2OBOA

Structure of hepatitis c viral ns3 protease domain complexed with ns4a peptide and ketoamide sch476776
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
184
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 protease
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 39
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oboA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oboA01
4DGJA 3RXRA 1G37A 1GMHF 3M36A 1EP6A 4BAMB 1JRSA 1S83A 1TE0A 1HYLA 3TJOA 2ANMH 2PR3A 1W12U 3AASA 1O39A 3P95A 2ZTXA 1AB9C 1SL3A 1MBMA 3LOXA 1SPJA 4YM9A 2ZIQH 1KTSB 1HFDA 1Y5BT 4UFEH 3UIRA 2Y5FA 1Y59T 3H09A 3DFJA 1G30B 1DOJA 1V2MT 1CU1A 2A4RA 4Q7XA 4CREA 5F8XA 5HMAA 3TNTA 4OS7A 2R2MB 4X1QU 1HAHH 2EI7A 3KNXA 2SGFE 1ZHPA 1P12E 1P57B 2LPRA 1QQ4A 2B0FA 3SU6A 1BB0B 1K2I1 1O3KA 1N1LA 2ANWA 3MO9A 1GBJA 2Y82A 2ZCHP 3V7TA 2ZHEH 4U01A 2ZZUH 2ANYA 1IOEA 2CHAC 4UFFH 4CBNA 4DIIH 1MD8A 8GCHG 2YOLA 3OX7U 3A8BA 6ESTA 1GBMA 1MBQA 5C1YA 2Z6BD 1HAYB 3LGIA 4O3TA 1F0TA 1A0HB 4BOHA 1QGFA 2W3KA 1DS2E 3OY6U 3RXMA 4INHA 3QLPH 3TJVA 3MH5A 1Z6EA 1S6HA 2V6NA 1YPGH 4J2YB 1GBBA 1O2XA 2GV6A 3PV2A 2Z9JA 3PV5A 1GMHG 1C1OA 5EGMA 3M3TA 2ZG0H 1TMBH 1OWKA 1C1UH 4ISIH 1T31A 5H4IB 1P9UA 1HXFH 1TMTH 1ZGVA 3PTBA 4ZXYH 2ZDLA 4MTBA 4OGXA 1TBRH 2R9PA 3PV4A 4FUBA 1D3DB 2VIVA 1C2GA 1NFXA 3AW1A 4ISLA 4ZH8A 1HNEE 5FAHA 1QBVH 3A83A 3HKJB 4ABFA 1FQ3A 3SU4A 3U1JB 2IJOB 1J9CH 1NT1A 3M35A 3URCA 1WTGH 3K9XB 3QN7A 1A2CH 1NRSH 3DT0H 1UHBA 1G36A 3KQBA 1NC6A 4Q2KA 1DT2A 3M7TA 2P95A 1W7GH 3SNEA 1GHYH 1UHBB 2OBQA 2J95A 2J34A 2OC0A 5A0AE 3A8DA 2HNTE 3SZNA 1FN6A 2BOKA 1MUEB 1BBRK 1SG8B 3PTNA 4MPXA 5GXPA 1FV9A 4DG4A 3A85A 2XRCA 4LXBH 2J2UA 2C3SA 3ATLA 3BTKE 1MQ5A 4U32A 1W3CA 2A5KA 2PSYA 3SU2A 2FYQA 1T32A 1GDQA 1SFQB 4X1PU 1FY1A 5F8ZA 5T3HA 4OGYA 3QZRA 3EGKH 2A31A 3BIVH 4Y0ZE 3LH1A 4ABHA 2RCEA 3TGKE 2F91A 2NWNA 1C5ZB 1FY4A 1Q3XA 2FXRA 1W10U 2BQ6B 1ZTKA 3H5CB 1GBFA 1VGCC 3ZVFA 3K6YA 1OP0A 1PQ8A 3RU4T 2Z94A 1BT7A 1RD3B 1SGNE 1UMAH 2SFAA 3ENSB 2GZ9A 2NU0E 1TWXB 2ALPA 1V2UT 1MZDA 4FU9A 4Q80A 1PJPA 1P04A 4KP0A 4WXVA 6CHAB 2NU3E 2OBOA 2WPJS 3MOCA 1BRBE 1O2TA 2JH5D 4HI3A 4ZKNU 1C2HA 3BTDE 5GPIB 2GZ7A 3BEIB 5DKMA 1GVZA 4AFQA 1JBUH 4FVDA 5E0HA 2FEQH 4IS5A 2TBSA 3FFGA 2QCYA 4UE7H 1ELGA 1O3HA 1ZRKA 1GL0E 1EX3A 1RGQA 1CO7E 1DY9A 1XUKA 1O34A 2F9NA 3MNXA 1CT0E 3GY6A 5EXNA 1QA0A 1C5YB 5DP8A 2NU1E 1NRNH 2W26A 3F9HA 3ZVDA 1H8DH 2FPZA 4K1SA 2Y80A 1V2JT 1CE5A 1YKTA 1F5LA 1MTSA 1YPMH 3BN9A 1W2KH 1GBCA 3A8CA 1GWAA 3MNSA 3SV8A 4D8NA 2HNTC 1D4PB 2BZAA 1FY5A 1GHBF 3AW0A 3HK6B 4OM9A 3M5MA 1O2PA 3QWCH 1O2JA 1CBWC 3D62A 1Z8JB 1HAXB 3F9EA 1GCTB 3RXAA 2O8UA 4WJG2 3SNBA 4GUXA 7GCHF 2J9NA 3E3TA 1AD8H 2J4IA 5C5OA 2QYIA 5TJXA 5JPMH 3VGCC 2VIQA 2PLXA 1VCWA 5JBBS 4HZHA 4Z0KA 2WYGA 4TPYA 5E8EH 5FBEA 2STAE 1HJAC 1AN1E 2BMGB 1S84A 4SGAE 3LKWA 4DVAU 1GHVH 3VXFH 1Y3VA 1BMMH 3R3GB 2H9TH 4FUCA 5FHTA 1HAGE 1MTNB 1GI4A 1HJ9A 2ZHQH 2KAIA 1C2MA 3ZV9A 1O3IA 2OC1A 2J38A 1AE8H 2KAIB 2EI8A 1SSXA 1H9LB 1V3XA 1GJBB 3ZZ9A 5HGGA 4YOIA 3SU1A 1AMHA 1C5WB 3DA9B 1SQOA 3O8CA 2FOFA 1ZJKA 5CHAB 2HPPH 2W7UA 3LONA 1GI1A 1JIRA 4NIYA 1OP2A 3RU4E 1KDQA 1GHZA 2FI3E 3V13A 2YNBA 1GHBG 1O5CB 1ZR0A 4UFGH 4B76A 2QAAA 4MNYA 1P2IA 5C5NA 2H6MA 2DUCA 2AMQA 3QTOH 1WQVH 3QK1A 3SBKA 2XCNA 3E91A 2Z7FE 3NCLA 1RRKA 3GY5A 3ZVCA 5GIBA 4SGBE 7GCHG 2QV1A 3E1XB 4WXIA 5FPTA 1THSH 2A4OA 1KLJH 1UK2A 2SGDE 3BTGE 4X0WU 5JDUB 1BBRH 3KQEA 1GJAB 1ABJH 3A7YA 1TX6A 1O2RA 1XX9A 4A1TA 1OWDA 1V2NT 1NRPH 4IW4E 4RKJB 1THPB 3A7XA 1ZMNA 3ZZ3A 1S85A 1UCYK 1MTWA 5DP3A 2FOEA 1OPHB 5EQQA 1PPZA 3P8GA 1A7SA 3RXOA 1YCPM 4FUDA 1NFWA 2VWOA 4M9FA 1SGEE 1SGPE 3SO3A 4K3JA 5FXLA 2WZQA 3BEFB 1MAXA 1EATA 2HOBA 3P92A 1ELTA 1UVUH 1GG6B 3VB5A 4ISOA 1H9HE 8ESTE 4YZUA 1ZLRA 1G9IE 1ZHMA 1DITH 2W3IA 4MNWA 2JH0D 2W5EA 4X6MA 2BLWA 1A0JA 1NM6A 2QXJA 3TITA 2B9LA 1O31A 3ZZCA 5B6LA 1A46H 3RM0H 3PMAB 5JB8S 1IQLA 1YGCH 1ZMLA 2WPIS 1UVOA 4JYTA 5L6NH 2VH0A 1HUTH 5DGJA 4E05H 1YPHE 1ANBA 5AFZH 1TGBA 1TPPA 1HV7A 1GBHA 3ELAH 2OCVB 3TH2H 4Q7ZA 1GMDF 1BTHH 2FP7B 2O8WA 1BTWA 2BVSH 3A7WA 1BTXA 1LVYA 1V2TT 1WQSA 4RI0A 1V2WT 1VJAU 1OWJA 4IMZA 4B73A 1GJDB 1QA7A 3OTJE 1CT4E 1PPEE 3KL6A 4U30A 3GOVB 2BVRH 3LGVA 3P8NA 3ZZ8A 1AQ7A 1K9OE 4AG1A 1P06A 1TPOA 1S81A 1SQAA 5A0BA 1O2KA 2F4LA 4DOQA 4I8LA 2A2XH 1Z71A 3M37A 1XKAC 3M5LA 3SU5A 1ZPZA 1C2EA 2FMJA 3G01A 3ZZ7A 1E35B 1F2SE 1C5VA 5DP5A 4X8UH 2Q6FA 4RSPA 2WUCA 2GT8A 4OS2A 1ARCA 1Y3UA 3MU4A 1GHAF 3SQHE 3GISB 1A0LA 3T62A 1O2VA 2ZQ2A 2W7SA 1MU6B 2CJIA 4O03A 1RTKA 5PTPA 1BUIA 6CHAC 1QB6A 1TBQH 5EW1H 1EKBB 1UTQA 3U1IB 1Y8TA 2K1QA 1VITH 4Y8YA 1ESTA 4F4OC 1O2LA 2Y81A 1DY8A 5K0HA 1C4Y2 3H7OA 2XBXA 2WPHS 2ZC9H 3SGAE 1UTPA 3ATWA 1QURH 2PGBB 3LGWA 3UY9A 3RP2A 1FDPA 1P9SA 1UJ1A 2Q1JA 4Y76A 3MU8A 1O5AB 3LPRA 2Z3CA 1O3AA 2EI6A 4ISHH 2PHBA 3CENA 3ZVEA 1ABIH 5J4SA 1N8OB 2G00A 1V2QT 4I8GA 2ZPQA 1EXFA 1V2VT 3LU9B 1B7XB 1Z1JA 1EPTA 3SV6A 1Y3XA 3RDZA 3SW2B 3P8FA 3RU4D 1GDNA 1O33A 1Z8IB 4ZKSU 5I25A 1A3BH 1AVWA 2BDAA 2ODQA 5LPRA 2SGAA 1GCTC 1OXGA 4AB8A 1BITA 3A81A 4AN7A 4A6LA 3L3TA 1KLIH 3VB3A 1YPEH 1YC0A 