2OBYA

Crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Putative quinone oxidoreductase
total genus 98
structure length 334
sequence length 334
chains with identical sequence B, C, D, E
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2obyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2obyA01
4PVDA 5AVOA 4G81A 2DKNA 3IP1A 3QJ5A 1R6DA 3GEGA 3IP3A 2YQ5A 3ZN2A 1M76A 3CMMA 1QXSA 1PJLA 5T57A 4B79A 1EEHA 4GWKA 4BIIA 4W9NC 1OC2A 4XYMA 5AXBA 4ALKA 3VPSA 5L4LA 1E1LA 3AWDA 4E32A 2YZ7A 1EFLA 1B26A 3JYQA 3FI9A 4IDAA 3RSHA 1U8FO 2AXQA 4U0JA 5CAEA 4YBZA 1GV0A 3TPCA 3E48A 4XGKA 1J6UA 1ONOA 5KJEA 4YR9A 1H0KA 1N7HA 4NR0A 2C7GA 4DLAA 4O5OA 4AVYA 3VTFA 3DHYA 3OJEA 3WGTA 4GSLA 4J7UA 1P3DA 5B1YA 4FR5A 1HE2A 2DBZA 3PQFA 3L07A 3ZWWA 1YONA 2JFHA 1UH5A 2GZ1A 2HSDA 3RBVA 1AUPA 3D3EA 3PHJA 5K1SA 1EK6A 2Y0EA 3NDRA 2WTBA 4EEZA 3BTSA 4CQLB 4L4RA 1R0KA 4CM9D 3DOOA 3W6UA 3AU9A 1J0XO 1YE3A 2AE1A 1Q0QA 4BNVA 4IQ0A 1IE3A 1XLTA 3K8ZA 1UZNA 2Z95A 2B4TO 1UZLA 2RCYA 5DF1A 3R3JA 2AEMA 3NGLA 4OAQA 5DN9A 1DIAA 1T1RA 4BO7A 4XB2A 1L7EA 4MVJA 3H2ZA 3PDJA 3PQEA 3C24A 1Z82A 4I1IA 4RGBA 2GZ2A 3I6IA 2X0IA 4BNXA 4MINA 1Z73A 4RVFA 1ZUD1 3PVZA 3UCEA 1H6BA 1O89A 1IULA 3W8DA 5KCZA 4II3A 2UUPA 3GA0A 1DAPA 4NH4A 4GQAA 4DIBA 1F8FA 5CFZA 4XZ3A 1PQWA 2HK8A 3PIDA 3IL2A 2SCUA 4TWRA 1BTOA 5DOVA 2HJSA 1ZSVA 2EP5A 1HLDA 2FHSA 4R41A 3L77A 2XAAA 5TF4A 4A2CA 2A92A 4NI5A 1E6WA 1HDGO 3L9WA 3E9NA 2HQ1A 3IOYA 3RFXA 3COSA 1SB8A 4CLHA 2NNLD 5JCJA 4C7JA 5KVSA 1LDNA 4IJUA 4HFMA 4NQZA 4M89A 4BNUA 5I7FA 1HZJA 2JD2A 2VOEA 1PGJA 1AXGA 1KERA 1DRWA 2O3TA 4JCOA 4FJ0A 3TF5A 4N7RA 5T8KC 4A26A 4K26A 5ITWA 2Q50A 1U8XX 3GUCA 2FZEA 3PFFA 3KYBA 3NTOA 1GCOA 4BGEA 4ND3A 2DTDA 1VSVA 1VSUA 4IDBA 4A7PA 2G17A 5I7SA 2VWHA 1OC4A 2J8ZA 1FDUA 4Q3DA 1NVGA 3ZZNA 4DXHA 2EW8A 5TX7A 4W9NA 4RV9A 3V1UA 3ZGYA 1X14A 1MG5A 3K9QO 1DFHA 2QZ9A 3V8BA 4CM3A 2C7VA 3F46A 4HY3A 1HRDA 4YEDA 3ZWNA 1CEQA 2VHVA 1HT0A 4JJFA 2ZTVA 1RM3A 1PTJA 4HP8A 1GYRA 2ZQZA 3EY4A 4QFCA 3DMYA 3L6EA 1YDEA 4PRKA 2NTNA 4YT2A 2HMVA 3K30A 4D45A 3RUDA 1FDVA 3TFOA 3ANLA 1EFKA 3DO5A 3UUWA 4DL9A 3AM5A 5DT9A 2Q3EA 4UVIA 3M2TA 4ONEA 3PDUA 3VZQA 4GLLA 3CEAA 4DLBA 1DC5A 4JBHA 2FPIA 3KZVA 1Y8QA 4YAKA 5TJHA 3WGQA 1ZVMA 1TB4A 3ZNQA 3GG9A 5CG2A 1PU2A 3WJAA 4ILKA 3WOHA 1G1AA 2PGLA 4UULA 1B2LA 5TSDA 2EXXA 4PN3A 1JWBB 5IXSA 1H5QA 3S2EA 5LCXA 4ZN6A 5DCWA 4LCJA 3ZWPA 3P5SA 4RORA 3LLSA 4WCFA 5H83A 4BKUA 2P91A 2HAEA 1NHWA 2EW2A 3KSZO 4W99A 5IDWA 1WMAA 3DHNA 3ZH2A 3NEPX 2BRUA 2EF1A 2BGLA 4LCEA 1U4OA 4CMGA 4RF5A 2YV3A 3KEQA 4CM4A 4RJTA 2DBRA 2FN7A 1UDAA 2OOSA 4QTZA 1ZMOA 5A9SB 1UP4A 3WQQA 3PWKA 4UUOA 4BV9A 1HE3A 2AG8A 4E30A 1EE9A 4F6LA 2VWQA 2DTXA 3OBBA 3FWZA 2DFDA 3TL3A 3ZU3A 4ZHSA 2Q2WA 2O48X 3A1NA 4R1UA 2BHLA 3I9MA 2POQX 4WLUA 1GPDG 3WB9A 2DM6A 5JY1A 1GZ3A 3GMSA 2C20A 1NWHA 2PD3A 3E5RA 1DEHA 1CERA 3OJLA 4IJKA 4J1TA 4BKOA 1Z7EA 1BXZA 1NNUA 1MXHA 4AJJA 4XJSA 2O4CA 3KHUA 4BO9A 4MVJG 1UJMA 5EMHA 5IZCC 5TNXA 4WECA 5JSFA 1D1SA 1NVMB 4Y67A 5HS6A 2D3TA 1PWZA 4Y6PA 4II2A 1LDEA 3PJDA 1KY5A 4PLVA 5JO9A 3U3XA 1ZCJA 4FFRA 3AU8A 1JQBA 3L6OO 4WOKA 1B3RA 1JU9A 1T2FA 3JQBA 4YDRA 3ZHBA 1NPDA 1GADO 3BMCA 3H9JA 5DDIP 2PD4A 2D0IA 2VHWA 1UAYA 1FXSA 2VT2A 3VH2A 4BL5A 4P38A 4WLEA 4Y6SA 2DQ4A 2X86A 2WWRA 3B1FA 5COBA 3SLKA 4ND1A 3KYCB 4CR8A 4H15A 4JX8A 3S1LA 2W2KB 3IAHA 5BR7A 2VHXA 4BMNA 1RM4A 1KS9A 2VOJA 2FPPA 3RUEA 2IZ0A 1QLHA 4WCFB 1NFFA 1PEDA 1JLLA 3RD5A 1NFRA 2YHUA 4MOWA 1NYTA 2QIOA 1N92A 3FWNA 1GZ4A 4LK3A 1Y1PA 4XIJA 5IJZA 4JNKA 1ZK4A 4XWYA 1O8CA 1XSEA 3WNQA 1RM0A 2JD0A 3OIFA 4P4LA 4BNKA 1BW9A 2D5AA 1E3WB 3GZNB 4YAGA 2FPGA 4YJGA 2FSVA 2X9NA 5IAAA 1V9LA 1OI7A 4RPGA 