJ0 A;  4PJO G;  2E64 A;  3JB9 G;  1M27 C;  5FRO A;  4FIB A;  5GJV B;  4JDS A;  2MWO A;  1KD1 C;  3CMA T;  4JRK A;  4PFO A;  2MPX C;  3EG0 A;  4M7A D;  3SFM A;  4GLM A;  4WTO B;  3C0C A;  3GF5 A;  5LJ3 g;  1WLP B;  1I5L A;  4ZN3 A;  1I5O B;  2O4X B;  3GBQ A;  3OYH A;  1OV3 A;  2JMC A;  2CP6 A;  4DOV A;  3DKM A;  4RCC A;  1PM3 A;  3OYC A;  3G1J A;  2E65 A;  4PJN A;  1OZ3 A;  4AG1 C;  2BE7 D;  1I1J A;  1PSF A;  2KI7 A;  3MHX A;  3TSW A;  1ABO A;  4KGV B;  4XU0 A;  3A8O B;  2XD0 A;  1SG5 A;  1VQP Q;  2K57 A;  4M7A G;  3OYI A;  2JN0 A;  1U06 A;  4KT0 E;  3MET A;  4NOY A;  3A8L B;  2L89 A;  2RA2 A;  3M57 A;  1VQ4 Q;  2C0I A;  1AT1 B;  5KYU B;  1Y57 A;  1ABQ A;  2DPP B;  3PT9 A;  5GAN 5;  4FYX B;  3FC3 A;  2ROL A;  1WHG A;  2BE9 B;  3AHU A;  2JNG A;  2VAS A;  2DX1 A;  2KRM A;  3CCU A;  1IGQ A;  4HVV A;  1M30 A;  1M3C A;  2AK5 A;  4M78 B;  2JMA A;  5KYW A;  3L2U A;  1VQK A;  2E41 A;  2QK0 A;  5M9O A;  5D7U A;  1UB4 A;  1TSF A;  4PJM A;  3JCM Q;  3G6E A;  3OYA A;  1PHT A;  1NYG A;  2LC4 A;  5GAM d;  3CC2 T;  1WXU A;  1O75 A;  1ZA2 B;  4C92 D;  8AT1 B;  3OW2 A;  1UGV A;  5KYN A;  1EZZ B;  1M1G A;  2O88 A;  1WZO A;  4XQ3 A;  3QII A;  1K9M C;  1M90 R;  3S3M A;  2HBP A;  4M77 D;  3V7S A;  3J80 E;  1JXM A;  2MCN A;  4HKE A;  3NMZ C;  4MDW A;  1D1B A;  1HSQ A;  2FHD A;  1Q86 C;  2RPN A;  1GFC A;  3OYG A;  1I0C A;  3HPW A;  4C8Q E;  1MHN A;  4L6V 5;  1VQ8 A;  4C0D C;  5LJ3 d;  3EGD A;  2LT4 A;  4JS5 A;  3L2V A;  5LJ5 f;  3M0T A;  2X51 A;  5FRM A;  4GBQ A;  4DBH A;  2DO3 A;  2R5A A;  3V8L A;  4C92 G;  1F1B B;  3VUZ A;  1M1K U;  2JS0 A;  4E7J A;  3D7S B;  4NS5 A;  2M51 A;  2JTM A;  3CCU T;  1NG2 A;  1T3S A;  4JZ4 A;  2FPF A;  1VQK T;  1R8O B;  2JW4 A;  4M77 G;  2F1L A;  2X4X A;  3EG3 A;  3CD6 Q;  1WJS A;  4J9E A;  3JCM X;  4M75 F;  5DY9 A;  2X4Y A;  3G6E T;  2VXE A;  2OTL A;  4M7D C;  1JXO A;  2C06 A;  2RJE A;  3BE3 A;  3QWY A;  3FLG A;  1SHF A;  2CDT A;  1BB9 A;  3C94 A;  3QJ6 A;  1AWJ A;  4PJL A;  3FRN A;  3JRZ A;  2J7I A;  3RES A;  2E6N A;  3TU4 K;  1SEM A;  2M16 A;  2CRE A;  4IIM A;  2LNH B;  3VS3 A;  1M8V