2OBOA

Structure of hepatitis c viral ns3 protease domain complexed with ns4a peptide and ketoamide sch476776
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
184
structure length
184
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 protease
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 39
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oboA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oboA01
1OKXA 4A6LA 2AMQA 3MNXA 4F49A 4NCYA 1AQ7A 2GZ8A 2FLRH 2XCNA 1HXFH 3TK5A 1ANBA 3QTOH 2ZPQA 2J2UA 3RXFA 2ZQ2A 3ITIA 1N8OB 2GZ9A 1ELVA 3UQOA 1SR5C 2FX6A 1K1LA 3K6ZA 3RXLA 3UPEA 1UVPA 1GBMA 3UWIA 1W13U 2EI6A 1FN6A 3BN9A 1HAYB 4YT6H 2NU3E 2VVUA 3KEEA 1O30A 1DWDH 1O3JA 1C1TA 4NWKA 4RKJB 5C5OA 4BAMB 3BSQA 3F6UH 1GJCB 7GCHF 1J17T 1EUFA 3TGIE 1ELTA 1WV7H 1KY9A 2VIPA 3MO6A 1TGBA 5CE1A 3HK3B 4NA9H 1SB1H 4BAKB 2AERH 1TABE 1XUJA 1GBAA 4TWYA 4YOIA 5L6NH 3D23A 3QO6A 4F4OC 1GPZA 4UDWH 2BXTH 1ZHMA 1AFQB 1GBBA 3CS7A 2R9PA 4ZXXH 5E8EH 2NWNA 2OLGA 3A7WA 1BBRE 3LOXA 1O2VA 1Z1IA 1CU1A 3FZDA 4YOGA 1C5SA 5F8TA 1G3EA 2P3TB 1KYNA 1P05A 2VIVA 1CA0B 2C8XB 2GD4B 3PTNA 1QNJA 3O8CA 3S9CA 6CHAC 1WYKA 2D8WA 2ZFSA 1P3CA 2PTCE 2ZIQH 2QIQA 1BRUP 2ZG0H 3CP7A 5AFYH 3AAVA 1KLIH 3MNCA 4X1RU 5SGAE 2BD2A 1Y5AT 3RM2H 2OC0A 2BVSH 1EB2A 1H9IE 5DG6A 1GGDB 2EI8A 1TALA 3U8TH 1OP2A 4I8HA 3F9EA 3RXDA 1DPOA 5JPMH 3LIWA 4IS5A 5EQQA 3BTDE 2ZGHA 1XMNB 3KQCA 2A5AA 2Z3EA 3LKWA 2H5DA 4JYTA 4MG3A 2Q6GA 3DA9B 3ZVBA 5GDSH 1MKWK 5CHAB 3RXVA 4AGJA 1PYTD 4K60A 1D3PB 2O9QA 2V35A 3RP2A 3A8CA 2FOMB 4CHAC 1AO5A 2VIQA 1K1PA 1C1VH 2A4OA 2AYWA 1GHAG 1Y59T 2BD7A 1BRBE 3E16B 4X8SH 3PLKA 1TPPA 4NIWA 4UE7H 1TNKA 2O8MA 1CT4E 4ABBA 3SYJA 2PTNA 1TA6A 1C9PA 3PO1C 3E91A 1FPHH 1SQAA 3V0XA 3OU0A 1TONA 3MTYA 4LXBH 1GCDA 1GCTC 1HXEH 1C1WH 1ZSLA 3MU0A 4MPUA 2WUBA 3MMGA 3VB3A 1QJ7B 1BMMH 1SGFG 4K1TA 8ESTE 3LH1A 4K2YA 3RMMH 3SO3A 1FY8E 3GDUA 3MHWU 3SJ9A 1FAXA 2CF9H 1QBOA 1EPTB 3E90B 1F0TA 3MH6A 1QJ1B 3RM0H 3P8GA 1HJ9A 1MCTA 1PJPA 1AB9C 2STAE 1C1UH 1GBDA 5I46H 1AVWA 3VPKA 1V3XA 3SU1A 5JB8S 1V6DA 1TGCA 4B6EA 1K2I1 1MU8B 4MNYA 2TPIZ 2BDGA 4GAWA 1H1BA 1O2NA 2GZ7A 2A4GA 5FPSA 1TGTA 3T2NA 5L2ZH 4AYYB 1S5SA 4K8BA 4JZIA 2IJD1 3PLPA 2EI7A 1BMAA 1E36B 1GHWH 2OD3B 1NM6A 1D4PB 4I32A 1HB0B 3ZZCA 2B8OH 3BEUA 4O03A 2VGCB 1GDUA 4CRCA 5GPIB 2Y7XA 5IYTA 2ZDNA 4Z6AH 3P95A 2BDAA 3BTTE 3BTHE 2GT8A 1EAIA 1IQMA 1C4U2 4AORA 2OCVB 1MBMA 3MU1A 1J8AA 4YOJA 5EQSA 1Y3VA 4FUHA 2P93A 1SGIB 2BQ6B 2SNWA 3HGPA 2THFB 4B1TA 4CBNA 2BHGA 2BQWB 1W7XH 1IQHA 1EJAA 2O8TA 2XWAA 3T5FH 5FAHA 3E1XB 5DPAA 1VITF 1GBKA 1PFXC 2P95A 4PROA 2FS9A 4KKDA 4E7NA 3ZVEA 1O2JA 3GY2A 1HAHH 1OWHA 3DUXH 3GY3A 4CH2B 1K1JA 1TBZH 1O35A 4K1SA 1B7XB 1NPMA 3UQVA 2ZA5A 4ZKSU 1O5BB 1A46H 3BTGE 1EP6A 1KIGH 2FDAA 2VNTA 2HOBA 5EXLA 3STJA 2WV4A 3SGAE 7ESTE 4OS7A 1T8NA 3VB5A 4Y10E 1EP5A 3EGKH 3RXBA 4GCHF 4Y7BA 3K2UA 2ZDKA 1WSSH 1GI4A 2R0KA 1ANDA 2DUCA 1NT1A 2FI5E 1UTQA 3TNTA 2BXUH 3GY8A 1O33A 2P3FH 3MNSA 1A4WH 3BEIB 3L3TA 4BTTB 3M3TA 1JIRA 3BIVH 1MD8A 1NO9H 2SGAA 1DX5M 2FX4A 4ZXYH 4X2XA 5GIBA 2FOFA 1KXAA 1VCWA 4BXSA 3SI3H 1QL9A 1QJ6B 3SQHE 2GMTC 5FX6A 1HAPH 1GI2A 1CBWB 4MQAA 3SU0A 3SU3A 1TPOA 1D3TB 3RXEA 4IN2A 1O2PA 2TGAA 4Y0YE 5EG4A 2Q6FA 1QURH 4XDEA 2FI3E 1LDTT 1N6XA 1INCA 2XC5A 3SGBE 1GMHG 5C2ZA 2UWLA 5DJ7A 2A45B 1NESE 2OTVA 1ETSH 1SLVB 5FX5A 1UTLM 3K6YA 2VWLA 2UUYA 2Y6TA 1W11U 1CGJE 5C1YA 1BTYA 1PQ8A 2ODPA 3AAUA 3O8RA 3GYMA 1HPGA 2BYAX 3SV7A 3DHKH 5CMXH 1MTVA 1V2TT 1HAOH 1GJAB 3ATLA 3VB4A 4DIHH 2W3KA 1P04A 1ETRH 3B23B 4FUJA 1O5CB 2VH6A 3VGCB 1LPGB 3P17H 5LPEA 4B2AA 2G81E 1O2MA 4ZHAA 3PMAB 2H5CA 1O3NA 4Y7AA 2CMYA 1C2FA 1NRNH 2QV1A 4ZKNU 3ZZ5A 3A88A 3GCTF 5LPFA 2FS8A 1Z8GA 1YPEH 1AE8H 4A92A 1F5RA 4X1NU 1G37A 3UIRA 1WCZA 1WXRA 1HIAA 3LC5A 4WH6A 2VJ1A 4RKOB 1D3DB 1A0LA 1HAVB 3BF6H 4ISHH 3SBKA 3BTWE 2FM2A 4KTCA 3RXTA 1QGFA 3TGKE 2AFQB 1MBQA 1QL7A 1QFKH 1RJXB 1TYNA 3K9XB 4YO9A 1C5LH 1QQUA 4WMDA 4JZEH 1AN1E 1O3HA 2XNIA 1ARBA 1SOZA 4AB8A 4ZAEA 1BOQA 3A85A 2NU0E 3ZV8A 1UHBA 2QXJA 3FP7E 1AKSA 1GVZA 1IHTH 1NS3A 1GMDG 1OXGA 2ZGBH 3EQ0H 1O3PB 1CT0E 1C5MD 1ZOMA 1EATA 4FUCA 1GBFA 1PQ7A 4HTCH 2J38A 1EQ9A 1YLDA 2H9HA 1SGNE 2C90B 3NWUA 2R3UA 1LMWB 1H8IH 4KP0A 1V2MT 1ZJKA 2D1JA 1TX8A 3RXIA 3B9FH 4NGAH 4IMQA 2BOKA 4UD9H 5JBTA 4WMFA 2BVRH 4RI0A 1EX3A 2LPRA 1DY8A 2BOHB 3ELAH 3U1JB 3SJOA 2UUKB 3UOUA 1MH0A 3I29A 1P57B 3SNBA 1P2JA 1EOJA 2FODA 1VGCC 1LQEA 1P0SH 5FCKA 1ZPBA 5EXMA 3A8AA 3RXKA 4D7FA 3H7OA 3OY5U 3QDZB 1HAZB 1O3DA 4ABAA 1KLTA 4NSYA 1XXFA 2BY6X 5A8YA 1PPHE 3UNRA 2CF8H 1DLKB 3F9GA 2ZCLP 1HBTH 3LGWA 4IMZA 2H6MA 1DOJA 2SGDE 5A2MH 1C2EA 2SGPE 3AK5A 3TK6A 1NU7B 3SU6A 3LC3A 4K5ZA 2C93B 2ZC9H 4ZUHA 1J15A 2Y82A 3LGVA 1FY5A 1AZZA 1LHFH 2CHAB 2QXIA 3EAJA 1P06A 1MTUA 1GBHA 1QRXA 1W0ZU 4A1TA 1F2SE 3PB1E 3RXUA 4D9RA 2A5KA 4E05H 3RXPA 3FZZA 1GVKB 1CE5A 1HAIH 4JMYA 3KNXA 3QN7A 1VJAU 2KAIB 5A09A 1O3BA 3V12A 3D49H 1ABIH 5EU8A 1YCPH 1P2OA 1EAXA 4FVDA 1LO6A 2W7UA 4DY7B 3F68H 4O3TA 4B2CA 1AFQC 5TCAA 1AGJA 1DUAA 5EPNA 4MNXA 3RLYH 1A3BH 1OYTH 4Y76A 4YM9A 1GHAF 1TMUH 3KF2A 4D9QA 1JRSA 4SGBE 