3VH1A 4U5QA 3GVCA 1X15A 5H81A 3GR6A 2O3RA 5EIOA 4Q9NA 4D79A 3BTOA 3BAZA 2CDAA 4J1SA 2NU6A 1DOHA 3AY3A 4PG5A 4IY1A 2ZJ0A 4CMHA 4W7HA 2VWGA 4JBIA 2Q99A 3TDKA 5GZ3A 4D3DA 2RIRA 2AMFA 2BFMA 1I3LA 3FD8A 4CV1A 5A1TA 3F47A 5I9LA 3X2EA 3HSKA 3EUWA 4MIEA 1HDXA 3QE3A 1TXGA 4CMEC 5JNLA 2Q2QA 4BMVA 4TKMA 3H7AA 4E21A 4NBWA 2FZWA 5G0TA 4KP7A 1XWFA 3I9OA 1Y8RB 3JD2A 4MKZA 1Y8QB 2I76A 4DPKA 1BDMA 3GFGA 4YAJA 4U6QA 3MJVA 2X5KO 3QVWA 2NQ8A 4J0EA 2DBVO 1PL6A 5T64A 1NP3A 1HXHA 4XYBA 4B3IA 3IIEA 2D8AA 3PHGA 2UYYA 3S55A 2P9GA 1P44A 2CZCA 1X7GA 2VNSA 4PVCA 4DBVO 2GLXA 1U3UA 1H94A 5TC4A 5JYEA 2O3QA 3ON5A 3IC5A 4FN4A 4M55A 1XHLA 1U7HA 3RC2A 3JQ7B 5TT0A 1DHRA 5G4LA 5IDYA 4R54A 1MLDA 4I08A 4NBVA 4R9SA 2HK7A 5IZCA 4FQ8A 4H3VA 3PZBA 3E1KA 2VYND 4BO4A 1Z74A 4E3ZA 4FIZA 3MJEA 1I33A 4DWVA 1QKIA 3W4KA 1DC6A 1GZ6A 2Y66A 4I8XA 3INTA 4JGBA 3C3XA 4R1SA 2NVWA 4FCCA 2VZ8A 4UUPA 1JW9B 3Q9NA 4JXKA 4XRRA 2P9CA 4E2YA 3TSCA 4U0KA 3D3WB 3W4IA 3GGPA 1LLDA 3WR5A 4OYRA 2V65A 2R2GA 4FD3A 3AOEA 3M6IA 1XEAA 4ND4A 5HS4A 4BO1A 4KWHA 3C1TA 3HQ4O 1T25A 3VKUA 4EUEA 4BUCA 5L95A 2Z1NA 5AXCA 1ZK2A 3BHIA 1CWUA 1WW8A 3U0BA 4I9HA 4P4NA 1E1KA 1KVQA 2VRCD 4RLSA 1X1EA 3WTBA 1XU9A 1PJCA 1ZH8A 1BVRA 4QO7A 3GN1A 3W8FA 1GD1O 3KYDA 1NQOA 3ZV3A 1GV1A 5A9SA 3KM0A 3WIDA 4Z9FA 4R1TA 2I3AA 2VTDA 1T24A 3G17A 3G79A 3ITDA 1O5IA 3GNQA 1E7QA 3INGA 2EERA 2NTVA 4MVJH 1U4SA 4B4UA 4CMIA 4IDCA 3TZKA 4E5YA 1RYEA 1LNQA 4XQGA 4OOFA 1P9LA 3BA1A 3DDNA 4AJPA 2GN6A 1JTVA 3JQ9A 3KBOA 4GSKA 3LVFO 3PFWO 1HSZA 4CMBA 1YQXA 1PJBA 1T2CA 1BRMA 4NHEA 2J5RA 1VL8A 3U4DA 3QIVA 2OXIA 2ILTA 2NACA 1VLLA 1PJ3A 4GX2A 4ND5A 1GEGA 1IL0A 3I9JA 1G0OA 4B3HA 2Q1TA 3BHMA 2ZCVA 4BNTA 2ZB8A 4O0LA 3CTMA 4OH1A 1YOVB 4G2NA 4GX1A 1ADBA 1MFZA 4BGUA 3SJUA 1E3EA 4D0SA 3R1IA 5EQFA 3UCXA 3H2SA 1TI7A 1EMDA 3ZU2A 4UREA 1YRLA 2Y67A 3AOEC 3IUSA 1A9ZA 4PG7A 3C7CB 3NT4A 1QG6A 4WOJA 4IGEA 2J3IA 3LSYA 1EK5A 3H5AA 3I3OA 3PGXA 3RC7A 2FY8A 3ZV5A 2RAFA 1FDWA 5JDCC 1LLCA 1ML3A 2X1HA 3IS3A 5F3RA 3E9MA 2Q4BA 5HBRA 4UVGA 4DIOA 3QP9A 3WQSB 2W98A 2ZB3A 4OKIA 4ZICA 3GG2A 3U4IA 3N74A 2PLAA 1JAYA 1DHTA 4FC7A 4MVJI 1ZK0A 3ENKA 1R0SA 4BNFA 1ONPA 2CF5A 5U4QA 3DR3A 2X5JO 3SC6A 2G1UA 3RJ5A 4DRYA 3T7EA 3ZU5A 3TFQA 3O8QB 4BKRA 5IG2A 1P1JA 5JMWA 1V3TA 5HM8A 3TN7A 1DIGA 5BSEA 5EN4A 4FS3A 4S3MA 1ENYA 3FNFA 4MVJE 5BNFA 1ZW1A 1YXMA 5G4KB 2YYYA 2BFAA 1A71A 4PCVA 3HN7A 3BMOA 4D44A 3H65A 4Q3AA 2PZMA 1X7HA 2AHRA 4QO8A 7MDHA 1BMDA 3F3SA 4TVOA 5CDUA 5C7LO 3AUAA 3DBRA 1SOVA 3AJRA 3SX2A 2Z1MA 3H5NA 5H82A 3B20A 2X0RA 3ZNNA 1TT5A 3NJ8A 4P8RA 5I7EA 3OSUA 4IINA 2ZB4A 2BELA 1PR9A 3W8EA 4N5NA 2DU8A 1Y5RA 2Y1DA 3AUUA 3DB2A 1VC2A 1R66A 3ADPA 4IXWA 1K3TA 4HADA 2YDYA 1JDJA 1KEPA 1NASA 3AY6A 4ESOA 1DIRA 1DIBA 3KYCA 3LC1O 3E5MA 4AJEA 2Y1CA 2VUTA 2NVBA 3GC6A 1PZFA 3LF1A 1BVUA 3JQ8B 7ADHA 4RDHA 2C0CA 3WG9A 1D1TA 4DA9A 4NU6A 2RH8A 3BYZA 1HDCA 2C5AA 1I2BA 4P22A 4OQYA 2JCXA 4IDGA 4BNGA 3D64A 4TRRA 3D4OA 1DB3A 2XXJA 3U62A 3RWBA 4CLRA 5A02A 4XA8A 3I9LA 3PYMA 4JIGA 4KQXA 1J5PA 1H6DA 1YGYA 4B7XA 5JCXA 1K6XA 1SPXA 3PP8A 2GZ3A 1KVUA 2WD8A 4DGSA 4CODB 2H63A 1NPYA 2OUIA 4KDEA 4MP8A 4OOEA 3DWFA 4HNGA 1WXDA 3WFJA 3AFMA 3GGOA 3DAGA 5COQA 5ICSA 4RQUA 1I0ZA 4W4TA 5JC1A 2BFOA 3QW2A 1MUUA 2VYVD 1YL7A 3B70A 1EBUA 1U28A 2PNFA 3DOJA 3PWSA 4YCAA 4F3YA 1O94A 4MVJD 1QYDA 2OL4A 3O03A 2BH9A 5JAIA 4WNIA 1UXKA 4BNIA 1VKNA 1C1DA 3GEMA 1QYVA 4AJ4A 1PSDA 4MVJP 1LDYA 1O95A 4E12A 1ZFNA 1ZMTA 1HDRA 1T1SA 3WWYA 1IZ9A 1ADGA 3B1JA 1KEWA 3TZHA 1Y5MA 3WGHA 1SMKA 2FWMX 4WCDA 1OBFO 2J3JA 3MWDB 3ONDA 2ZK7A 5G0SA 4DPMA 4EBFA 2GRAA 4CV0A 3JV7A 4XIYA 3O4RA 2BF7A 2VTEA 3QWHA 5L3ZA 2IYPA 1I32A 4J2OA 5T5QA 2B36A 3EW7A 3HJAA 