2OBFA

Structure of k57a hpnmt with inhibitor 3-hydroxymethyl-7-(n-4-chlorophenylaminosulfonyl)-thiq and adohcy (sah)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2obfA00
4F86A 3PVCA 3G5LA 2PX2A 2JJQA 2NXJA 1PJZA 3EGVA 3GXOA 3LBYA 3V97A 2NP6A 4KDRA 4BLVA 1EJ6A 1JSZA 2P3LA 3M6WA 5EC8A 3DP7A 1ORHA 3TQSA 1XTPA 3P9NA 1SQFA 3CC8A 1RJGA 3M70A 4GC5A 4KRGA 3UJBA 1XDZA 4LG1A 5LQCA 2LD4A 1VBFA 5MHTA 3FPJA 2C7QA 2V74B 3KR9A 1WG8A 4HC4A 2E5WA 5K01A 1R18A 1P1BA 1QZZA 3LL7A 4GF5A 3KQPA 2H00A 4YMHA 4R8RA 4ER0A 2JG3A 3PFHA 3T0IA 2AN3A 2CWWA 1QAOA 1L3IA 4RX1A 4RYLA 1BHJA 3CBGA 5FWDA 4M7RA 3FTDA 2FYTA 5FQNA 2P7IA 3O31A 4ER7A 1I9GA 3SM3A 4ER5A 3VC1A 3OPNA 3TOSA 2H1RA 1G8AA 1NBHA 3P9IA 2PBFA 3HM2A 3TLJA 1YFLA 3MAGA 2GAFA 3PFGA 4HH4A 4GOMD 5GP1A 3UJDA 4EQZA 5BXYA 1XXLA 5DPMA 5F2OA 4ZTBA 4PNEA 2EJTA 2YVLA 4GBED 1XJ5A 1B42A 1F38A 3G5TA 3HVIA 3ORHA 1XDUA 2VDUE 4PONA 4E32A 4YMGA 5LQRA 4OBWA 4FGZA 1UIRA 3HA5A 3UJ6A 4MTLA 5GIPE 1N7JA 3BWMA 1KXZA 3R24A 1AV6A 1Q0SA 2PLWA 1AQIA 4ER6A 4F85A 5T6BA 2YUIA 5DM4A 1NW5A 3KHKA 3SGLA 4C08A 1AQJA 2NP7A 1TPYA 3GWZA 3GO4A 4QTUB 2P3QA 3FUXA 1EQAA 4KIFA 4E30A 4DKJA 2Z6QA 2EX4A 3DLCA 3IHTA 4YV0A 4YUVA 5EHGA 2OYRA 2AS0A 4BP3A 5DRTA 3DMHA 3MB5A 5ICEA 2HWKA 4V0QA 3P71T 1O54A 3DR5A 3EVAA 5KQSA 2ONZA 1PRYA 1O9GA 5DTQA 3NMUF 3R9XB 2H11A 4RVGA 3FRHA 3HCEA 4OBXA 3LCVB 1JTEA 3G2MA 3M4XA 2YR0A 4RTQA 3KPVA 1JTFA 2ZVJA 2ZSUA 3FPFA 3UJAA 3KKZA 2AVNA 5DSXA 1KPGA 5GOZA 3KR2A 3HCDA 3LX6A 3B3FA 2JH9A 3FYDA 1P39A 3KPJA 3WSTA 5F2NA 2FCAA 2ORED 1JR4A 2WA1A 1RI4A 1X1AA 3MTIA 4HGYA 4CKCA 5HIKA 2G8NA 2UYOA 3MGGA 3BWYA 3GCZA 2ZBQA 3IYLW 1VLMA 2I6GA 4A6DA 3U81A 5ERGB 4CKBA 1RJFA 3HCFA 2A14A 2PXXA 2WA2A 4LECA 4QDKA 2I62A 4X63A 5DRYA 5F2KA 4LWPA 5FCDA 1MJFA 2YXEA 3EEYA 3LDFA 5EPEA 3T7SA 4AZTA 3DLIA 2GA9A 2OPBA 4GOOD 2IH2A 4RVDA 4C04A 1RI3A 5K0FA 1TW3A 2ESRA 3AXSA 5C9ZA 1FJXA 3EEOA 2JH8A 2B2CA 5BW4A 4XUEA 4FSXA 2AOTA 1G38A 2ZCJA 2G1PA 3TM5A 3TM4A 5K8VA 2PWYA 5E8JA 5CCXA 2ZWAA 3SXJA 3OU7A 4KDCA 5K03A 1ZGJA 3AY0A 3V8VA 2OKCA 2FK7A 5HZMA 3E05A 3FPEA 3KPYA 5DSTA 4PYQA 3HCAA 5K0NA 1KYWA 5M5BA 4RTOA 1D2GA 4U7TB 3LKZA 4RTPA 3B89A 2GH1A 3GRZA 4KVZA 1JSXA 3K0BA 2Q41A 3OFKA 4QVGA 3BUSA 4PYNA 5HIIA 3UJ7A 5EG5A 3THSA 4DMGA 3EVEA 5EIFA 4HSGA 4NECA 5K0JA 3P9CA 1P91A 3EVGA 3UJ8A 2EFJA 2ZWVA 3F4KA 1BKYA 4HGZA 5CCBA 3R0QA 3I53A 3QOWA 2ZTHA 3GNLA 3UA4A 1NW6A 3DTNA 5EMJA 5HOQA 2FRXA 3GRVA 3BWBA 1R6AA 2FHPA 3DXXA 1JQ3A 2ZIGA 5FHQA 5HIMA 4CTKA 3A27A 2VZ9A 4E2YA 3GIWA 3HEMA 3KQMA 1G8SA 3CJTA 4Y30A 2YX1A 3MCZA 2P40A 2IBTA 4GOND 2BH2A 4DQ0A 3OCJA 2C7OA 2BR4A 4FP9A 3UJ9A 4AUKA 1SUIA 4GQBA 4U7PB 2PWPA 3KQSA 1WY7A 2P3OA 4R05A 5ICGA 5IKMA 3R6TA 3ELUA 3IEIA 4XCXA 4EKIA 3KQTA 5C1IA 5K0EA 4OQDA 2Y1XA 3NJRA 4EVIA 2G72A 5EEHA 5E8RA 3T7TA 3UZUA 2N47A 4RTSA 2R6ZA 3X0DA 2OB1A 5GM1A 4AZVA 5E9QA 2ZZKA 3OE5A 1YUBA 4L7VA 1R00A 3UJCA 4AX8A 4DCGA 5E1DA 4HG2A 4B17A 1NT2A 1FP1D 5B1SA 3LBFA 3FUUA 3KPWA 1NV8A 1Q0TA 2G70A 5KVAA 1P1CA 3DUWA 3E8SA 3LSTA 5CD1A 2XBMA 3LKDA 3OU2A 5EZSA 2HR1A 3Q7EA 3LCUA 4R6WA 1I1NA 1SQGA 1EG2A 2ZBRA 5EMKA 4ISCA 5EEGA 2IPXA 4POOA 3C6MA 4P58A 3AWIA 3BGIA 1KIAA 1R74A 4E2WA 2AOXA 3DULA 1EJ0A 5DLYA 5BW5A 3R3HA 1U2ZA 3BGVA 2O57A 5FA8A 5GINE 3T7RA 2VP3A 1T43A 3MHTA 3QV2A 3G8BA 1QAMA 1IXKA 5EZQA 3A25A 3DXYA 5T67A 3A7EA 2VDVE 3KQOA 5CVJA 3IV6A 4PYKA 2P41A 4CTJA 4GC9A 4KIGA 3SSNA 2AN4A 2WK1A 1XVAA 3GU3A 1I4WA 3GRRA 3I5UA 4HTFB 2JHPA 4M36A 4P7KA 5D1HA 4QVKA 2ERCA 1UFKA 2GS9A 2OXTA 2NXNA 4RTJA 2ONYA 3BWCA 4YV2A 4QQKA 2YQZA 4V0RA 4ER3A 5LQJA 4M37A 3CCFA 2HMYB 1YZ3A 5DT2A 3G88A 3HA7A 3LCCA 3NDJA 3BKXA 2CMGA 3AJDA 4CWAA 3B3GA 4YUZA 3P9KA 4QPNA 4PGGA 1NV9A 2BR5A 3L8DA 3RW9A 4O29A 5EKXA 1KP9A 4OQEA 1JQEA 5DX1A 3G89A 5KQRA 3SSOA 1RJEA 3I64A 3LECA 5FUBA 2Z6AA 3B7PA 3S68A 1ZKDA 2ZW9A 3TMAA 3KU1A 1XCLA 5HILA 5T64A 4EMSA 1ZGAA 4X60A 5GIOE 5LQKA 2V7EA 2PGXA 2BR3A 3SVZA 1NKVA 3ER8A 1DL5A 4MHTA 4FT2A 3D2LA 4FT4A 3G2QA 4RSRA 1ZHFA 3NW9A 2BM8A 2QE6A 3NWEA 5DXAA 5FTWA 4PIMA 3ELWA 2AVDA 1RI5A 5K0GA 4RTRA 3O4FA 2HV9A 3ERCA 1VP9A 2IDKA 3HA3A 1NW7A 4OX9Y 5EIWA 4GEKA 1BC5A 5P8WA 3OZSA 2P7HA 4KWCA 4PIPA 4OA8A 3M6VA 1L9KA 5CVEA 4RTLA 5E1BA 4C03A 2YXLA 3P2IA 3B5IA 5JUWA 3EVFA 3PS9A 2GPYA 1JG3A 2G71A 1JQDA 4E2ZA 3MERA 4CKEA 2BM9A 3K6RA 5LR6A 5DTMA 2QRVB 7MHTA 1QANA 1RI2A 1F3LA 3CVOA 1VPTA 4WXHA 3UWPA 3RIEA 3TR6A 3CJRA 5IH3A 3GDHA 2AR0A 3MTEA 4QPPA 2AOVA 3VYWA 5KYGA 4CXMA 2PX5A 5E1MA 3AXTA 5FWAA 9MHTA 1ZQ9A 2ZIEA 4R8SA 5E2BA 4XUCA 1O9HA 3KQWA 2B78A 3EGIA 1JG2A 2IP2A 3E7PA 5K0BA 2XYVA 4LWOA 4QTTB 4GUAA 3OE4A 3DMGA 4PYIA 2NYUA 4C4AA 4E31A 4P7FA 2PSSA 1YZHA 3HVKA 5EHIA 3HNRA 3KR1A 3NTVA 8MHTA 4QDJA 2K4MA 4IV0A 1RI1A 3EMDA 3P2KA 2YXDA 2PJDA 5DM2A 3P2EA 2IBSA 2IH4A 2C7PA 4E33A 2O05A 3NVMB 4UOEA 3FYCA 1SVUA 2C7RA 1R8XA 3PX2A 3OFJA 1D2HA 1N2XA 4AZSA 3UBTA 5EVJA 5GWXA 5LSAA 1G55A 3UFBA 2HTEA 3VC2A 4PYLA 5LQNA 5CIYA 1BOOA 2FPOA 3DXZA 4Z2YA 3DMFA 2NNWB 3C6KA 2PY6A 4E2XA 5EMLA 3CJQA 1ORIA 3G2PA 1DCTA 5EOVA 2JHAA 2UYQA 3RODA 4RVFA 2VDWA 3ELDA 4PYMA 5FA5A 3FRIA 