A;  3QHS A;  1VYU A;  1R0C B;  4LE9 A;  3NPF A;  1NEB A;  1VQ8 T;  2YXY A;  2L0A A;  2D9T A;  4HCZ A;  1YFN A;  3EH1 A;  1JJ2 S;  4XU2 A;  1AVZ C;  4JRQ A;  4M78 E;  2EYQ A;  2DL4 A;  2CZ6 B;  5IXF A;  2DIG A;  4BE2 A;  5D6X A;  4RTW A;  2KRN A;  3NHN A;  1S1N A;  2RJD A;  5KYX A;  4J9D A;  4F16 A;  2WAC A;  1CKA A;  5FRN A;  2GFA A;  3H0H A;  2VKN A;  4K11 A;  2EYW A;  4Z8A A;  1HXD A;  2B86 A;  4ZTJ A;  5FU7 C;  2LQ8 A;  4E7K A;  2KK4 A;  1W70 A;  2E3I A;  2OTL T;  4OGC A;  4MDX A;  3H41 A;  2L3P A;  1WA7 A;  4FL6 A;  3UDC A;  2CT4 A;  3M55 A;  1U1S A;  2XI9 A;  1QP3 A;  4WF2 A;  2AKL A;  2COY A;  3BDU A;  2IPO B;  1VQ9 T;  1B34 A;  5GAN h;  1AZG B;  1XQH A;  1H8K A;  2R58 A;  3JAM E;  1X69 A;  1TXQ A;  1OPL A;  1ZSZ B;  5GAN 7;  2Y90 A;  2BTT A;  1KC8 C;  1JEG A;  2JTE A;  1NPR A;  2P0P A;  1YWO A;  2FB7 A;  2RQU A;  2K6D A;  4LXC A;  3QDR B;  2NUT A;  1X27 A;  2O9V A;  1X2K A;  2AHJ B;  1Y96 B;  4C8Q D;  2LNV A;  1UHC A;  2VXF A;  5CK9 A;  5KH6 A;  3FB9 A;  4RG8 A;  5CKF A;  3RKW A;  2LJ3 A;  4E6R A;  4EIK A;  2RQW A;  3PIO A;  1X2Q A;  1GL5 A;  3I56 A;  1YCS B;  2IIM A;  3QKJ A;  3VS7 A;  2DXB A;  2DM1 A;  3JV3 A;  4JLG A;  2CUB A;  2V26 A;  2CH4 W;  3UA6 A;  3M0S A;  1WXB A;  1YJW A;  3FEO A;  3BFM A;  2DRK A;  2NWM A;  1YIT A;  2PVO B;  2DEQ A;  4X9D A;  2VB6 A;  1YHQ A;  1Q82 R;  1LVK A;  2YWW A;  2HMA A;  3CC4 A;  2F69 A;  1RAG B;  1ZSZ C;  3O8V A;  3P8B B;  3HFN A;  2RI3 A;  4F7U A;  1KD1 R;  1GBQ A;  1JU5 C;  4PJJ A;  4E7S A;  5LJ5 j;  2D0Q B;  2AIR B;  4AFQ C;  3JCM h;  3GIB A;  4NL3 A;  4PJO A;  1BCM A;  2RF0 A;  2QTX A;  4Q5W A;  2JJ9 A;  5A2Q E;  2J6O A;  2LX9 A;  5HK0 A;  4D8K A;  1H64 1;  2YRD A;  4BDZ A;  2XDB A;  4M78 D;  2M02 A;  3I56 T;  3MO8 A;  1J3T A;  4BB7 A;  1K73 C;  3SDZ A;  1AWX A;  1EIF A;  3A1P A;  2L3Q A;  3LH0 A;  4D8D A;  2RQV A;  3SWN A;  2C0O A;  1MMG A;  4M7A C;  4JZ3 A;  4C0Z A;  1NM7 A;  1YIT T;  5GAN g;  1NBE B;  3OS1 A;  2DL3 A;  1IRE B;  1GXI E;  4N0A A;  1NJI U;  3G71 A;  1Q81 U;  1VQL Q;  2FRW A;  3EG9 A;  1B7T A;  3LX7 A;  2KNB B;  2LVM A;  1TUD