3RUFA 4A03A 5IF3A 3FPCA 3FCOA 2PTGA 4Z0HO 1HZZA 2Q1UA 4YRBA 3MOGA 3I4FA 5CEJA 1E1MA 3EVNA 3PI7A 3R3SA 2X23A 3VH4A 2B83A 3EZLA 3LLVA 2A94A 4YQYA 5GZ6A 4B3JA 2NV6A 1LDGA 2BKAA 1YOVA 3M1LA 1E5QA 1N1EA 3TJRA 3LC2O 4MPDA 1H9BA 2XPCA 2PY6A 4EYEA 3EZYA 4E31A 1CQIA 5L7YA 5B37A 4I9UA 5TLSA 1EVYA 1R16A 1LSUA 3WSWA 1BSVA 2GGSA 1OZAA 5EL0A 4FSHA 3DBLB 1DLJA 1A7KA 2B4RO 2PR2A 3F1KA 4UEJA 2VYVA 4XQ9A 4AJOA 5G2OA 1C1XB 1U9JA 3LT4A 1P0CA 4IDDA 3B6ZA 3ZWVA 4ALIA 3BMNA 4DUPA 2HMUA 2P5UA 1HYGA 1XQ1A 4E5KA 3WMXA 2B69A 4M49A 1HDZA 1QYWA 1WDKA 2XF8A 1LU9A 2WE7A 3ICCA 4WCFC 2IE0A 1TT5B 1NHGA 3ETDA 4BQRA 5EJ2A 5FF9A 5BQFA 5ADHA 5ILOA 4PLCA 3AY7A 1CDOA 1ENZA 3A14A 3GNSA 2WSBA 1ZEJA 3DBVO 4GX0A 4YJFA 1GPJA 1QORA 4NZ9A 3WGIA 1P1IA 3RKUA 4BKPA 3SEFA 4E6PA 1K2WA 4Q3BA 4W6ZA 3U5TA 3WGOA 5KVVA 4FGSA 3F5QA 2G5CA 2GCGA 1ENPA 5DNAA 4UUNA 4ZGWA 1GY8A 1YB5A 1OFGA 4RF2A 5JAQA 4Z3DA 2YFQA 1EVIA 4XDYA 4ZJUA 3RUHA 4FB5A 3UOGA 4JP3A 3GY0A 1IYZA 1AN9A 5KIAA 1QRRA 2W4QA 1OOEA 1VL0A 1VRWA 4G65A 5CDSA 3L9XA 3WWZA 1JN0A 3WS7A 5CPBA 4D3SA 2JL1A 4CM9A 3GVXA 3DBRB 3ZWAA 3V1TC 1B0AA 1YB1A 3ZWOA 5HA5A 3JQEA 4IQGA 4E33A 1I8TA 5FEUA 1WMBA 4EITA 4RPLA 2VHYA 3GN2A 1I30A 1LTHR 2O23A 1MC5A 2C59A 3KB6A 4MKXA 4NBTA 1VPDA 5FYDA 4KUEA 1G0NA 4RLHA 1MXFA 2R00C 1E6UA 5KVQA 1PGNA 2Y93A 2AQHA 1HDOA 2CVQA 3FBTA 4NG5A 3WGZA 4BO2A 1DBVO 4FFOA 2YHIA 1KC1A 2OP1A 3NTQA 1CF2O 3EC7A 3H4VA 2W2KA 1I2CA 3UH1A 3O9ZA 4R9RA 3VVBA 3ZU4A 1L7DA 2EKPA 2WYVA 3OETA 2GYYA 2RHCA 3Q6IA 3JQCA 3Q2IA 1N8KA 2O50A 4XR4A 3D5TA 1SOWA 4Q3EA 4FDAA 3ROMA 1GUYA 1G6KA 3I6QA 1WWKA 4KOAA 1GU7A 5A9TA 4C4OA 1HF3A 3G1UA 5A5FA 4LRSB 1LDMA 2V7PA 5GMOA 1LJ8A 5AOVA 3R6DA 1LBEA 4OSOA 4WJZA 1EVZA 2PKQO 1W0CA 5JY6A 1XKQA 1IHYA 4EJ0A 1AE1A 1ENOA 4FPXA 2AEJA 1Q2XA 5L4SA 1BDBA 5ILGA 3PTZA 4CPDA 2Q45A 1C0LA 4CJXA 1EQ2A 3JQFA 1LI4A 2PZLA 1KBZA 2WDZA 1P31A 3N58A 4PGFA 3BXXA 3S2FA 2EP7A 4ZRNA 3VZSA 5KTKA 1GTMA 4NBUA 4UVDA 4FW8A 2AQIA 4BNJA 4L4SA 1L1FA 5F21A 2AE2A 1Y9AA 1ISFA 1TT7A 2ZCUA 3LQFA 1UDCA 3DMTC 5THKA 1B14A 1FDSA 2O2SA 3DEYX 3H9EO 5CG1A 4PLZA 2IXBA 1C1XA 3H3FA 3EMKA 4U7WA 2Y99A 3Q11A 3ZWBA 1MP0A 4D42A 4Z9XA 4KTTE 2EWMA 4YB8A 1QYXA 4ITUA 2O4UX 3SJ7A 1T4DA 2E4AA 1FJHA 1H2HA 2GERA 2IDZA 2J3KA 2D59A 4O1MA 2P4HX 4WEQA 5DP2A 4KMSA 3ROPA 3PJEA 4RQTA 5EQDA 5MGBA 4JN6B 1GCUA 1YKFA 4ALLA 3L4BC 5TJ9A 1PGPA 2YW9A 2P2SA 2E37A 2AEFA 3GDOA 3WFIA 5A4DA 4IJVA 4CUJA 2B5VA 4IZIA 3AUTA 4DC1A 3G1TA 1ZO8A 4UVHA 5IDQA 3MCVA 1TVEA 3ZHXA 4PZDA 4YRDA 2B0JA 3TOXA 3WBFA 4MDHA 3WLFA 3IJRA 4BO3A 1JVBA 1KY4A 3D4PA 4BNHA 1M67A 3CE6A 1E1NA 3WYBA 1YJQA 3I83A 1E3WA 3GZNA 2OGUA 3TZQA 1YBVA 2BI7A 1B8UA 4R01A 3OH8A 1ORRA 4RO0A 3ADOA 1YWGO 2DUUA 2Q1SA 3RJ9A 2I5PO 3AM4A 4LW8A 1B8PA 2E49A 3H9QA 4DREA 3C85A 4KDFA 3KLMX 1JVSA 4QSMA 1QV6A 1RYDA 3DTTA 4CQLA 1VM6A 3PXXA 4IS2A 4CMCA 1R12A 2CMDA 1B16A 4EJ6A 4BMSA 3NKLA 3OJOA 5JXWA 3ETGA 3CXRA 3DBHA 2NWQA 1N2SA 3GGGA 5C5IA 1VE9A 3WXBA 8ADHA 5IFLA 2IRWA 3OEYA 5CDTA 3NGXA 5DBFA 2EKLA 3LT1A 3KOUA 5COAA 4KTVE 3DMTA 4DLLA 2E48A 5EESA 1BW9B 3BMQA 4QECA 5I7VA 2Z5LA 3MJ4A 4L74A 3VDRA 2PKQP 1HL3A 3G3EA 5JPIA 1H6CA 2WD7A 1P74A 2YJZA 1Z75A 3E82A 3GLQA 4GBJA 3UCFA 5ES3A 3HB4X 2CDCA 1PZEA 4L8VA 1HE5A 2G76A 1XYGA 5KWEA 4URFA 3QLJA 3NUGA 1XDWA 3WNVA 4DYVA 5TIIA 2JHGA 3AFNA 1NQAO 3HFSA 1DFGA 2Y05A 1DC4A 3GAFA 2ZKLA 1PS8A 3MZ0A 3PJGA 4J9UE 2Q1WA 4B7UA 5EPOA 1SNYA 1EDZA 2JKVA 4CR7A 3W6ZA 1R37A 1E7YA 1XU7A 3STHA 1MC4A 5B12A 3I52A 4EUFA 1E3LA 3PHIA 3OIDA 4K6CA 1BGVA 4XR9A 2I99A 3E18A 1IUKA 4Q39A 1S7CA 1E7SA 4D46A 5K6AA 5TGDA 1U5CA 2R6JA 3RIHA 4AFNA 4R3NA 4PLFA 2OMEA 5KNLA 3PWZA 3FHLA 4ALJA 1NTOA 4RVDA 4EGFA 2FOIA 1BXKA 5L7TA 