3FUVA 3SMQA 2QM3A 4H0NA 4X41A 5DXJA 5EMMA 1L1EA 2XVMA 2UYHA 4P7GA 3SX0A 2I7CA 4IV8A 2AOUB 1JG1A 3LHDA 3TPZA 4OA5A 3EVDA 3FPGA 4WVLA 5D1NA 1HMYA 3HCCA 3DOUA 1NW8A 2OB2A 3EVZA 1SUSA 3EGEA 5K05A 5JR3A 4HRAA 5EKUA 1VQ1A 5CVUA 4PWYA 3BT7A 2PV0A 2O0LA 4PYJA 5LQUA 4BLUA 3G8AA 3M6XA 3BGDA 3FTCA 3H2BA 3A7DA 1M0EA 1OR8A 5K0CA 4X61A 3TKAA 4ATNA 3NWBA 2BZGA 3CKKA 5DX8A 5DX0A 2B3TA 1M6YA 4YUXA 4Y2HA 3QOXA 4MQ4A 3M6UA 4JXJA 4KW7A 5BP7A 4RVHA 1WZNA 1KR5A 2OBFA 2IGTA 2CMHA 3REOA 4YUYA 3LDGA 4HTFA 1SKMA 3BXOA 1NE2A 4FS8A 4RTKA 1NW3A 3KR0A 2HNKA 2P1DA 4DCMA 4DA4A 1R8YA 2PX8A 5E9WA 4RTNA 3TRKA 2UZ4A 3FTFA 2PT6A 3A26A 4M38A 3I58A 5CVVA 2B9EA 2IDJA 5ICFA 2I9KA 3PB3A 4AZWA 4RV9A 3OZRA 2GLUA 4FSDA 3BKWA 3JWGA 5E2AA 3PX3A 5FHRA 3FZGA 1QAQA 1G60A 3Q87B 2R3SA 3EVBA 2DULA 3MQ2A 5FADA 3KPUA 1UWVA 3ANXA 5CUQA 5HFJA 3ELYA 4EKGA 1WXXA 3G7UA 2PVCA 1X1DA 3GJYA 1FP2A 1VE3A 1EIZA 1Y8CA 1ZG3A 2QY6A 3OZTA 3JWJA 4MWZA 5HEKA 5DM1A 4GOLD 2ZZMA 1VP3A 1H1DA 3LGAA 3KQYA 3JWHA 3NDIA 3HP7A 4PCLA 5E1OA 4YV1A 2GB4A 5DM0A 2ZBPA 1M6EX 2ZULA 4F84A 1KHHA 1IM8A 2AOWA 4E70A 3C0KA 4P7JA 4DF3A 3G2OA 5C0OE 5K09A 2IIPA 2UYCA 3VSEA 2FK8A 1WS6A 5E9JA 1X1CA 2PXCA 3JWIA 3P8ZA 2Y1WA 3GRYA 3HVJA 1Z3CA 4C06A 1IY9A 2DPMA 3OU6A 2P8JA 3LPMA 3M33A 1X19A 2OY0A 2QRVA 2EG5A 3E23A 5FULA 4MIKA 4IWNA 2VS1A 3THRA 2AZTA 2NXCA 3FUTA 1V39A 2CKDA 3LDUA 4RWZA 5ICCA 2OO3A 4PINA 4BY9E 2ADMA 1KPIA 1EAMA 1KPHA 3KQQA 5CM2Z 2OZVA 4FZVA 2ZLBA 2IFTA 2YTZA 5U4XA 3PT9A 1L3CA 2ZIFA 2PKWA 2XVAA 1DUSA 1RJDA 1VIDA 2XYQA 3GRUA 3P97A 4EK9A 3C3PA 3EMBA 5CVDA 3BZBA 4K6MA 5K0LA 3ID6C 4X1OA 4C05A 4BLWA 2Z6UA 2PX4A 1YF3A 3PTAA 10MHA 4DM3A 2IH5A 1XCJA 2AOTB 1FPQA 5FQOA 3A4TA 4PCAA 3DH0A 1X1BA 3KQVA 3UA3A 5G02A 1FBNA 3PLAE 3TFWA 1KYZA 1WXWA 2JHCA 4G56A 4BP1A 2QYOA 4DZRA 1NBIA 2AN5A 2PT9A 3HTXA 2B25A 2O06A 3ME5A 5KS2A 3O7WA 4PGHA 5DWQA 5EQJB 1L3BA 4YUWA 4PYOA 3MCTA 1MHTA 1INLA 1QYRA 3I9FA 1G6Q1 3EVCA 3EPPA 3GGDA 3TKYA 4A6EA 3FTEA 2F8LA 1AF7A 5H02A 2O07A 1TW2A 3CGGA 2EJUA 1N7IA 4RTMA 5HIJA 1YFJA 1VL5A 1YB2A 2XYRA 3B3JA 1D2CA 2ZFUA 3FPHA 2NXEA 2ZZNA 4FR0A 3NVKI 3ER9A 1SG9A 1XDSA 3C3YA 4R6XA 3HVHA 5GM2A 3SR4A 2PXAA 5LQAA 3SSMA 5DTRA 4XUDA 4IKPA 4C07A 4QQNA 1JG4A 2CL5A 3FUWA 1HNNA 3HCBA 5EGSA 2P35A 2AOUA 2KW5A
chains in the Genus database with same CATH superfamily
5AVUA 4JT8A 3L5OA 3GGSA 2BP7B 3V97A 1DBIA 1G8GA 5JSZA 3U44A 1SVIA 1B4DA 4CNBA 2DUWA 3O1JC 1LFAA 5KOJA 1H93A 1E7YA 5EA2A 4E22A 3GLHB 3HR8A 4GQIA 3K73O 5IS2A 1I3KA 1I5RA 2YQ5A 1K3UB 4PPFA 3UJBA 1XF1A 1Z8HA 2ODQA 3RRYA 3GEEA 3HLKA 1MAWA 3G2KA 1YOVA 4MCHA 5DISB 1R4NB 1OBCA 1P7YA 3NHBA 4LKOA 5SY6A 4ZYVA 2CBXA 3I1FA 4F6RA 3VYVA 1FOEB 2EVWX 1SWWA 1RQ2A 2FZVA 1YB6A 1XNHA 2Y9MB 3EAGA 4GYJA 4DUGD 4OU5A 4BS9A 5HM6A 3WLMA 4NFSA 2XGOA 2AQHA 2H54A 2Q8NA 4DLXA 4EHKA 1T5IA 2ZANA 3QEAZ 2P7IA 4ICIA 4JJ7A 4MR7A 1RADA 1SR8A 4KYTA 4Y1RA 4EJ0A 3AETA 4PFSA 2ZB4A 2FW8A 3ABOB 3U6KA 4QQRA 1YTUA 4Q93A 3C5VA 2WD8A 3DEHA 1I4DD 1I5EA 1TKBA 2OHIA 4H3VA 4UEWA 4KQIA 5AMXA 3LX8A 4L6IA 5F52A 4D5EA 1A71A 4YMTA 3ZLUA 3ZD9A 1GNPA 1VDMA 2GM5A 3H2SA 4GBED 3FB1A 3ORHA 4JT4A 4KQ2A 1XDUA 3NORA 4BNHA 2D4AA 4MMZB 4E0BA 5HS4A 4YQEA 1ZJ5A 3IL2A 1GKLA 2PLRA 4JSTA 4I1VA 1VJTA 1CP2A 5DK6A 1KXZA 2Y05A 4ZZ3A 1Q0SA 4DUGA 4WHMA 1DEXA 1FTNA 1UEXC 1ESEA 1LVUA 5EHZA 1D6MA 4GDFA 1M2WA 4Z7JA 5JJLA 1QV6A 4QTUB 2R25B 1UJ4A 2VWPA 3DLCA 3IHTA 4LYAA 3ONVA 2FEWB 3ZCTA 3CIOA 4HOYA 3NLLA 3WWOA 3VFDA 1NVWQ 3F6SA 4BV3A 1V11A 3GUCA 3QXHA 1WB6A 1KC3A 5H3LA 2L17A 1N3IA 5CLLA 3IVXA 3JAWB 2B8JA 4XASA 4E3WA 2XGMA 2XXBA 3FDZB 4ZO9A 1FZQA 1T1EA 2ONZA 4J9UE 1FMFA 1JPVA 2WM9B 3TYXA 1NZJA 2BFDB 3BXPA 4L4UA 3WV4A 1ZDMA 2YR0A 1WA5A 2UVQA 1K4MA 4ZOLA 1TQ4A 5IVDA 4BBZA 2QUHA 4JFAA 5K6AA 1V4VA 1QHSA 2PSFA 3ZWXA 2G0TA 3SNKA 1A3CA 3I23A 4P3KA 3UMFA 2FZEA 3ASZA 4ALMA 5AP9A 2Q99A 1U1CA 1H9AA 3L43A 4MI9A 2V0CA 2ORED 2R84A 3O2QB 4HGYA 3E3MA 2BN4A 2PS3A 3QEMA 2CSUA 4Z5XA 2UYGA 3NX4A 3SOZA 1JIVA 3WK4A 1U5BB 5A3JA 5F9HA 1QGYA 3QVUA 1A50B 1L7PA 4M9RA 1YC5A 3HI6A 4QGGA 4EFMA 4LMPA 3THYB 3OCCA 1Q83A 2XWPA 5FBZA 3ZR4B 3V8QA 2G77B 4U7GA 3EZGA 1GUBA 5TE9A 1BDMA 1V8PA 2PGOA 4LSMA 4YAFA 1ZSVA 2JGKA 3KUCA 4ARBA 5JARA 3RVMA 2IH2A 3AI7A 4RVDA 2DPXA 1EFVA 3RS8A 1T9CA 2XW6A 2IYWA 4YJGB 3H7AA 2YUTA 4HT3B 1K68A 2G4CA 1DS6A 2Q9CA 2JH8A 2RE8A 2FDCA 1ZN2A 4FSXA 1EVJA 2E4YA 1ZOOA 4RUKA 3UOGA 1ADFA 3N7AA 2CVOA 1P1KA 4JLNA 1SMKA 9LDTA 3W9UA 3OIDA 5JS2A 5HNKA 1PWYE 3ROZA 4BMYA 1EGQA 3I8XA 1U98A 3EWAA 2MMCA 4BLOA 2QDXA 4MOWA 3DLHA 3GROA 4OB7A 2A5DA 2GVDC 3KPYA 3OA2A 5F64A 1W0JD 2J45A 4KI7A 1W4LA 2WIFA 3VI4B 4F2PA 4LHEA 2VUHB 4AMYA 4MV6A 5HIIA 1DTSA 5BQPA 1VG9B 2I1QA 1G291 2MIIA 1ZFNA 1XD2A 3RSQA 5KQPA 3LO8A 3N2KA 4GG1A 1WHTA 4HGZA 3IUYA 4J0EA 4DAOA 2GBFA 3SZGA 4D45A 4G8DA 5FUVA 4GWGA 5FORA 2G9ZA 3IIKA 3TLBA 5K51A 1J6UA 4O4JF 3GRVA 1QF9A 2DBQA 2FZGA 3B5JA 4YJHB 4DIBA 3L4SO 2BFAA 3HN7A 2GERA 2ZUWA 5FHQA 1WCWA 3B52X 3GEGA 4O3MA 2QPLA 2L2QA 3OQHA 2YKGA 1A9XA 5TQJA 2YX1A 3SEAA 3WISA 3TNFA 5J4VA 1M72A 5G53C 4EI2A 3OCJA 1JFLA 1JVSA 1ODFA 1OXMA 3AO0B 