1MMJN 3QUMP 2OQ5A 3OY5U 3S0NA 2FWWA 1BRAA 2H5DA 1QRXA 2WUBA 1FONA 4WMFA 2BDHA 3T5FH 1KLTA 1L2EA 4MPWA 5GNDA 2GCTB 1GHAG 5ETXA 4B6EA 2GP9B 2TGTA 3A87A 1O3BA 2HALA 2EC9H 4Y6DA 4DW2U 2BD7A 1ELVA 2FOCA 1N6XA 1VR1H 1MTNC 2HPQH 2VWLA 4RKOB 1TLDA 1YBWA 1UCYH 3M5OA 3S9BA 4Y71A 4A5TS 2R0LA 2THFB 1YPKH 4ISNA 1GVLA 1ANDA 5DK1A 3LJOA 4WH8A 1BTUA 1SLUB 1HAZB 1BTPA 1DWDH 1C5PA 3ODFA 2BVXH 1DWEH 2PGQB 1UTLM 1TPSA 4Y79A 4GAWA 5L2YH 4J1YA 4DJZB 1ETTH 1SR5C 1RFNA 3T2NA 2Z3EA 2VIDA 4ZMAH 2XBYA 1O0DH 1CGIE 1XUJA 2A0QB 2G55A 4JCNA 3SUDA 1DX5M 3NXPA 3ESTA 2QN5T 1TONA 2AIQA 2BY6X 5FCKA 1MTUA 1CVWH 5ESBA 1MCTA 4ABAA 5F03A 1XM1A 3Q00A 4GHQA 2R0KA 1ARBA 2BY7X 2PUQH 4AGJA 1U6QA 2B7DH 5GDSH 1IQHA 1TB6H 4NIVA 5AFYH 1UVTH 1PPBH 2CGAA 3T27A 3U8TH 4A92A 1WTHD 1F7ZA 1AZ8A 1C1PA 2B8OH 1E34B 3TU7H 4JZ1A 2FESH 4OS1A 2BDYA 3UQVA 2VU8E 1EZSC 2C8YB 3ZZ5A 1AFQB 1EJMA 3A80A 1P02A 1WUNH 3BTQE 3RMMH 4ABBA 1S82A 2OXSA 2FI4E 1XVOA 1AUJA 1C2IA 3MU5A 2TGAA 1Z8GA 2ZHFH 1AO5A 2ZGBH 1BRUP 2D1JA 1OYTH 5JBCS 1FXYA 4AFUA 1GG6C 1P05A 4TY7A 2XC5A 1J16A 1GI5A 2H2ZA 2D26C 1G3DA 1BBRE 2FOBA 3A84A 1OWEA 4HGCA 1AVGH 1K1OA 1AI8H 1P3EA 2TGPZ 1PYTD 1GMCF 5AHGH 1P2QA 3B9FH 2TGDA 4XOJA 1LVOA 4E7RG 8LPRA 5T1VA 3I78A 4MPUA 3UOPA 2ASUB 6GCHF 4YLUA 4JZFH 4X1RU 3RXUA 1DVAH 3R0FA 3RMLH 5C1XA 1SOZA 5FX5A 3RXPA 2M5TA 4UONA 4GHTA 3NK8A 1FAXA 5JYIA 1P2NA 4MQAA 1C5SA 1VZQH 1V2KT 1SHYA 3UR9A 5EPNA 1INCA 1GI8B 1FN8A 1MQ6A 3EA8A 4BTIB 1WU1A 2PKSB 3T26A 1ZGIA 1HAVA 4K1EA 1FY3A 4B6FA 3LGUA 1UTNA 4TYDA 3F68H 3CS7A 2PKAA 1LHFH 3D23A 3UREA 4D7GA 2Z9KA 5GJ4B 2PKAB 2ALVA 1WSSH 1FUJA 1P2MA 5EXLA 2JH6D 2GDDA 1PPFE 5C1UA 3ITIA 2ZWLH 2JKHA 4AFZA 1HDTH 2VB0A 3C27B 2FOMB 4YESB 3SU0A 1ZZZA 3ATIA 5HXFA 1HLTH 2BB4A 1FIZA 1LHDH 4AX9H 1HAIH 1O3NA 3BG4B 1HB0B 1BMAA 1TALA 2ZCLP 2G81E 4NSYA 1GBTA 1MKWK 1TOMH 3TLOA 3A8AA 2GZ8A 2SNVA 2IN2A 4THNH 3EA9A 3F6UH 3HATH 3MNBA 4FXGH 4D7FA 3UNSA 4INKA 1GMCG 1TNGA 3URDA 3ZZDA 2O8TA 1TOCB 6GCHG 1GI9B 1CSOE 1QY6A 2C8ZB 4TPIZ 4O9VA 2GV7A 3TGIE 2ZGHA 4M7GA 4OS5A 1UK4A 2P94A 1SGTA 2BY5X 2P8OB 4A1XA 3P70B 1N8OC 1OYQA 2PSXA 4AG2A 3BV9B 3BTWE 4DT7B 1S0RA 3ZVAA 1LPKB 1HAOH 3DUXH 1JIMA 1J8AA 1SFIA 4CH8B 3FZZA 2GKVE 1IHTH 4XSKU 4I8KA 2ZU3A 1IQFA 2CF9H 3A7ZA 1B0FA 2ZKSA 2ZFRH 1SGFG 3L33A 3RLYH 4UDWH 2H5CA 3OU0A 2FZZA 3KIDU 1W0YH 1HRTH 1EAWA 3AAUA 3SUFA 1F92A 5DO4H 2UWLA 1BHXF 4F49A 4NGAH 4DCDA 4ABGA 2BY8X 2J94A 2OC8A 1OWHA 1FI8A 1C5UA 1MZAA 3LC3A 1T4VH 3TIUA 4BTTB 5I46H 3ZYDA 1QTFA 4ABEA 2AGIX 5T6GA 3B8JA 4WMEA 1O3FA 1C9PA 2GCTC 3GY7A 5C2ZA 1C5TA 1E36B 2CMYA 1BA8B 2HRVA 4B71A 1TNHA 3TJNA 1QIXB 1IQIA 2O8MA 3MO3A 3PMJA 5EU8A 4CH2B 4KGAA 2C4FH 2FTLE 2G8TA 3QGJA 2BDGA 2QY0B 2FDAA 3NKKA 2WYJA 3PO1B 2ZI2H 3GCHB 4NSVA 4XBDA 3GY4A 1XUIA 1OWIA 4X2WA 1EB2A 3FP8E 1QL8A 1S6FA 1ZPCA 4WH6A 3ZZBA 2A7JA 3SGQE 1DUEA 3KEEA 1XUGA 1FIWA 1O2WA 3B23B 3EYDA 3HGPA 5LPEA 4IC5A 1CA0B 3BF6H 2Q6DA 3S7KB 1GJ5H 1TFXA 1LVBA 2BLVA 1K1MA 1D9IA 1W11U 5DJ7A 2Z9IA 3MH6A 3M5NA 1C1WH 1YM0A 1AU8A 3S69A 1TA2A 1C1SA 3SI3H 4MDSA 1O3MA 2GGVB 1WAYB 3I77A 5JB9S 1L1NA 4KELA 3AK5A 4LZ1H 1UCYE 3E90B 3S9CA 2G52A 4MG3A 1KIGH 2QC2A 1KY9A 3O8BA 1TGSZ 3S9AA 3AVZA 1AGJA 3PWBA 1XMNB 5EXMA 1TRYA 3FVFB 5HM2A 1ELDE 4Y7AA 3ZYEA 1BRCE 1DXPA 1GI7B 3SN8A 3A7TA 1KXEA 1LCYA 2ILNA 5A0CA 1PPCE 4A7IB 2ZDMA 1ID5H 2OD3B 1L0ZA 1SLWB 2SGEE 2HNTF 4NG9H 1KDQB 2QA9E 1MAYA 4K60A 1L4DA 4NFFA 1EJAA 1LHEH 4FUIA 1NU7B 2ZEBA 1G3BA 1PQ7A 3RXQA 3ODDA 1AFQC 1SHHB 5AVDA 1O3EA 3DHKH 3ZZ6A 1O2MA 3FAOA 2ZDKA 1VCQA 4WMDA 4K8BA 1GJ4H 1LPZB 4IC6A 4CRBA 1DE7H 1ZSKA 2BQ7B 1C5OH 5BRRE 1A4WH 3SJ8A 3GDVA 2GVFA 4PROA 1ZJDA 5E0GA 1UK3A 3NUMA 1SMFE 4X1NU 1M9UA 1GI0A 1ESAA 1UTMA 2VVCA 1AB9B 3EQ0H 2ZPSA 4DY7B 1V2LT 4YT7H 5FCRA 1MKWH 2WPKS 1P10A 3PLBA 1O3JA 1GJCB 2QXHA 2OK5A 1GGDB 5TCAA 2XWAA 2FX4A 2BD4A 4NWLA 2CF8H 3NZIA 1UVPA 2XXLA 3K2UA 3CS0A 2GD4B 4CR9A 1RS0A 1P09A 1TA6A 2BD3A 7LPRA 1FJSA 1SGFA 1SLXB 1PQAA 1Y3WA 4CRAA 1ZRBA 2Y7XA 1ANEA 3NPSA 1L4ZA 1IQEA 2CXVA 1BQYA 3BEUA 3TNSA 3PMHB 1KXFA 1V2PT 1DM4B 1GJ9B 1SQTA 2UWPA 1EZUC 1F0RA 2PKSC 1O3LA 1AWHB 4ABIA 1Z6JH 1DANH 1PPHE 2BXUH 3K65B 4CHAB 3UPEA 2ZHWH 4BTUB 4K1TA 4RN6A 2F9UA 2VIWA 1J17T 1TNKA 1C4U2 1YCPK 1H9IE 2EEKA 3F9FA 9LPRA 3TK9A 2P3FH 3KHVA 1LHGH 5GWZA 4X8VH 1V6DA 1KXBA 5C3NA 1C2LA 1O2NA 1EASA 2FS8A 4XBBA 1LPGB 5T6DA 3EA7A 3QO6A 2STBE 1T8OA 1ZSJA 3DD2H 2D8WA 3KN2A 2G4TA 1N6YA 2BLQA 3GYMA 4DIHH 1G2LA 7KMEH 1EB1H 2P16A 1O30A 4NA7A 1RXPA 4BANB 1CHGA 2R3YA 1C1QA 1GBDA 4VGCB 1O3OA 3QZQA 3OTPA 2OC7A 4BAKB 3U8OH 3MO6A 1G32B 1CT2E 1TAWA 3EAJA 1WXRA 3AAVA 3O8DA 3Q3YA 4NA8A 1Y5UT 1C1VH 3LIWA 2ZU5A 3LH3A 1AIXH 1KXDA 1JRTA 2ZDAH 1F5RA 2BM2A 3RXJA 5ABWA 3RXIA 1TX7A 3LDXH 1O37A 1GCDA 1T8NA 4YLQH 4X2VA 4I8JA 1ZOMA 3VB4A 4B74A 1QL7A 4CRCA 4GCHF 1YPJH 2UUFB 1XUHA 2ULLA 4E7NA 2BXTH 3A86A 1GJ8B 5GCHF 2WV9A 2TIOA 2PFEA 1W8BH 1GMDG 3BTME 4JMYA 3V0XA 2PWXA 2HGTH 4D9RA 3RXKA 4LOYH 1TRMA 2BLOA 3RLWH 1FZZA 5L30H 1YPHC 1LKAA 2ODPA 1DDJA 1Y3YA 3P6ZB 1NESE 3U69H 1QJ6B 4YO9A 2PTNA 1EPTB 2BQWB 2VGCB 3STJA 1NFYA 1ELEE 3MI4A 1O5DH 3GICB 2OLGA 3MMGA 1EZXC 