3OF2A 1EZ4A 1N5DA 2ZTMA 4LMPA 2RH4A 4Z0PA 3ZI0A 2JD1A 1F0YA 1NQ5A 1Y6JA 4GAEA 4B4WA 2P68A 3K96A 4CLEA 3X2FA 1IPFA 2DC1A 3OQ1A 4DQUA 2QYTA 1DRUA 6LDHA 1HDYA 1Q1NA 1A7AA 3ANMA 4TRMA 2GN9A 1V35A 4DBZA 5KKCA 3HUDA 3AI3A 5CHEA 3M2PA 4YWJA 1XQ6A 4TROA 1KVRA 1X13A 3IMFA 4NU5A 1F14A 3MJCA 3QVSA 1DSSG 4FJ2A 3RUCA 1GQYA 1DAOA 5ER9A 3GRPA 4C7KA 4OL9A 3PZRA 1GQQA 1E7WA 2O7SA 4K6FA 1GEEA 4ND2A 4QEDA 2Y1GA 3NDJA 4TKLA 1ISIA 2CSUA 1DXYA 4R5MA 4BVAA 2X0NA 1E7MA 2D4AA 4WLFA 3QSGA 5EINA 2YFHA 3OECA 3DBLA 3HHPA 2CVOA 2QRLA 2FRDA 4PLYA 5LDHA 4WLNA 3O38A 2VHZA 3QVXA 4TZTA 1ZXBA 3U49A 2G82A 4NK5A 3OFSA 5IZ4A 3CPSA 3E03A 4AJKA 3DHEA 3RC9A 3ULKA 3W1VA 3ONFA 4GVLA 2Y68A 3KV3O 1I3KA 2WYWA 4R1NA 1O9BA 3VPXA 4EI2A 4WLOA 1N9GB 4W7IA 1DFIA 2QRJA 2X6TA 3IKTA 4DMMA 3KXDA 4GMFA 3VOSA 5JC8A 2I6TA 4LVUA 5KVCA 1P77A 1AHHA 1E0DA 3Q1LA 4O59O 4XD2A 1IY8A 3GQVA 3FNHA 4TVBA 1K0UA 1X1TA 3BMQB 3D4NA 4GPD1 5ER6A 4CMIB 4YQZA 5BSGA 3EHEA 3RI3A 4B4OA 5A3VA 3JQDA 1E5LA 3AK4A 3ICPA 1ZJZA 2I9PA 4CL3A 4D43A 4A0SA 3JQAD 1P1FA 1DRVA 2AQKA 3JQ8A 1DJNA 4XYLA 2RBEA 4OXNA 5I9MA 2OBYA 2HRZA 1IHXA 3OA2A 1U2DA 3VHRA 1NR7A 4JP2A 4XGIA 1XELA 2QYSA 2W2LD 3ZNOA 3PLNA 1M66A 5TS3A 4AJ2A 3OA0A 3JQ9C 4TRNA 4LGVA 3I4CA 3H6KA 2FSSA 3OQBA 1FMCA 5LDGA 1T2DA 1BHSA 1GUZA 1PZHA 3IKVA 1KOLA 4CV2A 4YRAA 1PQPA 3O26A 5CPFA 2NSDA 2CFCA 2NADA 1V8BA 4YJDA 3V2HA 1LSSA 4PG4A 3EGOA 4YT5A 4JLWA 3DTYA 1C0PA 4BNLA 1BXGB 4CM1A 2Y0DA 5BSHA 3JD4A 4DQVA 4OSPA 3QQPA 3BMOB 4L4XA 1X7DA 3D1LA 1BG6A 3QWAA 1NX6A 4MIYA 4GGOA 3RROA 4RZIA 3LYLA 2PFGA 1ISGA 3ZHZA 4IM7A 1K6IA 3TWOA 2H9IA 1PZGA 4WASA 4BNZA 4XEHA 1HSOA 1NVTA 4FFMA 4ZRMA 4D0RA 2UUOA 2C2XA 2EIHA 3NT2A 4K9DA 1B3BA 4XB1A 2ZYAA 4E0BA 3SLGA 1PGOA 5I8ZA 2AG5A 3ENNA 1SO8A 2OZPA 2PV7A 3N7UA 4GX5A 5BT9A 4L0QA 2H1SA 5ICMA 4OKNA 4DPLA 4EW6A 1P0FA 1PIWA 2VT3A 3QWBA 5L51A 1GUFA 3DBHB 4QUKA 1H2BA 4RPJA 2W90A 1QP8A 4CQMA 3BTVA 1R4MA 1E6EA 1UZMA 2HRBA 2JFGA 2OP0A 4NPCA 4PLHA 1RPNA 4R3WA 3VKVA 3PHHA 1LQTA 5THQA 1SZJG 3QV1A 5JLAA 2IXAA 1FDTA 4MIOA 1LXCA 1WZIA 3DFZA 1R4NB 3WJ7A 4RVUA 1WDLA 5ENDA 3GHYA 1PS0A 3D0OA 1KEVA 4EZBA 3RBXA 4PIVA 4Z6KA 3PIIA 4O63O 2IZZA 3QHAA 1QSGA 2J5QA 4CMAA 3TZ6A 2EHDA 3OM9A 4J7XA 4BGIA 1Y8RA 3HDYA 3NDIA 3TNLA 4N54A 3V2GA 1LA2A 3INRA 4CLDA 4BNYA 4CMEA 3JD3A 1WP4A 4ALMA 3RQSA 1MA0A 4RVSA 4NJMB 3JQGB 1E92A 2I67A 5AXDA 1U2GA 1P1KA 2RHRA 1QV7A 1QLJA 1XG5A 3PGJA 3U4HA 2EG9A 2BFPA 1WAMA 4D3FA 5CEEA 2QRKA 4UAGA 4TZKA 3H5RA 1ISJA 5AYVA 3UVEA 1H9AA 1Q0LA 2WYUA 3RUAA 1XCBA 3I9NA 4CLOA 4GI2A 4G5HA 2WEKA 4YYZA 4UVEA 3WX0A 1J49A 3OJ0A 2OO5A 3RFTA 4BB5A 1U1IA 3PLRA 1NAHA 3GPDG 4WNCA 4WUVA 4RCVA 1ZNQO 4AICA 2FR8A 2GR9A 2EGHA 4NIMA 3E9QA 4CQMB 3VPGA 4J7CA 2DTEA 2ZATA 1K89A 4IQ8A 4MVJF 2QZZA 3BZUA 3RC1A 3CMCO 4R68A 4J1NA 3D3WA 3S2GA 4A27A 3Q3CA 2QW8A 1O0SA 1I2ZA 5FI5A 3CZMA 3FTNA 2OBNA 2B37A 4AJHA 5DZSA 4NNJA 3IDSA 1EVJA 3I23A 1CQJA 1NWCA 4J91A 4WLVA 1N9GA 5DBGA 3FN4A 1WLYA 4WK6A 3HN2A 5JDIC 2JCYA 1P1RA 4N18A 3VDQA 3AOGA 4AJIA 1ZK1A 4OXYA 2YQ4A 1ARZA 3DAFA 1MG0A 2VN8A 3HDHA 1NXQA 3WYCA 2O3JA 4PZEA 3PPIA 1VI2A 3K6JA 2DT5A 1U3VA 3ETEA 3Q9UA 3RCBA 5KOIA 2PH3A 1W73A 3C1OA 4AJLA 3K2EA 4M54A 3WQRA 4IGFA 3G0OA 4F46A 4E2XA 1K6JA 5B4TA 1Q7CA 2YHIB 4IIVA 3KETA 3E6AA 2DLDA 3JQGA 5IDXA 3HFGA 2IEDA 4AG3A 3C1AA 1FF9A 3HDJA 3PYXA 3ST7A 2GD1O 3KSDO 3RVDA 1JKIA 4R69A 1CETA 4OQZA 1MV8A 4YJHA 4J1QA 4XDZA 1V6AA 4YJGB 2NUAA 5K0ZA 2XOXA 3K5PA 2J3HA 1DC3A 1XIVA 4QXMA 5HTOA 3WTCA 1SB9A 3D5QA 4F6CA 1M6HA 1RJWA 4YTEA 1Z7BA 1JAXA 4GKVA 3GVIA 4J9VA 2UAGA 1HWYA 3WBBA 3AI2A 4QX6A 5JCJD 3WDSA 3ZV6A 3ZWCA 1M75A 2H5LA 3GF4A 1PS9A 3H8VA 4IDEA 9LDBA 4FC6A 4FFNA 1IZ0A 2E82A 4NDNE 