4CRDA 1TE0A 1BMLA 1W12U 3QZRA 2A2QH 1CA0C 2ZF0H 5DO4H 1BQYA 1QCPA 4RN6A 2ZTZA 1QA7A 1UVUH 1WUNH 1O2OA 3RXCA 3PMJA 3VFEA 1AHTH 2ZDAH 4O3UA 2R2WU 3U69H 4U01A 1OWIA 1G30B 2QGRA 1TA2A 1TBRH 1BTHH 3ODDA 5DP4A 5T1VA 1UVSH 1Y3WA 4H4FA 4LK4A 4FUBA 3MH7A 1HUTH 1PPBH 2JH0D 2ZI2H 4NWLA 1PPGE 4Y79A 1S6HA 5F8ZA 2YNAA 2VWMA 1DWEH 3A83A 1GJ5H 2V0BA 2FI4E 2G4UA 2XBVA 4XBBA 1YCPK 2GCTB 1BMNH 1DS2E 1T8LA 2BY9X 3GY5A 3TH3H 2ZEBA 1SL3A 4MPVA 1C2IA 1S81A 1O5AB 5CHAC 3NPSA 5FXLA 1IQNA 5EQRA 1LCYA 4NA7A 1A0JA 1JRTA 1P9UA 1MCVA 4AX9H 4U2WA 2ZGXH 4XBDA 2HLCA 4FU8A 5FCRA 3A7VA 2ASUB 1T32A 2C8YB 1VZQH 2GT7A 1XUFA 2ZFRH 2ZHWH 1FV9A 4DW2U 2BDBA 2PUQH 3I78A 1BJUA 4BOHA 3SV9A 5DP7A 4INLA 4GVUA 1RTFB 3NZIA 5JBBS 1ANEA 1P2MA 5AF9H 1O32A 2AEIH 5FPYA 3ESTA 5DP3A 4AFUA 1F0SA 1S85A 3QZQA 1K22H 2Y5FA 1SFQB 2B0FA 1L1GA 1TNGA 1GJ8B 2W7SA 2ESTE 5C5NA 6LPRA 2PKSB 2B5TB 3BEFB 3RXRA 3PWCA 4MNWA 1ESTA 1GBEA 4FUFA 5DP6A 3OTPA 2WHXA 4DT7B 1CQQA 1RFNA 3G01A 2HPPH 1LVMA 3A8DA 1AUJA 1C4V2 1G3DA 1WAYB 4X6OA 1QL8A 2UUJB 5J4QA 3STIA 1A3EH 1SGCA 5HYOA 1P11E 4HZHA 3RC4A 2PWXA 1O39A 2EC9H 5IDKA 1THPB 3E3TA 2SGEE 1CHOF 1W2KH 4CRFA 4OS5A 1D6RA 1QRZA 5AVDA 1ARCA 2F9NA 1DSTA 4VGCB 3L33A 1Y5BT 3ZZ8A 4Y0ZE 1RIWB 2BMGB 1WTHD 3FANA 1ETTH 2ZCKP 2ANMH 1SBWA 1CGIE 1BDAA 2CJIA 3NKKA 2WV5A 4BANB 2VGCC 2Q6DA 1HNEE 4DVAU 4Y8YA 3SORA 2ZTXA 3RXSA 2ZU3A 1K1IA 2QCYA 1LVOA 1SHHB 1RGQA 1IOEA 1W14U 1GI6A 1O2SA 2SGFE 1QTFA 1TX7A 1C5NH 3Q76A 3GY4A 2VH0A 2FPZA 4X8UH 1NRSH 3M7UA 1LKAA 2WV9A 3GDSA 1QY6A 2C8WB 1ANCA 1DUEA 2FLBH 4K8YA 1MTSA 2WUCA 5A0AE 1O5EH 1TGSZ 3RXJA 4FXGH 4AOQA 2RA0A 5EODA 1AIXH 1O3OA 1SMFE 4A5TS 1O0DH 2G5VA 1MTNC 2BY8X 2UWPA 1G3CA 2ZFTA 2SFAA 2FOAA 3A8BA 3URDA 3E0PB 1GHXH 4ABGA 1HFDA 4RSPA 4NA8A 4R0IA 2C4FH 2R3YA 4AG2A 1AVXA 4XOJA 1Z6JH 1YPHE 1C2HA 1EB1H 1GMHF 1E38B 1PQAA 3AVZA 3K65B 2ZU5A 2Z9JA 1L1JA 1XX9A 4MVNA 1JXPA 2ZZUH 1SGTA 1OYQA 1Q3XA 3A80A 2Z3DA 3H09A 2GDEH 1C2DA 3ODFA 3QK1A 3BG4B 2JH6D 1MZAA 1O34A 2G5NA 2CGAA 3SZEA 3A84A 4AFQA 4MNVA 4CREA 3QUMP 1DICA 5H4IB 5FPTA 1FNIA 1GBTA 1Y3YA 1ZHPA 1LHEH 1BTZA 1RS0A 5GNDA 4B6FA 1KTSB 1EKBB 3FVFB 4OS1A 1KXBA 4TPYA 1BBRH 3OTJE 1UK2A 1IQGA 2ZDVH 4Y11E 3O8DA 4DG4A 1V2OT 3IITA 1FY4A 3ATKA 2HVXA 5DP9A 2WPHS 3ZZBA 4Y71A 1L4DA 4NG9H 1CBWC 2NU1E 1FY3A 3LT3A 2HNTE 4ZMAH 1ZGIA 2K1QA 1O2RA 3TLOA 4H6TA 2B9LA 3SU5A 4YESB 4Z0KA 5HMAA 1M9UA 1T8MA 2XWBI 3DT0H 3CENA 3QTVH 3SNDA 3TK9A 1FZZA 1TMTH 3A82A 1TNJA 1TRYA 1Z7KA 1HJAB 1DE7H 1HV7A 3F1SB 4GHQA 2XC4A 5LGOA 3LH3A 4I8GA 2ZDLA 1CVWH 2FTMA 1AWFH 1W3CA 1LVYA 1SPJA 3GCHC 2A5IA 3P70B 2IJOB 5JDUB 1GI1A 2GDDA 2ZO3H 5C1UA 1E34B 1Y3XA 1GMDF 4B74A 1C1NA 1K28D 4WJG2 3R3GB 3HATH 2TGDA 4AB9A 1BBRK 2ZGCA 3VGCC 3MH5A 2PGQB 3EA9A 3RXMA 1EZSC 2HALA 4DURA 3HGNA 1ELDE 4OM9A 3SUDA 1HLTH 3GYLB 1K21H 2ZWLH 1DDJA 2I6SA 2ZKSA 3EE0B 1ZTLA 2WINI 2VVCA 1DFPA 4TWWA 1F5KU 3RU4T 2OP9A 1AWHB 4UONA 2ANKH 4GPGA 1YCPM 1BRAA 1JIMA 4X6NA 1QBVH 1C5OH 1G2MA 1P10A 2BLVA 1W8BH 3U98H 3LDXH 1A5GH 4UEHH 2BZ6H 1HAGE 2O8UA 1PQ5A 3SUFA 5DKMA 5T3HA 4CRAA 1EZUC 1C2JA 1O3LA 2D26C 5C1XA 4FUDA 2PHBA 2AGIX 3BV9B 1Q31A 2GGVB 1P9SA 1C5XB 1XUGA 1O5FH 3PLBA 4IC5A 3W94A 4I8JA 1S0RA 1P09A 1F92A 2BX4A 3M5MA 4Q80A 4X1SU 3SQEE 4GHTA 4ABEA 1GHYH 1O37A 2QYIA 2HNTF 1XVMA 2ZPSA 1C5RA 1OP0A 1O3GA 1VCQA 1YPLH 1V2UT 4ZKRU 2IOTA 2XBYA 3SUGA 1HAVA 5L30H 1BZXE 3KCGH 2ZHQH 1B5GH 2BY7X 2OBOA 1AY6H 1LQDB 1O2GH 1W7GH 1T4VH 1S82A 1TIOA 1HGTH 3PV2A 1VR1H 2P8OC 1THRH 4LZ1H 2OXSA 2EEKA 1MTWA 4K69A 2BDIA 3KQEA 3BG8A 3IWMA 1SI5H 4YTAA 1KDQB 1LHDH 1ZJDA 5DK1A 2FOEA 3Q3YA 1FJSA 4J1YA 1AB9B 4INHA 4ISIH 1S6FA 4AYVB 4IW4E 4MTBA 2WPJS 1SGFA 1T4UH 3ZVAA 4CH8B 1O3AA 1ZRKA 2H9TH 3LGUA 4BTIB 4GSOA 2I6QA 3SJKA 3ZZ4A 1NN6A 1O31A 2VWNA 3M3VA 3TU7H 2A32A 2WYGA 1BCUH 4KELA 2V3OH 2CHAC 5ESTE 5EXNA 3E6PH 3U8OH 1AE5A 1Z8RA 3MU5A 3Q3XA 3FP8E 1TWXB 4I8KA 2ZPRA 1ZSJA 1G9IE 3T62A 5K0HA 2V3HH 1HCGA 2BZAA 2JKHA 3TJOA 2PV9B 4MDSA 1SQTA 1FPCH 1QRWA 4ISOA 4BAQB 2FOGA 1NZQH 1TFXA 4I8LA 5I25A 1C5QA 3ZYEA 2ZFQH 2Z9IA 5F6MA 2WPMS 1KXFA 1BJVA 1QR3E 1JBUH 3BTKE 5E0HA 1GI9B 3P92A 1MUEB 4Y8XA 1O3KA 2J4IA 3RXQA 1AD8H 1O5GH 1GJ9B 4U32A 1GMCG 3UY9A 5T6FA 1NFUA 3ZVGA 1HYLA 3NUMA 3TVJB 5C3NA 1JWTA 1H9HE 3UNSA 3W95A 1ZZZA 4D7GA 2C3SA 4H6SB 5T6GA 3SI4H 1SLUB 1DVAH 5A0BA 1YF4A 4IGDA 4A7IB 3FP6E 2VIOA 1HDTH 1GJBB 2A1DB 2ZP0H 4AFSA 1DSUA 1VJ9U 1ZRBA 4MLFB 5GJ4B 1K1OA 1GG6C 2AH4X 2BTCE 8GCHG 1A0HB 2GCTC 3D65E 1AVGH 3OYPA 1F0UA 1WBGB 1FXYA 1QBNA 2FMJA 1EZXC 4UFDH 3RMNH 3A7ZA 3VXEH 1P3EA 4WH8A 3E0NB 1BTPA 2BD8A 4LOYH 4DIIH 2J95A 2CN0H 5K7RA 1NTPA 1ELBA 1TNIA 2OQ5A 1L4ZA 3NK8A 1LPZB 1DWCH 2BVXH 2O8WA 3JZ2B 1VITG 1ID5H 3DFJA 1BTWA 4X8TH 3ZVFA 2WYJA 2A0QB 1DXPA 2FTLE 2GMTB 3NCLA 2AMDA 1UVOA 1YM0A 3ZV9A 3MFJA 2D2DA 2ZTYA 4GUXA 3RC6A 2A7HA 3SV6A 3S7KB 1Z1JA 4ASHA 3SV2H 8KME2 4KTUA 1N8OC 4I33A 1OWJA 1WQVH 1ZR0A 4ZROA 1W0YH 2OBQA 3SHCH 1KTTB 3BTQE 1SQOA 4YLUA 5EW1H 1SG8B 1MU6B 2FESH 1UTKA 1P2IA 3LGTA 1V2WT 1AFEH 1FONA 1GDQA 4WMEA 1LHCH 1O2KA 2STBE 4XSKU 5GWZA 2ZECA 1F7ZA 2PSYA 2WPIS 3PROA 4MPXA 1FUJA 1FI8A 1MD7A 3BIUH 4NFEA 1C1OA 