2OB5A

Crystal structure of protein atu2016, putative sugar binding protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
Knots found
sequence length
151
structure length
151
Chain Sequence
YFQGMLKNIDPALNADVLHALRAMGHGDTLVISDTNFPSDSVARQTTVGKVLHIDNVSAARAMKAILSVLPLDTPLQPSVGRMEVMGAPDQLEPVQVEVQQEIDAAEGKSAPMYGIERFAFYEKAKQAYCVITTGETRFYGCFLLTKGVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein Atu2016, putative sugar binding protein
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Sugar binding protein
molecule keywords Hypothetical protein Atu2016
total genus 36
structure length 151
sequence length 151
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 2ob5A00
2WCVA 4A34A 3P13A 1OGFA 2OB5A 1OGDA 3E7NA 1OGEA 3MVKA 3P12A 1OGCA 2WCUA
chains in the Genus database with same CATH superfamily
2WCVA 4A34A 3P13A 1OGFA 2OB5A 1OGDA 3E7NA 1OGEA 3MVKA 3P12A 1OGCA 2WCUA
chains in the Genus database with same CATH topology
2WCVA 4A34A 3P13A 1OGFA 2OB5A 1OGDA 3E7NA 1OGEA 3MVKA 3P12A 1OGCA 2WCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCV A;  4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  3E7N A;  1OGE A;  3MVK A;  3P12 A;  1OGC A;  2WCU A; 
#chains in the Genus database with same CATH topology
 2WCV A;  4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  3E7N A;  1OGE A;  3MVK A;  3P12 A;  1OGC A;  2WCU A; 
#chains in the Genus database with same CATH homology
 2WCV A;  4A34 A;  3P13 A;  1OGF A;  2OB5 A;  1OGD A;  3E7N A;  1OGE A;  3MVK A;  3P12 A;  1OGC A;  2WCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...