3JQBC 3HB5X 3Q2KA 4XJTA 5EERA 3VPFA 4DVJA 4NJMA 3MOIA 2A4KA 2JAPA 1VKOA 3L4BA 4JJIA 3JYPA 3OHSX 3FR8A 3QVTA 4CMKA 4MKRA 4LN1A 4LRTB 5CDGA 2NU8A 1I01A 5LC1A 3KUXA 3JQ7A 3V5NA 4IMRA 1SEPA 4RVHA 4CLOB 4ROSA 3ASUA 3BTUA 4X54A 5AXAA 2UVDA 4RPHA 3QVOA 1JWAB 3T7CA 1GYQA 1GR0A 3GRKA 3JQAB 2VCYA 2NU9A 2WE8A 1YO6A 1UAGA 2GUGA 3SXPA 4RF3A 2B35A 1A4UA 2CF6A 3H3JA 4Y8VA 1F8GA 1R4MB 4ZQFA 3GT0A 4I5EA 5J23A 2VZ0A 4CM5A 5TT1A 1A72A 2HCTA 4IMPA 4IUYA 5FWNA 4OO3A 3L0DA 3ANNA 4FOOA 1PX0A 2PWZA 1I10A 3SC4A 1FK8A 1V3VA 1A27A 5A5EA 2AA3A 3IJPA 2V6MA 3GVHA 5JDCA 3VPHA 5FFFA 1SC6A 4CUKA 5KJCA 4PFJA 4CQMD 1WVGA 1J4AA 3WSVA 3PHLA 2V6GA 3U9LA 4NMHA 3OP4A 2Q49A 1D3AA 4L73A 1WDMA 2GO1A 4YT8A 2GNAA 3HNPA 4BO0A 2C29D 4CL8A 2PGJA 4FFLA 2X9GA 2DAPA 3DQPA 1T4BA 3UAGA 3S2IA 1HYEA 2LDBA 5JAMA 3I9KA 4XYGA 3QA9A 5CDYA 5C37A 4R5HA 5MDHA 3GEDA 3TZCA 4RF4A 3ZCXA 1Q7GA 3ZWXA 2QG4A 5F5NA 4QQRA 4NFYA 3GK3A 3F4BA 4ZD6A 4CLXA 3AI1A 1PWXA 1U3WA 2ET6A 1LLQA 2Q4EA 4Z0TA 5HWSA 2BGKA 1GYPA 3C7AA 1GFSA 2IEBA 2DPGA 2LDXA 3JSAA 3WMWA 3RU9A 3A06A 3GHHA 1OMOA 1T26A 1Z45A 2X9VA 5JW6A 3E8XA 1CJCA 5I8WA 4EDFA 1VJ0A 2V6BA 3RKRA 3PRJA 4J16A 3KTDA 5TRTA 1D4FA 1E7RA 2V6FA 3I1JA 3P19A 5L45A 4QFDA 2NVUB 1VL6A 4XKJA 2ZYDA 3DZIA 3CSDA 3H9GA 5KJFA 1ZJYA 4Y6RA 5B4VA 1B7GO 5GZ1A 5F1PA 1GDHA 1PL7A 3DZGA 5A05A 1PGQA 4GGPA 4IZHA 2X58A 3W4JA 3JYOA 1P1HA 3JCZA 3ZV4A 1F06A 3TL2A 1ZKMA 3AW9A 4HBGA 5F1KA 3D7LA 3KRTA 4MP3A 3ZWMA 1XGKA 2EJWA 2ZTLA 1WNTA 3F9IA 5U1PA 1C14A 3DOCA 3ZW8A 3VAZA 5L4NA 4ZQGA 1RKXA 2OHXA 2PZKA 5F1OA 4JBGA 4XX0A 2DUWA 3RUIA 2JHFA 4YAIA 5IN4A 2GF2A 1HLPA 3ONEA 1CRWG 2O2YA 4KWIA 3ZHYA 4IJWA 5BSFA 2GN8A 3KVOA 5L53A 3GDGA 3GMDA 2X7HA 4OHUA 1YDWA 4L75A 3DZBA 3Q0EA 4L76A 4ZQHA 4D7AA 3B1KA 1QMGA 2CY0A 4A5OA 3KO8A 3JQ6A 2D1YA 2VYNA 2DBQA 1A4IA 2ZTUA 4P4GA 2WD7B 4J0FA 4CUZA 2ZB7A 4IBOA 4WGGA 4AJNA 1EQUA 1HETA 5KJ1A 2JAHA 3EYWA 2B5WA 1NR1A 3MJSA 4UUMA 1T2EA 2G0TA 4NK4A 1IPEA 4GVXA 3EK2A 4Z3KA 2OORA 3JYNA 1P45A 2HDHA 3LF2A 4GLOA 5G4KA 5JYDA 2QHXA 1EE2A 5T8KA 2E6UX 3S8MA 2PK3A 1Y81A 2QQ5A 1Q0HA 4K28A 1SEVA 4D41A 3VZPA 2HMWA 1UXGA 1QYCA 3K31A 1R4NA 3VH3A 1UP6A 1VJ1A 4BQPA 1HTBA 3HADA 4WEOA 1K5HA 4YVFA 3ZW9A 3WYEA 4E5PA 1YBMA 4JK3A 3GAZA 2I3GA 4J90A 5DP1A 3GOHA 3F1LA 4JJGA 3CIFA 1IB6A 3DONA 3FNEA 1GAEO 2FMUA 4BO8A 5B4UA 2C54A 4BV8A 5IXYA 2BGMA 2P4QA 1NAIA 5JE8A 5T67A 5AQ1A 1T2AA 3MWEB 1DLIA 4EUHA 1YL6A 3FR7A 2NTJA 1ZXLA 1DDOA 3LZ6A 4B8ZA 3FTPA 3FSRA 1IOLA 3C8MA 4J4BA 5JDIA 3ASVA 2IZ1A 3RBZA 1AXEA 4OIMA 5JAZA 1ZK3A 3JD0A 2PD6A 4RVGA 5DCYA 5K9ZA 1EUCA 1X0VA 2P9EA 1X0XA 5BNIA 2EEZA 4ZVVA 2UV8A 4RPKA 2JFFA 4CM8A 2NQTA 3GDFA 2NLOA 4NFHA 2Y1EA 2CDBA 4CLRB 3QY9A 3EDMA 4HFJA 3PJFA 4H16A 3MEQA 2D2IA 1HYHA 4O6VA 2R00A 3V2UA 1JKJA 1ADCA 3T4EA 4I5FA 4XQEA 5A9RA 3BIOA 2X5OA 4BO6A 3CUKA 3C7DB 1NM5A 3BMCB 3JYLA 1Q7BA 1S6YA 1R15A 2PA3A 1V0JA 3MTJA 3TRIA 3WGYA 3F4LA 1W6UA 3GVPA 1JKFA 2GPTA 1DO8A 1PJSA 2H6EA 2O3SA 3FPLA 3FRJA 3NT5A 4CV3A 2J6IA 3U4CA 1TLTA 4W82A 5F5LA 4CM7A 1W4ZA 4JQCA 5C3MA 4BNMA 4M86A 1LSJA 4M87A 1EUZA 1P33A 2BLLA 1E3SA 4A10A 5ENVA 4I5GA 5KJ6A 1LEHA 1M6WA 5GY7A 3LU1A 3IUPA 3OEWA 5BNTA 4PLWA 4HXYA 4PG8A 3BHJA 3UN1A 5G0VA 2DVMA 3K2BA 9LDTA 1LRLA 4OMUA 4DTIA 4IIUA 1KC3A 3H9UA 4OJNA 4YPOA 3KYDB 5JBIA 4WPGA 4KUGA 1I24A 4DC0A 2Q2VA 1LRJA 2BMAA 3DZJA 2HO5A 4J4TA 3A9WA 3I5MA 1LQUA 1EUDA 2X22A 4FJ1A 1PR3A 3QWIA 2YUTA 3V1YA 3VZRA 2VQ3A 4FFPA 4ZA2A 4MJLA 2PZJA 1UP7A 1GQ2A 3OJFA 4YA6A 1R0LA 1E3JA 3GFBA 1NQTA 2F00A 3EVTA 4YAEA 4GWGA 1JA9A 3WIEA 4YXFA 4HFRA 2DFVA 5A06A 1ZIDA 2AQ8A 5C7OO 4GL4A 1PJTA 2NVUA 1KIFA 4KUHA 2VRBA 2W8ZA 2VZ9A 4K1LA 4MP6A 4OGWA 3VVCA 4BS9A 2NU7A 3WICA 4NJOA 