2C4NA 2JIQA 1QE0A 2DPYA 3FCUB 3HKEA 3T99A 4MVJF 4KN5A 5U1PA 1N34B 1I33A 3FYTA 2O7RA 2QUJA 2VF7A 1RABA 1E6LA 4IDPA 3S2IA 2N47A 4Q1AA 4WK2B 3L7CA 2BHSA 3HFGA 1FJ2A 4F56A 3I0ZA 3KYCA 2AMJA 1Y0BA 2ODTX 1GV1A 2XTNA 4RNCA 1GRRA 1Y3BE 3FMFA 3OE5A 4RGQA 4LBZA 4NIMA 3MTJA 3HVUA 4MROA 4BB0A 2FQYA 2NZWA 3CO0S 2BEWB 2A78A 4L73A 2VAVA 3MWKA 4ZXFA 2PRJA 4NAHA 3Q3JB 3DLPX 3LSTA 4IDCA 4B1FA 2H4HA 3AEKA 3L7DA 3P32A 3WJ7A 4RVUA 4IVRA 3ISVA 3ZDQA 3CEAA 1VMDA 3P2MA 4RDHA 1PJCA 3EOBI 4DQDA 2OV3A 2JA1A 3K09A 4NXMB 3GCWA 3WBKA 4KO1S 2PUVA 4C6SA 3EGDA 5AM1A 2OWEA 1EDDA 2OEPA 2WV9A 4PO9A 2AJBA 3AHEA 1UPFA 4BVGA 2AFHA 2I03A 3IHWA 4EENA 1YQQA 3GR6A 3L7IA 3QTLA 3F6EX 4KMSA 2FR1A 5GOTA 4DB4A 4TTVA 2D1FA 2G82A 4FOPA 1S89A 5ADVA 4PZUA 2RONA 3K4PA 3ZNNA 5JAPA 2DR0A 3V4SA 4ON9A 2Y8EA 1XXHA 1DWUA 4YGYA 2D06A 3CNQS 1T5BA 3SSNA 4OOFA 2AN4A 2DBRA 2H2FA 3PHBE 2N75A 3G9XA 4C6HA 1KQFA 2ATXA 4QGSA 2GWHA 4IJQA 1X8XA 4ZV7A 1GRVA 4ARAA 2W6ZA 3OOWA 4B5KA 4ZREA 1YJXA 4UOQA 3TUIC 4JJIA 1QIEA 1XKTA 1YZ3A 2H5LA 1YRWA 3D8BA 3JZMA 3ZWNA 1MAVA 2DPGA 1D5CA 1GNSA 2QRKA 4MGEA 2BGGA 1G20A 1MO4A 3E7FA 5HMLA 3QRWA 4EATA 5A6VA 4EABA 5K3DA 4DNFA 4L3WA 3RW9A 2EQ5A 3PE3A 1RRVA 1IULA 4PBTA 3GBPA 1BGVA 2LKDA 1XZBA 4I4CA 3B1YA 3LXRA 4JQOA 3RWBA 1XL1A 3LAWA 2V1UA 4UXJA 1A0OA 2PX0A 4RL6A 4V39A 5FWYB 1YOBA 5C34B 1DCKA 2PUGA 5AD1A 3S68A 3WWCA 4WZZA 2VWGA 3PUZA 5KNCH 3K2QA 3L05A 4NEQA 4KXLA 3SFVA 3W34A 2CCKA 4EZEA 3DW3X 2WF6A 3SVZA 3MB8A 1IPHA 3WB9A 4FT2A 4FT4A 1ZESA 3NW9A 4IOLA 2ZKIA 2QE6A 2E87A 3NWEA 4EG4A 1YE3A 1WZCA 4C0WA 4YQZA 5FUQA 1ZJWA 4G1EB 3SCZA 5IYZB 3J7AC 1UJMA 2JBAA 5I5EA 4OX9Y 3A4LA 1OH7A 1TVMA 2CL6X 4FZJA 3PGA1 3ZDFA 4L5CA 1EVEA 5IM4F 5E1BA 3L4JA 3RG8A 2DETA 1NNEA 4DLKA 4DQUA 1OVMA 4R8LA 1RCTE 1D0SA 1RKUA 1XF9A 1RHUA 2Z30A 1ZK4A 3F8TA 2RGDA 3BXXA 4RFSA 4UHKA 3FBWA 2ZI4A 4RZIA 4BV2A 3TZ6A 2D1TA 3W2IA 3C5HA 4X85A 1NHWA 1QVAA 2Q0SA 3O38A 1HT2E 3V46A 3OLVA 1SCUB 1X38A 4ZT6A 3EZ2A 4HQRA 3RBZA 5ALKA 4XUCA 3VPCA 2QF7A 1FUIA 2FPGA 2J3EA 2FX2A 4A16A 2ZB3A 2GEVA 1PFVA 2HSWA 2IVFA 5AVKA 5FPKA 5CITA 2H4WA 2C9BA 3CEMA 2C9CA 4MRPA 4CRWB 1CZLA 1QLHA 2ZCVA 4A91A 5EHIA 1XZ8A 4F9TA 4J0KA 1NOIA 3MWJA 3U6BA 4MCAA 3PWKA 4YK7A 3HFSA 3P2KA 3EMVA 1GCGA 1E20A 1GUYA 1XPJA 2J9XB 5TXGA 2IL1A 4EG1A 3CZQA 4R9RA 4V0KA 3EPJA 1W85A 5LBIA 3PNPA 1IPFA 2WYIA 1Z74A 2NYAA 4I4TF 5IPFA 1N2XA 3PHLA 2AGVA 3R7AA 1E6MA 2RB4A 2XCQA 4MDHA 1QIMA 4PYLA 1YJQA 2A33A 1TQ6A 4Q4HA 1LTKA 3GLHA 3ZKWB 3B48A 4C4SA 4QFMA 4CKWB 4MZXA 1JEYB 3K4HA 3EOAI 4H16A 2XRYA 2YOFA 2JASA 4B8ZA 5DFAA 3S5UA 2UYQA 1JIUA 4MGYR 1CS4C 3C8DA 4QA9A 1GY8A 1C3OB 2DMRA 4H0NA 4N65A 1AXGA 1EDOA 5BQXA 2FKNA 3SHFA 4LXYA 4BB9A 2M6LA 3KXLA 4UZEA 1WXEA 2HFJA 3FSJX 1J1UA 4Q6BA 2VJOA 3ZV6A 3EF3A 1OZAA 4Q12A 1RXEA 3HJGA 4GXNA 1E1LA 2QGFA 3HCCA 3HZHA 3K35A 4RY8A 5HMMA 5KYWA 1H4VB 2BBOA 1HE4A 2JJYA 4TVBA 1IBMB 1W88A 2ZDGA 2AX3A 2NSDA 1WRBA 1DUVG 1P77A 3MWEA 3E1SA 3U7EB 4YCLA 4DSTA 3NDBB 5GV8A 4CM8B 2CMFA 3EFOA 4ZZIA 2WC1A 3PR3A 2X0EA 1W47A 1WXHA 5TVGA 3L8HA 4RVCA 1H4SA 4UUPA 1BDIA 2ZYAA 3G1TA 1C9NA 2ZJAA 4TV9B 4DLSA 5JRJA 4QUAA 4ZAZA 4AD8A 5KTMA 2P2YA 2I4IA 1W1WA 4FVTA 4GVPA 2OCLA 2GM3A 3B9QA 3HCPA 3W3AD 3GJ0A 4KW7A 4NICA 3T6KA 1ZH8A 3REOA 4FLEA 2TS1A 4M8NE 2EARA 1EP1B 3BHMA 3AW9A 4TN5A 5B1IA 1ECJA 1KI1A 2ATIA 2QLBA 1TF7A 2BFOA 4DA4A 2XZTA 2ANCA 5E9WA 1EWTA 2RHOA 2FR8C 5ALRA 3U1TA 1VE7A 2C0QA 2H08A 4UMDA 4V02A 5B7NA 1XJCA 5TF4A 2A84A 2BVNA 4P82A 4CF7A 1DG1G 5KSYA 1QAQA 1VHQA 4Q4AA 4IH4A 4FFWA 3Q87B 4OQPA 2MSEB 2GA8A 2ZG6A 1IZ0A 1MEOA 2DULA 3E7DA 3W3AA 3GMDA 4N5MA 4RZ2A 4WCFC 2I6SA 4TT3D 4IJVA 1EM8B 4KPFC 3HP4A 3OEYA 5A04A 1UOPA 1YQ9A 2BHTA 2NZXA 1GUAA 3S70A 1VE3A 2JFXA 3QV1A 1ZUIA 3E8MA 4MWZA 4DV5B 4I1PA 5I9IA 3HRIA 2H51A 3A0RB 4Q7MB 1CUJA 4XE5A 2P9TA 2IHBA 3MMSA 3CUWA 4X91A 5J2TF 2V7XA 1SD2A 3F3MA 3LGAA 3OX1A 5HPYB 1NPYA 3RAFC 4K1XA 1XMXA 3THOA 2XUQA 2I2FA 1UDCA 3CLSC 3JVUA 4LISA 5AI0A 1CNFA 1RZRD 2XUHA 2GF0A 5BOSA 3ILXA 3KOOA 5K09A 2RJOA 2UYCA 2HB6A 3EDCA 4JJAA 1TQHA 4NG4A 3OMXA 2NMVA 3D7KA 3JWIA 2XTZA 4CN8A 2KJQA 2WV7A 3NM5A 3MBIA 1UADA 3GZTB 5J9FA 1G7RA 5IXSA 4FMBB 3LPMA 1CRQA 3T41A 2C61A 3WZLA 1KE2A 4BVKA 1IUNA 1D7OA 1OE0A 3N6VA 3WGLA 1UFRA 4ZI2A 4WASA 1RCFA 1VLHA 3UTCA 4UZFA 2D0IA 2Z5GA 3E9EA 3UMRA 5CM2Z 3DTYA 3PF8A 1W5FA 1NVGA 4OI4A 4YAGA 4PLFA 2ZIFA 4U6QA 2OXRA 2J9GA 1DUSA 1KI7A 1TJYA 2XVAA 2XA2A 3PFFA 5BN3B 1P2TA 2IP1A 4P4SB 3CVUA 4K2AA 3ZC3A 4LVNA 4FINA 2GLTA 4C05A 4TWJA 5FTKA 5KJCA 4ETIA 5LNK1 1O0BA 1V3TA 3K0KA 2IOFA 2D54A 1H0RA 1HE2A 4LRYA 3MJHA 4TXHA 5FPQA 2GAIA 2ZJ2A 4OLHA 1KFEB 4H7EA 3TFWA 2GCOB 1SBZA 4HUJA 4QASA 1Y98A 2FPLA 4QO7A 3ZZ1A 2VK1A 3ME5A 4ANFA 3X2FA 3QWAA 1SUPA 1RQLA 4PGHA 1IOWA 1HQYE 1I2DA 1U6JA 4IMPA 4RD0A 3EPPA 4HDCA 4PIVA 1FL9A 3R40A 2CKMA 1NI5A 2QRZA 2VI5A 4KNYA 1FXUA 3CGGA 4UAVA 4ZTUB 4B73A 1G9SA 1N7IA 1NZFA 3JZAA 4WT7A 1VRCA 3AIMA 4TX1A 3P2OA 2F4NA 4YJ3B 4EY4A 1NKTA 3MVEA 1QS0A 4G8CA 5REQB 3RUPA 3SEQA 3L0ZA 2XKBA 3C3YA 4N12A 4BYGA 2PLAA 3HVHA 6REQA 5AW4A 3CU5A 1HYHA 3K5PA 1NVMB 4CMHA 3E7XA 3FCOA 