A;  4XK8 E;  1PRL C;  4FT4 A;  3JCM P;  4ZGD B;  1T0J A;  4XTW A;  2RQT A;  1WHM A;  2DXU A;  2DF6 A;  1N9R A;  2K2V A;  1IB8 A;  1V76 A;  1C6V X;  2VWF A;  2Z0W A;  3EGX A;  2CKK A;  3QUI A;  4M7D G;  2Y4X A;  3I56 Q;  3X26 B;  1VQM A;  2FVU A;  4EPC A;  3MCA B;  1K9M R;  4A4H A;  1PNJ A;  3E9F A;  4KGX B;  5GAN 4;  1WJQ A;  1OX8 A;  3OBW A;  1D09 B;  2HNI A;  2RI5 A;  3L42 A;  1VQO A;  1YJW Q;  2HAX A;  1RAH B;  1Q86 R;  1KQ2 A;  3PVQ A;  2OJ2 A;  2IVW A;  1G3T A;  1VQ7 A;  4CI0 C;  4E7I A;  3GP8 A;  4M75 B;  3INZ A;  2EJF A;  3JCM V;  1YHQ Q;  3VKI A;  5GAM f;  1YIJ A;  3C95 A;  3A8H B;  2AKK A;  3CC4 Q;  2DVE A;  2DL5 A;  2ZPG B;  3OA6 A;  1VYT A;  4C92 C;  7AT1 B;  2ZPF B;  3CBP A;  3G71 T;  2FZG B;  3UAT A;  1HK9 A;  3JCM g;  1RAI B;  2BIV A;  3G4S A;  1QVF S;  2CZ0 B;  1PG5 B;  4ORZ A;  4FW2 A;  1KQ1 A;  5LJ3 f;  1YP5 A;  4M77 A;  4OB3 B;  3CPW P;  1H92 A;  4N4I A;  5GAN d;  3E1S A;  1VQM T;  1WX6 A;  2A36 A;  3KFV A;  2P0Q A;  4BI3 A;  4E47 A;  3VS1 A;  1KG1 A;  1MV3 A;  4HA8 A;  1M2V B;  3H0I A;  1VQ4 A;  1VOM A;  1TS9 A;  2ZPI B;  1M8M A;  1VQO T;  4CC4 B;  1KHC A;  1MMN A;  3QSU A;  1YJN Q;  1ARK A;  1ACM B;  2DXT A;  1VYV A;  3J81 E;  5CAI A;  5CCA A;  3CXC P;  1FMV A;  2QYZ A;  4OP0 A;  3CME Q;  2P4R A;  2CSQ A;  2LQK A;  1D3B A;  3V8K A;  1YIJ T;  1PD1 A;  1TU0 B;  4Z02 A;  3QDF A;  4YTL A;  2V1R A;  1WHL A;  2RO0 A;  2EIF A;  4ZGE B;  2C0T A;  4J83 A;  1N9S A;  1ZUU A;  3VJP A;  2ZPH B;  4KRT A;  5LJ5 e;  2JS2 A;  5L23 A;  4RUG A;  4OVA A;  3G4S T;  1QP2 A;  3OW2 P;  4DBR A;  2ED0 A;  1YI2 Q;  4EMK C;  2W0Z A;  4MML A;  1D0Z A;  1VQM Q;  3E19 A;  3EGU A;  3M0U A;  3V7C A;  2O2O A;  1M3B A;  2KR3 A;  1UJY A;  4F7U F;  2LJ1 A;  2EYX A;  2V8J A;  1VQP T;  5GMK h;  2EPD A;  4PFZ A;  4RTY A;  3TQ7 P;  1VQO Q;  5AT1 B;  2EQI A;  4PJO F;  1VQ4 T;  4CC2 A;  4M75 E;  3JB9 F;  3JCM d;  1VQ7 Q;  2GNC A;  1G5V A;  1KC8 R;  2A08 A;  1N8R U;  4TVR A;  4P5N A;  3I9Q A;  1YIJ Q;  5LL6 S;  2RHZ A;  4XTU A;  2DFU A;  3O5Z A;  1RAA B;  1Q7Y R;  2M9U A;  4LN2 A;  1M1F A;  2FL7 A;  2PUK B;  1I07 A;  