4I5DA 4E5MA 3AM3A 2A9FA 3ABIA 3CZRA 3JQFC 3DC2A 1BXGA 5ITVA 1E77A 2PH5A 3ROKA 2FR1A 1KVTA 3K92A 1YVEI 3HE3A 4PZCA 3UFXA 1KYQA 3L4SO 1ZEMA 2P5YA 5TQVA 1ONNA 4HUJA 4INAA 1YB4A 4MO2A 2OFPA 2JJYA 4XQCA 1D8AA 1U7TA 4E2WA 4R16A 4PRLA 3ZNPA 1OAAA 3KSUA 1WZEA 4LMRA 5A03A 2I66A 4ALNA 3LDHA 3A4VA 4XCVA 4J49A 1CIVA 2NM0A 1GL3A 4ZQBA 3GUYA 3EAGA 4BNWA 4U8GA 3HG7A 3OICA 4XRGA 4FGWA 2HUNA 3PEFA 4HX5A 1D7OA 4Q3NA 4RL6A 5HRUA 2CVZA 3WGGA 4FBGA 4DYDA 4TRJA 4A73A 1PJQA 3NX4A 4QT0A 2UDPA 2YDXA 4F45A 4PG6A 1UUFA 5DCUA 1A9YA 2Y1OA 5FI3A 4J4HA 3ZWYA 4BKQA 1ULSA 3LT0A 2QX7A 3UGKA 5A04A 3UXYA 5KKAA 3KEOA 4CMJA 3LK7A 2CNBA 5IN5A 5JFOA 1SAYA 4EEXA 1AHIA 3P7MA 1LC3A 2F1KA 4CM8B 4NFSA 3JTMA 4L9RA 1LRKA 2Y0CA 4LISA 3K73O 2HJRA 4IPTA 5CP8A 1M2WA 3UHAA 1ZSYA 4BNNA 2VWPA 4MVJM 1ISHA 4N5LA 1LC0A 4YACA 1I3MA 1YJ8A 2AW5A 1HE4A 2O3UA 1O6ZA 4OM8A 5JO0A 3DXFA 2VUSA 1HKUA 4KQWA 1F12A 1TA4A 3GH3A 3BMNB 4BOYA 3NV9A 3DZKA 3NTRA 2WM3A 3ORFA 4LSWA 4B7CA 5G0WA 3SBOA 1U5AA 1PL8A 2EKQA 4Y98A 4E13A 4HKTA 2PGDA 5C7IO 4ID9A 4R51A 1MX3A 1DPGA 1W8DA 2HLPA 3KLPX 8LDHA 1I5RA 1KETA 1VJTA 4YJFB 6ADHA 1LUAA 3CKYA 1C0KA 4BGVA 4YJHB 2HMTA 2JCVA 4WE3A 1YBAA 2C07A 3F6YA 4S1VA 4TSKA 2WJPA 1SCUA 3UW3A 3VC7A 4E2ZA 2CD9A 2GSDA 4UEKA 1HEUA 3HZZA 2X8LA 5U9CA 1SBYA 3NYWA 4Z9YA 5L9AA 1DJQA 4IDFA 4TMFA 3GPIA 1MGOA 3F5SA 4FOSA 1Y9EA 4LSMA 2O7QA 1WPQA 2VNAA 4BO5A 4UEOA 1ZSNA 3T4XA 4CM6A 1YQGA 3NRCA 1LSOA 3A28A 2XXBA 5A3JA 3SVTA 4ZQEA 3M1AA 5G0UA 3TOZA 4J43A 2C5EA 2EV9A 3DFUA 3PK0A 4DQXA 1ZZEA 2W2LA 4LVCA 1EDOA 1ADFA 4U6SA 3FF4A 5DOZA 4IXTA 3TQHA 3DZHA 1Z6ZA 1U3TA 4PLPA 1PJ4A 1NFQA 1N7GA 3ITKA 4AL4A 2ZJ1A 5T6BA 3MTGA 3RU7A 2C2YA 1BWSA 1C1DB 3HWRA 1ID1A 3CINA 4RZHA 4RDIA 3RAJA 3P2YA 3DAPA 2HKIA 4PLTA 1KEUA 4ZU3A 4GKBA 3O8QA 3VTZA 3LT2A 5JMPA 2YV2A 1C3VA 1LX6A 1YL5A 4H7PA 3WLEA 2EGGA 2YV1A 1RWBA 4I9NA 3RASA 1C0IA 3CH6A 4IS3A 3HDQA 4M1QA 1YQDA 4B4VA 4E4YA 2CUKA 3LC7O 1I36A 2DPHA 2FR0A 4HFNA 3UF0A 1UR5A 4HV4A 3ROQA 2Q46A 4R4JA 2GN4A 1EBFA 1MB4A 5CEFA 2C82A 4XGNA 2X4GA 4OXKA 4CM4B 5DBIA 2TMDA 3PQDA 3ZDFA 4BHTA 1E3IA 3NJ4A 3FNGA 4BB6A 3R0IA 2ZQYA 1YH3A 2GASA 3AUSA 3L6DA 3JQAA 5JS6A 1UXJA 3DZFA 5I9NA 2PKRA 5K6AC 1TEHA 4M8SA 4WKGA 2GDZA 2D5CA 4YT4A 1LDBA 5L40A 1UXIA 2YY7A 1H93A 1UDBA 4GMGA 4J2HA 1MFPA 3QRWA 1I3NA 4E5NA 1PJ2A 3IQDB 2HK9A 3MJTA 4PLGA 3OMLA 2IODA 4HNHA 2ZIZA 2X0JA 2HU2A 4JROA 3RFVA 1CYDA 3GZ4A 4KZPA 5DULA 2J5KA 1V3UA 1DIHA 4TQGA 1YS4A 2IYOA 4DMLA 5L7WA 2A35A 1ZBQA 4NBRA 2BI8A 1UXHA 1ULUA 2VRCA 1QR6A 3FBGA 3OIGA 4HWKA 1XA0A 2ZYGA 4XYEA 1B15A 4GH5A 1AGNA 2FP4A 4J6FA 4CR6A 2WMDA 3UKOA 1XR3A 1NBOA 3QWFA 2Y1FA 4J3FA 2VUUA 3DL2A 1RM5A 1ISMA 4Y9DA 3UICA 1N1GA 3NAQA 4AJ1A 4B8WA 2TMGA 1B8VA 4EJMA 4N5MA 3PYLA 2EJVA 1Y7TA 1H6AA 1A5ZA 1F17A 2HMSA 1NPTO 1PQUA 3GNTA 1LLUA 4Q3CA 4DIFA 3U09A 2B4QA 2I65A 3OQ6A 3P2OA 3JD1A 1KVSA 2BD0A 3G49A
chains in the Genus database with same CATH superfamily
1RXIA 3B1YA 1R4ZA 1E59A 1U1EA 1E61A 4EG3A 1GR1A 5C8YA 1QG2A 2OC9A 1F0NA 3O3NB 2BWJA 1LPNA 2OV8A 2R8YA 2QTAA 4X7MA 4EG5A 3LDAA 4A91A 5G41A 4NONA 3F7MA 1QVWA 1Y1KE 1Z5VA 3IILA 2NXNA 9GPBA 2WT8A 3CLSD 4PIPA 2HGZA 4XYMA 5AXBA 2VL7A 2QTFA 2BGRA 2P6MA 4M8LA 5EWMB 2Q4TA 5F33A 3ZE2B 3MS4A 3B36A 2FH5B 2FLWA 2R6GA 4MR8A 5L4LA 1E1LA 3AWDA 5DLEA 2RJNA 3VOTA 4EG7A 2O8DB 2O0HA 4OQNA 4QQKA 2QB5A 3A6JA 3JYQA 3SYRA 3NDBB 3AG6A 5LFAA 1QRSA 1A50B 1UBEA 1WCV1 2OLJA 4M21A 3OF3A 4LCBA 1JJ7A 5E4JA 3TLXA 5CAEA 5KYXB 1RZRD 3TPCA 1SULA 1OXBB 2ZIXA 3Q9SA 3L6UA 2O59A 3UQYS 2CL7X 1UMCB 1UFVA 3GCZA 1ONOA 1AZLA 1VKZA 3GJ3A 2R7LA 4KQHA 3SS8A 3H18A 3R3ZA 2C77A 3U3MA 1WL8A 3D4IA 4RKRA 4YR9A 2JJ1A 4Y0NA 1PWHA 3BJMA 2A0KA 4N65A 