3CP7A 3SJKA 3MH7A 3SORA 3RXCA 1O35A 5LGOA 4X8TH 1AUTC 2Z9LA 1E0FD 2I6SA 2A2QH 1AE5A 5A2MH 3PO1C 2ZGJA 2B5TB 3RC6A 2Y7ZA 2QXGA 5BPEA 3A89A 1KXCA 2ZTZA 4K8YA 5B6OA 4NFEA 1ZHRA 2WPMS 1GVKB 3RMOH 1CA8B 1K21H 1SB1H 3MTYA 4INLA 1CA0C 4BAHB 3KF2A 3RXHA 3PMBB 2VNTA 2ZA5A 2WV5A 1W13U 1DXWA 5LH8A 3UWIA 4IGDA 4CRGA 1TNLA 4I32A 4BXWA 1VCPA 4U2WA 1NS3A 1PYTC 1JOUB 3BTTE 1XKBC 1O3DA 4H6TA 4GCHG 3E16B 3FP7E 2FS9A 5FX6A 4B2BA 1NO9H 2BY9X 4YT6H 5GCHG 2ZHDA 1C5QA 1TABE 3RXBA 1A5GH 2C8WB 2UUJB 2ZGXH 1OP8A 2GMTB 3PM3A 2ZGCA 4BAQB 2PV9B 4X1SU 5K7RA 3Q77A 1GL1A 4KTCA 5CHAC 1GI3A 3VPKA 3TJUA 1C4V2 5ESTE 1YLDA 1O5GH 2UUYA 1AVXA 1LKBA 1YYY1 2Y6TA 3SI4H 1ZSLA 4B75A 1C5XB 1P3CA 1AKSA 2G5VA 3UQOA 2AEIH 1FMGA 1K1JA 2PW8H 1O2OA 1D6RA 2TPIZ 2NU4E 1K1NA 1O2UA 4ZXXH 1P2KA 2QIQA 1YCPH 3BG8A 3GCTF 2R2WU 4GPGA 4YOGA 2J92A 2QGRA 1TGCA 1TX8A 2ZFQH 1QRZA 1ZTLA 1ORFA 1ETSH 1EJNA 1EOJA 1O3PB 1WBGB 2VBCA 2A45B 2CV3A 1KSNA 3HPTB 3ZVGA 1XVMA 3C1KA 3MH4A 3M3SA 3D49H 4B2AA 2ANKH 2OUAA 2A4QA 3VB7A 4I33A 3TK6A 4ABJA 1SGYE 1A5HA 4X2XA 3BIUH 3K6ZA 2FOAA 4XDEA 1NN6A 2RG3A 5IYTA 4B1TA 1D3PB 1GGDC 1O2ZA 3SV2H 3GCOA 5DP4A 1O3CA 2BYAX 2FYRA 4JK6A 2YNAA 1T7CA 1TQ0B 1XUFA 3SNDA 3MU0A 3Q3KA 4JZDH 4WVPE 1C1MA 2ZP0H 4D76A 1MH0A 3VEQB 1W14U 3SU3A 2BDBA 1GI6A 4Q7YA 3RXEA 4I7YH 3TH4H 1W7XH 1EOLA 3W94A 1S5SA 2G5NA 2ZFPH 1E38B 1FPHH 2QF0A 1BOQA 4BXSA 4CHAC 2JETB 5DG6A 1KYNA 2HVXA 2C90B 1GHXH 1WCZA 4LZ4B 2DE9A 1SVPA 2AS9A 3E8LA 2XCFA 3JZ2B 2BD5A 1OKXA 1Z8RA 1IHSH 1O5FH 3SOSA 1GBAA 3E6PH 3ZVBA 1XXFA 4AYYB 3GCTG 1DUAA 4I8HA 4MNXA 2ZDVH 2Z9GA 3SZEA 1HGTH 1T4UH 5EG4A 1C5MD 3RXDA 1Q2WA 3MNCA 3FZDA 4ZUHA 4K2YA 1HAVB 5EW2H 4FUGA 1X7AC 2VINA 2XNIA 4O97A 3TVJB 2DE8A 1QJ7B 5IDKA 2UUKB 4NWKA 3VXEH 3RXVA 3SNCA 2ZO3H 4Y7BA 5A8ZA 2F9BH 2RA3A 4VGCC 1C1TA 1EUFA 2BZ6H 4A1VA 4CRFA 1DSTA 3QDZB 9ESTA 1O2SA 5AF9H 1VJ9U 4OS6A 1GBIA 2ZPRA 2P93A 1SGCA 5L2ZH 2ZECA 3N7OA 1C1NA 1T8LA 2AMDA 4E06H 4Y10E 4MPVA 1LMWB 1K22H 1GBEA 4ZROA 3V3MA 1F5KU 1K28D 1ETRH 2ESTE 2AGGX 4GLYA 2AYWA 2FLRH 2P3TB 2F9PA 2WHXA 1SBWA 1NZQH 1TGNA 1JWTA 4OS4A 3Q76A 1MTVA 5A8XA 2ZDNA 1O5BB 1O36A 2Y5HA 4X6NA 1V2OT 1YLCA 4AZ2B 1F0UA 1H8IH 2BD8A 1C5LH 4CRDA 4B2CA 2XC4A 1B5GH 4HFPB 3QGNB 1FNIA 2BHGA 2D2DA 2ODYB 1LQEA 2HLCA 2XC0A 1EPTC 2VGCC 2GTBA 3JZ1B 3PB1E 1QB9A 2XTTB 4TWYA 1GI2A 1L1GA 5F8TA 1AHTH 2A4GA 3E0NB 5C20A 4Z6AH 1Q31A 1ANCA 4FU7A 1A1RA 4IN2A 1QQUA 1UTJA 2V0BA 3L6PA 1MD7A 2VIOA 1SI5H 4KTSA 1PFXC 2RDLA 1QBNA 1AWFH 3LGTA 1UTKA 1FAKH 1HIAA 5DP9A 4R8TB 5F6MA 1YPLH 4FUHA 1HIAB 2GT7A 2ZFTA 2AIPA 5EOKA 2F9VA 4WF8A 3RM2H 2SGPE 4KKDA 3SHCH 1TMUH 2ZFSA 2Y5GA 1IQMA 5EQSA 3ATKA 1PPGE 1A61H 1NRRH 5EPYA 4AGKA 1TNIA 4K5ZA 2OINA 3NWUA 2TRMA 2G4UA 1QL9A 2IPHA 2V3HH 3F9GA 3KQDA 3PYHA 3T25A 1EAXA 3S7HB 1NFUA 1SGQE 1MKXK 1A3EH 1OX1A 5DP6A 3U98H 2C93B 1GJ6A 3SQEE 3WY8A 2GMTC 2SNWA 1MCVA 2VVUA 3A88A 4Y0YE 1V2RT 1EP5A 1ZPBA 4JYUH 1O38A 2AGEX 6LPRA 2QXIA 5HYOA 5JBTA 1QJ1B 1BTYA 1C9TA 3RMNH 2FOGA 4MVNA 1C1RA 1CQQA 1NRQH 1DLEA 2XW9A 1Y5AT 5J4QA 2BX3A 2ZCKP 1C2KA 3U8RH 5HM9A 1JMOH 3PROA 2WPLS 4CBOA 3SYJA 1O2YA 3KQCA 5DPAA 8KME2 4FUEA 4TWWA 2XWBI 2IOTA 1O32A 1NROH 1IQJA 4X8SH 3UFAA 4NZQA 4BAOB 3LGYA 4X2YA 3STIA 1TBZH 1BMNH 4XE4A 2V3OH 3GY8A 5EQRA 2ZU1A 3SJ9A 3T28A 3MYWA 4NIXA 2WV4A 1RIWB 5TCCA 1BIOA 1DWBH 3BTHE 1EAIA 5SGAE 3RC5A 4I31A 2BD2A 1W0ZU 2CN0H 4D9QA 3W95A 1SGRE 1LVMA 1BDAA 1O2IA 5A09A 3RXSA 1RTFB 2XYAA 1HBTH 5A8YA 2VH6A 3ZZAA 4WWYA 1H4WA 2VWMA 3GY2A 3OYPA 4YTAA 2OTVA 1THRH 1UVSH 3VFEA 2BDCA 1DICA 2F83A 1ELAA 1CGHA 4FUJA 1Z7KA 3UR6A 2V35A 3VB6A 1A5IA 5FBIA 1GBLA 1C2JA 1TQ7B 2OQUA 2PTCE 2FO9A 3LT3A 4ZHLU 1K1LA 4FU8A 1P03A 1WV7H 3TK5A 1WOFA 1OOKB 1DFPA 4ABDA 4AORA 1EZQA 1P01A 4X6PA 1H1BA 1UTOA 2BOHB 2UWOA 3O8RA 3UOUA 2IJD1 2JETC 3HKIB 3H7TA 2F9OA 4IN1A 1QR3E 2VIPA 2GCHF 1E37B 1ELBA 2H9EH 3E0PB 3RXLA 3EE0B 3GY3A 1TRNA 4XBCA 3GDSA 5E0JA 3MU1A 3SGBE 1TNJA 4H4FA 3T29A 1NPMA 2SGQE 1KXAA 1GBKA 1VITF 1QCPA 2CHAB 2HWLB 1D6WA 1O3GA 2AFQB 3A7VA 5T6FA 4H6SB 1K1PA 2BX4A 1C2DA 2VWNA 1HAPH 2FX6A 1SGDE 3OSYA 3RUOA 3PLKA 2FOHA 2H1UA 1OSSA 4BNRA 1NU9A 1ZTJA 2OP9A 1P11E 2GX4A 1EAUA 1CGJE 2ZFFH 1O2GH 4Y8ZA 1O5EH 1TYNA 3V12A 3A82A 2I6QA 5FPYA 3TH3H 1AZZA 2AH4X 4TY6A 4KTUA 5EODA 3M7QA 1LTOA 1UO6A 1C5RA 1IQGA 5E2OA 2FODA 3BG4C 4DURA 2Q6GA 2FI5E 2NU2E 1LQDB 5LPFA 4ZKOU 4FUFA 3IG6B 4UFDH 1G3CA 4NZLA 1ZMJA 1BJVA 1SGIB 4R0IA 4MLFB 3P8OA 1D3TB 1GJ7B 1DLKB 3FANA 3EDXB 3UUZA 5CE1A 2GCHG 2GDEH 2R3UA 1IAUA 3SUGA 3BTEE 1F0SA 3SNAA 1QHRB 2ZTYA 1IQNA 4GVUA 3LJJA 1G2MA 1LDTT 1BZXE 1P0SH 2P8OC 2G51A 1GPZA 2BTCE 4IBLH 1BHXB 1FLEE 1CHOF 1BJUA 1MKXH 1VITG 4ASHA 1O2QA 5C67A 2P3UB 3SUEA 1J15A 1DSUA 3MFJA 4IMQA 2A5IA 3F1SB 3M3VA 4JK5A 1S0QA 4MNVA 5G4BA 4O3UA 4YOJA 3TPIZ 2C8XB 4NCYA 3PLPA 3FP6E 1ELCA 2LNCA 3SJIA 1WYKA 1BCUH 4Y11E 1KTTB 1HJ8A 1BMLA 1NTPA 3DFLA 1GDUA 1HCGA 1QRWA 4GSOA 1P2OA 2WINI 4ZHMU 4AB9A 1SOTA 3QX5H 2ZF0H 4ZHAA 1VGCB 4JZEH 1Z1IA 2XBVA 1B0EA 2A5AA 4X6OA 3ATMA 1LO6A 1C2FA 4AYVB 2FIRH 3UTUH 3HK3B 3LC5A 1GHWH 1OS8A 1ZYOA 2A32A 1ELFA 3ZZ4A 7ESTE 1SLVB 1JXPA 4JZIA 1G3EA 1QBOA 1T8MA 