3PYHA 1P01A 1GBIA 4B73A 2GX4A 3KQBA 3PV4A 3T26A 1C5UA 4Q7XA 5LH8A 3MO9A 1E35B 4JYUH 4AGKA 1TMBH 4BAHB 1JOUB 1GDNA 5ESBA 1AUTC 1AKSB 1ZHRA 4UFFH 2A2XH 3UOPA 1QA0A 2FEQH 3A89A 4FU7A 5C20A 2Z7FE 5JB9S 1SGDE 1WTGH 2ZFFH 3PWBA 1AI8H 2PKAB 3TIUA 4BNRA 1ZPZA 3RU4D 4YZUA 1GBLA 2OINA 1TRMA 3KHVA 1O5DH 1PPEE 5E2PA 2FOHA 2XC0A 1T7CA 5BPEA 3UFAA 1J16A 1BIOA 1GGDC 2BDYA 3HPTB 1GI5A 2W3IA 1KSNA 3TH4H 3ZYDA 1H8DH 3TJUA 2A4RA 1XKBC 1XUKA 2F4LA 1FIWA 2F9OA 5ABWA 3SNCA 1GHVH 2OC7A 2W5EA 3DFLA 1PPZA 1UTJA 2B7DH 3MWIU 5A8ZA 3ATIA 2BDHA 5JBCS 3T27A 2FYRA 1KXDA 3F9HA 1TOCB 1UTPA 5AHGH 5T6DA 3UR9A 2GV6A 2ULLA 3SU2A 3S0NA 2FWWA 3URCA 1G2LA 3F9FA 5GCHG 4JCNA 2QXHA 1E37B 1YBWA 2G4TA 2F9PA 1C5YB 1L2EA 1A5HA 1NRPH 2BQ7B 1SC8U 1BITA 1TQ0B 2Q1JA 2GVFA 4NIYA 3AASA 3S7HB 3KIDU 2GKVE 4D76A 3M7QA 1A5IA 3EA7A 2FZZA 3I77A 3UTUH 1FMGA 4ABJA 5E0JA 2F91A 3BG4C 2AGEX 2J92A 1F0RA 3U8RH 1QQ4A 2JETB 1DITH 3EDXB 1OWKA 3BTEE 4NIXA 2GP9B 4FUEA 2FOBA 1GI8B 1EPTC 2Y7ZA 5AFZH 4AG1A 1IQJA 1TQ7B 1SGRE 2VU8E 3S9AA 3S9BA 3RMOH 1GJ7B 2HGTH 5LPRA 1XKAC 2XRCA 1ORFA 3A86A 1SGEE 2VVVA 4FUGA 1O2IA 1RD3B 2VINA 5E0GA 1UMAH 1C5TA 3WY8A 2BD3A 3RXAA 4HGCA 1DXWA 3R0FA 3LGYA 1UO6A 1YC0A 4WF8A 4UFGH 3V3MA 3HKJB 1YGCH 1WU1A 1QB6A 1O2LA 1HJAC 1YPKH 2OUAA 4CRGA 1SHYA 3M5NA 3MH4A 1Z71A 4MPWA 2P59A 1K1MA 2RG3A 4HFPB 2GCHG 4JZFH 1K1NA 3QWCH 4DCDA 1SFIA 1ZYOA 2ZHDA 1S0QA 1J14A 1GJ4H 1W10U 1EPTA 4WXIA 1DWBH 6GCHG 1MKWH 1AU8A 1P03A 1OOKB 2XXLA 2ZU2A 7LPRA 1C1RA 3EA8A 4ABIA 1ZMLA 3TJVA 1P2KA 4SGAE 3IG6B 4BTUB 1TOMH 3P6ZB 1DLEA 2Z94A 1TX6A 2J34A 1ELFA 2BY5X 2WPKS 2W26A 3HK6B 2VB0A 3LONA 5EW2H 1O2UA 2A31A 1OX1A 1Z8JB 4JZ1A 5C67A 2HPQH 4OS4A 1O2ZA 1NY22 4WWYA 3MU4A 1VCPA 9LPRA 4AFZA 1MKXH 2CXVA 3ATWA 3JZ1B 5JBAS 2VWOA 1V2JT 2PLXA 1ZTKA 3KL6A 1N1LA 2QF3A 1EJMA 4CR9A 1P2NA 3M61U 1CGHA 2AGGX 3MU8A 5L2YH 4WVPE 1RTLA 1C1MA 1SGQE 1P8VC 2G8TA 1PPCE 1GHBG 3V13A 1IQKA 3GY6A 4FVBA 1V2RT 3OY6U 2BD5A 1TPSA 1D3QB 4ESTE 3M3SA 5HM9A 1O2YA 1IQLA 3UR6A 2RA3A 3ZZ9A 2NU4E 1TB6H 5ETXA 2FXRA 1LHGH 2J9NA 3SNEA 3S69A 1PPFE 2FIRH 3SOSA 4HI3A 5TJXA 4CR5A 2QAAA 3DD2H 1AZ8A 1C1SA 2ALVA 4XBCA 1GI3A 3RXGA 2FO9A 3TH2H 1Z6EA 1CT2E 4NIVA 4O9VA 1MKXK 1EJNA 2BM2A 3ATMA 3SGQE 1ESAA 4JZDH 3AW0A 3A87A 2ZHFH 1UK4A 3LJOA 3MOCA 1YPJH 3MNBA 2R0LA 2ZU1A 1MMJN 4A1XA 3RLWH 3SUEA 1MAXA 2GV7A 3EYDA 1WOFA 2A4QA 1GMCF 2XTTB 4AZ2B 1O3IA 1TPAE 1ZGVA 4ABFA 3GISB 3ZVDA 1P12E 2EA3A 4B71A 5BRRE 1U6QA 1OWEA 4K1EA 1L1NA 3O8BA 2BLOA 1F5LA 1ELEE 3L6PA 3T25A 1QB9A 2ANWA 1ESBA 4X8VH 3LGIA 2CV3A 2XBWA 4OS2A 3LU9B 1Y5UT 4CRBA 2ODYB 3GDVA 1NC6A 2ZFPH 5JYIA 4X2YA 4JYVH 8GCHF 4TYDA 3UREA 1KDQA 4K3JA 1E0FD 5J4SA 4ZHLU 1GI7B 3RMLH 4B2BA 1FY1A 6CHAB 3MI4A 1C1PA 3P8NA 4ABHA 4JK5A 3RXHA 1P02A 1UVTH 1ZSKA 4TPIZ 2P3UB 3GOVB 2XW9A 2Z9LA 1VITH 1FDPA 1XM1A 1UCYE 5A0CA 1SGPE 2HRVA 7GCHG 2ZDMA 1MTNB 3TGJE 1XXDA 3Q77A 1ZTJA 3OX7U 3QLPH 1O2WA 5DGJA 3GCNA 1GBCA 1O2XA 1CHOG 4Q2KA 3SN8A 1WQSA 5DP5A 1BA8B 2H1UA 1G3BA 4XE4A 1DM4B 4CHAB 1QHRB 4E7RG 3QGNB 1L0ZA 1FAKH 3C27B 1ZLRA 2PUXB 1GI0A 4J2YB 1BB0B 3NXPA 2IN2A 3SHAH 3ZZ3A 3PV5A 3TJNA 1SGYE 5FBEA 3GICB 1CA8B 4A1VA 3KQDA 1QB1A 5FHTA 1J9CH 2Z6BD 4WY3A 2PGBB 3PO1B 2P16A 2F9UA 3A7YA 1GCTB 3P8OA 2RDLA 2XBXA 1DANH 1V2LT 4X2WA 2ILNA 5EPYA 1EASA 2JH5D 2BDCA 2BLQA 4UFEH 1Y8TA 2WPLS 2ALPA 5G4BA 3ZVCA 4FUIA 2F9VA 1EXFA 3SNAA 2H2ZA 1NU9A 2ZCHP 2BLWA 3M7TA 2QXGA 1BHXB 2OK5A 2IPHA 3C1KA 1LVBA 2Z3CA 3A81A 2RCEA 1O2QA 4YT7H 1YKTA 2BX3A 1OP8A 2WZQA 1A7SA 2Z9KA 2R2MB 1K9OE 2PW8H 3GCOA 3FFGA 1FLEE 5E2OA 1NRQH 2QN5T 1BTUA 3PTBA 1DT2A 1ELCA 2QA9E 3M5OA 3VXFH 4DGJA 1O2TA 3TPIZ 3OSYA 2UUFB 1TRNA 3A7XA 4O97A 1RXPA 1C1QA 1C2MA 3SU4A 1C5ZB 2TIOA 1UCYH 2H9EH 1C2GA 5EOKA 4M9FA 5F03A 3RXOA 1XUHA 1RTKA 1CHGA 4IC6A 1C9TA 5DP8A 4THNH 3GCHB 2BD4A 2A7JA 6ESTA 1N6YA 3RU4E 4BAOB 1GL1A 4IBLH 2PSXA 1HAXB 2DE9A 1ACBE 4E06H 1KXCA 3LPRA 4I31A 2AS9A 3PM3A 5GCHF 2J94A 1PYTC 4X6MA 3ENSB 1NRRH 4OGXA 1O3MA 4AN7A 3VB7A 1JMOH 4H42U 4OS6A 4QT8C 1S83A 1V2KT 2SNVA 1TGNA 1TNHA 1LTOA 1G32B 1NFXA 1O2HA 2AIPA 2BD9A 1ELAA 5B6OA 1O3CA 1HJ8A 1YPGH 2GTBA 1UK3A 1YP9A 1UJ1A 3SJ8A 1DY9A 2QY0B 4R8TB 3H7TA 2TGTA 3H5CB 1O3FA 2TBSA 1IAUA 4Q7ZA 1OSSA 1UCYK 2KAIA 4X1QU 2M5TA 3UNQA 4GLYA 4NFFA 2FOCA 1HRTH 4FU9A 1IHSH 2SGQE 5FBIA 1IQEA 3M37A 3A7TA 1H9LB 2VIDA 2F9BH 1NFYA 4X6PA 1EOLA 3SZNA 2A7CA 4U30A 1GJ6A 1ELGA 1TNLA 1XVOA 1THSH 1LPKB 3Q3KA 1C4Y2 3RC5A 1UTNA 2OQUA 2ZQ1A 1O3EA 2PKAA 1UTMA 1IQFA 4JK6A 4DJZB 1C5VA 1BHXF 1GJDB 2G00A 4B75A 3VEQB 3T28A 1GVLA 1EAUA 1YYY1 4ZH8A 1NFWA 4BXWA 2P94A 3KN2A 3BTME 1EZQA 2P8OB 2GCHF 3LJJA 1OPHB 2Y5GA 1MQ5A 3QGJA 1A61H 6GCHF 2Z9GA 1QIXB 2ODQA 1KLJH 3KGPA 1XUIA 4D8NA 1S84A 1Z8IB 1O38A 2JETC 3ZZDA 1SVPA 2PKSC 4TY7A 4DOQA 3T29A 4KTSA 3VB6A 2XCFA 4B76A 1HIAB 4Q7YA 1V2NT 4ISNA 1NROH 4GCHG 1C2KA 2V6NA 2ZNKH 2G52A 4NSVA 1KXEA 4LZ4B 5HGGA 1IQIA 1MZDA 4ABDA 4ZHMU 1T31A 3E8LA 4KGAA 1GHZA 1MAYA 1SLXB 5A8XA 3D62A 1BTXA 2TGPZ 3RDZA 3TNSA 1ABJH 3CS0A 1V2VT 3ZZAA 2TRMA 8LPRA 1ZPCA 3ZZ6A 1Q2WA 1OS8A 1UHBB 1MQ6A 4OGYA 1P2QA 4VGCC 1AMHA 2QC2A 3M35A 1RIWC 2Y5HA 2QF0A 2F3CE 3SW2B 