3KFXA 2EIXA 4LPKA 1ELOA 4IKPA 4TYPA 4C07A 5M04A 4GLJA 5FBLB 5C37A 4Q82A 5IWAB 2QD2A 2KS6A 1CS0B 3TQSA 3JRNA 3ZU2A 2JCXA 4HP8A 2X0RA 4CM3A 5L3SA 4KE7A 1OXBB 3IQXA 1V4BA 3NHYA 4UVGA 4PS0A 5EC8A 1GGEA 1UM8A 2QXTA 3GZNB 3GLIE 3ZUGA 5JAHA 5BORA 1VBFA 4D4LA 3H05A 1OILA 2FPRA 2VUIB 2YV2A 3EQ8A 3HN2A 3OZIA 1SCNE 5E95A 5YASA 3V9AA 4ACAA 1EBFA 1Y5IA 3TLYA 3OBIA 3ZJ4A 4W1RA 1IQUA 2DFVA 4OXYA 1R18A 2ZJ6A 2MYNA 4U2EA 3HJNA 1LF5A 2POQX 4J4BA 2GUGA 2NAFA 5DMXA 4BLPA 4JI4B 4RYLA 1DDOA 3HHPA 2XAUA 4M7RA 4GR4A 3BL5A 4IFTA 2A1TS 1T8TA 4NZPA 1APBA 1RPJA 4WQMA 1AMOA 3AV0B 2JGLA 1J70A 4NMLA 2OQRA 2WWIA 2O8EA 1O94C 1FFDA 1XROA 5KU7A 2A88A 3BZUA 2J08A 3DV2A 3GF4A 1HT1E 4OMDA 4WNIA 3AK4A 3PC2A 5C1OA 2FZLA 2Q4OA 4KR6A 2Y99A 4II3A 4TM7A 2A0UA 1OSNA 4JQZA 5EIBD 4J7UA 1AV6A 2QRUA 4S04A 1IWPB 4PZDA 5DYTA 1MZVA 3O1LA 4EUEA 2PR7A 1AQJA 2ZR8A 4L74A 3MT9A 2QSUA 3HB1A 3CRRA 2L82A 4G0PA 1EESA 3GJ6A 1AX9A 1PWZA 1TE2A 4JR2A 4DJAA 2C4VA 4YY3B 1NFFA 3WYBA 2E3JA 1XKXA 2Q28A 1H6BA 1X1RA 4NU0A 3R9KA 3RQIA 1DQYA 1N8KA 2FSVA 3PXCX 3Q7TA 1OGYA 3UB4A 5A03A 3OBBA 1GVHA 3ODPA 4F1KA 4MRVA 2CBGA 2A4KA 2NV0A 4JYMA 1JTEA 2D1SA 3M4XA 5KIAA 1N5LA 2QT1A 5JANA 2OLJA 3R0VA 3RI3A 5DN6D 2DXIA 5DEIA 3LM8A 5K3FA 2YW2A 3VBEA 5ALVA 2GTHA 2HO5A 1DAMA 3P9XA 1YB1A 2HKIA 1YRLA 1BTOA 2XNKA 3L3BA 3PR1A 2XZPA 2Q6KA 3UK6A 1BE6A 2RGBA 2GCIA 3CY6A 3ENQA 3IGFA 3K94A 5HXAA 1G5PA 1F0KA 4DCJA 4D3ZA 4MI1A 1DAEA 2V03A 5DBHX 3JU3A 1HQDA 1KZ1A 1TQ8A 3NBQA 5KTTA 3R0XA 3BHJA 5JXGA 2PAAA 2BEUB 2G04A 2YN2A 2RD2A 1IHYA 4CEHA 2Z5FA 1AKWA 4RANA 4RKWA 4JITA 3ZXYA 4AJIA 1BAPA 1SA0B 3O82A 5I45A 1EK1A 4QNNA 1XKLA 4JC8A 1WQ4A 2WHRA 3UKDA 3WK7A 2BIFA 4DDMA 2OHGA 2Q3LA 3OZDA 4YN3A 1D2NA 2CV0A 4JROA 4IIGA 1QHEA 1PHPA 1BZYA 1XVLA 2P9HA 2XYPA 4YVFA 5I9SA 3BXFA 1QM5A 2ESRA 1L7AA 4NCHA 1VGQA 1ZEMA 4MULA 4AO7A 4HX9A 9LDBA 4Q19A 4RH3A 1T0PA 1WU8A 1X1TA 1VYVA 4MLCA 4CL3A 1PJSA 5ED4A 5HBRA 4YWJA 3TRJA 4CKEB 3QA3E 4IILA 4MYCA 3UAGA 1J9EA 2ZWAA 3OU7A 4CMJA 1D4ZA 5B3AA 1L4BA 2FN8A 4P0TA 4QOIA 2QLFA 2Z98A 3ZZNA 1CF2O 1OZHA 2QQFA 3CNOA 4BN4A 4PYQA 5EUMA 3MOSA 4HPXB 3TBFA 2PWBA 3KTOA 4BC1A 4AAYA 3SR0A 4KVZA 5DBEX 4A6XA 3GWGA 3WHPA 5T8KA 4UNRA 1O08A 3NHLA 2ZIUB 3TL6A 1YJCA 3O1HB 2FUEA 4Q3NA 2ZI5A 2DFDA 1JHUA 2QAGB 3OVMA 3Q3VA 2A2ZA 1YH3A 3JQPA 3F4KA 3QWIA 1LLDA 5A05A 3IQHX 1YJ8A 4QWWA 4LTNA 3AR7A 4P81A 3UT5A 5DOVA 2O7VA 3H2YA 2A5GA 3UA4A 2C20A 1Q22A 1MFPA 1NW6A 3DTNA 4EJSB 3VVMA 4QT0A 2LIVA 3DEYX 1KI3A 3SQNA 2DERA 2ZIWB 2AV6A 4K9QA 4E94A 2BUBA 2M6SA 4AJOA 3I39X 2AG0A 2OG2A 1V26A 2IZ1A 5CW2A 4RVNA 2FOIA 3BMOA 1YS4A 2BH2A 1H05A 3OQNA 1E8MA 2IOFK 1H8HD 2FUG1 1FMJA 1XP5A 2IE8A 2WMDA 3N5CA 1P5FA 5I9MA 3SBXA 3WLLA 4E07A 4M86A 1EJ2A 5KHLB 3L2OB 4RAOA 5E3JA 4NRDA 4BASA 3DWEX 5A9RA 4JEMA 4DR6B 2QPTA 2P4SA 5CIWA 4UTPA 3ZG6A 3OZBA 4AZVA 2VDWB 1U7HA 4LDPA 2IC5A 4J0IA 1T36A 3LYLA 1H22A 1QJ4A 1MAHA 3LDAA 4LDAA 3AM3A 3IUPA 1TM7E 4ZP1A 5B1SA 4OQYA 1TU4A 2ZK7A 2M1ZA 1OBFO 1L5QA 3MJ4A 4MI3A 5EZSA 4MPJA 4QYMA 2DJIA 4O08A 1WSDA 1V8FA 3H42B 3I6YA 3C3EA 5B2FA 3LPCA 4NQRA 3LHFA 1LSSA 1MIOA 2HNAA 2IPXA 2QM8A 2Q4BA 2ZJBA 3OQJA 4FMDF 1S1CA 4TYNA 1OOEA 4K9OA 1R74A 1SBYA 2RK3A 1RSZA 1XUOA 2EYUA 4BX8A 4E2WA 5HZHA 4DUPA 1CQXA 2FQ1A 1EK6A 1VKOA 2R6DA 2FEOA 2DGDA 2B2XA 5G4KA 3QV2A 1XZDA 4KUHA 3TSYA 2HU5A 1QGDA 1PNQA 2GZHA 3RV4A 3LQQA 5B7GA 1JFVA 2GUWA 3GZ4A 1A9TA 4ZCRA 3SIWA 1BH2A 1CHDA 1N2JA 2YWDA 1MTZA 3GJQA 4OH7A 3LF1A 4TWAA 2AYZA 4X84A 5FI3A 5K0FA 1WLYA 2ZU6A 3ADCA 2WSSD 2GPSA 3L7KA 1FPMA 2APJA 1UFKA 3GNQA 2V4UA 3Q1LA 2C4KA 3UT6A 3F96A 1TUGA 5K0ZA 3OX3A 2R6HA 3P94A 4IEIA 3VSBA 1Y8QA 1JW9B 3IEMA 1XA3A 2GD6A 1O94A 3HI4A 4I9FA 4QPDA 3D8TA 3G88A 3O8QA 2QRHA 3FPLA 4WDRA 4WXYB 1H65A 1QU2A 1KI9A 4JIGA 3NYWA 1JDPA 1KDTA 1KO5A 4RSHA 5BSUA 3HZOA 3RTDA 3UK2A 4PG4A 3DHVA 3DBRB 4Q7LA 5DNEA 3RIYA 1BEUB 3ED5A 1JQEA 1OCEA 4JLDA 4P08A 4NAUA 5IAJA 3CG0A 1QX3A 1W5BA 2UZ4A 3B7PA 4YC7A 1NN3A 2R6CA 4Z0NA 3L7LA 3MS4A 5LA6F 3SNHA 5I7EA 1R0KA 2FG6C 2PGXA 4GM4A 2GZMA 4Q9LA 1X87A 1MGPA 3W79A 1ZD4A 2XDQA 3C15C 1QVWA 4BNLA 3GLFB 1CWUA 1XZFA 3MFQA 1ZMXA 2PMWB 2AVDA 4PLPA 4X3PA 3UEOA 4LEIA 2GDZA 4X7RA 3QNMA 3EY9A 1NW7A 4A0FA 1EX7A 4EB6B 3EPHA 4I3HA 2X2EA 2XODA 3MT8A 4UVDA 5I9TA 4BCBA 1OROA 1E1RD 4BQPA 2DPLA 1AA6A 1HKUA 2VHXA 5FPYA 1C1DA 4H9GA 1BOFA 3QG5A 4C7BA 3A6FA 3EDMA 3ZU4A 1JG3A 4JJ8A 4WWHA 2V4MA 3N0XA 5KWVA 2BM9A 5JTUA 5DTMA 1FLDA 4ZT5A 3CVOA 4FFNA 1Y34E 3UWPA 2H7YA 3HDJA 4PWZA 3V8RA 5CFZA 1HSOA 1ZW6A 1ZIPA 1K8QA 1GARA 1Z16A 1R6DA 2PCJA 3AFMA 4XFKA 4LNUB 2QG9A 2DLDA 3JASB 2ZI6A 2WY2D 3ZVRA 4MKZA 5FA6A 4RZUA 5HF5A 4R8SA 5F1YA 2JAQA 4KQ9A 3UV6A 1R6TA 5CM9C 3GT7A 1IBCA 4M4SA 4X44A 4D81A 3HKCB 4YAUA 2HLDD 4L50A 3D5QA 1D8TA 1E61A 3WLSA 1E1RA 3V1TC 1G3UA 4OX9B 1Q84A 4Q15A 1OH5A 3C43A 1OFVA 3DMGA 1XWIA 4NFLA 3H0KA 1UC8A 1H8ED 3GMTA 4NH4A 2PHZA 2Z2JA 2G4VA 4QDJA 4QPCA 3QLEA 1O77A 2ADOA 1UM9B 4WNAB 4ZEMA 1UT8A 1QF6A 1Y5LA 2B9VA 1NQVA 2PJDA 1M3SA 3MUOA 3TFQA 3DFIA 2BRUA 1TUBB 1QJCA 4YROA 5IMBA 1RXUA 3A6JA 4CF3A 3T7EA 1L5MA 2QVGA 3T3NA 1IEXA 2XUZA 3OIYA 