4IUV A;  5I2S A;  1OZ2 A;  3H6Z A;  5KYW B;  3C12 A;  1OOT A;  1SSH A;  3CCE Q;  3CD6 A;  3Q1J A;  4ME7 A;  1VQ5 Q;  1TG0 A;  3G4S Q;  2NUP A;  1QCO A;  2LMJ A;  2VGN A;  2WSE E;  4FT2 A;  4QQG A;  1GCQ C;  2RB6 A;  4J5Y A;  1W2B S;  4A53 A;  3CPW A;  2DAQ A;  4M7A F;  2ED1 A;  3HRU A;  3VUB A;  4MZT A;  3NTH A;  2DTH A;  3EFO B;  3X20 B;  1K0X A;  3VV0 A;  1IGU A;  2YLC A;  2QEX Q;  4C8Q C;  2VYT A;  2XMF A;  5CKB A;  2ECZ A;  2HKN A;  2RM4 A;  3CQT A;  4BUG A;  1C1A A;  4FW1 A;  3CXC A;  3L1A A;  3EGD B;  2RHU A;  2QQA A;  1M1K C;  2OI3 A;  5DLQ E;  1PWT A;  3RMQ A;  5HKC A;  1G3S A;  3EG1 A;  4LDX A;  2KSS A;  3CD6 T;  3R6N A;  1ZLM A;  5I2M A;  3CC7 Q;  4QW2 A;  1M9S A;  3V8J A;  1D0Y A;  2GQI A;  2DRM A;  3TCJ A;  2HDA A;  3RKX A;  3CCS A;  4EDU A;  1K73 R;  3GNF B;  2QGF B;  2RJF A;  5FU6 B;  4WCI A;  2K2M A;  1D1C A;  2CP2 A;  2H8H A;  2D1X A;  5CKE A;  1RAD B;  2K3Y A;  2DJZ A;  1TUG B;  2L8D A;  2EQK A;  4KBM B;  4L5G A;  2QAS A;  4OMO A;  4JS4 A;  1XJW B;  1Y0M A;  2PVG B;  1QW1 A;  2FG0 A;  5FW9 A;  3KXT A;  4C92 F;  3H9N A;  4QVC A;  3MPU B;  2SEM A;  1Y71 A;  1HJD A;  4JUV A;  2DYB A;  4M78 C;  1GBR A;  2RN8 A;  4M77 F;  1JQQ A;  5GAO q;  2J05 A;  3LW5 E;  2QDY B;  2H3E B;  4DQ2 A;  3VRZ A;  2BUD A;  4M75 D;  1B3Q A;  4CC3 A;  1G3Y A;  3AT1 B;  5I22 A;  2HL3 A;  1NEG A;  4FYV B;  1PKT A;  5KYX B;  2A0F B;  5GAO m;  1D1A A;  5DLO A;  3OYD A;  1K9A A;  2SRC A;  1UGR B;  4LUD A;  3HKS A;  2K5F A;  1ZX6 A;  3ER0 A;  5FU6 C;  4JJN K;  4PKC C;  2CGH A;  3CCS T;  5IHN A;  4BY6 B;  3VYG A;  2CZ1 B;  1QQJ A;  3PIP A;  4LDW A;  2D8H A;  2MIO A;  4JRP A;  4OF1 A;  4BI8 B;  2CYZ B;  4M7D A;  2XDP A;  5GMK i;  2OX7 A;  3QPH A;  1TWB A;  1YNZ A;  2KT8 A;  1MNE A;  3CBO A;  2EGC A;  3I5S A;  3ZL7 C;  2RHX A;  4J7I A;  4M75 G;  4JPB W;  3UPU A;  3OYE A;  2HQX A;  3X25 B;  1I4K 1;  4R55 A;  2L3R A;  1B34 B;  1IRX A;  2OAW A;  5CO7 A;  3J7A F;  1MGQ A;  2EWN A;  4X1V A;  1KQS S;  4FYY B;  1Q86 U;  2K79 A;  3A8G B;  1X6G A;  2NUT B;  4IIO A;  2FZC B;  1ZQ1 A;  2OTJ Q;  3M0Q A;  3M4Y A;  1NPP A;  