4ZKOU 2OC8A 2PR3A 4YLQH 2Y81A 3GY7A 1TBQH 4XFQA 1YPMH 2FP7B 1GHBF 1C5WB 2ANYA 2BB4A 5GXPA 1V2QT 2VIWA 3V7TA 3BTFE 3AW1A 3PMBB 3MO3A 1OWDA 2PFEA 3UWJH 5F8XA 2ZU4A 5EGMA 3Q00A 4M7GA 3N7OA 5TCCA 2G55A 2YOLA 4X1PU 2ZHEH 2XYAA 1T8OA 1D9IA 4IN1A 2F83A 4ISLA 1EAWA 1SLWB 1X7AC 2NU2E 7KMEH 1TAWA 3RUOA 3FAOA 2LNCA 2Y80A 1SOTA 1TLDA 1C5PA 1YPHC 1V2ST 4NZLA 2VBCA 1G36A 3M5LA 3M36A 1YLCA 1BUIA 1H4WA 2UWOA 1CO7E 4TY6A 3U9AH 1B0FA 2YNBA 5B6LA 1A2CH 1SSXA 2AMPA 4INKA 2DE8A 2AIQA 1BRCE 1GBJA 1B0EA 3SJIA 5HM2A 3P8FA 1GG6B 4NZQA 1BT7A 9ESTA 1CSOE 3QX5H 3UUZA 3GCTG 2HWLB 1D6WA 1GWAA 1GL0E 1A1RA 1ZMNA 1UTOA 1FIZA 1FQ3A 4I7YH 3MYWA 2C8ZB 3U1IB 4WXVA 3PMHB 3SV8A 1ZMJA 3TITA 2ZGJA 5PTPA 1FN8A 1RRKA 2FYQA 1O36A 2G51A 4Y6DA 2O8LA 5HXFA 1C2LA 3HKIB 1Y3UA 4X2VA 3B8JA 1LKBA 3ZZ7A 1VGCB 4X0WU 4CBOA 2OC1A 1V2PT 4Y8ZA 2HNTC
chains in the Genus database with same CATH superfamily
1OKXA 4A6LA 2AMQA 3MNXA 4F49A 3UB0A 4NCYA 1AQ7A 2GZ8A 2FLRH 2XCNA 1HXFH 3TK5A 1ANBA 3QTOH 2ZPQA 2J2UA 3RXFA 2ZQ2A 3ITIA 1N8OB 2GZ9A 1ELVA 3UQOA 1SR5C 2FX6A 1K1LA 3K6ZA 3RXLA 3UPEA 1UVPA 1GBMA 3UWIA 1W13U 2EI6A 1FN6A 3BN9A 1HAYB 4YT6H 2NU3E 2VVUA 3KEEA 1O30A 3OFND 1DWDH 1O3JA 1C1TA 4NWKA 4RKJB 5C5OA 1H8HD 4BAMB 3BSQA 3F6UH 1GJCB 2HLDD 7GCHF 1J17T 1EUFA 3TGIE 1ELTA 1WV7H 1KY9A 2VIPA 3MO6A 1TGBA 5CE1A 3HK3B 4NA9H 1SB1H 4BAKB 2AERH 1TABE 1XUJA 1GBAA 4TWYA 4YOIA 5L6NH 3D23A 3QO6A 4F4OC 1GPZA 5EJZA 4UDWH 2BXTH 1ZHMA 1AFQB 1GBBA 3CS7A 2R9PA 4ZXXH 5EJ1A 5E8EH 2NWNA 2OLGA 3A7WA 1BBRE 3LOXA 1O2VA 1Z1IA 1CU1A 3FZDA 4YOGA 1C5SA 5F8TA 1E79D 1G3EA 2P3TB 1KYNA 1P05A 2VIVA 1CA0B 2C8XB 2GD4B 1WDIA 3PTNA 4F48B 1QNJA 3O8CA 3S9CA 6CHAC 1WYKA 2D8WA 2ZFSA 1P3CA 2PTCE 2ZIQH 2QIQA 2J98B 1BRUP 2ZG0H 3CP7A 5AFYH 3AAVA 1KLIH 2V7QD 3MNCA 4X1RU 5SGAE 2BD2A 1Y5AT 3RM2H 2OC0A 2BVSH 1EB2A 3PRDA 4XD7D 1H9IE 5DG6A 1GGDB 2EI8A 1TALA 3F2GA 3U8TH 1OP2A 4FOUC 4I8HA 3F9EA 3RXDA 1DPOA 5JPMH 3LIWA 4IS5A 5EQQA 3BTDE 2ZGHA 1XMNB 3KQCA 2A5AA 2Z3EA 3LKWA 2H5DA 4JYTA 4MG3A 2Q6GA 3DA9B 3ZVBA 5GDSH 1MKWK 5CHAB 3RXVA 4AGJA 1PYTD 4K60A 1D3PB 2O9QA 2V35A 3RP2A 3A8CA 2FOMB 4CHAC 1AO5A 2VIQA 1K1PA 1C1VH 2A4OA 2AYWA 1GHAG 1Y59T 2BD7A 1BRBE 5EIYA 3E16B 4X8SH 3PLKA 1TPPA 4NIWA 4UE7H 1TNKA 2O8MA 1CT4E 4ABBA 3SYJA 2PTNA 1TA6A 1C9PA 3PO1C 3E91A 1FPHH 1SQAA 3V0XA 3OU0A 1TONA 3MTYA 4LXBH 1GCDA 3DSPA 1GCTC 1HXEH 1C1WH 1ZSLA 3MU0A 4MPUA 2WUBA 3MMGA 3VB3A 1QJ7B 1BMMH 1SGFG 4K1TA 8ESTE 3LH1A 4K2YA 3RMMH 3SO3A 1FY8E 3GDUA 3MHWU 3SJ9A 1FAXA 2CF9H 1QBOA 1EPTB 3E90B 1F0TA 3MH6A 1QJ1B 3RM0H 3P8GA 1HJ9A 1MCTA 1PJPA 1AB9C 2STAE 1C1UH 1GBDA 5I46H 1AVWA 1H8ED 3VPKA 1V3XA 3SU1A 5JB8S 1V6DA 1TGCA 4B6EA 4ACAA 1K2I1 1MU8B 4MNYA 2TPIZ 2BDGA 4GAWA 1H1BA 1O2NA 2GZ7A 2A4GA 5FPSA 1TGTA 3T2NA 5L2ZH 4AYYB 1S5SA 4K8BA 4JZIA 2IJD1 3PLPA 2EI7A 1BMAA 1E36B 1GHWH 2OD3B 1NM6A 1D4PB 4I32A 1HB0B 3ZZCA 2B8OH 3BEUA 4O03A 2VGCB 1GDUA 3VG8A 5GPIB 2Y7XA 5IYTA 2ZDNA 4CRCA 4Z6AH 3P95A 2BDAA 3BTTE 3BTHE 2GT8A 1EAIA 1IQMA 1C4U2 4AORA 2OCVB 1MBMA 3MU1A 1J8AA 4YOJA 3F0OA 5EQSA 1Y3VA 4FUHA 2P93A 1SGIB 2BQ6B 2SNWA 3HGPA 2THFB 4B1TA 4CBNA 2BHGA 2BQWB 1W7XH 1IQHA 1EJAA 2O8TA 2XWAA 3T5FH 5FAHA 4AC9A 3E1XB 5DPAA 1VITF 1GBKA 1PFXC 2P95A 4PROA 2KR7A 2FS9A 4KKDA 5HIZA 4E7NA 3ZVEA 1O2JA 3GY2A 1HAHH 1OWHA 3DUXH 3GY3A 4CH2B 1K1JA 1TBZH 3F3BA 1O35A 4K1SA 1B7XB 1NPMA 3UQVA 2ZA5A 4ZKSU 1O5BB 1A46H 5FL7D 3BTGE 1EP6A 1KIGH 2FDAA 2VNTA 2HOBA 5EXLA 3STJA 2WV4A 3SGAE 3FO8D 7ESTE 5HIYA 4OS7A 1T8NA 3VB5A 3WW7A 4Y10E 1EP5A 3EGKH 3RXBA 4GCHF 4Y7BA 3K2UA 2ZDKA 1WSSH 1GI4A 2R0KA 1ANDA 2DUCA 1NT1A 2FI5E 1UTQA 3TNTA 2BXUH 3GY8A 1O33A 2P3FH 3MNSA 1A4WH 3BEIB 3L3TA 4BTTB 3M3TA 1JIRA 3BIVH 1MD8A 1NO9H 1COWD 2SGAA 1DX5M 2FX4A 4ZXYH 4X2XA 5GIBA 2FOFA 1KXAA 1VCWA 4BXSA 3SI3H 1QL9A 1QJ6B 3SQHE 2GMTC 5FX6A 1HAPH 1GI2A 1CBWB 4MQAA 3SU0A 3SU3A 1TPOA 1D3TB 3RXEA 4IN2A 1O2PA 2TGAA 4Y0YE 5EG4A 2Q6FA 1QURH 4XDEA 2FI3E 1LDTT 1N6XA 1INCA 2XC5A 3SGBE 1GMHG 5C2ZA 2JJ2D 2UWLA 5DJ7A 2A45B 1NESE 2OTVA 1ETSH 1SLVB 5FX5A 2KCPA 1UTLM 3K6YA 4FETA 2VWLA 2UUYA 2Y6TA 1W11U 1CGJE 5C1YA 1BTYA 1PQ8A 5CDFE 2ODPA 3AAUA 3O8RA 3GYMA 1HPGA 2BYAX 3SV7A 3DHKH 5CMXH 1MTVA 1V2TT 1HAOH 1GJAB 3ATLA 3VB4A 4DIHH 2W3KA 1P04A 1ETRH 3B23B 4FUJA 1O5CB 2VH6A 3VGCB 1LPGB 3P17H 5LPEA 4B2AA 2G81E 1O2MA 4ZHAA 3PMAB 4TT3D 2H5CA 1O3NA 4Y7AA 2CMYA 1C2FA 1NRNH 2QV1A 4ZKNU 3ZZ5A 1YY3A 3A88A 3GCTF 5LPFA 2FS8A 1Z8GA 1YPEH 1AE8H 1OHHD 4A92A 1F5RA 4X1NU 1G37A 3UIRA 1WCZA 1WXRA 1HIAA 2EQNA 3LC5A 5EJLA 4WH6A 2VJ1A 4RKOB 1D3DB 1A0LA 1HAVB 3BF6H 4ISHH 3SBKA 3KYGA 3BTWE 2FM2A 4KTCA 3RXTA 1QGFA 3TGKE 2AFQB 1MBQA 1QL7A 1QFKH 1RJXB 1TYNA 3K9XB 4YO9A 1C5LH 1QQUA 4WMDA 4JZEH 1AN1E 1O3HA 2XNIA 1ARBA 1SOZA 4AB8A 2LP6A 4ZAEA 1BOQA 3A85A 2NU0E 3ZV8A 1UHBA 2QXJA 4RT0A 3FP7E 1AKSA 1GVZA 1IHTH 1NS3A 1GMDG 1OXGA 2ZGBH 3EQ0H 1O3PB 1CT0E 1C5MD 1ZOMA 1EATA 4FUCA 1GBFA 1PQ7A 4HTCH 2J38A 1EQ9A 1YLDA 2H9HA 1SGNE 2C90B 3NWUA 2R3UA 1LMWB 3OAAD 1H8IH 4KP0A 1V2MT 1ZJKA 1KMHB 2WSSD 2D1JA 1TX8A 3RXIA 3B9FH 4NGAH 4IMQA 2BOKA 4UD9H 5JBTA 4RI0A 2BVRH 4WMFA 1EX3A 2LPRA 1DY8A 2BOHB 3ELAH 3U1JB 