4LGCA 1QDEA 2VXBA 3LLVA 2P6MA 2JK1A 3EBLA 5JASA 4X6XA 2HLDA 1WUIS 4IUCS 2H1CA 4FFRA 4LHSA 2O2EA 1YQUA 2HRDA 2DQYA 5CHYA 2QYHA 2AQKA 8ABPA 1YMUA 3A1VA 3PG5A 3HMQA 5AQ1A 2IDMA 3ZLJA 4ZPJA 1BS9A 4LV8B 4KFCA 1H8EA 4PYMA 2FFQA 1VHTA 5C7IO 1E5QA 4EY3A 5LUAA 2E18A 4ND1A 3WKBA 4N76A 1TADA 1QRRA 4LMRA 4IQ0A 1CLUA 2DCUA 4NOLA 3ZGLA 3RYIB 2W8BB 5B37A 5D1NA 4RK0A 1PUIA 3VV3A 4ZI7A 3U4QB 3ILHA 4R7ZA 4DLZA 3HE3A 4EECA 4Z6KA 1BD3A 2Q6TA 2QNRA 3DBOB 2V9ZA 3MJDA 2CHEA 3REQA 2P1RA 1EUYA 3NM4A 1JDSA 2GN0A 4LC1A 4UE6A 1QP7A 1BRTA 3PI7A 1Y8RA 4L9SA 4PWYA 1NYTA 1VDZA 5AKKA 2R7NA 3TAHA 5LMCA 2H2WA 1YA8A 2IKQA 4M9CA 3L04A 1K5DA 4X24A 3R7SA 3VYUB 3D7LA 5AJUA 4LJ9A 3CKKA 4OLAA 1LJLA 2P67A 2X0DA 1ADYA 1QG2A 5SZJA 4JXJA 4MS1A 3PJFA 4ESEA 4UC0A 3G5MA 2C94A 2W0SA 3T1HB 2XE6A 3AJ9A 1SKMA 2G63A 3OLYA 2I67A 1A4XA 3NV7A 2GNOA 1FS4A 3L0DA 4MV1A 4FS8A 1KERA 2ACWA 4RTKA 3G2JA 2C7GA 2XQGA 4BBJA 3KKMA 4RPIA 3TRKA 3UWMA 4X20B 3RU7A 4M83A 5F5NA 3E84A 1B26A 5A3VA 3PFKA 1BMQA 4LSGA 5FJIA 5J40A 4Q9AA 1N4DA 4UPDA 2EBFX 4Q9KA 4NZMA 5EFZA 3DHEA 2HJRA 4WZBE 4S1VA 2E1PA 4XD7D 5JAZA 1Y42X 1TO1E 4QXMA 5B1DA 5PNTA 2WJ3A 3TDKA 1G41A 1C30B 2YJ4A 3DBLA 4OHBA 4D3DA 5AUNB 1FNDA 3FTQA 2P2ZA 2R11A 1G4AE 2X9LA 1X1DA 3KVVA 3BEOA 4X7MA 4FBGA 4ENWA 8ADHA 4EW1A 2WOJA 5A4DA 2HA4A 1T8WA 2W2VA 1VPWA 3OEED 1J7JA 1W6UA 1A76A 2QJRA 3GIDA 3LA8A 1T6XA 1JFSA 2PUHA 3OI7A 4FYMA 3WBFA 1FYEA 1T2FA 4PCLA 3D6VA 2WF7A 3KJEA 5G40A 3R7DA 4G5FA 5AKEA 4QM6A 1JDNA 4TZTA 3TZLA 3KE8A 3B51X 2CLLB 3CHYA 1GLGA 5JI2E 2TMYA 3MWDB 3VR6D 2NLOA 1I32A 1LBEA 4J0FA 2VF5X 3HZZA 1YL5A 3DOFA 4OHYA 5CAEA 1HTWA 3HR4A 2HI0A 1DKUA 2HYDA 1A5TA 4E13A 5CVTA 2AJCA 1P19A 3E23A 1XN1A 1QH0A 2DP4E 3OEEA 3QYJA 3AFOA 4JQSA 3VHLB 1W1IA 5FOUA 3GG2A 2V5AA 8ATCA 3B78A 2PNFA 1JVNA 1OGIA 4R2MA 4XEHA 2B1IA 4PLGA 2LPMA 5KTNA 1LTHR 1PZFA 1Z35A 4KR2A 1PJ2A 2CEAA 3IILA 4IH9A 1PJAA 3PNLA 5K0LA 1HL7A 3I1JA 1QHYA 4X1YB 3JWEA 4QVIA 1H6AA 1L2TA 4KXXA 3H18A 3A4TA 3P20A 2A5LA 3R8CA 4CLOB 1B6SA 1L5RA 5E7JA 4G24A 4LCJA 3EF1A 4M9ZA 5BURA 4FC7A 2GF9A 5GGXA 4BP1A 5IFKA 4JT9A 2VSOA 4FGJA 4B35A 4YBZA 3H4MA 2O06A 4WNCA 3RASA 4E5SA 1Z5GA 4LFAB 3MG9A 4WXEA 1P5HA 1AC5A 1FVXA 2P6NA 2RG1A 3CW9A 3PR2B 3LCJA 4GLOA 3BWEA 4BNTA 3FVQA 1VSBA 1IM2A 1V35A 4WW0A 3O74A 5I8PA 1DO8A 2WOOA 4H6XA 1L5LA 1N77A 4RHFA 5E4JA 1E4OA 4AWAA 1EUQA 4KE9A 1YB2A 2FQXA 1D2CA 2O2YA 3DVAB 3QKSA 3VOAA 1NQXA 4FR0A 4BGEA 4CV0A 5JYEA 1UP7A 3K70C 1SC3A 4PR3A 2W9XA 1I4LD 3AVOA 3VPSA 2WNSA 1JIJA 2HF9A 5TQ0A 2YJZA 4AX4A 1AA9A 3HJRA 3UOAB 5EJ8A 2J0UA 4KITB 3HGTA 4DLUA 4ODIA 1VPLA 4Q1CA 1RHRA 3QHPA 3ZPXA 1E3QA 1EB9A 3H3FA 4MGHA 4HDSA 1NY6A 3JQAD 4Z1OA 2EV9A 4IIJA 2VPIA 1EJ6A 1JSZA 2P3LA 4F4FA 4TUYB 4BKQA 2CXQA 3DP7A 3I5MA 1EXDA 4ENRA 1EIWA 1HDZA 2Q5JA 2RH5A 5JY1A 3H2KA 2B4YA 1XZCA 1VCMA 1IN1A 3UQZA 1UINA 5TMDA 1VRWA 3U7QA 1T3TA 2BMJA 1H23A 2V74B 4E03A 1FNCA 4GF5A 4R1OA 5GONF 3DAGA 1L5FA 5THQA 1AO0A 5C1BA 4GKKB 3SC3A 3FZEA 3R4CA 3PFHA 2FN4A 2VJQA 1SRRA 2GHIA 2H65A 1BHJA 3PYLA 2XECA 3NC4A 1OHHA 4IP0A 4MH0R 4KMMA 1B15A 3VPDA 4BX3A 4CN9A 2ZIXB 4DC1A 3W2EA 3JQAA 3HM2A 4ALIA 2P9EA 4KVFA 2GAFA 1NVXQ 5BRAA 4C43A 2P91A 3UJDA 4EQZA 5ALTA 2QI9F 3EEBA 2XR1A 3MMZA 2EFYA 4WK4B 3FWZA 721PA 1D8AA 3ZDBA 4KQFA 3C98A 1UBMS 5JFTA 2OM6A 4ZYXA 2DFPA 1KP2A 3L92A 4S1TA 1NMZA 2QTMA 3TPFA 2WU1A 4Q18A 3PVZA 4MTLA 1UBEA 3SQXA 1CUZA 1BXKA 1RXYA 2BGLA 1LD3A 1TQ2A 1VBMA 1V8BA 2JVJA 3QE2A 1M6HA 2BGIA 1HLGA 2X2FA 3FR8A 3IUMA 3F49S 3GO4A 5AI6A 3RS0A 4ZHQF 4MQFB 2Z6QA 2O8BA 4F2GA 1OWNA 3V6LA 2EZ8A 3P9YA 3KD2A 4B40A 2ATVA 2HRBA 3RB8A 2HJSA 1NJGA 2AEEA 4WOKA 4HVTA 3HXKA 1Y7HA 2FUCA 3HSYA 4G86A 4UAJA 2JLVA 1F2TA 2P0AA 3RVJA 4F4HA 2BTOA 1BKSB 1YTLA 1ZK2A 4H15A 1TIKA 1U9YA 3V4ZA 2Q1SA 1K6MA 1PGJA 1M6VB 3EASA 1L4HA 1SOUA 3V2UA 4MS4A 4AZ0B 3H87A 3M5DA 4OKSA 3QSGA 1LPOA 4Q48A 2WUFA 3RABA 1S2NA 2HPHA 4UFPA 2QZJA 2YCBA 1FFBA 2ZE7A 3GARA 2QZPA 1QIJA 3PHIA 5CFQA 1GPAA 1P2SA 4P35A 5IC5A 4AUNA 1FMTA 1KKLA 3RFCA 4MVWA 1ZPDA 2OENG 2UVDA 2PL1A 2YZ7A 3PDWA 2YV4A 3T54A 1JEAA 3DC2A 2DB3A 2KX7A 1A7KA 3MGGA 1OAKA 3BTSA 3SU8A 1DXHA 2HO4A 3RK0A 2RGGA 2V59A 4FD2A 4OVKA 2XUOA 3SQLA 4CKBA 4DMCA 4PLWA 4EHFA 3IUBA 5DB4A 1E6WA 1CZHA 5CW1A 3DE6X 4F71A 1U7DA 1D5WA 1R8QA 2VJNA 2ETVA 4CLRA 4TS4A 3W04A 4AXBA 2B34A 1BMFD 1XJWA 1GQ2A 2YH2A 1ITZA 1ZVQA 4QLBA 1AURA 2F6RA 2O2CA 8AT1A 2I3GA 3THXB 2XXAB 2ACEA 1V96A 1Z0AA 2X1VA 4MP6A 5FLKA 5FTJA 1Z5OA 5AM5A 1IH8A 3ODGA 4IDGA 4TPKA 1Y9AA 2NUPB 4XGNA 3HBLA 3PNVA 1PX2A 4ZYTA 5BW4A 3KV3O 3U60B 1LW7A 2RHLA 5A0FA 2JHFA 3HB9A 3M6LA 3R7NA 4OEHA 4DEYA 1WP4A 3INNA 3IXLA 3P9ZA 3ZD7A 3J80A 2D6FA 2FSPA 3AY0A 3Q72A 3NAMA 4QX6A 5FTLA 2CNLA 4CJXA 1JR6A 4JP8A 2GPBA 1T0BA 2CB9A 2QRMA 3F7MA 4EB0A 1RZUA 3EC2A 3B89A 1SVLA 3IBFA 2Q41A 3I2JA 3BUSA 1JR2A 1JPUA 1KK2A 3VNVA 1PWXA 5EIFA 2F8MA 2VHTA 2OV4A 2ZRBA 4U4AA 2CJFA 3D4IA 3ETNA 4HQ6A 3ZI0A 3HUDA 1KWGA 3ITKA 3X2EA 2ZEJA 1T4BA 2P77A 4LS3A 2GRUA 3DNFA 2P0EA 4ZICA 4E5NA 2P30A 3HXTA 3GQBB 1P2FA 4ISBA 2FSUA 4PAQA 1Z0FA 4JX8A 3GIWA 1WZUA 1RLMA 4Y6PA 3WJ2A 4D0NA 3NHZA 