2A7HA 1ACBE 1HPGA 2ZU4A 1XXDA 4WY3A 2QF3A 2VVVA 4ZAEA 3UNQA 3GCHC 2ZU2A 1TIOA 2O9QA 1YP9A 1RTLA 1TPAE 2PUXB 3KGPA 4Y8XA 2Z3DA 1YF4A 2BD9A 3GYLB 3BSQA 1NY22 1RJXB 1HXEH 3GDUA 2H9HA 3SJOA 1FY8E 1MU8B 2ZNKH 3GCNA 3MWIU 3IWMA 1QNJA 1V2ST 3UWJH 3SV9A 3HGNA 3RXTA 3UNRA 3D65E 1CHOG 4FVBA 3PWCA 5CMXH 2ZQ1A 3SHAH 2AERH 2A7CA 2P59A 4UEHH 1IQKA 1PQ5A 3RC4A 1L1JA 1FPCH 4AOQA 3TGJE 3ZV8A 5JBAS 5E2PA 4ZKRU 2A1DB 3MHWU 2RA0A 1SC8U 4QT8C 1P8VC 2F3CE 3RXGA 4CR5A 3RXFA 1CBWB 1TGTA 2FM2A 4NIWA 1QB1A 4AFSA 2O8LA 3I29A 1C5NH 4UD9H 4K69A 1J14A 2BDIA 1DPOA 2AMPA 2FTMA 1ESBA 1QFKH 1O2HA 3SV7A 8GCHF 4XFQA 3IITA 1LHCH 3BTFE 3KCGH 3M61U 1DWCH 3VGCB 2EA3A 4ESTE 1RIWC 4JYVH 1EQ9A 3P17H 4HTCH 3U9AH 1BTZA 1P2JA 4NA9H 1K1IA 1HJAB 1AKSB 3Q3XA 5DP7A 1D3QB 2VJ1A 2XBWA 3M7UA 2FLBH 4H42U 1AFEH 4LK4A 5FPSA 1AY6H 3QTVH
chains in the Genus database with same CATH superfamily
4DGJA 3RXRA 1G37A 1GMHF 3M36A 1EP6A 4BAMB 1JRSA 1S83A 1TE0A 3WWFA 1HYLA 3TJOA 2ANMH 2PR3A 5KGOA 1W12U 3AASA 1O39A 3P95A 2ZTXA 1AB9C 1SL3A 1MBMA 3LOXA 1SPJA 4YM9A 2ZIQH 1KTSB 3CNRA 1HFDA 1Y5BT 4UFEH 3DSOA 3UIRA 2Y5FA 1Y59T 1UW7A 3H09A 3DFJA 1G30B 1DOJA 1V2MT 1CU1A 2A4RA 4Q7XA 4CREA 5F8XA 5HMAA 3TNTA 4OS7A 2R2MB 4X1QU 1HAHH 2EI7A 3KNXA 2SGFE 1ZHPA 1P12E 1P57B 2LPRA 1QQ4A 2B0FA 3SU6A 1BB0B 1K2I1 1O3KA 1N1LA 2ANWA 3MO9A 1GBJA 2Y82A 2ZCHP 3V7TA 2ZHEH 4U01A 2ZZUH 2ANYA 1IOEA 2CHAC 4UFFH 4CBNA 4DIIH 1MD8A 8GCHG 2YOLA 3OX7U 3A8BA 6ESTA 1GBMA 1MBQA 2KCPA 5C1YA 2Z6BD 1HAYB 3LGIA 4O3TA 1F0TA 1A0HB 4BOHA 1QGFA 2W3KA 1DS2E 3OY6U 3RXMA 4INHA 3QLPH 3TJVA 3MH5A 1Z6EA 1S6HA 2V6NA 1YPGH 4J2YB 1GBBA 1O2XA 2GV6A 3PV2A 2Z9JA 3PV5A 1GMHG 1C1OA 5EGMA 3M3TA 2ZG0H 1TMBH 1OWKA 1C1UH 4ISIH 1T31A 5H4IB 1P9UA 1HXFH 1TMTH 1ZGVA 3PTBA 4ASUD 4ZXYH 2ZDLA 4MTBA 4OGXA 1TBRH 2R9PA 3PV4A 4FUBA 1D3DB 1YWUA 2VIVA 1C2GA 1NFXA 3AW1A 4ISLA 4ZH8A 1HNEE 5FAHA 1QBVH 3A83A 3HKJB 4ABFA 4Q63A 1FQ3A 3SU4A 3U1JB 2IJOB 1J9CH 1NT1A 3M35A 3URCA 1WTGH 3K9XB 3QN7A 1A2CH 1NRSH 2K0QA 3DT0H 1UHBA 1G36A 3KQBA 1NC6A 4Q2KA 1DT2A 3M7TA 2P95A 1W7GH 3SNEA 1GHYH 1UHBB 2OBQA 1FX0B 2J95A 2J34A 2OC0A 5A0AE 3A8DA 2HNTE 3SZNA 1FN6A 2BOKA 1MUEB 1BBRK 1SG8B 3PTNA 4MPXA 5GXPA 2KFWA 1FV9A 4DG4A 3A85A 2XRCA 4LXBH 2J2UA 2C3SA 3ATLA 3BTKE 1MQ5A 4U32A 1W3CA 2A5KA 2PSYA 3SU2A 2FYQA 1T32A 1GDQA 1SFQB 4X1PU 1FY1A 5F8ZA 5T3HA 4OGYA 3QZRA 3EGKH 2A31A 3BIVH 3U28C 4Y0ZE 3LH1A 4ABHA 2RCEA 3TGKE 2F91A 2NWNA 1C5ZB 1FY4A 1Q3XA 2FXRA 2J5UA 1W10U 2BQ6B 1ZTKA 3H5CB 1GBFA 1VGCC 3FO8D 3ZVFA 3K6YA 1OP0A 1PQ8A 3RU4T 2Z94A 3N99A 1BT7A 1RD3B 1SGNE 1UMAH 2SFAA 3ENSB 2GZ9A 1H8HD 2NU0E 1TWXB 2ALPA 1V2UT 1MZDA 4FU9A 2RDEA 4Q80A 1PJPA 1P04A 4KP0A 4WXVA 6CHAB 2NU3E 2OBOA 2WPJS 3MOCA 1BRBE 1O2TA 2JH5D 4HI3A 4ZKNU 1C2HA 3BTDE 5GPIB 2GZ7A 3BEIB 5DKMA 1GVZA 4AFQA 1JBUH 4FVDA 5E0HA 2FEQH 4IS5A 2TBSA 3FFGA 2QCYA 4UE7H 1ELGA 1O3HA 1ZRKA 1GL0E 1EX3A 1RGQA 1CO7E 1DY9A 1XUKA 1O34A 2F9NA 3MNXA 1CT0E 3GY6A 5EXNA 1QA0A 1C5YB 5DP8A 2NU1E 1NRNH 2W26A 3F9HA 3ZVDA 1H8DH 2FPZA 4K1SA 2Y80A 1V2JT 1K0HA 1CE5A 1YKTA 1F5LA 1MTSA 1YPMH 3BN9A 4TSFD 1W2KH 1GBCA 3A8CA 1GWAA 3MNSA 3SV8A 4D8NA 2HNTC 1D4PB 2BZAA 2YMSC 1FY5A 1GHBF 3AW0A 3HK6B 4OM9A 3M5MA 1O2PA 3QWCH 1O2JA 1CBWC 3D62A 1Z8JB 1KMHB 1HAXB 3F9EA 1GCTB 3RXAA 2O8UA 4WJG2 3SNBA 4GUXA 7GCHF 2J9NA 3E3TA 1AD8H 2J4IA 5C5OA 2QYIA 5TJXA 5JPMH 3VGCC 2VIQA 2PLXA 1VCWA 5JBBS 4HZHA 4Z0KA 2WYGA 4TPYA 5E8EH 5FBEA 2STAE 1HJAC 1AN1E 2BMGB 1S84A 4SGAE 3LKWA 4DVAU 1GHVH 3VXFH 1Y3VA 1BMMH 3R3GB 2H9TH 4FUCA 5FHTA 1HAGE 1MTNB 1GI4A 1HJ9A 2ZHQH 2KAIA 1C2MA 2JJ2D 3ZV9A 1O3IA 2J38A 2OC1A 1AE8H 2KAIB 2EI8A 1SSXA 3EE7A 1H9LB 1V3XA 1GJBB 3ZZ9A 5HGGA 3W1EA 4YOIA 2LELA 2AHME 3SU1A 1AMHA 1C5WB 3DA9B 1SQOA 3N7EA 3O8CA 2FOFA 1ZJKA 5CHAB 2HPPH 2W7UA 3LONA 1GI1A 1JIRA 4NIYA 1OP2A 3RU4E 1KDQA 1GHZA 2FI3E 3V13A 2YNBA 1GHBG 1O5CB 1ZR0A 4UFGH 2XNDD 4B76A 4FETA 2QAAA 4MNYA 1P2IA 5C5NA 1NBMD 2H6MA 2DUCA 2AMQA 3QTOH 1WQVH 3QK1A 3SBKA 2XCNA 3E91A 2Z7FE 3NCLA 5IK2D 1RRKA 3GY5A 3ZVCA 5GIBA 4SGBE 7GCHG 2QV1A 3E1XB 4WXIA 5FPTA 1THSH 1QZ8A 2A4OA 1KLJH 1UK2A 2SGDE 3BTGE 4X0WU 5JDUB 1BBRH 3KQEA 1GJAB 1ABJH 3A7YA 1TX6A 1O2RA 5C0UA 1XX9A 4A1TA 1OWDA 1V2NT 1NRPH 4IW4E 4RKJB 1THPB 3A7XA 1ZMNA 3ZZ3A 1S85A 1UCYK 1MTWA 5DP3A 2FOEA 1OPHB 5EQQA 2HLDD 1PPZA 3P8GA 1A7SA 3RXOA 1YCPM 4FUDA 1NFWA 2VWOA 4M9FA 1SGEE 1SGPE 3SO3A 4K3JA 5FXLA 2WZQA 3BEFB 1MAXA 1EATA 2HOBA 3P92A 1ELTA 1UVUH 1GG6B 3VB5A 4ISOA 2KX4A 2QF5A 1H9HE 4DT4A 8ESTE 4YZUA 1ZLRA 1G9IE 1ZHMA 1DITH 2W3IA 4MNWA 2JH0D 2W5EA 4X6MA 2BLWA 1A0JA 1NM6A 2QXJA 3TITA 2B9LA 1O31A 3ZZCA 5B6LA 1A46H 3RM0H 3PMAB 5JB8S 1IQLA 1YGCH 3DSPA 1ZMLA 2WPIS 1UVOA 4JYTA 5L6NH 2VH0A 1HUTH 5DGJA 4E05H 1YPHE 4HG6A 1ANBA 5AFZH 1TGBA 1TPPA 1HV7A 1GBHA 3ELAH 2OCVB 3TH2H 4Q7ZA 1GMDF 1BTHH 2FP7B 2O8WA 1BTWA 2BVSH 3A7WA 1BTXA 1LVYA 1V2TT 1WQSA 4RI0A 1V2WT 1VJAU 1OWJA 4IMZA 4B73A 1GJDB 1QA7A 3OTJE 1CT4E 1PPEE 3KL6A 4U30A 3GOVB 2BVRH 3LGVA 3P8NA 3ZZ8A 2M2AA 1AQ7A 1K9OE 4AG1A 1P06A 1TPOA 1S81A 1SQAA 5A0BA 2V7QD 1O2KA 2F4LA 4DOQA 4I8LA 2A2XH 1Z71A 3M37A 1XKAC 3M5LA 3SU5A 1ZPZA 1C2EA 2FMJA 