3SJOA 2UUKB 3UOUA 1MH0A 3I29A 1P57B 3SNBA 1P2JA 1EOJA 2FODA 1VGCC 5DN6D 1LQEA 1P0SH 5FCKA 1ZPBA 5EXMA 3A8AA 3RXKA 4D7FA 3H7OA 3OY5U 3QDZB 1HAZB 1O3DA 4ABAA 1KLTA 4NSYA 1XXFA 2BY6X 5A8YA 1PPHE 3UNRA 2CF8H 1DLKB 3F9GA 2ZCLP 1HBTH 3LGWA 4IMZA 2H6MA 1DOJA 2SGDE 5A2MH 1C2EA 2SGPE 3AK5A 3TK6A 1NU7B 3SU6A 3LC3A 4K5ZA 2C93B 2ZC9H 4ZUHA 1J15A 2Y82A 3LGVA 1FY5A 1AZZA 1LHFH 2CHAB 2QXIA 3EAJA 1P06A 1MTUA 1GBHA 1QRXA 1W0ZU 4A1TA 1F2SE 3PB1E 3RXUA 4D9RA 2A5KA 4E05H 3RXPA 3FZZA 1GVKB 1CE5A 1HAIH 4JMYA 3KNXA 3QN7A 1VJAU 2QF5A 2KAIB 5A09A 1O3BA 3V12A 3D49H 1ABIH 5EU8A 1YCPH 1P2OA 1EAXA 4FVDA 1LO6A 2KZ4A 2W7UA 4DY7B 3F68H 1FX0B 4O3TA 4B2CA 1AFQC 5TCAA 1AGJA 1DUAA 5EPNA 4MNXA 3RLYH 1A3BH 1OYTH 4Y76A 4YM9A 1GHAF 1TMUH 3KF2A 4D9QA 1JRSA 4SGBE 4CRDA 1TE0A 1BMLA 1W12U 3QZRA 2A2QH 1CA0C 2ZF0H 5DO4H 1BQYA 1QCPA 4RN6A 2ZTZA 1QA7A 1UVUH 1WUNH 1O2OA 3RXCA 3PMJA 3VFEA 1AHTH 2ZDAH 4O3UA 2R2WU 3U69H 4U01A 1OWIA 1G30B 2QGRA 2KCOA 1TA2A 1TBRH 1BTHH 3ODDA 5DP4A 5T1VA 1UVSH 1Y3WA 4H4FA 4LK4A 4FUBA 3MH7A 1HUTH 1PPBH 2JH0D 2ZI2H 4NWLA 1PPGE 4Y79A 1S6HA 5F8ZA 2YNAA 2VWMA 3ZIAD 1DWEH 3A83A 1GJ5H 2V0BA 2FI4E 2G4UA 2XBVA 4XBBA 1YCPK 2GCTB 1BMNH 1DS2E 1T8LA 2BY9X 3GY5A 3TH3H 2ZEBA 1SL3A 4MPVA 1C2IA 1S81A 1O5AB 5CHAC 3NPSA 5FXLA 1IQNA 5EQRA 1LCYA 4NA7A 1A0JA 1JRTA 1P9UA 2F43B 1MCVA 4AX9H 4U2WA 2ZGXH 4XBDA 2HLCA 4FU8A 5FCRA 3A7VA 2ASUB 1T32A 2C8YB 1VZQH 3DSGA 2J98A 2GT7A 1XUFA 2ZFRH 2ZHWH 1FV9A 4DW2U 2BDBA 2PUQH 3I78A 1BJUA 4BOHA 2RDEA 3SV9A 5DP7A 4INLA 3NRLA 4GVUA 1RTFB 3NZIA 5JBBS 1ANEA 1P2MA 3F2HA 5AF9H 1O32A 2AEIH 5FPYA 3ESTA 5DP3A 4AFUA 1F0SA 1S85A 3QZQA 1K22H 2Y5FA 1SFQB 2B0FA 1L1GA 1TNGA 1GJ8B 2W7SA 2ESTE 5C5NA 6LPRA 2PKSB 2B5TB 3BEFB 3RXRA 3KYFA 3PWCA 4MNWA 1ESTA 1GBEA 4FUFA 5DP6A 3CNRA 3OTPA 2WHXA 4DT7B 1CQQA 1RFNA 4Q4LA 3G01A 2HPPH 1LVMA 3A8DA 1AUJA 1C4V2 1G3DA 1WAYB 4X6OA 1QL8A 2UUJB 5J4QA 3STIA 2EY4C 1A3EH 1SGCA 5HYOA 1P11E 4HZHA 5KGOA 3RC4A 2PWXA 1O39A 2EC9H 5IDKA 1THPB 3E3TA 2SGEE 1CHOF 1W2KH 4CRFA 4OS5A 1D6RA 1QRZA 5AVDA 1ARCA 2F9NA 1DSTA 4VGCB 3L33A 1Y5BT 3ZZ8A 4Y0ZE 1RIWB 2BMGB 1WTHD 3FANA 1ETTH 2ZCKP 2ANMH 1SQRA 1SBWA 1CGIE 1BDAA 2CJIA 3NKKA 2WV5A 4BANB 2VGCC 2Q6DA 1HNEE 4DVAU 4Y8YA 3SORA 2ZTXA 3RXSA 2ZU3A 1K1IA 2QCYA 1LVOA 1SHHB 1RGQA 1IOEA 1W14U 1GI6A 1NBMD 1O2SA 2SGFE 1QTFA 1TX7A 1C5NH 3Q76A 3GY4A 2VH0A 2FPZA 4X8UH 1NRSH 3M7UA 1LKAA 2WV9A 3GDSA 1QY6A 2C8WB 1ANCA 1DUEA 4Z1MD 2FLBH 4K8YA 1MTSA 2WUCA 5A0AE 1O5EH 1TGSZ 3RXJA 4FXGH 4AOQA 2RA0A 5EODA 1AIXH 1O3OA 1SMFE 4A5TS 1O0DH 2G5VA 1MTNC 2BY8X 2UWPA 1G3CA 2ZFTA 2SFAA 2FOAA 3A8BA 3URDA 3E0PB 1GHXH 4ABGA 1HFDA 4RSPA 4NA8A 4R0IA 2C4FH 2R3YA 4AG2A 1AVXA 4XOJA 1Z6JH 1YPHE 2YMSD 1C2HA 1EB1H 1GMHF 1E38B 1PQAA 3AVZA 3K65B 2ZU5A 2Z9JA 1L1JA 1XX9A 4MVNA 1JXPA 2ZZUH 1SGTA 1OYQA 1Q3XA 3A80A 2Z3DA 1S6LA 3H09A 2GDEH 1C2DA 3ODFA 3QK1A 3BG4B 2JH6D 1MZAA 2KM0A 1O34A 2G5NA 2CGAA 3SZEA 3A84A 4AFQA 4MNVA 4CREA 3QUMP 1DICA 5H4IB 5C0TA 5FPTA 1FNIA 1GBTA 1Y3YA 1ZHPA 1LHEH 1BTZA 1RS0A 5GNDA 4B6FA 1KTSB 1EKBB 3FVFB 4OS1A 1KXBA 4TPYA 1BBRH 3OTJE 1UK2A 1IQGA 2ZDVH 4Y11E 3O8DA 4DG4A 1V2OT 3IITA 1FY4A 3ATKA 2HVXA 5DP9A 2W6JD 2WPHS 3ZZBA 4Y71A 1L4DA 4NG9H 1CBWC 2NU1E 1FY3A 3LT3A 2HNTE 5C0UA 4ZMAH 1ZGIA 2K1QA 1O2RA 3TLOA 4H6TA 2B9LA 3SU5A 2J5UA 4YESB 4Z0KA 5HMAA 1M9UA 1T8MA 2XWBI 3DT0H 3CENA 3QTVH 3SNDA 3TK9A 1FZZA 1TMTH 3A82A 1TNJA 1TRYA 1Z7KA 1HJAB 1DE7H 1HV7A 3F1SB 4GHQA 2XC4A 5LGOA 3LH3A 2CK3D 4I8GA 2ZDLA 1CVWH 2FTMA 1AWFH 1W3CA 1LVYA 1SPJA 3GCHC 2A5IA 3P70B 2IJOB 5JDUB 1GI1A 2GDDA 2ZO3H 5C1UA 1E34B 1Y3XA 1GMDF 4B74A 1C1NA 3OE7D 1K28D 4WJG2 3R3GB 3HATH 2TGDA 4AB9A 2HVYB 1BBRK 2ZGCA 3VGCC 3MH5A 2PGQB 3EA9A 3RXMA 1EZSC 2HALA 4DURA 3HGNA 1ELDE 4OM9A 4XRNA 3SUDA 1HLTH 3GYLB 1K21H 2ZWLH 1DDJA 2I6SA 2ZKSA 3PRBA 2K8IA 3EE0B 1ZTLA 2WINI 2VVCA 1DFPA 4TWWA 4P02A 1F5KU 3RU4T 2OP9A 1AWHB 4UONA 2RFKC 2ANKH 4GPGA 1YCPM 1BRAA 1JIMA 4X6NA 1QBVH 1C5OH 1G2MA 1P10A 2BLVA 1W8BH 3U98H 3LDXH 1A5GH 4UEHH 2BZ6H 1HAGE 2O8UA 1PQ5A 3SUFA 5DKMA 5T3HA 4CRAA 1EZUC 2JDID 1C2JA 1O3LA 2D26C 5C1XA 4FUDA 1MABB 2PHBA 2AGIX 3BV9B 1Q31A 2GGVB 1P9SA 1C5XB 1XUGA 1O5FH 3PLBA 2KCAA 4IC5A 3W94A 4I8JA 1S0RA 1P09A 1F92A 2BX4A 3M5MA 4Q80A 4X1SU 3SQEE 4GHTA 4ABEA 1GHYH 1O37A 2QYIA 2HNTF 1XVMA 2ZPSA 2JIZD 1C5RA 1OP0A 1O3GA 1VCQA 1YPLH 1V2UT 4ZKRU 2IOTA 2XBYA 3SUGA 1HAVA 5L30H 1BZXE 3KCGH 3W1EA 2ZHQH 1B5GH 2BY7X 2OBOA 1AY6H 1LQDB 3WWFA 1O2GH 1W7GH 1T4VH 1S82A 1TIOA 1HGTH 3PV2A 1VR1H 2P8OC 1THRH 4LZ1H 2OXSA 2EEKA 1MTWA 4K69A 2BDIA 3KQEA 3BG8A 3IWMA 1SI5H 4YTAA 1KDQB 1LHDH 1ZJDA 5DK1A 2FOEA 2KCYA 3Q3YA 1FJSA 4J1YA 1AB9B 4INHA 4ISIH 1S6FA 4AYVB 2J97A 4IW4E 4MTBA 2WPJS 1SGFA 1T4UH 3ZVAA 4CH8B 1O3AA 1ZRKA 2H9TH 3LGUA 2L74A 4BTIB 4GSOA 2I6QA 3SJKA 3ZZ4A 1NN6A 1O31A 2VWNA 3M3VA 3TU7H 2A32A 2WYGA 1BCUH 4KELA 2V3OH 2CHAC 5ESTE 5EXNA 3E6PH 3U8OH 1AE5A 3N7EA 1Z8RA 3MU5A 3Q3XA 3DSOA 3FP8E 2W6ID 1TWXB 4I8KA 2ZPRA 1ZSJA 1G9IE 3T62A 5K0HA 2V3HH 1HCGA 2BZAA 2JKHA 3TJOA 2PV9B 4MDSA 1SQTA 1FPCH 1QRWA 4ISOA 4BAQB 2FOGA 1NZQH 1TFXA 4I8LA 5I25A 1C5QA 3ZYEA 2ZFQH 2Z9IA 5F6MA 2WPMS 1KXFA 