4GOND 1F48A 5B36A 5JATA 2C7OA 2OR3A 2VUUA 2R6R1 4GM1A 2OD9A 2BISA 1RS0A 2RI1A 3CLHA 3KWJA 1Q0PA 2XD4A 3QPBA 4KV7A 2YBEA 4R40A 1K92A 2IKSA 3TQRA 2OYSA 5CD9A 3T3GA 1ULHA 5K0SA 1D0IA 3KQTA 3QVLA 2B35A 3F9RA 2QQ5A 2VHCA 4R1PA 2GD1O 1UC9A 2R4UA 4FLMA 2BELA 1Z63A 4HZGA 5GM1A 1FS6A 2LVBA 1TGVA 2RAFA 1PP4A 3ZHXA 3ENKA 3HKBA 1IOZA 4DCGA 3G1WA 3LTEA 3C3BA 3OT1A 3LBFA 4JMPA 5JW6A 4FEGA 4MW6A 2JLAA 2HBRA 2HQBA 3EB9A 4Q9JA 3IKLA 4BQSA 1X7WA 2PRZA 4C0BA 4FGUA 4QREA 4RE6A 5AM2A 2A9FA 2YXBA 1PZNA 5TX7A 4CHTA 5IMSA 3TSZA 5HP4A 3RS7A 4ZI3A 4HX5A 4ZK2A 3VR3D 4NV0A 1XRRA 5BW5A 4I9NA 3ZK8A 4I5IA 4CM7A 1ISSA 1T91A 3CLRC 4FKZA 3ESYA 1VL1A 2PD4A 1KR2A 2JCBA 3IBCA 4I14A 3UMCA 5BMVA 3T1TA 2ZUEA 5KTYA 1NBME 4LNAA 2REOA 3WWEA 4COKA 2CY0A 3QF7A 3HHEA 2ZATA 3S1AA 3CEJA 1TEZA 1KQ3A 1J8DA 4A5SA 2O6HA 4DSNA 3N0RA 4M36A 2FX3A 4BU0A 1RT9A 1CE8A 4K9DA 2PUFA 4D4IA 4BVFA 2OXTA 3AERA 4ZEVA 4OHFA 4A1FA 4F8YA 3JS5A 2D2VA 2YQZA 1XI2A 4NU6A 3RVRA 2DTXA 1PKXA 3VR3A 1SIWA 4KI0A 3PICA 5AI9A 1LDEA 2HA3A 2CMGA 3UMGA 3O8RA 3PZBA 2IPNA 4YP0A 4U5XA 2DY0A 2IYXA 3TI7A 4DABA 1XLVA 2I71A 1OYWA 4NL4H 2QRGA 4BO5A 3HDQA 1IN7A 1KK0A 4Q66C 3LCMA 5DNCA 4FS3A 1JYEA 4R3NA 1FDOA 5AM0A 4D9IA 1NQTA 3GVIA 1QIGA 1SVNA 2Z8YA 4FHGA 3CBQA 5T7BA 4LGYA 3H1TA 2BGRA 4KTVE 2WVHA 3GI1A 4BE4A 2BR3A 5K99A 2Q2VA 3OCUA 1NM5A 1UT5A 3ZHOA 1QRUA 4R9UC 2PJZA 2JIPA 1FSZA 4OJQA 3F6BX 1OX4B 4K8RB 3O4RA 5JVDB 3UB2A 1ISJA 3ZQJA 2X41A 1X8KA 2ZSJA 3MINB 5P8WA 2C2ZA 3N7UA 1Z0DA 3UHFA 1Q1ZA 1IQ0A 1RVDA 4E1BA 2DR2A 3U0BA 4RA9B 4HLCA 1FTGA 1KS2A 3NEYA 2PUJA 2IYYA 1FXWF 3LWDA 3UGTA 3M4ZA 4BFXA 2BT4A 2GLXA 3SKYA 2IQ5A 3C6ZA 4UCXA 4KE6A 4JBWA 2V1XA 3FR7A 1EP3B 4W1PA 1VSTA 4ZVMA 3JSXA 2Q7DA 4GVXA 1NN5A 3EXFB 1NNUA 1OV4A 3TTWA 1JF8A 2WJGA 2ZIEA 1DIHA 1I9CA 4TTTS 1P9WA 1VXRA 3BRCA 3DQPA 5DNYB 1E2BA 3G9QA 3G9TA 3M49A 1TQDA 1YNSA 4OHPA 2WFAA 1GKIA 3VYSB 2R2GA 4NVRA 4ZU1X 1G64A 1ZK3A 3SYTA 2C5GA 1CQIB 3PXDA 4GQAA 4TRJA 2XMSA 4QD3A 3W8EA 4S12A 1RRPA 4G63A 3TGLA 7MDHA 4TOIA 1EWQA 2H07A 4REQB 1XP8A 1Z7YA 2Y3IA 6PFKA 3CV3A 4Z9FA 5DM2A 2FUG6 2QLMA 4HO1X 2FB9A 3ZKAA 3PUXA 2C7PA 3A6GA 4FDLA 4RSGA 5K4HA 3BE5A 5E3HA 2GN6A 3C4VA 3GPCA 4JASB 1H94A 1XALA 2HA0A 2OP0A 1S4QA 3CNNA 4ZAVA 1H6CA 2IYVA 2J09A 3D6HA 5HKKA 3OUTA 4ZO8A 4AJPA 4CW7A 3LRPA 2DZDA 3IOYA 4A9AA 5C4MA 1CUVA 2IY9A 3DXZA 2YFQA 1G7SA 1FC0A 1UKCA 3UAXA 3N6XA 3OWOA 5FLXA 3CN9A 3CF4A 3DVSX 1HUQA 2G9NA 1U1DA 3KCNA 1HFEL 2FN3A 4LOKA 3KP1A 4TMTA 5JJBA 4FOOA 3UH0A 5LB2A 4ETWA 1KDVA 1RBYA 2JD2A 2YINC 3TPZA 1BSVA 1T9ZA 3N1UA 3S2GA 1DKNA 5LOVB 2Z1NA 1DAPA 1TM2A 4QGFA 5AJHA 3LT0A 3WA6A 1EUZA 3Q5EA 3S81A 2VJDA 4HYTA 1L5KA 4DMMA 2HRCA 3E18A 3GELA 2FH5B 3TIXB 2LR0A 1JNYA 1PJLA 1QF7A 2C1EA 3EY4A 4LKRA 2JGDB 3L0OA 4XLLA 1YA6A 3CKYA 2ZRNA 4CMKA 3EIXA 3WV5A 1YO6A 2ZOSA 3QMMA 4MPTA 5DGIA 1MDFA 3SHOA 1ZJZA 3V4RA 1JP7A 4OQQA 3JZFA 4OGKA 4F1WA 4BN5A 1R9MA 1JKIA 4IOJA 5DBIA 2AFIE 1U7XA 4WPGA 1EBUA 2IGTA 1GCOA 4KE8A 1FX1A 2POCA 1L8XA 3LVBA 4MITA 4B3GA 3D3QA 2NWQA 2GGSA 1AN9A 2SCUB 4RJTA 1EFDN 1AZSC 2HNKA 1LRJA 1URPA 1Q11A 3FF4A 4I46A 3ZHTA 3QVTA 2L0XA 4GX1A 1O58A 1EVKA 4D98A 1II8A 2D8AA 4CEJB 1OFUX 2KHZA 5LQMA 2IDJA 2YV1A 3AYZB 2PN1A 3NFRA 2Q5EA 1MT0A 1N8TA 3PK0A 1QHFA 1WXGA 3UG6A 3EDOA 2NG1A 1VZ3A 1Z38A 2LZ0A 3FDFA 1T15A 1Q3TA 3GX1A 5FHRA 1K5HA 2PEZA 1W75A 2V8BA 1N9ZA 1GXSB 2C54A 3MTAA 2C00A 2CHUA 3WGTA 3UIEA 5HGXA 1TC2A 4QG7A 4FC6A 4R2WA 4X5OA 3CB4A 3WIBA 4URVR 5H81A 1DE0A 1TYAE 3N2GA 3B9PA 1W29A 2V4ZA 2P90A 1EIZA 5CJ2A 1CZUA 1LI7A 5AVSA 1IN4A 3OLXA 4YAWA 3WB1A 4JJ4A 1AGXA 1P7VA 3KXPA 1C29B 2IQIA 4H77A 2AUTA 1IQRA 3ZCRA 3ZBPA 1ILEA 5BNIA 3HXOA 3V80A 1ORVA 1UZUA 2I99A 3JWHA 4A4DA 3HP7A 4F3NA 2O8FB 4IXNA 3KZNA 2Y1GA 2O7QA 4TV9F 3V32A 1QHIA 1PI3A 1ZNXA 2GZRA 1U90A 5I7AA 2OGWA 4IZIA 3UT0A 1T5SA 3K72B 1UBLS 1E2GA 2CXUA 2H2AA 4I3FA 5AOVA 1OB5A 1OXVA 4CM5A 4N3NA 1ZS9A 1PR0A 3DBVO 1H2HA 2WPNA 1A7JA 1SBHA 2Z3VA 4GOKA 2A0XA 2RKBA 4MR9B 1EKXA 2W42A 5I7VA 1IY9A 5FKJA 1F0PA 4C29A 1Z2DA 2WU4A 1N1GA 4PZYA 1HGXA 4FFLA 3AR6A 2IZ0A 5KOIA 4BY9E 4ALJA 1ABFA 1CJVC 3H2JA 5ITSA 5TS3A 1CDDA 1XZQA 2BFFB 3KQQA 2OHFA 4HX2A 4LUCA 3RJTA 1OFTA 2BKXA 5KEIA 4HNHA 4TWRA 2VQEB 1MRSA 4O4HB 1UPCA 3GRUA 1NXWA 3DAHA 3KOUA 4P92A 2JIOA 4FNOA 3ZJ5A 3GK3A 2OOKA 3JW8A 4HV4A 2PQ0A 5JEDA 2AXNA 5CK5A 3L93A 3VI3B 4DIDA 3A28A 3EXHC 2D59A 2GAAA 2PQMA 4IIHA 1CNMA 3NBMA 3H9QA 1WPQA 1X1BA 1K7EB 4NI5A 1V7QA 1DAOA 3M6IA 4LOLA 3NCHA 1ZI9A 5JAUA 4RK5A 2W90A 1T5OA 3E5NA 2GO7A 3D4PA 1P31A 1I2BA 3L8ZA 3WGUA 5L9AA 4KWTA 2HQRA 3GVHA 3WFZA 4BFWA 4KZPA 5ALUA 5KS2A 1TM1E 3O7WA 1S6YA 4P5PA 3L41A 2WI8A 1ARZA 1QR6A 2VKQA 4K2HA 4OUDA 5EIAA 2H29A 4BNMA 2C8LA 2WWFA 1GGMA 4RLFA 3BF7A 5HKLA 4BAZA 4DLWA 5F7XA 3PEYA 2O0KA 2R8ZA 2ZYWX 1UMBA 3ND5A 3CNHA 2QE7D 1RNLA 4JLOA 4D4KA 4F4IA 3ER9A 3LL4A 5GM2A 4Y6SA 2WHYA 2G6BA 3ETEA 1ZICA 5J59A 4WZ6A 4R1QA 1LNSA 2O3RA 2WJWA 2QQEA 3N9IA 3VM6A 3VZDA 4B75A 2X9QA 2JBHA 5AVOA 1TUEA 5AOBA 1MORA 2RAPA 3GUUA 5DNAA 4RSMA 1KI6B 3CLUD 3VU9A 2HV8A 2J6HA 3G5LA 3TIIA 1VECA 1PJZA 3LBYA 1TPZA 2C7VA 2QS9A 