3G01A 3ZZ7A 1E35B 1F2SE 1C5VA 5DP5A 4X8UH 2Q6FA 4RSPA 2WUCA 2GT8A 4OS2A 1ARCA 1Y3UA 3MU4A 1GHAF 3SQHE 3GISB 1A0LA 3T62A 1O2VA 2ZQ2A 2W7SA 1MU6B 2CJIA 4O03A 1RTKA 5PTPA 1BUIA 6CHAC 1QB6A 1TBQH 5EW1H 1EKBB 1UTQA 3U1IB 1Y8TA 2K1QA 1VITH 4Y8YA 1ESTA 4F4OC 3MQKC 1O2LA 2Y81A 1DY8A 5K0HA 1C4Y2 3H7OA 2XBXA 2WPHS 2ZC9H 3SGAE 1UTPA 3ATWA 1QURH 2PGBB 5C94A 3LGWA 3UY9A 3RP2A 1FDPA 1P9SA 1UJ1A 2Q1JA 4Y76A 3MU8A 1O5AB 3LPRA 2Z3CA 5HKKD 1O3AA 2EI6A 4ISHH 2PHBA 3CENA 3ZVEA 1ABIH 3F2GA 5J4SA 1N8OB 2G00A 1V2QT 4I8GA 2ZPQA 1EXFA 1V2VT 3LU9B 1B7XB 1Z1JA 1EPTA 3SV6A 1Y3XA 3RDZA 3DCLA 3SW2B 3P8FA 3RU4D 1GDNA 1O33A 1Z8IB 4ZKSU 5I25A 1A3BH 1AVWA 2BDAA 2ODQA 5LPRA 2SGAA 1GCTC 1OXGA 4AB8A 1BITA 3A81A 4AN7A 4A6LA 3L3TA 5CHBA 1KLIH 3VB3A 1YPEH 1YC0A 1MMJN 3QUMP 2OQ5A 3OY5U 3S0NA 2FWWA 1BRAA 2H5DA 1QRXA 2WUBA 1FONA 4WMFA 2BDHA 2EQNA 3T5FH 1KLTA 1L2EA 4MPWA 1W0JD 5GNDA 2GCTB 1GHAG 5ETXA 4B6EA 2GP9B 2TGTA 3A87A 1O3BA 2HALA 2EC9H 3NRLA 4Y6DA 4DW2U 2BD7A 1ELVA 2FOCA 1N6XA 1VR1H 1MTNC 2HPQH 2VWLA 4RKOB 1TLDA 1YBWA 1UCYH 3M5OA 3S9BA 4Y71A 4A5TS 2R0LA 2THFB 1YPKH 4ISNA 1GVLA 1ANDA 5DK1A 3LJOA 4WH8A 1BTUA 1SLUB 1HAZB 1BTPA 1DWDH 1C5PA 3ODFA 2BVXH 1DWEH 2PGQB 1UTLM 1E1RD 1TPSA 4Y79A 4GAWA 5L2YH 4J1YA 4DJZB 1ETTH 1SR5C 5HIYA 1RFNA 3T2NA 2Z3EA 2VIDA 4ZMAH 2XBYA 1O0DH 1CGIE 1XUJA 2A0QB 2G55A 4JCNA 3SUDA 1DX5M 3NXPA 3ESTA 2QN5T 1TONA 2AIQA 2BY6X 5FCKA 1MTUA 1CVWH 5ESBA 1MCTA 4ABAA 5F03A 1XM1A 4FOUC 3Q00A 4GHQA 2R0KA 1ARBA 2BY7X 2PUQH 4AGJA 1U6QA 2B7DH 5GDSH 1IQHA 1TB6H 4NIVA 5AFYH 1UVTH 1PPBH 2CGAA 3T27A 3U8TH 4A92A 1WTHD 1F7ZA 1AZ8A 1C1PA 2B8OH 3OE7D 1E34B 3TU7H 4JZ1A 2FESH 4OS1A 2BDYA 3UQVA 2VU8E 1EZSC 2C8YB 3ZZ5A 1AFQB 1EJMA 3A80A 1P02A 1WUNH 3BTQE 3RMMH 5CDFE 4ABBA 1S82A 2OXSA 2FI4E 1XVOA 2J98A 1AUJA 1C2IA 3MU5A 2TGAA 1Z8GA 2ZHFH 1AO5A 2ZGBH 1BRUP 2D1JA 1OYTH 5JBCS 1FXYA 4AFUA 1GG6C 1P05A 4TY7A 2XC5A 1J16A 1GI5A 2H2ZA 2D26C 1G3DA 1BBRE 2FOBA 3A84A 1OWEA 4HGCA 1AVGH 1K1OA 1AI8H 1P3EA 2TGPZ 1PYTD 1SQRA 1GMCF 5AHGH 1P2QA 3B9FH 4I86A 2TGDA 4XOJA 1LVOA 4E7RG 1W0KD 5T1VA 8LPRA 3I78A 5EJZA 4MPUA 3UOPA 2ASUB 6GCHF 4YLUA 4JZFH 4X1RU 3RXUA 1DVAH 3R0FA 3RMLH 5C1XA 1SOZA 5FX5A 3RXPA 2M5TA 4UONA 4GHTA 3NK8A 1FAXA 5JYIA 1P2NA 4MQAA 1C5SA 1VZQH 1V2KT 1SHYA 3UR9A 5EPNA 1INCA 1GI8B 1FN8A 1MQ6A 3EA8A 4BTIB 1WU1A 2PKSB 3T26A 1ZGIA 1HAVA 1NBME 4K1EA 1FY3A 4B6FA 3LGUA 1UTNA 4TYDA 3F68H 3CS7A 2PKAA 1LHFH 3D23A 3UREA 4D7GA 2Z9KA 5GJ4B 2PKAB 2ALVA 1WSSH 1FUJA 1P2MA 5EXLA 2JH6D 2GDDA 1PPFE 5C1UA 3ITIA 2ZWLH 2JKHA 4AFZA 1HDTH 2VB0A 3C27B 5C0TA 2FOMB 4YESB 3SU0A 1ZZZA 3ATIA 5HXFA 1HLTH 2BB4A 1FIZA 1LHDH 4AX9H 1HAIH 1O3NA 3BG4B 1HB0B 1BMAA 1TALA 3UAIC 2ZCLP 2G81E 4NSYA 1GBTA 1MKWK 1TOMH 3TLOA 3A8AA 2GZ8A 2SNVA 2IN2A 4THNH 3EA9A 3F6UH 3HATH 3MNBA 4FXGH 4D7FA 3UNSA 4INKA 1GMCG 1TNGA 3URDA 3ZZDA 2O8TA 1TOCB 6GCHG 1GI9B 3KQ5A 1CSOE 1QY6A 2C8ZB 4TPIZ 4O9VA 1YY3A 2GV7A 3F2FA 3ZIAD 3TGIE 2ZGHA 4M7GA 4OS5A 1UK4A 2P94A 1SGTA 2BY5X 3WW7A 2P8OB 4A1XA 3P70B 1N8OC 1OYQA 2PSXA 4AG2A 3BV9B 3BTWE 4DT7B 1S0RA 3ZVAA 1LPKB 1HAOH 3DUXH 1JIMA 1J8AA 5EJLA 1SFIA 4CH8B 3FZZA 2GKVE 1IHTH 4XSKU 4I8KA 2ZU3A 1IQFA 2CF9H 3A7ZA 3N7DA 1B0FA 2ZKSA 2ZFRH 1SGFG 3L33A 3RLYH 4UDWH 2H5CA 3OU0A 2FZZA 3KIDU 1W0YH 1HRTH 1EAWA 4ACBA 3AAUA 3SUFA 1F92A 5DO4H 2UWLA 1BHXF 4F49A 4NGAH 4DCDA 4ABGA 2BY8X 2J94A 2OC8A 1OWHA 1FI8A 1C5UA 1MZAA 3LC3A 1T4VH 3TIUA 4BTTB 5I46H 3ZYDA 1QTFA 4ABEA 2AGIX 5T6GA 3B8JA 4WMEA 1O3FA 1C9PA 2GCTC 3GY7A 5C2ZA 1C5TA 1E36B 2CMYA 1BA8B 2HRVA 4B71A 1TNHA 3TJNA 1QIXB 1IQIA 2O8MA 3VG8A 3MO3A 3PMJA 5EU8A 4CH2B 4KGAA 2C4FH 2FTLE 2G8TA 4P02A 3QGJA 2BDGA 2QY0B 2FDAA 3NKKA 2WYJA 3PO1B 2ZI2H 3GCHB 4NSVA 4XBDA 3GY4A 1XUIA 1OWIA 4X2WA 1EB2A 3FP8E 1QL8A 1S6FA 1ZPCA 2KR7A 4WH6A 3ZZBA 2A7JA 3SGQE 1DUEA 3KEEA 1XUGA 1FIWA 1O2WA 3B23B 3EYDA 3HGPA 5LPEA 4IC5A 1CA0B 2KCAA 3BF6H 2Q6DA 3S7KB 1GJ5H 1TFXA 1LVBA 2BLVA 5C17A 1K1MA 1D9IA 1W11U 5DJ7A 2Z9IA 3MH6A 3M5NA 1C1WH 1YM0A 1AU8A 3S69A 1TA2A 1C1SA 3SI3H 4MDSA 1O3MA 2GGVB 1WAYB 3I77A 5JB9S 1L1NA 4KELA 3AK5A 4LZ1H 1UCYE 3E90B 3S9CA 2G52A 4MG3A 1KIGH 2QC2A 1KY9A 3O8BA 1TGSZ 3S9AA 3AVZA 1AGJA 3PWBA 1XMNB 5EXMA 1TRYA 3FVFB 5HM2A 1ELDE 4Y7AA 3ZYEA 1BRCE 1DXPA 1GI7B 3SN8A 2CK3D 3A7TA 1KXEA 1LCYA 2ILNA 5A0CA 1PPCE 4A7IB 2ZDMA 1ID5H 2OD3B 1L0ZA 1SLWB 2SGEE 2HNTF 1E79D 1KDQB 4NG9H 2QA9E 1MAYA 4K60A 1L4DA 4NFFA 1EJAA 1LHEH 4FUIA 1NU7B 2ZEBA 1G3BA 1PQ7A 3RXQA 3ODDA 1AFQC 1SHHB 5AVDA 1O3EA 3DHKH 3ZZ6A 1O2MA 5F53A 3FAOA 3OEHD 2ZDKA 1VCQA 4WMDA 4K8BA 1GJ4H 1LPZB 4IC6A 4CRBA 1DE7H 1ZSKA 2BQ7B 1C5OH 5BRRE 1A4WH 2KCOA 3SJ8A 3GDVA 2GVFA 3FKSD 2GJGA 4PROA 1ZJDA 5E0GA 1UK3A 3NUMA 1SMFE 4X1NU 1M9UA 1GI0A 1ESAA 1UTMA 2VVCA 1AB9B 3EQ0H 2ZPSA 4DY7B 1V2LT 4YT7H 5FCRA 1MKWH 2WPKS 1P10A 3PLBA 1O3JA 1GJCB 2QXHA 2OK5A 1GGDB 3F0OA 5TCAA 2XWAA 2FX4A 2BD4A 4NWLA 2CF8H 3NZIA 1UVPA 2XXLA 3K2UA 3CS0A 2GD4B 4CR9A 1RS0A 1P09A 1TA6A 2BD3A 7LPRA 5KECA 1FJSA 1SGFA 1SLXB 4Z1MD 1PQAA 1Y3WA 4CRAA 1ZRBA 2Y7XA 1ANEA 3NPSA 1L4ZA 1IQEA 2CXVA 1BQYA 3BEUA 3TNSA 3PMHB 1KXFA 1V2PT 1DM4B 1GJ9B 1SQTA 2UWPA 1EZUC 1F0RA 