1BJVA 1QR3E 1JBUH 3BTKE 5E0HA 1GI9B 3P92A 1MUEB 4Y8XA 1O3KA 1YWUA 2J4IA 3RXQA 1AD8H 1O5GH 1GJ9B 4U32A 1GMCG 3UY9A 5T6FA 1NFUA 3ZVGA 1HYLA 5DSFA 3NUMA 3TVJB 1W0JD 5C3NA 1JWTA 1H9HE 3UNSA 3W95A 1ZZZA 4D7GA 2C3SA 4H6SB 5T6GA 3SI4H 1SLUB 1DVAH 5A0BA 1YF4A 4IGDA 4A7IB 3FP6E 5C94A 2VIOA 1HDTH 1GJBB 2A1DB 2ZP0H 4AFSA 1DSUA 1VJ9U 1ZRBA 4MLFB 5GJ4B 1K1OA 1GG6C 2AH4X 2BTCE 8GCHG 1A0HB 2GCTC 3D65E 1AVGH 3OYPA 1F0UA 1WBGB 1FXYA 1QBNA 2FMJA 1EZXC 4UFDH 3RMNH 3A7ZA 3VXEH 1P3EA 4Q63A 4WH8A 3E0NB 1BTPA 2BD8A 4LOYH 4DIIH 2J95A 2CN0H 5K7RA 1NTPA 1ELBA 1TNIA 2OQ5A 1L4ZA 3NK8A 1LPZB 1DWCH 2BVXH 2GJGA 2O8WA 3JZ2B 1VITG 1ID5H 3DFJA 1BTWA 4X8TH 3ZVFA 2WYJA 2A0QB 1DXPA 2FTLE 2GMTB 4ACBA 3NCLA 2AMDA 1UVOA 1YM0A 3ZV9A 3MFJA 2D2DA 2ZTYA 4GUXA 3RC6A 2A7HA 3SV6A 3S7KB 1Z1JA 4ASHA 3SV2H 8KME2 4KTUA 1N8OC 4I33A 1OWJA 3FOAA 1WQVH 1ZR0A 4ZROA 1W0YH 2OBQA 3SHCH 1KTTB 3BTQE 3OEED 1SQOA 4YLUA 5EW1H 1SG8B 1MU6B 5KECA 2FESH 1UTKA 1P2IA 3LGTA 1V2WT 4TSFD 1AFEH 1FONA 1GDQA 4HG6A 4WMEA 1LHCH 1O2KA 2STBE 4XSKU 5GWZA 2ZECA 1F7ZA 2PSYA 2WPIS 3PROA 4MPXA 1FUJA 1FI8A 1MD7A 3BIUH 4NFEA 4DT4A 1C1OA 1NBME 3PYHA 1P01A 1GBIA 4B73A 2GX4A 3KQBA 3PV4A 3T26A 1C5UA 4Q7XA 5LH8A 3MO9A 1E35B 4JYUH 4AGKA 1TMBH 4BAHB 1JOUB 1GDNA 5ESBA 1AUTC 1AKSB 1ZHRA 4UFFH 2A2XH 3UOPA 1QA0A 2FEQH 3N7DA 3A89A 4FU7A 5C20A 2YMSB 2Z7FE 5JB9S 1SGDE 1WTGH 2ZFFH 3PWBA 1AI8H 3F0PA 2PKAB 3TIUA 4BNRA 1ZPZA 3MQKC 3RU4D 4YZUA 1GBLA 2OINA 1TRMA 3KHVA 1O5DH 1PPEE 5E2PA 2FOHA 2XC0A 4F55A 1T7CA 5BPEA 3UFAA 1J16A 1BIOA 1GGDC 2BDYA 3HPTB 1GI5A 2W3IA 1KSNA 3TH4H 3ZYDA 1H8DH 3TJUA 2A4RA 1XKBC 1XUKA 2F4LA 1FIWA 2F9OA 5ABWA 3SNCA 1GHVH 2OC7A 2W5EA 3DFLA 1PPZA 1UTJA 2B7DH 3MWIU 5A8ZA 3ATIA 2BDHA 3DCLA 5JBCS 3T27A 2K0QA 2FYRA 1KXDA 3F9HA 1TOCB 1UTPA 5AHGH 5T6DA 3UR9A 2GV6A 2ULLA 3SU2A 3S0NA 1BMFD 2FWWA 3URCA 1G2LA 3F9FA 5GCHG 4JCNA 2QXHA 1W0KD 1E37B 1YBWA 2G4TA 4P00A 2F9PA 1C5YB 1L2EA 1A5HA 1NRPH 2BQ7B 1SC8U 1BITA 1TQ0B 2Q1JA 2GVFA 4NIYA 3AASA 3S7HB 3KIDU 2GKVE 4D76A 3M7QA 1A5IA 3EA7A 2FZZA 1EFRD 3I77A 3UTUH 1FMGA 4ABJA 5E0JA 2F91A 2LELA 3BG4C 2AGEX 2J92A 1F0RA 3EE7A 3U8RH 1QQ4A 2JETB 1DITH 3EDXB 1OWKA 3BTEE 4NIXA 2GP9B 4FUEA 2FOBA 1GI8B 1EPTC 2Y7ZA 5AFZH 4AG1A 1IQJA 1TQ7B 1SGRE 2VU8E 3S9AA 3S9BA 3RMOH 2WPDD 1GJ7B 2HGTH 5LPRA 1XKAC 2XRCA 1ORFA 3A86A 1SGEE 2VVVA 4FUGA 1O2IA 1RD3B 2VINA 5E0GA 1UMAH 1C5TA 3WY8A 2BD3A 3RXAA 4HGCA 1DXWA 3R0FA 1SKYE 3LGYA 1UO6A 1YC0A 4WF8A 4UFGH 3V3MA 3HKJB 1YGCH 1WU1A 1QB6A 1O2LA 1HJAC 1YPKH 2OUAA 4CRGA 1SHYA 3M5NA 3MH4A 1Z71A 4MPWA 2P59A 1K1MA 2RG3A 4HFPB 2GCHG 4JZFH 1K1NA 1YLNA 3QWCH 4DCDA 1SFIA 1ZYOA 2ZHDA 1S0QA 1J14A 1GJ4H 1W10U 1EPTA 4WXIA 1DWBH 6GCHG 1MKWH 1AU8A 1UW7A 1P03A 1OOKB 2XXLA 2ZU2A 2QF4A 7LPRA 3N99A 1C1RA 3EA8A 4ABIA 1ZMLA 3TJVA 1P2KA 4SGAE 3IG6B 4BTUB 1TOMH 3KQ5A 1DLEA 3P6ZB 2Z94A 1TX6A 2J34A 1ELFA 2BY5X 2WPKS 2W26A 3HK6B 2VB0A 3LONA 5EW2H 1O2UA 2A31A 1OX1A 1Z8JB 4JZ1A 5C67A 2HPQH 4OS4A 1O2ZA 1NY22 4WWYA 3MU4A 2KFWA 1VCPA 9LPRA 4AFZA 1MKXH 2CXVA 3ATWA 3JZ1B 5JBAS 2VWOA 1V2JT 2PLXA 1ZTKA 3KL6A 1N1LA 2QF3A 1EJMA 4CR9A 5C17A 1P2NA 3M61U 1CGHA 2AGGX 3MU8A 5L2YH 4WVPE 1RTLA 1C1MA 1SGQE 1P8VC 2G8TA 1PPCE 1GHBG 3V13A 1IQKA 3GY6A 4FVBA 2V3MA 1V2RT 3OY6U 2BD5A 1TPSA 1D3QB 4ESTE 3M3SA 5HM9A 1O2YA 1IQLA 3UR6A 2RA3A 3ZZ9A 2NU4E 1TB6H 5ETXA 2FXRA 1LHGH 2J9NA 3SNEA 3S69A 1PPFE 2FIRH 3SOSA 4HI3A 5TJXA 4CR5A 2QAAA 3DD2H 1AZ8A 1C1SA 2ALVA 4XBCA 1GI3A 3RXGA 2FO9A 3TH2H 1Z6EA 1E1RD 1CT2E 4NIVA 4O9VA 1MKXK 1EJNA 2BM2A 3ATMA 3SGQE 1ESAA 4JZDH 3AW0A 3A87A 2ZHFH 1UK4A 3LJOA 3MOCA 1YPJH 3MNBA 2R0LA 2ZU1A 1MMJN 4A1XA 3RLWH 3SUEA 1MAXA 2GV7A 3EYDA 1WOFA 2A4QA 1GMCF 2XTTB 4AZ2B 1O3IA 1TPAE 1ZGVA 4ABFA 3GISB 3ZVDA 1P12E 2EA3A 4B71A 5BRRE 1U6QA 1OWEA 4K1EA 1L1NA 3O8BA 2BLOA 1F5LA 1ELEE 3L6PA 3T25A 1QB9A 2ANWA 1ESBA 4X8VH 3LGIA 2CV3A 2XBWA 4OS2A 3LU9B 1Y5UT 4CRBA 2ODYB 3GDVA 1NC6A 2ZFPH 5JYIA 4X2YA 4JYVH 8GCHF 4TYDA 3UREA 1KDQA 4K3JA 1E0FD 5J4SA 4ZHLU 1GI7B 3RMLH 4B2BA 1FY1A 6CHAB 3MI4A 1C1PA 3P8NA 2AHME 4ABHA 4JK5A 3RXHA 1P02A 1UVTH 1ZSKA 4TPIZ 2P3UB 3GOVB 2XW9A 2Z9LA 1VITH 4ZCNA 1FDPA 1XM1A 1UCYE 5A0CA 1SGPE 2KX4A 2HRVA 7GCHG 4RT1A 2ZDMA 2JJ1D 3U28C 1MTNB 3TGJE 1XXDA 2PP6A 3Q77A 1ZTJA 3OX7U 3QLPH 3FN8A 1O2WA 5DGJA 3GCNA 1GBCA 1O2XA 1CHOG 4Q2KA 3SN8A 1WQSA 5DP5A 1BA8B 2H1UA 1G3BA 4XE4A 1DM4B 4CHAB 1QHRB 4E7RG 3QGNB 1L0ZA 1FAKH 2QE7D 3C27B 1ZLRA 2PUXB 1GI0A 4J2YB 1BB0B 3NXPA 2IN2A 3SHAH 3ZZ3A 3PV5A 3TJNA 1SGYE 5FBEA 3GICB 1CA8B 4A1VA 3KQDA 1QB1A 5FHTA 1J9CH 2Z6BD 4WY3A 2PGBB 3PO1B 2P16A 2F9UA 3A7YA 1GCTB 1E1QD 3P8OA 2RDLA 2XBXA 1DANH 1V2LT 4X2WA 2ILNA 5EPYA 1EASA 2JH5D 2BDCA 2BLQA 4UFEH 1Y8TA 2WPLS 2ALPA 5G4BA 3ZVCA 4FUIA 2F9VA 1EXFA 3SNAA 2H2ZA 1NU9A 2ZCHP 2BLWA 3M7TA 2QXGA 1BHXB 2OK5A 2IPHA 3C1KA 1LVBA 2Z3CA 3A81A 3OEHD 2RCEA 1O2QA 4YT7H 1YKTA 2BX3A 1OP8A 2WZQA 1A7SA 2Z9KA 2R2MB 1K9OE 2PW8H 3GCOA 3FFGA 1FLEE 5E2OA 1NRQH 2QN5T 1BTUA 3PTBA 1DT2A 1ELCA 2QA9E 3M5OA 3VXFH 4DGJA 1O2TA 3TPIZ 3OSYA 2UUFB 1TRNA 3A7XA 4O97A 1RXPA 1C1QA 1C2MA 3SU4A 1C5ZB 2TIOA 1UCYH 2H9EH 1C2GA 5EOKA 4M9FA 5F03A 3RXOA 1XUHA 