2ENM A;  4RTV A;  5DM7 R;  3CCS Q;  1BCO A;  1QVG S;  4C5I A;  4RG2 A;  4BY6 C;  2JXB A;  1VQN Q;  1IZ6 A;  2FEI A;  1QVP A;  2DET A;  3M4G A;  2RQR A;  4LDU A;  4AG2 C;  1FX7 A;  3QBY A;  1AD5 A;  1S72 A;  4XAX B;  3CCQ Q;  1WHJ A;  2VVK A;  4RCB A;  1HD3 A;  5EG2 A;  1VQL A;  2CP3 A;  1X6O A;  1QLY A;  1BI1 A;  5HCK A;  4FSS A;  2BZY A;  2ABL A;  2J6F A;  5IN1 A;  2EGA A;  3P8H A;  1UFF A;  5GAN f;  4A4E A;  2DXC A;  2HKQ B;  4FM4 B;  1BIB A;  3FJP A;  4LNP A;  5GAM e;  2JOY A;  3M54 A;  1LOJ A;  4PJO B;  1MV0 B;  5C6S A;  2LT1 A;  4QKU A;  1K76 A;  1OX9 A;  2X9H A;  3RIR A;  5A0D A;  2I0N A;  5GAO r;  3MEA A;  3FDR A;  4QT7 A;  3CCR Q;  2R57 A;  2QTV A;  5CKH A;  1QWF A;  1MMD A;  3HFO A;  2EJ9 A;  1K8A R;  3LH5 A;  2RHY A;  4AFZ C;  2EW3 A;  2MAM A;  1E7O A;  2DE0 X;  1LJO A;  2HL5 C;  1IHW A;  3M58 A;  3EG2 A;  4C5G A;  3OS5 A;  3L2Q A;  3OMC A;  2XK0 A;  3QO3 A;  3SWN B;  4C8Q G;  4F04 B;  1UG1 A;  2AZV A;  2Y4Y A;  4PL6 A;  4J9H A;  2LCS A;  1NJI C;  3V7R A;  3KBG A;  1Q81 C;  3CCJ A;  1VQL T;  2WSF E;  1ZSZ A;  2GTO A;  3EG9 B; 
#chains in the Genus database with same CATH homology
 2PTK A;  4AG1 C;  3EHQ A;  2LQW A;  1I1J A;  1YP5 A;  3TSW A;  1ABO A;  1H92 A;  2PNI A;  2KBT A;  1U06 A;  2RMO A;  2MOX A;  1WX6 A;  2A36 A;  3KFV A;  1QWE A;  1PRM C;  2C0I A;  5GJW B;  3VS1 A;  1Y57 A;  1MV3 A;  1ABQ A;  1ZUK A;  1M3A A;  3H0I A;  5IHK A;  1SHG A;  1VA7 A;  1M8M A;  2ROL A;  2K9G A;  4CC4 B;  2DMO A;  2QDL A;  2DX1 A;  1RUW A;  2KRM A;  1ARK A;  1VYV A;  4HVV A;  1M30 A;  1M3C A;  1MUZ A;  1ZBJ A;  2AK5 A;  2JMA A;  1NYF A;  1UEC A;  2P4R A;  2CSQ A;  1NLO C;  2DIL A;  4F17 A;  1YN8 A;  2V1R A;  4Y92 A;  4OMM A;  1PHT A;  4RTX A;  2RNA A;  1NYG A;  2C0T A;  1WXU A;  1QCF A;  1ZUU A;  4A63 B;  1GRI A;  4KRT A;  2YDL A;  2FO0 A;  1OPK A;  2JS2 A;  5L23 A;  1UGV A;  2X3X D;  4RUG A;  2O88 A;  3VS0 A;  5I11 A;  2X3W D;  2DVJ A;  2ED0 A;  2DNU A;  2PZ1 A;  2W0Z A;  1JXM A;  2MCN A;  1SRM A;  4DEX A;  3NMZ C;  3EGU A;  3M0U A;  1HSQ A;  1QKW A;  2CUD A;  4OMN A;  2O2O A;  1M3B A;  2RPN A;  