1BMFD 2PKSC 1O3LA 1AWHB 4ABIA 1Z6JH 1DANH 1PPHE 2BXUH 3K65B 1S6LA 4CHAB 3UPEA 2ZHWH 4BTUB 4K1TA 4RN6A 2F9UA 2VIWA 1J17T 1TNKA 1C4U2 1YCPK 1H9IE 2EEKA 3F9FA 9LPRA 3TK9A 2P3FH 1H8ED 3KHVA 1LHGH 5GWZA 4X8VH 1V6DA 1KXBA 5C3NA 1C2LA 1O2NA 1EASA 2FS8A 4XBBA 1LPGB 3F2HA 5T6DA 3EA7A 3QO6A 2STBE 1T8OA 1ZSJA 3DD2H 2D8WA 3KN2A 2G4TA 1N6YA 2BLQA 1E1QD 3GYMA 4DIHH 1G2LA 7KMEH 1EB1H 2P16A 1O30A 4NA7A 1RXPA 4BANB 1EFRD 1CHGA 2R3YA 1C1QA 1GBDA 3OTPA 1O3OA 3QZQA 4VGCB 2OC7A 4BAKB 3U8OH 3MO6A 1G32B 1CT2E 1TAWA 3EAJA 1WXRA 3AAVA 3O8DA 3Q3YA 4NA8A 1Y5UT 1C1VH 3LIWA 2ZU5A 3LH3A 1AIXH 1KXDA 1JRTA 2ZDAH 4ZCNA 1F5RA 2BM2A 3RXJA 5ABWA 3RXIA 1TX7A 3LDXH 2J97A 1O37A 5DN6D 1GCDA 1T8NA 3FOAA 2L74A 4X2VA 4I8JA 4YLQH 1ZOMA 3VB4A 4B74A 1QL7A 4CRCA 4GCHF 1YPJH 2UUFB 1XUHA 2ULLA 4E7NA 2BXTH 3A86A 1GJ8B 5GCHF 2WV9A 2TIOA 2PFEA 1W8BH 1GMDG 3BTME 4JMYA 3V0XA 2PWXA 2HGTH 4D9RA 3RXKA 4LOYH 1TRMA 2BLOA 3RLWH 1FZZA 5L30H 1YPHC 1LKAA 1DDJA 2ODPA 1Y3YA 3P6ZB 1NESE 3U69H 1QJ6B 4YO9A 2PTNA 1EPTB 2BQWB 2VGCB 3STJA 1NFYA 1ELEE 3MI4A 1O5DH 3GICB 1SKYE 2OLGA 3MMGA 1EZXC 3CP7A 3SJKA 3MH7A 3SORA 3RXCA 1O35A 5LGOA 4X8TH 1AUTC 2Z9LA 1E0FD 2I6SA 2A2QH 1AE5A 5A2MH 3PO1C 2ZGJA 2B5TB 2LP6A 3RC6A 2Y7ZA 2QXGA 5BPEA 3A89A 1KXCA 2ZTZA 4K8YA 5B6OA 4NFEA 1ZHRA 2WPMS 1GVKB 3RMOH 1CA8B 1K21H 1SB1H 3MTYA 4INLA 1CA0C 4BAHB 3KF2A 3RXHA 3PMBB 2WPDD 2VNTA 2ZA5A 2WV5A 1W13U 1DXWA 5LH8A 3UWIA 4IGDA 2JJ1D 4CRGA 1TNLA 4I32A 4BXWA 2PP6A 1VCPA 4U2WA 1NS3A 1PYTC 1JOUB 3BTTE 1XKBC 1O3DA 4H6TA 4GCHG 3E16B 3FP7E 2FS9A 5FX6A 4B2BA 1NO9H 1VKYA 2BY9X 4YT6H 5GCHG 2ZHDA 1C5QA 1TABE 3RXBA 1A5GH 2C8WB 2UUJB 2ZGXH 1OP8A 2GMTB 3PM3A 2ZGCA 4BAQB 2PV9B 4X1SU 5K7RA 3Q77A 1GL1A 4KTCA 5CHAC 1GI3A 3VPKA 3TJUA 1C4V2 5ESTE 1YLDA 1O5GH 2UUYA 1AVXA 1LKBA 1YYY1 2Y6TA 3SI4H 1ZSLA 4B75A 1C5XB 1P3CA 1AKSA 2G5VA 3UQOA 2AEIH 1FMGA 1K1JA 2PW8H 1O2OA 3F0PA 1D6RA 2TPIZ 2NU4E 1K1NA 1O2UA 4ZXXH 1P2KA 2QIQA 1YCPH 3BG8A 3GCTF 2R2WU 4GPGA 4YOGA 2J92A 2QGRA 1TGCA 1TX8A 2ZFQH 1QRZA 4P00A 1ZTLA 1ORFA 1ETSH 1EJNA 1EOJA 1O3PB 1WBGB 2VBCA 2A45B 2CV3A 1KSNA 3HPTB 3ZVGA 1XVMA 3C1KA 3MH4A 3M3SA 3D49H 4B2AA 2ANKH 2OUAA 2A4QA 3VB7A 4I33A 3TK6A 4ABJA 1SGYE 1A5HA 4X2XA 3BIUH 3K6ZA 2FOAA 4XDEA 1NN6A 2RG3A 5IYTA 4B1TA 1D3PB 1GGDC 1O2ZA 3SV2H 3GCOA 5DP4A 1O3CA 2BYAX 2FYRA 4JK6A 2YNAA 1T7CA 1TQ0B 1XUFA 4F48B 2J98B 3SNDA 3MU0A 3Q3KA 2F43B 4JZDH 4WVPE 1C1MA 2ZP0H 4D76A 1MH0A 3VEQB 1W14U 3SU3A 2BDBA 1GI6A 4Q7YA 2WSSD 3RXEA 4I7YH 3TH4H 1W7XH 1EOLA 3W94A 1S5SA 2G5NA 2ZFPH 1E38B 1FPHH 2QF0A 1BOQA 2W6ID 4BXSA 4CHAC 2JETB 5DG6A 1KYNA 2HVXA 2C90B 1GHXH 1WCZA 4LZ4B 2DE9A 1SVPA 2AS9A 3E8LA 2XCFA 3JZ2B 2BD5A 1OKXA 1Z8RA 1IHSH 1O5FH 3SOSA 1GBAA 3E6PH 3ZVBA 1XXFA 4AYYB 3GCTG 1DUAA 4I8HA 4MNXA 2ZDVH 2Z9GA 3SZEA 1HGTH 1T4UH 5EG4A 1C5MD 3RXDA 1Q2WA 3MNCA 3FZDA 3OEED 5KEDA 4ZUHA 4K2YA 1HAVB 5EW2H 4FUGA 1X7AC 2VINA 2XNIA 3PRBA 4O97A 3TVJB 2DE8A 3GS9A 1QJ7B 5IDKA 4ACAA 2UUKB 4NWKA 3VXEH 3RXVA 3SNCA 2ZO3H 4Y7BA 5A8ZA 2F9BH 2RA3A 4VGCC 1C1TA 1EUFA 2BZ6H 4A1VA 4CRFA 1DSTA 3QDZB 9ESTA 1O2SA 5AF9H 1VJ9U 4OS6A 2L6OA 1GBIA 2ZPRA 3UB0A 2P93A 1SGCA 5L2ZH 2ZECA 3N7OA 1C1NA 1T8LA 2AMDA 4E06H 4Y10E 2EY4C 4MPVA 1LMWB 1K22H 1GBEA 4ZROA 3V3MA 1F5KU 1K28D 1ETRH 2ESTE 2AGGX 4GLYA 2AYWA 2FLRH 2P3TB 2F9PA 2WHXA 1SBWA 1NZQH 1TGNA 1JWTA 4OS4A 3Q76A 1MTVA 5A8XA 2ZDNA 1O5BB 1O36A 2Y5HA 4X6NA 3KYGA 1V2OT 1YLCA 4AZ2B 1F0UA 1H8IH 2BD8A 1C5LH 4CRDA 4B2CA 2XC4A 1B5GH 4HFPB 3QGNB 1FNIA 2BHGA 2D2DA 2ODYB 1LQEA 2HLCA 2XC0A 1EPTC 2VGCC 2GTBA 3JZ1B 3PB1E 1QB9A 2XTTB 4TWYA 1GI2A 1L1GA 5F8TA 1AHTH 2A4GA 3E0NB 5C20A 4Z6AH 1Q31A 1ANCA 4FU7A 1A1RA 1COWD 4IN2A 1QQUA 1UTJA 2V0BA 3L6PA 1MD7A 2VIOA 4AC9A 1SI5H 4KTSA 1PFXC 2RDLA 1QBNA 1AWFH 3LGTA 4F55A 1UTKA 1FAKH 1HIAA 5DP9A 4R8TB 5F6MA 1YPLH 4FUHA 1HIAB 2GT7A 1MABB 2KM0A 2ZFTA 2AIPA 5EOKA 2F9VA 4WF8A 3RM2H 2SGPE 4KKDA 3SHCH 1TMUH 2ZFSA 2Y5GA 1IQMA 5EQSA 3ATKA 1PPGE 1A61H 1NRRH 5EPYA 4AGKA 1TNIA 4K5ZA 2OINA 3NWUA 2TRMA 3FN8A 2G4UA 1QL9A 2IPHA 2V3HH 3F9GA 3KQDA 3PYHA 3T25A 1EAXA 3S7HB 1NFUA 1SGQE 1MKXK 1A3EH 1OX1A 5DP6A 3U98H 2C93B 1GJ6A 3SQEE 3WY8A 2GMTC 2SNWA 1MCVA 2VVUA 3A88A 4Y0YE 1V2RT 1EP5A 1ZPBA 4JYUH 1O38A 2AGEX 6LPRA 2QXIA 5HYOA 5JBTA 1QJ1B 1BTYA 1C9TA 3RMNH 2FOGA 4MVNA 1C1RA 1CQQA 1NRQH 1DLEA 2XW9A 1Y5AT 5J4QA 2BX3A 3WWBA 2ZCKP 1C2KA 3U8RH 5HM9A 1JMOH 2K8IA 3PROA 2WPLS 3SYJA 4CBOA 1O2YA 3KQCA 5DPAA 8KME2 4FUEA 4TWWA 2XWBI 4YXWD 2IOTA 1O32A 1NROH 4XRNA 1IQJA 4X8SH 3UFAA 4NZQA 4BAOB 3LGYA 4X2YA 3STIA 1TBZH 1BMNH 4XE4A 2V3OH 3GY8A 5EQRA 2ZU1A 3SJ9A 3T28A 3MYWA 4NIXA 2WV4A 1RIWB 5TCCA 1BIOA 1DWBH 3BTHE 1EAIA 5SGAE 3RC5A 4I31A 2BD2A 1W0ZU 2CN0H 4D9QA 3W95A 1SGRE 1LVMA 1BDAA 1O2IA 5A09A 3RXSA 1RTFB 2XYAA 1HBTH 5A8YA 2VH6A 3ZZAA 4WWYA 1H4WA 2VWMA 3GY2A 3OYPA 2HVYB 4YTAA 1THRH 1UVSH 2OTVA 3VFEA 2BDCA 1DICA 2F83A 1ELAA 1CGHA 4FUJA 1Z7KA 3UR6A 2IPQX 2V35A 3VB6A 1A5IA 5FBIA 1GBLA 4TT3D 1C2JA 1TQ7B 2OQUA 2PTCE 2FO9A 3LT3A 4ZHLU 1K1LA 4FU8A 1P03A 1WV7H 3TK5A 1WOFA 1OOKB 1DFPA 4ABDA 4AORA 2YMSD 1EZQA 1P01A 4X6PA 2QF4A 1H1BA 1UTOA 2BOHB 2UWOA 3O8RA 3UOUA 2IJD1 