3NWOA 4L4RA 4NV1A 1IRXA 5JSFA 3M6WA 4KQHA 5J2UB 5CX4A 1DQSA 1R27A 3SFTA 3VAAA 4BTEA 1XFDA 1YBAA 2BMEA 1CJMA 3AEUB 3OX4A 4HYQA 4FMPA 4LG1A 3ZV3A 3PKJA 3L49A 4DE5A 4DBVO 1J5PA 1WQ3A 5GGYA 2QE7A 1KOJA 3NRCA 2DTDA 2N3ZA 4ID3A 4OUKX 2XUPA 2IEDA 3I04M 1N2EA 3QXXA 5SY9A 1QZZA 5JD3A 1MO6A 2IHZA 1B1AA 2OAEA 2ZUSA 4OL0A 1BXGA 5E7MA 2FPMA 3RS9A 4CQMD 2IXBA 5BN1A 4J0CA 1XC7A 4A8JC 1RQPA 1B43A 2AXEA 3CSDA 5AI4A 3MT7A 4BAUA 3VJLA 4WJKB 1UPXA 1YBVA 1H5QA 2QVBA 2PBFA 3O3OB 5D00A 2GOYA 2XLCA 3MAGA 3E22B 4HZIA 1KRXA 2GKOA 4BC0A 2GEUA 3COPA 4JLAA 5JQGB 1NXVA 1SVWA 5DPMA 5F2OA 1NVVQ 3KFLA 2EJTA 1RYHA 4LHYA 4YJ3F 5FTWA 5BQ5A 4EVSA 4NZZA 2NPIA 2PMBA 4TS1A 4X7BA 1ECCA 2AHOA 5IEBA 3DL4A 5D8DA 3RKSA 1X3LA 4OBWA 4KSYA 3ONNA 1B14A 1N7JA 3QBEA 1UODA 1V5WA 1MHPA 1V71A 1ONNA 3EEIA 4C5BA 4CQMA 3MUFA 5JOQA 1DZIA 4E15A 3B6JA 5LU8A 3EHDA 1LPAB 3CUKA 4PSKA 3W90A 4BB6A 2XRFA 4UNQA 1QC5A 1HDRA 2DR3A 1N1DA 4RXTA 5CEEA 4U3JA 3AYXB 3DKVA 4ETNA 3E5RA 3AEXA 3NUZA 1T4CB 2AHRA 3BHIA 2BE9A 2OORA 1PRYA 2RGUA 3JQ9C 1IUPA 1UXKA 5CLQA 1DHRA 4YJFA 5CR9A 4C76A 1SC4A 3OPQA 2EIHA 3GBSA 1MQ9A 1DIRA 3V9PA 1NF2A 3EDRA 3KPVA 4FWIB 3U80A 1BMTA 1HEYA 3IHLA 2CDNA 2GTIA 2GI4A 4XPIA 3LT5A 4UNNA 5J5CA 5CEFA 5KC9A 3FUCA 1FU8A 4NDAA 1TM3E 4W4TA 3E4DA 1DJNA 1U7UA 3WRVA 2F3SA 3M34A 1TYCA 2QR5A 2I6XA 4MUEA 1YZTA 2PH3A 3F1KA 4WCFB 4GSKA 4ZMRA 5FBHA 3RDPA 3GCZA 2WP0A 3ICOA 3IYLW 3WL7A 1YR9A 4YJ2A 5KDLA 1FFCA 3QX8A 5KOHA 2PXXA 4IJKA 4E21A 1ZUNA 3VPFA 4NE7A 2FFBA 3BJEA 2J7KA 3KDSE 4F11A 2IUUA 4B84A 1H1LB 3SFZA 4DZTA 1L5YA 1YR7A 2FP3A 5HKAA 3PUJA 4J0JA 2W2OA 4D6YA 5DBFA 4OIFA 3LUBA 2GO1A 1PVVA 5DJ5A 5C9ZA 1FJXA 2JB9A 1Z22A 3QENA 4Q5IA 1N78A 4Y6OA 1IN5A 1LS6A 2RC5A 2XMPA 4LJYA 4WGGA 1ZGZA 4I1SA 4C22A 2H2GA 1ZGBA 2R8RA 5EP1A 3Q10A 2G1PA 5I5GA 1EQ2A 4TQGA 4XDGA 1W2GA 1IY0A 1EMDA 2R62A 3ADBA 1GQFA 1JPNA 3DC7A 3LLSA 1MNAA 3LHKA 4L3VA 5JE8A 2NU9B 2REBA 4BZZA 1L8LA 3K9CA 3LUKA 4M88A 3SQMA 1YNOA 3DJFA 1VRVA 1RLJA 2VL7A 2WMOB 1UUFA 5M5BA 2Q3CA 4I0WB 3N6RA 1B93A 4REMA 2EP5A 1YSCA 2N42A 4FHEA 4KXVA 5FPSA 3W06A 1FS5A 1LDNA 1PZMA 4RE5A 1BEEA 1JEEA 1K08A 1RYBA 4QE3A 4O4IA 1E64A 3K2IA 1ZP6A 5IAAA 1BKYA 2IYLD 2JI6A 3GH3A 2PS0A 4NLLA 2KQUA 5EINA 4UZSA 5LCXA 4Q1VA 4RK4A 4LJ5A 2A92A 3EXHA 5CDYA 2RHDA 2IVZA 1GGNA 3GGOA 2B82A 3DXXA 1C4WA 2NX2A 1QHHA 3DDWA 4KWEA 1Z7GA 4E2YA 5HZKA 5KYYA 1P45A 2XYGA 4OHRA 4LF4B 1DEAA 4Q9HA 1KVRA 1NC1A 1WF3A 3G0DA 4US0R 2BR4A 4AUKA 3UJNA 3AJEA 1II9A 4U7PB 4NJEB 5HJ5A 1UR5A 1PQWA 3OA0A 1PK7A 1CDOA 3O6VA 4N5DA 1EUDB 4DLTA 2CMDA 5B64A 5LP6A 5E6UB 3SPXA 5IN4A 1M1YA 4OAQA 5AW9A 5BN5A 2XDYA 3ACCA 3BK7A 2I6TA 3A06A 5AH0A 1P5JA 2OFPA 2LRHA 3K8QA 4CM4A 4E4YA 4M8KA 1Y4AE 1YBFA 2G70A 3W5UA 4A82A 1N0UA 3A1CA 5GMOA 2PZBA 4CODB 3LFUA 3LKDA 3OHPA 2CXNA 5D86A 1Q0ZA 4DDUA 3RLIA 3S2FA 3LCUA 2ZBRA 5K3BA 2XA9A 2YYZA 3OAAD 4QG3A 5JPDA 4X66B 4AIIA 2OWDA 1OQAA 1YK1A 2TMGA 3FCXA 4G0ZA 5FUMA 1BVUA 2FMHA 3UK0A 3P0FA 1PKEA 3RUDA 2DHEA 4JLMA 3JQRA 3NDPA 4DXDA 3T4XA 5E7QA 5JMPA 3KS9A 3OE1A 3B6EA 3DV0A 3KLNA 3OQ1A 3SSAA 3QYFA 4JI6B 1POWA 1SKYB 3G8BA 4MJ7A 1JHQA 2E6KA 4XUGB 3OICA 3KQOA 4R2KA 1GDHA 2RAUA 3O3MB 2P41A 1UDBA 1WKBA 2PSDA 4KIGA 1GTG1 4Y6RA 3WVNA 2VUTA 3KWMA 1E2HA 1EWVA 4DS3A 1QOPB 5A2GA 3PC7A 3RROA 2UZAA 1ISPA 1X94A 5BSGA 1EGMB 3Q6NA 1P4JA 5TQ2B 3T1QA 1TZJA 4MWGA 4U2CA 1S0UA 4L9RA 1RC1A 1UWCA 2OVBA 4I50B 3WYAA 2ASVA 1K3TA 3KJZA 5IJ9B 2PV7A 1AKEA 2C2YA 5EI5A 5A6SB 3OIVA 1E1MA 1GEEA 3MJFA 4QUGA 3TLZA 5D84A 1CJKC 2OHJA 4FDAA 1FEZA 2O8DB 1JBEA 2HBYA 4AP9A 3DO6A 1ENPA 1YJ5A 2ZWPA 1DHTA 1TEHA 2XV1A 3TIVA 4HNQA 3SSOA 5B6JA 3ENZA 5AJZA 2I2AA 4ZMBA 3L6DA 3EIQA 1ZKDA 2ZW9A 2C1XA 2HXGA 2XB6A 3KHTA 1UBOS 2II6A 1NJ6A 1ZGAA 2ILVA 3MCUA 1N0IA 4MB0A 2NO1A 2R7MA 5DIZA 2IF0A 4M1TA 5LU9A 4Y9DA 1HWYA 2PDAA 1DL5A 1KZYC 2JRCA 2V6JA 3K1ZA 1XHEA 1DXOA 3SZMA 2O3TA 1QGED 2XB4A 2XNHA 3KM0A 1PD0A 4UM9B 2JGEA 3FNEA 3IBTA 4QU0A 2D7JA 3ETHA 1L8OA 4JBLA 2R8EA 3NHMA 4FZ5A 4PIPA 3TGWA 1E5VA 2Q3MA 1P0QA 2XIQA 1G9XA 4GWKA 3VO1A 2Z04A 2FW1A 2B4RO 5ELMA 2X19A 1L7XA 3MOIA 3AHGA 3QP9A 3KXDA 4O8CA 4E2ZA 2EWMA 3K6RA 1KH1A 2VNHA 3PPWA 2QN2A 1EX9A 4WXHA 1T26A 4FDUA 5KI6A 3ZY4A 2AR0A 2W8ZA 3F78A 4QIHA 1Z36A 1GRQA 2IU6A 2R6AA 3U7GA 2G08A 4YHBA 3MD0A 1OLOA 3A3YA 1ZQ9A 2W4QA 1YHNA 4HXGA 4X97A 1ODTC 2Q50A 4LZZA 1K5GA 4UPEA 3DT9A 4IH1A 5I9NA 3S2UA 4G5RA 4G09A 2PE5A 1LEHA 4XVHA 3MRTA 2Y0DA 1M76A 2H4FA 3KSUA 4BWGA 2ZBDA 3EGWA 1VBKA 2RFLA 4Q3DA 4EA9A 4OY3A 1KI8A 1SOWA 4KREA 3HBNA 5CDHA 1Q6YA 4NULA 5F5LA 1BCSB 3Q3EA 4BIIA 3KR1A 4MW1A 2ZSAA 1NAHA 5EERA 4ASUD 3OLQA 5TJ9A 1G21A 5F33A 2IBSA 2AC4A 1QIFA 3QKRB 4QEZA 3T95A 4L4YA 2L18A 1CRWG 1KEWA 3RVBA 1BFUA 5IT0A 1RP1A 1ZNYA 3OM9A 1VLJA 4N3CA 3L7NA 1QGUB 3VGJA 1UQRA 1ST3A 1VI5A 2JLQA 4IO1A 4YCJA 2CHFA 2GHRA 1U7WA 2VTKA 2NW6A 3IJPA 4BV9A 4E7OA 5AK4A 1GGJA 2DWPA 5IG2A 1V8OA 4JC0A 2JHAA 1IQPA 4RVFA 4XIJA 1SUWA 3FRIA 4GX2A 1MB3A 1PX0A 3Q0TA 4X41A 4ASUA 4HQFA 1KIMA 3N58A 4INJA 2AI2A 3S55A 2G3YA 5K8IA 2DSNA 2HJGA 2ZGVA 3HKDB 3KE9A 4V0ME 4I08A 4ZAYA 4C0QC 1ND6A 1L9XA 3MD9A 2YZNA 