1GFC A;  2KR3 A;  1UJY A;  2AZS A;  4DEY A;  1I0C A;  3RBB B;  2LJ1 A;  2EYX A;  1G2B A;  4OML A;  1N5Z A;  2O31 A;  1GFD A;  1WI7 A;  2EPD A;  1ZSG A;  4RTY A;  3M0T A;  2EQI A;  4GBQ A;  3UF4 A;  4CC2 A;  1FMK A;  5IHI A;  2GNC A;  2A08 A;  2JS0 A;  1Z9Q A;  4OMP A;  2M51 A;  3I9Q A;  1NG2 A;  1T3S A;  4JZ4 A;  4M4Z A;  2EYZ A;  2FPF A;  3O5Z A;  3VS4 A;  2JW4 A;  3VS2 A;  1U3O A;  5ECA A;  4LN2 A;  1T3L A;  2YUO A;  3EG3 A;  1UUE A;  1I07 A;  4J9E A;  1OOT A;  1SSH A;  2J6K A;  2CH4 A;  2GBQ A;  1UHF A;  1TG0 A;  2KYB A;  1BK2 A;  3PVL A;  2KRS A;  2DBM A;  1JXO A;  4J9C A;  3THK A;  2LMJ A;  3QWY A;  1JO8 A;  5IXB A;  3I5R A;  2EGE A;  1GCQ C;  1SHF A;  1IO6 A;  1W6X A;  1PKS A;  2CDT A;  1BB9 A;  4RTZ A;  2DJQ A;  4OMQ A;  1U5S A;  5FWB A;  1K1Z A;  1AWJ A;  1AWW A;  2JT4 A;  2J7I A;  2ED1 A;  1UTI A;  1SEM A;  2NUZ A;  1XOV A;  2CRE A;  4IIM A;  1K0X A;  1A0N B;  4HCK A;  2LNH B;  2FPD A;  1KIK A;  3VS3 A;  1QKX A;  1VYU A;  2KXC A;  4LE9 A;  3NPF A;  1NEB A;  4CC7 A;  2L0A A;  3VS6 A;  2XMF A;  3VRY A;  1X6B A;  2ECZ A;  1AVZ C;  3CQT A;  2KT1 A;  4F14 A;  2DL4 A;  2W10 A;  2L3S A;  5IXF A;  2DLP A;  1GCP A;  4RTW A;  2KRN A;  3NHN A;  1S1N A;  2HSP A;  2EKH A;  4J9D A;  2EBP A;  4F16 A;  2OI3 A;  2HEQ A;  3SHW A;  1CKA A;  1WDX A;  3H0H A;  2VKN A;  1EFN A;  1PWT A;  4K11 A;  2EYW A;  4Z8A A;  3EG1 A;  2B86 A;  2GTJ A;  2F2X A;  2O9S A;  4RTU A;  3R6N A;  1ZLM A;  1W70 A;  3H41 A;  2L3P A;  1WA7 A;  2J06 A;  2GQI A;  2DRM A;  2HDA A;  2YUN A;  1NLP C;  1BBZ A;  2M0Y A;  1AWO A;  4WCI A;  2K2M A;  1UDL A;  2CT4 A;  3EHR A;  1LCK A;  2H8H A;  2D1X A;  2AKL A;  2KGT A;  2DA9 A;  1AZG B;  4J9G A;  1H8K A;  1X69 A;  2V1Q A;  5IH2 A;  4J9F A;  1OPL A;  1CKB A;  2BTT A;  4OMO A;  1Y0M A;  1JEG A;  2FG0 A;  2JTE A;  2CT3 A;  5FW9 A;  2D0N A;  4Z89 A;  2KYM A;  1YWO A;  2RQU A;  2E5K A;  2K6D A;  1X27 A;  2O9V A;  1X2K A;  2ESW A;  1OEB A;  2SEM A;  2KRO A;  1HJD A;  3ULR B;  2DYB A;  1UHC A;  4J9I A;  1GBR A;  2RN8 A;  1KJW A;  4HVW A;  1JQQ A;  1SPK A;  1WFW A;  2J05 A;  2LJ3 A;  4E6R A;  4EIK