1RTKA 1CHGA 4IC6A 1C9TA 5DP8A 4THNH 3GCHB 2BD4A 2A7JA 6ESTA 1N6YA 3RU4E 4BAOB 1GL1A 4IBLH 2PSXA 1HAXB 2DE9A 1ACBE 4E06H 1KXCA 3LPRA 4I31A 2AS9A 3PM3A 5GCHF 2J94A 1PYTC 3GS9A 4X6MA 3ENSB 1NRRH 4OGXA 1O3MA 3F2FA 4AN7A 3VB7A 1JMOH 4H42U 4OS6A 4QT8C 1S83A 1V2KT 2SNVA 1TGNA 1TNHA 1LTOA 1G32B 2YMSC 1NFXA 1O2HA 2AIPA 2BD9A 1ELAA 5B6OA 1O3CA 1HJ8A 1YPGH 2GTBA 1UK3A 1YP9A 1UJ1A 3SJ8A 1DY9A 2QY0B 4R8TB 3H7TA 2TGTA 3H5CB 1O3FA 2TBSA 1IAUA 4Q7ZA 1OSSA 1UCYK 3FKSD 2KAIA 4X1QU 2M5TA 3UNQA 4GLYA 4NFFA 2FOCA 1HRTH 4FU9A 1IHSH 2SGQE 5FBIA 1IQEA 3M37A 3A7TA 1H9LB 2VIDA 5CHBA 3WWBA 2F9BH 1NFYA 4X6PA 1EOLA 3SZNA 2A7CA 4U30A 1GJ6A 1ELGA 1QZ8A 1TNLA 1XVOA 1THSH 1LPKB 3Q3KA 1C4Y2 3RC5A 1UTNA 2OQUA 2ZQ1A 1O3EA 2PKAA 1UTMA 1IQFA 4JK6A 4DJZB 1C5VA 1BHXF 1GJDB 2G00A 4B75A 3VEQB 3T28A 1GVLA 1EAUA 1YYY1 4ZH8A 1NFWA 4BXWA 2P94A 3KN2A 3BTME 1EZQA 2P8OB 2GCHF 3LJJA 1OPHB 2Y5GA 1MQ5A 3QGJA 1A61H 6GCHF 2Z9GA 1QIXB 2ODQA 1KLJH 3KGPA 1XUIA 4D8NA 1S84A 1Z8IB 1O38A 2JETC 3ZZDA 1SVPA 4ASUD 2PKSC 4TY7A 4DOQA 3T29A 5IK2D 4KTSA 3VB6A 2XCFA 4B76A 1HIAB 4Q7YA 1V2NT 4ISNA 4I86A 1NROH 4GCHG 1C2KA 2V6NA 2ZNKH 2G52A 4NSVA 1KXEA 4LZ4B 5HGGA 1IQIA 1MZDA 4ABDA 4ZHMU 1T31A 3E8LA 4KGAA 1GHZA 1MAYA 1SLXB 5A8XA 3D62A 1BTXA 2XOKD 5HKKD 2TGPZ 3RDZA 3TNSA 1ABJH 3CS0A 1V2VT 3ZZAA 2IPQX 2TRMA 8LPRA 2XNDD 1ZPCA 3ZZ6A 1Q2WA 1OS8A 1UHBB 1MQ6A 4OGYA 1P2QA 4VGCC 1AMHA 2QC2A 3M35A 1RIWC 2Y5HA 2QF0A 2F3CE 3SW2B 1VKYA 4ZKOU 2OC8A 2PR3A 4YLQH 2Y81A 3GY7A 1TBQH 4XFQA 1YPMH 2FP7B 1GHBF 1C5WB 2ANYA 5F53A 5KEDA 2BB4A 5GXPA 1V2QT 2VIWA 3V7TA 3BTFE 3AW1A 3PMBB 3MO3A 1OWDA 2PFEA 3UWJH 5F8XA 2ZU4A 5EGMA 3Q00A 4M7GA 3N7OA 5TCCA 2G55A 2YOLA 4X1PU 2ZHEH 2XYAA 1T8OA 1D9IA 4IN1A 2F83A 4ISLA 1EAWA 1SLWB 1X7AC 2NU2E 7KMEH 1TAWA 3RUOA 3FAOA 2LNCA 3UAIC 2Y80A 1SOTA 1TLDA 1C5PA 1YPHC 1V2ST 2VBCA 4NZLA 1G36A 3M5LA 3M36A 1YLCA 1BUIA 1H4WA 2L6OA 1CO7E 2UWOA 4TY6A 3U9AH 4YXWD 1B0FA 2YNBA 5B6LA 1A2CH 1SSXA 2AMPA 4INKA 2DE8A 2AIQA 1BRCE 1GBJA 1B0EA 3SJIA 5HM2A 3P8FA 1GG6B 4NZQA 1BT7A 9ESTA 1CSOE 3QX5H 3UUZA 3GCTG 2HWLB 1D6WA 1GWAA 1GL0E 1A1RA 1ZMNA 2M2AA 1UTOA 1FIZA 1FQ3A 4I7YH 3MYWA 2C8ZB 3U1IB 4WXVA 3PMHB 3SV8A 1ZMJA 3TITA 2ZGJA 5PTPA 1FN8A 1RRKA 2FYQA 1O36A 2G51A 4Y6DA 2O8LA 5HXFA 1C2LA 3HKIB 1Y3UA 4X2VA 1K0HA 3B8JA 1LKBA 3ZZ7A 1VGCB 4X0WU 4CBOA 2OC1A 1V2PT 4Y8ZA 2HNTC
chains in the Genus database with same CATH topology
1OKXA 4A6LA 2AMQA 3MNXA 4F49A 3UB0A 4NCYA 1AQ7A 2GZ8A 2FLRH 2XCNA 1HXFH 3TK5A 1ANBA 3QTOH 2ZPQA 2J2UA 3RXFA 2ZQ2A 3ITIA 1N8OB 2GZ9A 1ELVA 3UQOA 1SR5C 2FX6A 1K1LA 3K6ZA 3RXLA 3UPEA 1UVPA 1GBMA 3UWIA 1W13U 2EI6A 1FN6A 3BN9A 1HAYB 4YT6H 2NU3E 2VVUA 3KEEA 1O30A 3OFND 1DWDH 1O3JA 1C1TA 4NWKA 4RKJB 5C5OA 4BAMB 1H8HD 3BSQA 3F6UH 1GJCB 2HLDD 7GCHF 1J17T 1EUFA 3TGIE 1ELTA 1WV7H 1KY9A 2VIPA 3MO6A 1TGBA 5CE1A 3HK3B 4NA9H 1SB1H 4BAKB 2AERH 1TABE 1XUJA 1GBAA 4TWYA 4YOIA 5L6NH 3D23A 3QO6A 4F4OC 1GPZA 4UDWH 2BXTH 1ZHMA 1AFQB 1GBBA 3CS7A 2R9PA 4ZXXH 5E8EH 2NWNA 2OLGA 3A7WA 1BBRE 3LOXA 1O2VA 1Z1IA 1CU1A 3FZDA 4YOGA 1C5SA 5F8TA 1E79D 1G3EA 2P3TB 1KYNA 1P05A 2VIVA 1CA0B 2C8XB 2GD4B 3PTNA 1QNJA 3O8CA 3S9CA 6CHAC 1WYKA 2D8WA 2ZFSA 1P3CA 2PTCE 2ZIQH 2QIQA 1BRUP 2ZG0H 3CP7A 5AFYH 3AAVA 1KLIH 3MNCA 2V7QD 4X1RU 5SGAE 2BD2A 1Y5AT 3RM2H 2OC0A 2BVSH 1EB2A 3PRDA 4XD7D 1H9IE 5DG6A 1GGDB 2EI8A 1TALA 3F2GA 3U8TH 1OP2A 4I8HA 3F9EA 3RXDA 1DPOA 5JPMH 3LIWA 4IS5A 5EQQA 3BTDE 2ZGHA 1XMNB 3KQCA 2A5AA 2Z3EA 3LKWA 2H5DA 4JYTA 4MG3A 2Q6GA 3DA9B 3ZVBA 5GDSH 1MKWK 5CHAB 3RXVA 4AGJA 1PYTD 4K60A 1D3PB 2O9QA 2V35A 3RP2A 3A8CA 2FOMB 4CHAC 1AO5A 2VIQA 1K1PA 1C1VH 2A4OA 2AYWA 1GHAG 1Y59T 2BD7A 1BRBE 3E16B 4X8SH 3PLKA 1TPPA 4NIWA 4UE7H 1TNKA 2O8MA 1CT4E 4ABBA 3SYJA 2PTNA 1TA6A 1C9PA 3PO1C 3E91A 1FPHH 1SQAA 3V0XA 3OU0A 1TONA 3MTYA 4LXBH 1GCDA 3DSPA 1GCTC 1HXEH 1C1WH 1ZSLA 3MU0A 4MPUA 2WUBA 3MMGA 3VB3A 1QJ7B 1BMMH 1SGFG 4K1TA 8ESTE 3LH1A 4K2YA 3RMMH 3SO3A 1FY8E 3GDUA 3MHWU 3SJ9A 1FAXA 2CF9H 1QBOA 1EPTB 3E90B 1F0TA 3MH6A 1QJ1B 3RM0H 3P8GA 1HJ9A 1MCTA 1PJPA 1AB9C 2STAE 1C1UH 1GBDA 5I46H 1AVWA 1H8ED 3VPKA 1V3XA 3SU1A 5JB8S 1V6DA 1TGCA 4B6EA 1K2I1 1MU8B 4MNYA 2TPIZ 2BDGA 4GAWA 1H1BA 1O2NA 2GZ7A 2A4GA 5FPSA 1TGTA 3T2NA 5L2ZH 4AYYB 1S5SA 4K8BA 4JZIA 2IJD1 3PLPA 2EI7A 1BMAA 1E36B 1GHWH 2OD3B 1NM6A 1D4PB 4I32A 1HB0B 3ZZCA 2B8OH 3BEUA 4O03A 2VGCB 1GDUA 4CRCA 5GPIB 2Y7XA 5IYTA 2ZDNA 3VG8A 4Z6AH 3P95A 2BDAA 3BTTE 3BTHE 2GT8A 1EAIA 1IQMA 1C4U2 4AORA 2OCVB 1MBMA 3MU1A 1J8AA 4YOJA 3F0OA 5EQSA 1Y3VA 4FUHA 2P93A 1SGIB 2BQ6B 2SNWA 3HGPA 2THFB 4B1TA 4CBNA 2BHGA 2BQWB 1W7XH 1IQHA 1EJAA 2O8TA 2XWAA 3T5FH 5FAHA 3E1XB 5DPAA 1VITF 1GBKA 1PFXC 2P95A 4PROA 2KR7A 2FS9A 4KKDA 4E7NA 3ZVEA 1O2JA 3GY2A 1HAHH 1OWHA 3DUXH 3GY3A 4CH2B 1K1JA 1TBZH 3F3BA 1O35A 4K1SA 1B7XB 1NPMA 3UQVA 2ZA5A 4ZKSU 1O5BB 1A46H 5FL7D 3BTGE 1EP6A 1KIGH 2FDAA 2VNTA 2HOBA 5EXLA 3STJA 2WV4A 3SGAE 3FO8D 7ESTE 4OS7A 1T8NA 3VB5A 3WW7A 4Y10E 1EP5A 3EGKH 3RXBA 4GCHF 4Y7BA 3K2UA 2ZDKA 1WSSH 1GI4A 2R0KA 1ANDA 2DUCA 1NT1A 2FI5E 1UTQA 3TNTA 2BXUH 3GY8A 1O33A 2P3FH 3MNSA 1A4WH 3BEIB 3L3TA 4BTTB 3M3TA 1JIRA 