2JETC 3HKIB 3H7TA 2F9OA 4IN1A 1QR3E 2VIPA 2GCHF 1E37B 1ELBA 2H9EH 3E0PB 3RXLA 3EE0B 3GY3A 1TRNA 4XBCA 3GDSA 5E0JA 3MU1A 3SGBE 1TNJA 4H4FA 3T29A 1NPMA 2SGQE 1KXAA 1GBKA 1VITF 1QCPA 2CHAB 2HWLB 1D6WA 1O3GA 2AFQB 3A7VA 5T6FA 4H6SB 1K1PA 2BX4A 1C2DA 1WDIA 2VWNA 1HAPH 2FX6A 1SGDE 3OSYA 3RUOA 3PLKA 2FOHA 2H1UA 1OSSA 4BNRA 1NU9A 1ZTJA 2OP9A 1P11E 2GX4A 1EAUA 1CGJE 2W6JD 2ZFFH 1O2GH 4Y8ZA 1O5EH 1TYNA 5DSFA 3V12A 3A82A 2I6QA 5FPYA 3TH3H 1AZZA 2AH4X 4TY6A 4KTUA 5EODA 1YLNA 3M7QA 1LTOA 5FL7D 1UO6A 1C5RA 1IQGA 5E2OA 2FODA 3BG4C 4DURA 2Q6GA 2FI5E 2NU2E 1LQDB 5LPFA 2QE7D 4ZKOU 3OAAD 4FUFA 3IG6B 4UFDH 1G3CA 4NZLA 4RT0A 1ZMJA 1BJVA 1SGIB 4R0IA 4MLFB 3P8OA 1D3TB 1GJ7B 1DLKB 3FANA 3EDXB 3UUZA 5CE1A 2GCHG 2GDEH 2R3UA 1IAUA 3SUGA 2JIZD 3BTEE 1F0SA 3SNAA 1QHRB 2ZTYA 3F3BA 1IQNA 4GVUA 3LJJA 1G2MA 1LDTT 4XD7D 1BZXE 1P0SH 2P8OC 2G51A 4Q4LA 1GPZA 2BTCE 4IBLH 1BHXB 1FLEE 1CHOF 1BJUA 1MKXH 1VITG 4ASHA 4RT1A 1O2QA 5C67A 2P3UB 3SUEA 1J15A 1DSUA 3MFJA 4IMQA 2A5IA 3F1SB 3M3VA 4JK5A 1S0QA 4MNVA 5G4BA 2XOKD 4O3UA 4YOJA 3TPIZ 2C8XB 4NCYA 3PLPA 3FP6E 1ELCA 2LNCA 3SJIA 1WYKA 1BCUH 3PRDA 1KTTB 4Y11E 1HJ8A 1BMLA 1NTPA 3DFLA 1GDUA 1HCGA 1QRWA 4GSOA 1P2OA 2WINI 4ZHMU 4AB9A 1SOTA 3QX5H 2ZF0H 4ZHAA 1VGCB 4JZEH 1Z1IA 2XBVA 1B0EA 2A5AA 2RFKC 4X6OA 3ATMA 1LO6A 1C2FA 3OFND 4AYVB 2FIRH 3UTUH 3HK3B 3LC5A 1GHWH 1OS8A 1ZYOA 2A32A 1ELFA 3ZZ4A 7ESTE 1SLVB 1JXPA 4JZIA 1G3EA 1QBOA 1T8MA 2A7HA 1ACBE 1HPGA 2ZU4A 1XXDA 4WY3A 2QF3A 2VVVA 4ZAEA 3UNQA 3GCHC 2ZU2A 1TIOA 2O9QA 1YP9A 1RTLA 1TPAE 2PUXB 3KGPA 4Y8XA 2Z3DA 1YF4A 2BD9A 3GYLB 3BSQA 2JDID 1NY22 1HXEH 1RJXB 3GDUA 2H9HA 5HIZA 3SJOA 1FY8E 1MU8B 2ZNKH 3GCNA 3MWIU 3IWMA 1QNJA 1V2ST 3UWJH 3SV9A 3HGNA 3RXTA 3UNRA 3D65E 1CHOG 4FVBA 3PWCA 5CMXH 2ZQ1A 2V3MA 2AERH 3SHAH 2A7CA 2P59A 4UEHH 1IQKA 1PQ5A 3RC4A 1L1JA 1FPCH 4AOQA 3TGJE 3ZV8A 5JBAS 5E2PA 4ZKRU 2A1DB 3MHWU 2RA0A 1SC8U 2YMSB 5EJ1A 4QT8C 1P8VC 2F3CE 3RXGA 4CR5A 3RXFA 1CBWB 1TGTA 2FM2A 4NIWA 1QB1A 4AFSA 2O8LA 3I29A 1C5NH 4UD9H 1OHHD 4K69A 1J14A 2BDIA 1DPOA 2AMPA 2FTMA 1ESBA 3KYFA 1QFKH 1O2HA 3SV7A 8GCHF 4XFQA 3IITA 5EIYA 1LHCH 3BTFE 3KCGH 3M61U 1DWCH 3VGCB 2EA3A 4ESTE 1RIWC 4JYVH 1EQ9A 3P17H 4HTCH 3U9AH 1BTZA 1P2JA 4NA9H 2KZ4A 1K1IA 1HJAB 1AKSB 3Q3XA 5DP7A 2KCYA 1D3QB 2VJ1A 3DSGA 2XBWA 3M7UA 2FLBH 4H42U 1AFEH 4LK4A 5FPSA 1AY6H 3QTVH
chains in the Genus database with same CATH topology
4DGJA 3RXRA 1G37A 1GMHF 3M36A 1EP6A 4BAMB 1JRSA 1S83A 1TE0A 3WWFA 1HYLA 3TJOA 2ANMH 2PR3A 1W12U 3AASA 1O39A 3P95A 2ZTXA 1AB9C 1SL3A 1MBMA 3LOXA 1SPJA 4YM9A 2ZIQH 1KTSB 1HFDA 1Y5BT 4UFEH 3DSOA 3UIRA 2Y5FA 1Y59T 3H09A 3DFJA 1G30B 1DOJA 1V2MT 1CU1A 2A4RA 4Q7XA 4CREA 5F8XA 5HMAA 3TNTA 4OS7A 2R2MB 4X1QU 1HAHH 2EI7A 3KNXA 2SGFE 1ZHPA 1P12E 1P57B 2LPRA 1QQ4A 2B0FA 3SU6A 1BB0B 1K2I1 1O3KA 1N1LA 2ANWA 3MO9A 1GBJA 2Y82A 2ZCHP 3V7TA 2ZHEH 4U01A 2ZZUH 2ANYA 1IOEA 2CHAC 4UFFH 4CBNA 4DIIH 1MD8A 8GCHG 2YOLA 3OX7U 3A8BA 6ESTA 1GBMA 1MBQA 5C1YA 2KCPA 2Z6BD 1HAYB 3LGIA 4O3TA 1F0TA 1A0HB 4BOHA 1QGFA 2W3KA 1DS2E 3OY6U 3RXMA 4INHA 3QLPH 3TJVA 3MH5A 1Z6EA 1S6HA 2V6NA 1YPGH 4J2YB 1GBBA 1O2XA 2GV6A 3PV2A 2Z9JA 3PV5A 1GMHG 1C1OA 5EGMA 3M3TA 2ZG0H 1TMBH 1OWKA 1C1UH 4ISIH 1T31A 5H4IB 1P9UA 1HXFH 1TMTH 1ZGVA 3PTBA 4ASUD 4ZXYH 2ZDLA 4MTBA 4OGXA 1TBRH 2R9PA 3PV4A 4FUBA 1D3DB 2VIVA 1C2GA 1NFXA 3AW1A 4ISLA 4ZH8A 1HNEE 5FAHA 1QBVH 3A83A 3HKJB 4ABFA 4Q63A 1FQ3A 3SU4A 3U1JB 2IJOB 1J9CH 1NT1A 3M35A 3URCA 1WTGH 3K9XB 3QN7A 1A2CH 1NRSH 3DT0H 2K0QA 1UHBA 1G36A 3KQBA 1NC6A 4Q2KA 1DT2A 3M7TA 2P95A 1W7GH 3SNEA 1GHYH 1UHBB 2OBQA 1FX0B 2J95A 2J34A 2OC0A 5A0AE 3A8DA 2HNTE 3SZNA 1FN6A 2BOKA 1MUEB 1BBRK 1SG8B 3PTNA 4MPXA 5GXPA 2KFWA 1FV9A 4DG4A 3A85A 2XRCA 4LXBH 2J2UA 2C3SA 3ATLA 3BTKE 1MQ5A 4U32A 1W3CA 2A5KA 2PSYA 3SU2A 2FYQA 1T32A 1GDQA 1SFQB 4X1PU 1FY1A 5F8ZA 5T3HA 4OGYA 3QZRA 3EGKH 2A31A 3BIVH 4Y0ZE 3LH1A 4ABHA 2RCEA 3TGKE 2F91A 2NWNA 1C5ZB 1FY4A 1Q3XA 2FXRA 2J5UA 1W10U 2BQ6B 1ZTKA 3H5CB 1GBFA 1VGCC 3FO8D 3ZVFA 3K6YA 1OP0A 1PQ8A 3RU4T 2Z94A 1BT7A 3N99A 1RD3B 1SGNE 1UMAH 2SFAA 3ENSB 2GZ9A 1H8HD 2NU0E 1TWXB 2ALPA 1V2UT 1MZDA 4FU9A 4Q80A 1PJPA 1P04A 4KP0A 4WXVA 6CHAB 2NU3E 2OBOA 2WPJS 3MOCA 1BRBE 1O2TA 2JH5D 4HI3A 4ZKNU 1C2HA 3BTDE 5GPIB 2GZ7A 3BEIB 5DKMA 1GVZA 4AFQA 1JBUH 4FVDA 5E0HA 2FEQH 4IS5A 2TBSA 3FFGA 2QCYA 4UE7H 1ELGA 1O3HA 1ZRKA 1GL0E 1EX3A 1RGQA 1CO7E 1DY9A 1XUKA 1O34A 2F9NA 3MNXA 1CT0E 3GY6A 5EXNA 1QA0A 1C5YB 5DP8A 2NU1E 1NRNH 2W26A 3F9HA 3ZVDA 1H8DH 2FPZA 4K1SA 2Y80A 1V2JT 1CE5A 1YKTA 1F5LA 1MTSA 1YPMH 3BN9A 4TSFD 1W2KH 1GBCA 3A8CA 1GWAA 3MNSA 3SV8A 4D8NA 2HNTC 1D4PB 2BZAA 2YMSC 1FY5A 1GHBF 3AW0A 3HK6B 4OM9A 3M5MA 1O2PA 3QWCH 1O2JA 1CBWC 3D62A 1Z8JB 1KMHB 1HAXB 3F9EA 1GCTB 3RXAA 2O8UA 4WJG2 3SNBA 4GUXA 7GCHF 2J9NA 3E3TA 1AD8H 2J4IA 5C5OA 2QYIA 5TJXA 5JPMH 3VGCC 2VIQA 2PLXA 1VCWA 5JBBS 4HZHA 4Z0KA 2WYGA 4TPYA 5E8EH 5FBEA 2STAE 1HJAC 1AN1E 2BMGB 1S84A 4SGAE 3LKWA 4DVAU 1GHVH 3VXFH 1Y3VA 1BMMH 3R3GB 2H9TH 4FUCA 5FHTA 1HAGE 1MTNB 1GI4A 1HJ9A 2ZHQH 2KAIA 1C2MA 2JJ2D 3ZV9A 1O3IA 2OC1A 2J38A 1AE8H 2KAIB 2EI8A 1SSXA 1H9LB 1V3XA 