1LK5A 4MUKA 4W1QA 4ZJPA 2ZR0A 3KTFA 3M9XA 4O2AB 3UF0A 3R8FA 3RHTA 3W8NA 3I4CA 1E4YA 4G1VA 1PTJA 4RD1A 5FOTA 1PR9A 3EGEA 4I4NA 4RMIA 5HYVA 5EKUA 3KHUA 3VPGA 1MH9A 4NJMA 5CVUA 4FNMA 4DCOA 1RKQA 1L4KA 2B8WA 2HMWA 2JI7A 4UBNA 2MSKA 2R5WA 2IXGA 5F1PA 1M9NA 1Z68A 3STYA 4BQNA 3OQOA 5G1NA 3OJ0A 4JMLA 3AC0A 5K0CA 4X61A 3TWOA 3TKAA 2H9IA 5SYMA 5DX8A 1QHNA 2QN6A 3P26A 1V4NA 3I0NA 3NQ41 3N0TA 2CXHA 4DGSA 2IS1A 2VZEA 4J91A 2C97A 5EGNA 4Y9TA 1Z29A 4CMIA 2B5WA 3NOQA 1MJ5A 1JEQB 1NYRA 3O7MA 3LDGA 1G7CA 1KP3A 2Q3FA 4P84A 3A32A 1LV7A 3BGSA 4N6NA 3RJMA 2B92A 2JFQA 3LQKA 1QB8A 1I3MA 1E58A 1Z0UA 4QOSA 4DV7B 1DADA 3K16A 5HA5A 2P6PA 1K8XB 3K0FA 4LQLA 3LGSA 2A0KA 2IEIA 1I80A 3D7RA 3EAQA 4L76A 4NBKA 4M38A 5EESA 2YV5A 3UVEA 1F1JA 3ZZTA 4YLEA 1U0NA 2C1ZA 1QWSA 2P3SA 1X9HA 2QZSA 2QRNA 3LUPA 1NULA 3OZRA 3GVCA 1ZIXA 1QH1A 1OU0A 3PX3A 4C7VA 4ND6A 2WWXA 2Q1WA 1P0CA 2QD4A 3WIVA 4DSOA 1EINA 1E7WA 1EWYA 1HYGA 1JZTA 2GETA 3DTVA 4OQXA 4GSYA 2HZ7A 3NIWA 4TTQA 4EFNA 4U7DA 2Z83A 4A15A 4HB2A 2I6FA 4UE3S 1Z83A 3MJRA 5IABA 1D4AA 2YV3A 3G7UA 5F21A 2GD2A 4QC2A 1K6XA 2CBZA 2OLEA 4JI3B 2QL6A 3WADA 5BR7A 5JFOA 2YFYA 3D4NA 5EPUA 2GZ2A 4IDNA 1ECFA 5H0IA 5NULA 1QFMA 1WY5A 1GKUB 1L5VA 4L7QA 3K5WA 2VF8A 1FJGB 1BN6A 5G0SA 4DV4B 5JNVA 1SXJE 1X8LA 6ADHA 2C9ZA 3A3NA 4WKGA 2PYZA 5FTMA 1IM8A 3BQ9A 1O5TA 3ICCA 2P9FA 3K0AB 4NF2A 1OWLA 1BJRE 1MQSA 1Q16A 3A8TA 4X65B 4WY5A 1NIJA 1QK4A 2VDPB 2X8AA 4JK3A 3VSEA 1QTNA 1WDMA 1X1CA 2CVHA 3RKRA 4X3CA 4LJ4A 4B4OA 3PIDA 4C4PA 4F2WA 4CKCB 4X92A 5BSHA 5BSVA 1GGFA 1N9GA 2GBGA 1SPXA 4RZQA 4MR8A 4JBYA 2P8JA 2VSQA 2OY0A 1TDJA 4YCAA 1L5SA 2JNWA 1YJAA 1GN9A 3ZBUA 1S8OA 5A5VA 4IWNA 3WLNA 1JXQA 2AK2A 3T7JA 1H0SA 5KDDA 4DHWA 3FE2A 3SF8B 5U4XA 1T3GA 3SJBA 2C3UA 2YYAA 4XD2A 4ZAXA 4JU8A 4MWEA 4EK9A 1E9EA 2CFIA 4Q00A 4YXWA 2HSEA 1U65A 3AUAA 5JH7A 3K30A 5EZ6B 4MP8A 3OIWA 3QELA 4BO4A 10MHA 1PFQA 1PBTA 2WTNA 1TCCA 3DHYA 4KXFB 4PV7A 3URKA 4HLQB 4HWRA 2DH5A 4XXHA 1IBLB 4C3OB 3IA7A 3DA8A 2B25A 1REQB 3NBYC 1MABB 5GV7A 2GX6A 3UWKA 3S2SA 4O8ZA 4FE4A 4OFBA 2PQ6A 3U4IA 1NXTA 2LGJA 2Q4EA 3QHQA 3PX7A 1K1EA 4K8OA 4P4UA 3F5SA 3TW4A 3V7WA 2W93A 4NZOA 3TKYA 3ZDRA 4DA9A 3VU0A 4NK5A 1E6KA 4OSEA 4M0PA 4D6PA 1YXMA 1VKJA 1N7GA 1ST2A 1TW2A 3DOHA 4HAZA 2NVWA 2C31A 3AKDA 4TVKA 4WK0B 4GRIA 5DH9A 5DKFA 4AO6A 1PS8A 1Q7BA 1Z33A 1VL5A 4DDHA 1E3SA 4R1SA 3MTDA 1SG9A 3MS7A 1WULS 3FBTA 4YIHA 4KFUA 3I5AA 3IR5A 4OYYA 2I4TA 3CRW1 2V0NA 4LHXA 2DAPA 4U2KA 5C1PA 2ZJ3A 1QNLA 3C8UA 4O6VA 3TOZA 4YRZA 4MZDA 3MZ0A 3L4BC 3GFTA 3VKVA 2V65A 4ITRC 2PUEA 2ZI7A 1Y89A 1LDGA 1NRIA 2XSZD 2RGNC 3NU1A 1ZY2A 3AL3A 4MUNA 1SHJA 4OAPA 4M89A 1WCYA 4XX0A 4COOA 1QCZA 4DV1B 2R1TA 2IYZA 1KI2A 3B85A 1X7ZB 3OESA 3P2YA 2HK6A 4RESA 5CHEA 2P78A 3DFUA 1D03A 1SG0A 2EG9A 1XHLA 3TW6A 1OD6A 1ZM3A 2GF2A 2XKAA 4C7OB 3L1VA 3D6AA 2C7QA 1WG8A 1IY8A 1KSGA 1U1GA 1P1BA 1KI4A 2AN1A 3KZXA 2VA8A 4I19A 3U5TA 1HTTA 1MU0A 3L6OO 2JG3A 1ESDA 4JODA 1QAOA 2OV8A 3H0CA 4KGDA 4Q47A 4XQEA 2Z8XA 3U17A 1ODLA 1VHJA 3PNQA 4ER5A 4KWIA 2O8VA 1Z0JA 3FFAA 3HXMA 4U6SA 3P9IA 1P7WA 1HH4A 1GL7A 1AUXA 3TLJA 1MD9A 2XSZA 3OF2A 3QUAA 2RHMA 1UWKA 4GBJA 9GPBA 4UDYX 4YI3A 1XOIA 4OBEA 4F12A 3RF6A 4ND8B 5EJFA 4F21A 3KSRA 1XVIA 2F48A 1VFNA 4PONA 4UREA 3T5DA 1NVUQ 1DRVA 4JA0A 4Y2YA 2X58A 5H16A 2W48A 1F7UA 4JJ6A 2XRZA 5CB4A 1AQIA 1PGNA 1A98A 2H52A 3QKWA 1H5UA 3PC3A 4G9EA 1EQAA 4KIFA 4MAAA 4RPCA 5ERXA 4DJ5X 2YRWA 5EIEA 4O1IA 5AQEA 2F55A 3DMHA 4TLDA 3D8UA 1KMHB 4LXIA 2CXTA 2COKA 4TUYF 4C4OA 3P71T 2PFSA 2J0VA 3ZH9B 5C8VA 1FRFS 1R37A 2C4UA 2GWRA 3K32A 1CPYA 2IXFA 3H84A 3HDHA 1RJ9A 1M2VB 4EB8A 3LCVB 4LDZA 2PZFA 3A9UA 3VH4A 2FFAA 2ZVJA 5IBCA 1GAWA 4E1AA 4JSRA 2PRYA 4ZIRB 3PEEA 3ZBQA 4J3FA 5JG7A 2VDKB 3LX6A 1VGRA 4DLAA 3B3FA 1I3CA 1Q5PA 3P0RA 3QVOA 4JR1A 4RD6A 5EKDA 3AVVA 2C5AA 1AN0A 1FQOA 3BWVA 1ZISA 2JFYA 1LKZA 4NMXB 4Z0PA 5FP0A 3DDUA 2YHBA 1U0EA 1LBHA 2HBZA 3KNZA 4IF6A 5HIKA 2HIAA 3STHA 5ESRA 5TMEA 2FCRA 3A1SA 4TWBA 2B4QA 3NBZC 3JALA 4NY1A 2XMDA 2BUCA 4F2HA 3FJOA 4WERA 5EXPA 4QDKA 4WKPA 4K03A 2HX1A 2Y0BA 3BH7A 4C0AC 5JDCC 4ZJUA 2W2KB 1DRJA 2XHEA 4EO4A 2CFRA 2AMLA 7AT1A 1KZ7B 2I3ZA 1S9HA 3BHNA 3DLIA 2EGUA 4Y9SA 4E5YA 1G2PA 2FPPB 3W2FA 3H99A 5AT1A 4RLSA 3FNGA 3IAM1 2XX3A 1OXXK 4QTYA 4TZ0A 3EEOA 4RCYA 3H83A 4QXAA 2HUPA 2F62A 5KHOC 1LVHA 4TL9A 2NO4A 1UXHA 2V9PA 2YWJA 3JZDA 3WLPA 1SZDA 4BMXA 5K8VA 3LZDA 3NEJA 1G8MA 2CZCA 3E03A 3G5AA 5TNXA 1GRNA 4B6JA 2C78A 1E6UA 3WSWA 1Q1NA 1ZM7A 3QLJA 5H9WA 1A1SA 4OXIA 1RQXA 4K26A 5K0NA 1PT5A 2VPXA 4D1YA 4J4HA 1OI2A 2ZREA 4CFSA 4XLZA 2CXOA 4JBGA 3A1UA 4HSGA 4NECA 3D3JA 3GPDG 5FRDA 1P91A 2QJOA 2WSYB 3DVLA 3AH8A 1ZN7A 2EFJA 3BREA 4PBRA 4AB1A 2Y1EA 4J4TA 5F7ZA 2WUGA 2VXOA 3H04A 1RXVA 3MCVA 1WZ2A 2JAXA 1I51A 4NWIA 3KTDA 4HMOA 2FHPA 3DE5X 3ZEAA 2RGEA 1TO6A 2NO6A 1VJ0A 2EGHA 4YRBA 2EEPA 4LZPA 1OFIA 1E32A 4H6PA 1T3SA 1SIOA 1RAFA 1VIAA 4KOAA 3F3SA 4QOJA 2AWOA 1CJCA 2OGUA 3AEZA 3ELUA 1IL0A 1XWFA 5T4BA 4OHMA 2EFGA 4BO3A 4GD3Q 4U8HA 2Z1MA 3SQWA 3N70A 4OI2A 4EDHA 1IEWA 2FLWA 2I6UA 5FWNA 2DUMA 3IQFA 5KNDH 3X0DA 2OB1A 2ARKA