3SBXA 4DLAA 4W5NA 4BFCA 1Y7HA 3F71A 4GSLA 1P4JA 1RYNA 2OKCA 1H2AS 4OYYA 3NAGA 5CFOA 2ZBQA 3FMPB 1GKYA 2JFHA 1UH5A 1NP6A 2GZ1A 2XNJA 1FSSA 2B5OA 3E61A 3PHJA 4LHYA 4M9RA 3TW6A 4EZIA 2Q6KA 3RLFA 3V4OA 1SIWA 3PPWA 4CQLB 2W43A 1C9KA 3DOOA 1ZH4A 1PZMA 3W6UA 1U5BA 2BKXA 2JFBA 2UYCA 5JNRA 1YE3A 1O6FA 4F4HA 5CD1A 2EZTA 2FUG6 1X77A 3I2IA 3V1LA 4JEHA 5DK4A 2XXAA 2O8EB 5FPHA 1RJFA 4EHIA 1BRTA 4NYJQ 5DF1A 1CE8A 3JR7A 3R3JA 3PDCA 4ND6A 5BV2P 3A4MA 2AEMA 4OAQA 3QKIA 3L40A 1IQRA 1K97A 1XJ5A 4QGFA 5DN9A 3C6MA 5G40A 1Y1LA 3PDJA 3HY6A 4Q9LA 1JFTA 3CWQA 2RHDA 5HYVA 4Q9DA 1A8UA 3KB8A 4H7JA 1EM8A 2OK8A 1J00A 5AVSA 2HH9A 1HOTA 4RVFA 2C88A 3UCEA 1H6BA 4F1WA 5KX5B 1RI4A 1U7XA 1UL1X 1YDGA 3LO5A 5KCZA 3TTUA 5AW1A 2UUPA 3IODA 5HW0A 5LJLA 1KSJA 3UAVA 4GQAA 3EXG2 1G41A 1PTKA 3R3UA 4PM4A 1Z2PX 1YTLA 1PQWA 2ZBRA 3JAWA 3OEHA 3PNBA 2HK8A 1GIAA 2O5RA 4IYRA 4PCUA 2WMOB 5HIKA 4ZV7A 3IL2A 1GNSA 3SC2B 1IEVA 2SCUA 3HP7A 4TWRA 2B7BA 1BTOA 3A05A 1J1IA 3AERA 4CIAA 5BN3A 3MWGA 1BFKA 2C7PA 5F3WB 3DVAB 2FWJA 4QPNA 4CCYA 4NV1A 4QOHA 4QUEA 1JG2A 4R41A 1USGA 3MC1A 2HDOA 1Q6YA 2A92A 1JYEA 1E6WA 2VPIA 1BXRA 3C5WP 3X1YA 2HQ1A 3IOYA 1SB8A 2XH8A 4U2BA 4C7JA 3C8HA 1V1MB 4MTCA 3ESYA 3ZE8A 5D00A 2Q1YA 4NQZA 3QIAA 2ZYWX 1TKBA 2UUCB 2PZEA 3CLUC 2ID7A 1HZJA 1NW3A 2JD2A 2K87A 1IN5A 1AXGA 2IY7A 3L8FA 1N6KA 1KYWA 1FTYA 5ESRA 1L4EA 2HUPA 4XPZA 4POOA 3CO0S 1UBRS 3KLBA 4QODA 4A26A 2IEYA 5JVDA 2W71A 4IHJB 4BIMA 3CEJA 3KYBA 2WIFA 4KBGA 4ND3A 5FOTA 5I3CA 3GLSA 1RYMA 1XZFA 4PW0A 1OC4A 2BTQA 2J41A 1HA3A 2XKJE 4IFBA 1H2EA 4QG7A 1BFUA 1T0UA 4QJ4A 1Y6ZA 1FDUA 1PFKA 1VA5A 1T36A 3G1WA 4QUBA 4NXMB 3CF0A 5GOZA 1OBOA 1SCIA 4DXHA 5IHPA 3WLOA 4FFVA 1COZA 3H2HA 1U3DA 3N5CA 1PEAA 3AJ9A 3H2YA 1EB8A 1OI3A 2VAMA 4TM8A 3K9QO 1DFHA 3MGBA 1CEYA 2H4YA 2R85A 3F46A 4HY3A 1ZHHA 4P54A 1GRCA 2B3DA 2PUBA 3GH1A 3BL8A 5LQRA 2JIRA 2ONJA 5YASA 2Q9BA 2QXYA 3ZJ5A 3B89A 1F38A 1SU8A 1FU8A 3VC1A 3P9RA 1I5EA 3QXHA 1ZM4A 4PQGA 2HMVA 5LKRA 3RUDA 1L1QA 3PC8A 5EIEA 4QEZA 2F1IA 3TFOA 5J5CA 1EFKA 1WDWB 1CR2A 3DO5A 4G1EB 4LRUA 4P53A 3W5SA 3WP0A 4ZDIA 3AM5A 5CCEA 1WF6A 4P86A 3NVKI 3PE3A 5FO1A 2FZ4A 2XA9A 4F4CA 5HGJA 4G1CA 3T1HB 1KE2A 3CEAA 3T0FA 4P4SB 2DWOA 2ZWIA 3KOWA 5TMBA 4QQ8A 2B92A 3O83A 2LUOA 2Q9UA 3WK4A 1TVKB 3LUCA 4GZ3A 1DUSA 3KJGA 1I2DA 5J63A 4FCVA 3TUJC 4L4YA 3EQ2A 3W9UA 5FBQB 1G8GA 1G1AA 3IV9A 4Y2GA 5TSDA 1T5TA 3NAZA 4PN3A 2CXXA 4XWKA 4U2KA 5JI3E 3S2EA 1DPFA 1RXCA 1SBCA 2PYDA 5DCWA 3ZWPA 4RORA 3HDGA 1ECFA 2WWTA 5D84A 2P91A 2EW2A 3DHNA 5FL7A 4HNUA 1WOYA 1OUMA 3UJ8A 4C0LA 3IB3A 1EX1A 1Z68A 2VK2A 3F6SA 3OZBA 1U4OA 2XIQA 2YV3A 4G5FA 1L9KA 1M1XB 3BWXA 2DBRA 4LPSA 3WGJA 4RJTA 1ZMOA 2GAFA 1EM8B 1F2DA 1Y98A 3E3OA 1CCWA 3EQ8A 1W35A 4LHWA 4UUOA 2GDJA 5K4GA 3QE9Y 4E30A 1WHSA 2VWQA 3ES9A 3H1AA 3OBBA 4LOIA 4LF4B 1BS9A 3FWZA 3PQ7A 2ATCA 1P7CA 4FYWA 3ZU3A 2O48X 1LVUA 3A1NA 2BHLA 5F9HA 1T2UA 4PO8A 5GV7A 5HX7A 1LQ2A 2GPJA 2Z5FA 3GRCA 1GPDG 3HB1A 4IGAA 2PRYA 3L8MA 3TGWA 3TXYA 2HBYA 4P98A 3ZXSA 1MH1A 3CC8A 2WIAA 3NU1A 5ALXA 3MHTA 4YPOA 4J3JA 1WXXA 5LD2C 4JUDX 3C7KA 5LB2A 5LZ7A 1RKQA 3EQ6A 4GGMX 4AJJA 1EIWA 5EE5B 4AUMA 3PDIB 4X20B 4DLRA 2QLMA 1EXVA 1TM1E 1Z8FA 2OECA 4XARA 1UJMA 4L78A 1UWLA 1NXWA 1PHRA 3AVOA 2ZT6A 3DYBA 5FD8A 1BN7A 1II8A 1FQJA 3IAS1 2XY4A 1CZNA 2I3DA 1H8ED 4Y6PA 1Y9ZA 3PJDA 1KY5A 4UKDA 5C34B 3KQQA 4L2IB 5JO9A 3WGVA 1FX0B 1ZCJA 4DZTA 3AU8A 5LP1A 3CUEF 3A1TA 3L6OO 2G7ZA 4KQMA 4WOKA 3UJHA 3TG2A 1EJ0A 1Z2OX 2FFHA 2CBGA 1UK7A 1T2FA 1E66A 4JSYA 5TY0A 1WMSA 3BMCA 3ZHBA 3H9JA 2PD4A 3SYMA 2VHWA 4UOQA 3TFWA 1J7KA 2K5UA 1LPSA 2VT2A 1FYFA 1NN0A 3DMRA 2A7XA 1NV8A 5A4AA 1N0UA 3VH2A 4BL5A 4XVCA 5ITZB 4EJ2A 4KAJA 2WWRA 