A;  2RQW A;  2ROT A;  1X2Q A;  1GL5 A;  3VRZ A;  3H0F A;  1B3Q A;  1YCS B;  2IIM A;  3VS7 A;  1RI9 A;  4CC3 A;  1T0H A;  2DM1 A;  1G83 A;  2LP5 A;  3JV3 A;  5I22 A;  4R0K A;  1ZUY A;  1NEG A;  2CUB A;  1PKT A;  2BZX A;  3FJ5 A;  2CH4 W;  3UA6 A;  3M0S A;  1WXB A;  3I35 A;  2DRK A;  1K9A A;  2SRC A;  1H3H A;  1B07 A;  4LUD A;  2DL7 A;  2NWM A;  2LJ0 A;  1ZX6 A;  1E6H A;  5IHN A;  4JJD A;  2D8H A;  2MIO A;  3M0R A;  4ESR A;  2FPE A;  3VS5 A;  1KSW A;  1YNZ A;  2KT8 A;  3IQL A;  2EGC A;  3I5S A;  3ZL7 C;  4HXJ A;  1GCQ A;  4JPB W;  1GBQ A;  1AEY A;  1JU5 C;  3NGP A;  5FWC A;  2OAW A;  1K0S A;  2YUP A;  4AFQ C;  1AZE A;  3REA B;  2YUQ A;  1WXT A;  1V1C A;  2RF0 A;  4JJC A;  4X1V A;  2DL8 A;  2G6F X;  2K79 A;  2J6O A;  1X6G A;  3TSZ A;  3TVT A;  3A98 A;  3U23 A;  4D8K A;  4AFS C;  4IIO A;  4JJB A;  3SEM A;  1W1F A;  2JM8 A;  1KFZ A;  3M0P A;  1RLP C;  2L2P A;  1J3T A;  1FYN A;  3UA7 A;  1WIE A;  3M0Q A;  1AWX A;  2GGR A;  2EYY A;  2F2V A;  2L3Q A;  2BZ8 A;  1YWP A;  2YT6 A;  4D8D A;  2FRY A;  2RQV A;  2C0O A;  2ENM A;  4RTV A;  1X43 A;  2LZ6 B;  2K7A A;  2JXB A;  2A28 A;  4JZ3 A;  1Z9Z A;  2FEI A;  1NM7 A;  4HVU A;  2RQR A;  1CSK A;  2DL3 A;  4AG2 C;  3PE0 A;  1AD5 A;  1WYX A;  2VVK A;  4LUE A;  1HD3 A;  2FRW A;  1BU1 A;  2KNB B;  1QLY A;  1TUD A;  5HCK A;  4FSS A;  1PRL C;  2BZY A;  2EVR A;  2YSQ A;  2KXD A;  2ABL A;  2J6F A;  1T0J A;  2EGA A;  4ZNX A;  2RQT A;  2A37 A;  2JM9 A;  1UFF A;  2HCK A;  3REB B;  2DF6 A;  2HBW A;  3QWX X;  4AFU C;  2DBK A;  1AOJ A;  2VWF A;  4LNP A;  2K3B A;  2LX7 A;  3RNJ A;  4J9B A;  1MV0 B;  1K76 A;  1RLQ C;  1PNJ A;  2CSI A;  2I0N A;  5EC7 A;  4QT7 A;  2LQN A;  1SRL A;  1QWF A;  2KEA A;  3PVQ A;  2D8J A;  2OJ2 A;  3LH5 A;  1UJ0 A;  4AFZ C;  2EW3 A;  1E7O A;  2DE0 X;  4RTT A;  1M27 C;  5GJV B;  3EG2 A;  1E6G A;  3EG0 A;  2AKK A;  1UG1 A;  2AZV A;  2KE9 A;  4GLM A;  3C0C A;  2DL5 A;  1WLP B;  1VYT A;  1TUC A;  4J9H A;  2LCS A;  2F2W A;  3UAT A;  4Z88 A;  1UE9 A;  3GBQ A;  1OV3 A;  2JMC A;  2GTO A;  1K4U S;  4ORZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...