3BIVH 1MD8A 1NO9H 2SGAA 1COWD 1DX5M 2FX4A 4ZXYH 4X2XA 5GIBA 2FOFA 1KXAA 1VCWA 4BXSA 3SI3H 1QL9A 1QJ6B 3SQHE 2GMTC 5FX6A 1HAPH 1GI2A 1CBWB 4MQAA 3SU0A 3SU3A 1TPOA 1D3TB 3RXEA 4IN2A 1O2PA 2TGAA 4Y0YE 5EG4A 2Q6FA 1QURH 4XDEA 2FI3E 1LDTT 1N6XA 1INCA 2XC5A 3SGBE 1GMHG 5C2ZA 2JJ2D 2UWLA 5DJ7A 2A45B 1NESE 2OTVA 1ETSH 1SLVB 5FX5A 2KCPA 1UTLM 3K6YA 4FETA 2VWLA 2UUYA 2Y6TA 1W11U 1CGJE 5C1YA 1BTYA 1PQ8A 5CDFE 2ODPA 3AAUA 3O8RA 3GYMA 1HPGA 2BYAX 3SV7A 3DHKH 5CMXH 1MTVA 1V2TT 1HAOH 1GJAB 3ATLA 3VB4A 4DIHH 2W3KA 1P04A 1ETRH 3B23B 4FUJA 1O5CB 2VH6A 3VGCB 1LPGB 3P17H 5LPEA 4B2AA 2G81E 1O2MA 4ZHAA 3PMAB 4TT3D 2H5CA 1O3NA 4Y7AA 2CMYA 1C2FA 1NRNH 2QV1A 4ZKNU 3ZZ5A 3A88A 3GCTF 5LPFA 2FS8A 1Z8GA 1YPEH 1AE8H 1OHHD 4A92A 1F5RA 4X1NU 1G37A 3UIRA 1WCZA 1WXRA 1HIAA 3LC5A 4WH6A 2VJ1A 4RKOB 1D3DB 1A0LA 1HAVB 3BF6H 4ISHH 3SBKA 3BTWE 2FM2A 4KTCA 3RXTA 1QGFA 3TGKE 2AFQB 1MBQA 1QL7A 1QFKH 1RJXB 1TYNA 3K9XB 4YO9A 1C5LH 1QQUA 4WMDA 4JZEH 1AN1E 1O3HA 2XNIA 1ARBA 1SOZA 4AB8A 4ZAEA 1BOQA 3A85A 2NU0E 3ZV8A 1UHBA 2QXJA 3FP7E 1AKSA 1GVZA 1IHTH 1NS3A 1GMDG 1OXGA 2ZGBH 3EQ0H 1O3PB 1CT0E 1C5MD 1ZOMA 1EATA 4FUCA 1GBFA 1PQ7A 4HTCH 2J38A 1EQ9A 1YLDA 2H9HA 1SGNE 2C90B 3NWUA 2R3UA 1LMWB 3OAAD 1H8IH 4KP0A 1V2MT 1ZJKA 1KMHB 2WSSD 2D1JA 1TX8A 3RXIA 3B9FH 4NGAH 4IMQA 2BOKA 4UD9H 5JBTA 4WMFA 2BVRH 4RI0A 1EX3A 2LPRA 1DY8A 2BOHB 3ELAH 3U1JB 3SJOA 2UUKB 3UOUA 1MH0A 3I29A 1P57B 3SNBA 1P2JA 1EOJA 2FODA 1VGCC 5DN6D 1LQEA 1P0SH 5FCKA 1ZPBA 5EXMA 3A8AA 3RXKA 4D7FA 3H7OA 3OY5U 3QDZB 1HAZB 1O3DA 4ABAA 1KLTA 4NSYA 1XXFA 2BY6X 5A8YA 1PPHE 3UNRA 2CF8H 1DLKB 3F9GA 2ZCLP 1HBTH 3LGWA 4IMZA 2H6MA 1DOJA 2SGDE 5A2MH 1C2EA 2SGPE 3AK5A 3TK6A 1NU7B 3SU6A 3LC3A 4K5ZA 2C93B 2ZC9H 4ZUHA 1J15A 2Y82A 3LGVA 1FY5A 1AZZA 1LHFH 2CHAB 2QXIA 3EAJA 1P06A 1MTUA 1GBHA 1QRXA 1W0ZU 4A1TA 1F2SE 3PB1E 3RXUA 4D9RA 2A5KA 4E05H 3RXPA 3FZZA 1GVKB 1CE5A 1HAIH 4JMYA 3KNXA 3QN7A 1VJAU 2QF5A 2KAIB 5A09A 1O3BA 3V12A 3D49H 1ABIH 5EU8A 1YCPH 1P2OA 1EAXA 4FVDA 1LO6A 2W7UA 2KZ4A 4DY7B 3F68H 1FX0B 4O3TA 4B2CA 1AFQC 5TCAA 1AGJA 1DUAA 5EPNA 4MNXA 3RLYH 1A3BH 1OYTH 4Y76A 4YM9A 1GHAF 1TMUH 3KF2A 4D9QA 1JRSA 4SGBE 4CRDA 1TE0A 1BMLA 1W12U 3QZRA 2A2QH 1CA0C 2ZF0H 5DO4H 1BQYA 1QCPA 4RN6A 2ZTZA 1QA7A 1UVUH 1WUNH 1O2OA 3RXCA 3PMJA 3VFEA 1AHTH 2ZDAH 4O3UA 2R2WU 3U69H 4U01A 1OWIA 1G30B 2QGRA 2KCOA 1TA2A 1TBRH 1BTHH 3ODDA 5DP4A 5T1VA 1UVSH 1Y3WA 4H4FA 4LK4A 4FUBA 3MH7A 1HUTH 1PPBH 2JH0D 2ZI2H 4NWLA 1PPGE 4Y79A 1S6HA 5F8ZA 2YNAA 2VWMA 3ZIAD 1DWEH 3A83A 1GJ5H 2V0BA 2FI4E 2G4UA 2XBVA 4XBBA 1YCPK 2GCTB 1BMNH 1DS2E 1T8LA 2BY9X 3GY5A 3TH3H 2ZEBA 1SL3A 4MPVA 1C2IA 1S81A 1O5AB 5CHAC 3NPSA 5FXLA 1IQNA 5EQRA 1LCYA 4NA7A 1A0JA 1JRTA 1P9UA 2F43B 1MCVA 4AX9H 4U2WA 2ZGXH 4XBDA 2HLCA 4FU8A 5FCRA 3A7VA 2ASUB 1T32A 2C8YB 1VZQH 2GT7A 1XUFA 2ZFRH 2ZHWH 1FV9A 4DW2U 2BDBA 2PUQH 3I78A 1BJUA 4BOHA 3SV9A 5DP7A 4INLA 3NRLA 4GVUA 1RTFB 3NZIA 5JBBS 1ANEA 1P2MA 3F2HA 5AF9H 1O32A 2AEIH 5FPYA 3ESTA 5DP3A 4AFUA 1F0SA 1S85A 3QZQA 1K22H 2Y5FA 1SFQB 2B0FA 1L1GA 1TNGA 1GJ8B 2W7SA 2ESTE 5C5NA 6LPRA 2PKSB 2B5TB 3BEFB 3RXRA 3PWCA 4MNWA 1ESTA 1GBEA 4FUFA 5DP6A 3OTPA 2WHXA 4DT7B 1CQQA 1RFNA 4Q4LA 3G01A 2HPPH 1LVMA 3A8DA 1AUJA 1C4V2 1G3DA 1WAYB 4X6OA 1QL8A 2UUJB 5J4QA 3STIA 1A3EH 1SGCA 5HYOA 1P11E 4HZHA 3RC4A 2PWXA 1O39A 2EC9H 5IDKA 1THPB 3E3TA 2SGEE 1CHOF 1W2KH 4CRFA 4OS5A 1D6RA 1QRZA 5AVDA 1ARCA 2F9NA 1DSTA 4VGCB 3L33A 1Y5BT 3ZZ8A 4Y0ZE 1RIWB 2BMGB 1WTHD 3FANA 1ETTH 2ZCKP 2ANMH 1SBWA 1CGIE 1BDAA 2CJIA 3NKKA 2WV5A 4BANB 2VGCC 2Q6DA 1HNEE 4DVAU 4Y8YA 3SORA 2ZTXA 3RXSA 2ZU3A 1K1IA 2QCYA 1LVOA 1SHHB 1RGQA 1IOEA 1W14U 1GI6A 1O2SA 2SGFE 1NBMD 1QTFA 1TX7A 1C5NH 3Q76A 3GY4A 2VH0A 2FPZA 4X8UH 1NRSH 3M7UA 1LKAA 2WV9A 3GDSA 1QY6A 2C8WB 1ANCA 1DUEA 4Z1MD 2FLBH 4K8YA 1MTSA 2WUCA 5A0AE 1O5EH 1TGSZ 3RXJA 4FXGH 4AOQA 2RA0A 5EODA 1AIXH 1O3OA 1SMFE 4A5TS 1O0DH 2G5VA 1MTNC 2BY8X 2UWPA 1G3CA 2ZFTA 2SFAA 2FOAA 3A8BA 3URDA 3E0PB 1GHXH 4ABGA 1HFDA 4RSPA 4NA8A 4R0IA 2C4FH 2R3YA 4AG2A 1AVXA 4XOJA 1Z6JH 1YPHE 2YMSD 1C2HA 1EB1H 1GMHF 1E38B 1PQAA 3AVZA 3K65B 2ZU5A 2Z9JA 1L1JA 1XX9A 4MVNA 1JXPA 2ZZUH 1SGTA 1OYQA 1Q3XA 3A80A 2Z3DA 1S6LA 3H09A 2GDEH 1C2DA 3ODFA 3QK1A 3BG4B 2JH6D 1MZAA 2KM0A 1O34A 2G5NA 2CGAA 3SZEA 3A84A 4AFQA 4MNVA 4CREA 3QUMP 1DICA 5H4IB 5C0TA 5FPTA 1FNIA 1GBTA 1Y3YA 1ZHPA 1LHEH 1BTZA 1RS0A 5GNDA 4B6FA 1KTSB 1EKBB 3FVFB 4OS1A 1KXBA 4TPYA 1BBRH 3OTJE 1UK2A 1IQGA 2ZDVH 4Y11E 3O8DA 4DG4A 1V2OT 3IITA 1FY4A 3ATKA 2HVXA 5DP9A 2WPHS 2W6JD 3ZZBA 4Y71A 1L4DA 4NG9H 1CBWC 2NU1E 1FY3A 3LT3A 2HNTE 5C0UA 4ZMAH 1ZGIA 2K1QA 1O2RA 3TLOA 4H6TA 2B9LA 3SU5A 2J5UA 4YESB 4Z0KA 5HMAA 1M9UA 1T8MA 2XWBI 3DT0H 3CENA 3QTVH 3SNDA 3TK9A 1FZZA 1TMTH 3A82A 1TNJA 1TRYA 1Z7KA 1HJAB 1DE7H 1HV7A 3F1SB 4GHQA 2XC4A 5LGOA 3LH3A 2CK3D 4I8GA 2ZDLA 1CVWH 2FTMA 1AWFH 1W3CA 1LVYA 1SPJA 3GCHC 2A5IA 3P70B 2IJOB 5JDUB 1GI1A 2GDDA 2ZO3H 5C1UA 1E34B 1Y3XA 1GMDF 4B74A 1C1NA 3OE7D 1K28D 4WJG2 3R3GB 3HATH 2TGDA 4AB9A 1BBRK 2ZGCA 3VGCC 3MH5A 2PGQB 3EA9A 3RXMA 1EZSC 2HALA 4DURA 3HGNA 1ELDE 4OM9A 3SUDA 1HLTH 3GYLB 1K21H 2ZWLH 1DDJA 2I6SA