1GJBB 3ZZ9A 5HGGA 3W1EA 4YOIA 2LELA 2AHME 3SU1A 1AMHA 1C5WB 3DA9B 1SQOA 3O8CA 3N7EA 2FOFA 1ZJKA 5CHAB 2HPPH 2W7UA 3LONA 1GI1A 1JIRA 4NIYA 1OP2A 3RU4E 1KDQA 1GHZA 2FI3E 3V13A 2YNBA 1GHBG 1O5CB 1ZR0A 4UFGH 4B76A 2XNDD 4FETA 2QAAA 4MNYA 1P2IA 5C5NA 2H6MA 1NBMD 2DUCA 2AMQA 3QTOH 1WQVH 3QK1A 3SBKA 2XCNA 3E91A 2Z7FE 3NCLA 5IK2D 1RRKA 3GY5A 3ZVCA 5GIBA 4SGBE 7GCHG 2QV1A 3E1XB 4WXIA 5FPTA 1THSH 2A4OA 1KLJH 1UK2A 2SGDE 3BTGE 4X0WU 5JDUB 1BBRH 3KQEA 1GJAB 1ABJH 3A7YA 1TX6A 1O2RA 5C0UA 1XX9A 4A1TA 1OWDA 1V2NT 1NRPH 4IW4E 4RKJB 1THPB 3A7XA 1ZMNA 3ZZ3A 1S85A 1UCYK 1MTWA 5DP3A 2FOEA 1OPHB 5EQQA 2HLDD 1PPZA 3P8GA 1A7SA 3RXOA 1YCPM 4FUDA 1NFWA 2VWOA 4M9FA 1SGEE 1SGPE 3SO3A 4K3JA 5FXLA 2WZQA 3BEFB 1MAXA 1EATA 2HOBA 3P92A 1ELTA 1UVUH 1GG6B 3VB5A 4ISOA 4DT4A 2QF5A 1H9HE 8ESTE 4YZUA 1ZLRA 1G9IE 1ZHMA 1DITH 2W3IA 4MNWA 2JH0D 2W5EA 4X6MA 2BLWA 1A0JA 1NM6A 2QXJA 3TITA 2B9LA 1O31A 3ZZCA 5B6LA 1A46H 3RM0H 3PMAB 5JB8S 1IQLA 1YGCH 3DSPA 1ZMLA 2WPIS 1UVOA 4JYTA 5L6NH 2VH0A 1HUTH 5DGJA 4E05H 1YPHE 1ANBA 5AFZH 1TGBA 1TPPA 1HV7A 1GBHA 3ELAH 2OCVB 3TH2H 4Q7ZA 1GMDF 1BTHH 2FP7B 2O8WA 1BTWA 2BVSH 3A7WA 1BTXA 1LVYA 1V2TT 1WQSA 4RI0A 1V2WT 1VJAU 1OWJA 4IMZA 4B73A 1GJDB 1QA7A 3OTJE 1CT4E 1PPEE 3KL6A 4U30A 3GOVB 2BVRH 3LGVA 3P8NA 3ZZ8A 2M2AA 1AQ7A 1K9OE 4AG1A 1P06A 1TPOA 1S81A 1SQAA 5A0BA 2V7QD 1O2KA 2F4LA 4DOQA 4I8LA 2A2XH 1Z71A 3M37A 1XKAC 3M5LA 3SU5A 1ZPZA 1C2EA 2FMJA 3G01A 3ZZ7A 1E35B 1F2SE 1C5VA 5DP5A 4X8UH 2Q6FA 4RSPA 2WUCA 2GT8A 4OS2A 1ARCA 1Y3UA 3MU4A 1GHAF 3SQHE 3GISB 1A0LA 3T62A 1O2VA 2ZQ2A 2W7SA 1MU6B 2CJIA 4O03A 1RTKA 5PTPA 1BUIA 6CHAC 1QB6A 1TBQH 5EW1H 1EKBB 1UTQA 3U1IB 1Y8TA 2K1QA 1VITH 4Y8YA 1ESTA 4F4OC 1O2LA 2Y81A 1DY8A 5K0HA 1C4Y2 3H7OA 2XBXA 2WPHS 2ZC9H 3SGAE 1UTPA 3ATWA 1QURH 2PGBB 3LGWA 3UY9A 3RP2A 1FDPA 1P9SA 1UJ1A 2Q1JA 4Y76A 3MU8A 1O5AB 3LPRA 2Z3CA 5HKKD 1O3AA 2EI6A 4ISHH 2PHBA 3CENA 3ZVEA 1ABIH 3F2GA 5J4SA 1N8OB 2G00A 1V2QT 4I8GA 2ZPQA 1EXFA 1V2VT 3LU9B 1B7XB 1Z1JA 1EPTA 3SV6A 1Y3XA 3RDZA 3DCLA 3SW2B 3P8FA 3RU4D 1GDNA 1O33A 1Z8IB 4ZKSU 5I25A 1A3BH 1AVWA 2BDAA 2ODQA 5LPRA 2SGAA 1GCTC 1OXGA 4AB8A 1BITA 3A81A 4AN7A 4A6LA 3L3TA 5CHBA 1KLIH 3VB3A 1YPEH 1YC0A 1MMJN 3QUMP 2OQ5A 3OY5U 3S0NA 2FWWA 1BRAA 2H5DA 1QRXA 2WUBA 1FONA 4WMFA 2BDHA 3T5FH 1KLTA 1L2EA 4MPWA 1W0JD 5GNDA 2GCTB 1GHAG 5ETXA 4B6EA 2GP9B 2TGTA 3A87A 1O3BA 2HALA 2EC9H 3NRLA 4Y6DA 4DW2U 2BD7A 1ELVA 2FOCA 1N6XA 1VR1H 1MTNC 2HPQH 2VWLA 4RKOB 1TLDA 1YBWA 1UCYH 3M5OA 3S9BA 4Y71A 4A5TS 2R0LA 2THFB 1YPKH 4ISNA 1GVLA 1ANDA 5DK1A 3LJOA 4WH8A 1BTUA 1SLUB 1HAZB 1BTPA 1DWDH 1C5PA 3ODFA 2BVXH 1DWEH 2PGQB 1UTLM 1E1RD 1TPSA 4Y79A 4GAWA 5L2YH 4J1YA 4DJZB 1ETTH 1SR5C 1RFNA 3T2NA 2Z3EA 2VIDA 4ZMAH 2XBYA 1O0DH 1CGIE 1XUJA 2A0QB 2G55A 4JCNA 3SUDA 1DX5M 3NXPA 3ESTA 2QN5T 1TONA 2AIQA 2BY6X 5FCKA 1MTUA 1CVWH 5ESBA 1MCTA 4ABAA 5F03A 1XM1A 3Q00A 4GHQA 2R0KA 1ARBA 2BY7X 2PUQH 4AGJA 1U6QA 2B7DH 5GDSH 1IQHA 1TB6H 4NIVA 5AFYH 1UVTH 1PPBH 2CGAA 3T27A 3U8TH 4A92A 1WTHD 1F7ZA 1AZ8A 1C1PA 2B8OH 3OE7D 1E34B 3TU7H 4JZ1A 2FESH 4OS1A 2BDYA 3UQVA 2VU8E 1EZSC 2C8YB 3ZZ5A 1AFQB 1EJMA 3A80A 1P02A 1WUNH 3BTQE 3RMMH 5CDFE 4ABBA 1S82A 2OXSA 2FI4E 1XVOA 1AUJA 1C2IA 3MU5A 2TGAA 1Z8GA 2ZHFH 1AO5A 2ZGBH 1BRUP 2D1JA 1OYTH 5JBCS 1FXYA 4AFUA 1GG6C 1P05A 4TY7A 2XC5A 1J16A 1GI5A 2H2ZA 2D26C 1G3DA 1BBRE 2FOBA 3A84A 1OWEA 4HGCA 1AVGH 1K1OA 1AI8H 1P3EA 2TGPZ 1PYTD 1GMCF 5AHGH 1P2QA 3B9FH 2TGDA 4XOJA 1LVOA 4E7RG 8LPRA 1W0KD 5T1VA 3I78A 4MPUA 3UOPA 2ASUB 6GCHF 4YLUA 4JZFH 4X1RU 3RXUA 1DVAH 3R0FA 3RMLH 5C1XA 1SOZA 5FX5A 3RXPA 2M5TA 4UONA 4GHTA 3NK8A 1FAXA 5JYIA 1P2NA 4MQAA 1C5SA 1VZQH 1V2KT 1SHYA 3UR9A 5EPNA 1INCA 1GI8B 1FN8A 1MQ6A 3EA8A 4BTIB 1WU1A 2PKSB 3T26A 1ZGIA 1HAVA 1NBME 4K1EA 1FY3A 4B6FA 3LGUA 1UTNA 4TYDA 3F68H 3CS7A 2PKAA 1LHFH 3D23A 3UREA 4D7GA 2Z9KA 5GJ4B 2PKAB 2ALVA 1WSSH 1FUJA 1P2MA 5EXLA 2JH6D 2GDDA 1PPFE 5C1UA 3ITIA 2ZWLH 2JKHA 4AFZA 1HDTH 2VB0A 3C27B 5C0TA 2FOMB 4YESB 3SU0A 1ZZZA 3ATIA 5HXFA 1HLTH 2BB4A 1FIZA 1LHDH 4AX9H 1HAIH 1O3NA 3BG4B 1HB0B 1BMAA 1TALA 2ZCLP 2G81E 4NSYA 1GBTA 1MKWK 1TOMH 3TLOA 3A8AA 2GZ8A 2SNVA 2IN2A 4THNH 3EA9A 3F6UH 3HATH 3MNBA 4FXGH 4D7FA 3UNSA 4INKA 1GMCG 1TNGA 3URDA 3ZZDA 2O8TA 1TOCB 6GCHG 1GI9B 1CSOE 1QY6A 2C8ZB 4TPIZ 4O9VA 2GV7A 3TGIE 3F2FA 3ZIAD 2ZGHA 4M7GA 4OS5A 1UK4A 2P94A 1SGTA 2BY5X 3WW7A 2P8OB 4A1XA 3P70B 1N8OC 1OYQA 2PSXA 4AG2A 3BV9B 3BTWE 4DT7B 1S0RA 3ZVAA 1LPKB 1HAOH 3DUXH 1JIMA 1J8AA 1SFIA 4CH8B 3FZZA 2GKVE 1IHTH 4XSKU 4I8KA 2ZU3A 1IQFA 2CF9H 3A7ZA 3N7DA 1B0FA 2ZKSA 2ZFRH 1SGFG 3L33A 3RLYH 4UDWH 2H5CA 3OU0A 2FZZA 3KIDU 1W0YH 1HRTH 1EAWA 3AAUA 3SUFA 1F92A 5DO4H 2UWLA 1BHXF 4F49A 4NGAH 4DCDA 4ABGA 2BY8X 2J94A 2OC8A 1OWHA 1FI8A 1C5UA 1MZAA 3LC3A 1T4VH 3TIUA 4BTTB 5I46H 3ZYDA 1QTFA 4ABEA 2AGIX 5T6GA 3B8JA 4WMEA 1O3FA 1C9PA 2GCTC 3GY7A 5C2ZA 1C5TA 1E36B 2CMYA 1BA8B 2HRVA 4B71A 1TNHA 3TJNA 1QIXB 1IQIA 2O8MA 3VG8A 3MO3A 3PMJA 5EU8A 4CH2B 4KGAA 2C4FH 2FTLE 2G8TA 3QGJA 2BDGA 2QY0B 2FDAA 3NKKA 2WYJA 3PO1B 2ZI2H 3GCHB 4NSVA 4XBDA 3GY4A 1XUIA 1OWIA 4X2WA 1EB2A 3FP8E 1QL8A 1S6FA 1ZPCA 2KR7A