1N2GA 3SLKA 4L07A 4H15A 4JX8A 1AGYA 1G98A 2VJMB 3X44A 4J0CA 1PD0A 3GJSA 1M2KA 3LDUA 2ETXA 4INOA 3ISJA 4M1TA 3OX1A 1E4EA 1I4EB 4HMPA 3TS1A 3ZX5A 4A8HA 5IC4A 5JWOA 3WL8A 2JATA 2PZAA 1SKYE 2XB9A 4RQBA 2XBLA 1NYTA 2PUTA 4MOWA 4CTOA 1GZ4A 4LHSA 3FKSA 2ZRGA 2EZUA 3DE4X 5C51B 1CLUA 5AJHA 5FT9A 2GZDA 1O8CA 2CL6X 1UWKA 2CUNA 1HTTA 2Z2YA 3WNQA 4BE7B 4QKQA 5CDHA 3GZNB 3K70D 1E9RA 4YJGA 1RAGA 1CF4A 1F2VA 3NV7A 4KAFA 4QU5A 4FNOA 1XTVA 2II6A 4B46A 1OWOA 2R1VB 1A5TA 1NBAA 1C3LA 1EHIA 4RFLA 4DLPA 1BU5A 1G17A 3BAZA 2JI6A 2GYUA 3OEEA 2DH6A 2YHAA 1PG0A 3FG9A 4B5LA 4ZZ1A 2G04A 4HDAA 4PG5A 3Q2OA 3K8YA 4W7HA 4IOMA 5GZ3A 1IJFA 1JHYA 2X6RA 4G8CA 1KI8A 3HKDA 3Q3JB 2YIJA 1EXMA 3DL7A 3SIXA 4OLBA 3TDNA 4PZ0A 2J9ZB 5DI3B 5I01A 1YF3A 2Q3BA 1NM5C 5A1TA 4FUTA 3F47A 2P77A 4UM9B 2ZFUA 3UUEA 3VNQA 4E70A 3ESXA 4G56A 4NZPA 4FHGA 3EULA 4N82A 1HDXA 2CVFA 1TXGA 3BRWD 3MAAC 2YXLA 4TKMA 3H7AA 3NIGB 4BMVA 4TYYA 4C89A 4Q66C 5K3EA 1L7XA 2GK6A 1DAIA 1XWFA 2F3SA 2RGDA 4RHFA 4MKZA 5DHSA 1IOZA 2WJHA 2HY7A 3QI7A 1TTHA 3LDFA 2JF0A 3D2BA 3GFGA 4LF8B 1XMIA 3MJVA 2K2QB 1S8NA 2WZCA 2DBVO 1X19A 1JQ3A 1WKVA 2MCFA 4LFBB 1I5OA 3K05A 1ZIXA 2P9GA 4IILA 4MGEA 4O4JA 3SJBA 4AO8A 3GMIA 2X7JA 1PDWA 5LWHA 3GLHB 1X7GA 2OO5C 4JQYA 4WZ6A 5AJYA 5TC4A 2CFIA 4MRPA 3T35A 4BFZA 5JYEA 2O3QA 1YACA 3EPJA 1M9NA 1XHLA 5K1ZA 4N3BA 3RC2A 3I04A 4OHVA 5G4LA 4I08A 1U8UA 5EZSA 4WY5A 3LCUA 1E6LA 3UMRA 2GSWA 4KK4A 5BMVB 3ZKWA 1RP7A 3MCUA 3PZBA 4FYPA 4E3ZA 1VG9B 5FJJA 2CHFA 2YW2A 2XW6A 1U04A 3H1BA 1CB7A 2H29A 2Y66A 3NTVA 1IQPA 4MQLA 4D9GA 3T15A 3INTA 3IKMB 4OQQA 2HFKA 4YJ3B 4K2AA 2V6JA 3VMMA 2HCRA 3TSCA 3UENA 1R0ZA 4U0KA 3RSLA 1AKWA 1HT1E 4G0UA 1ORDA 1VHWA 1GPAA 1H1LA 4C78A 4G84A 2IHYA 2ZZMA 3HK2A 1FFXB 2LWIA 2G1KA 4MB6A 2R2GA 4FD3A 2HSWA 5EI5A 3AOEA 3M6IA 1NIPA 1TO6A 3DCYA 5JXHA 5JSZB 4ND4A 2XB2A 3ESAA 5AP9A 2DQYA 3SKXA 4AMYA 1T25A 2QQGA 3C4QA 4N0MA 4WGFA 3SEQA 4B3DA 1VPLA 4D82A 3NYIA 4QTUB 4YCMA 3L02A 3G7NA 1WW8A 3UK6A 2OFOA 3HH8A 2GEFA 1HMPA 2K2WA 4P4NA 2BEWA 1E1KA 1GNVA 2CHGA 1LZLA 3NUZA 4OMDA 1D6JA 2Z09A 3ZPXA 1S0UA 1JEQA 2H51A 4DJEC 1ZC4A 1HBJA 1XU9A 3WGUA 1PJCA 1ZH8A 3OO0A 4DKJA 3KUCA 2HLDA 3W8FA 3Q8XB 1NQOA 3LWZA 1DAKA 3NNNA 3H11A 4ZDWA 5A9SA 3IV7A 2H4JA 4YECA 1NUTA 1T24A 3G17A 3PXUA 2RDMA 3VM6A 2XGJA 1E7QA 4JSRA 5A7GA 3INGA 4I1SA 3WLTA 1G3RA 4BU1A 3NANA 1WXHA 2FJPA 3QU9A 4PQFA 4XQGA 4OOFA 5IU6A 3BCSA 2OO7A 3BA1A 1GZHB 3V4SA 1JTVA 3HRHA 3MRSA 1UT5A 1PJBA 5EJAA 1BRMA 5KO2A 4P2GA 3QIVA 2P9QA 1TMGE 3I58A 1MO6A 1VCNA 5ALYA 1B0ZA 3OQMA 1ECBA 1GEGA 4QOEA 1JPUA 2C2ZA 3ZHTA 1G0OA 4B3HA 4UU1A 1Q1AA 5FUQA 1LK7A 2QY6A 1BWRA 3AB8A 3E22A 4OH1A 4C4PA 2GT1A 3O8OB 4KJZA 4M53A 4O4HF 4GX1A 3T4PA 1ADBA 4E1BA 2ZJOA 3T5CA 4HXGA 3PUXA 4BGUA 3R1IA 5EQFA 3WKBA 1EFAA 2QAGB 4FDMA 3TEJA 2X2PA 2I1VB 1RC1A 3EIEA 3ZU2A 4INPA 4LWQA 3LIPA 4UREA 1ZOPA 1ZIPA 3W6PA 1Q0TA 1A9ZA 1NMQA 1UXOA 2QQFA 3FCUB 4DRXA 4WOJA 3FDXA 4IGEA 4BFUA 2J3IA 3PC3A 3R9XB 2GK7A 4DV5B 3LSYA 4JNCA 1EK5A 3GLGA 1I13A 1ZD2P 4FS8A 2FY8A 3ZV5A 5JDCC 4LBWA 6REQA 2OQIA 5K0BA 2VJOA 1JRLA 4H6VA 1C2TA 4RIEA 5HUJA 2QL6A 1RCTE 3O73A 1CZUA 3CKLA 3A3KA 4DUGD 3CW2A 1EWYA 4RTLA 1YZYA 1D2MA 4U63A 2ZB3A 3H4TA 4OAOA 4ZICA 3GG2A 3JQRA 4JI8B 5FR1A 1PLKA 3CISA 3N74A 4JEUA 5F2OA 3EIWA 3BOSA 4E22A 4JKIA 1RI1A 4TS9A 4TV9B 1J06A 2WC1A 4D2IA 2QTZA 1GPWB 2G83A 2CF5A 2QTHA 3L4EA 5AVYA 5DGDA 4F56A 4A8JB 1D6SA 2X5JO 2G1UA 3RJ5A 2AX4A 3HCAA 4R98A 1N33B 1I4LD 2XZTA 3QPWA 3O8QB 1J1UA 3FJYA 4QU0A 2P3LA 4HWPA 3P5BA 3I9V1 3OFVA 1UEIA 1V3TA 5DLDA 5FORA 3VRHA 5HM8A 2I2CA 4N6GA 2AEEA 2WOJA 1CNFA 1YIAA 1QVRA 3QK7A 3AJDA 4WXYB 2PS1A 5EN4A 4WBXC 3NBZC 1ENYA 1DZ3A 4UNPA 4BPBA 2GYWA 1M0TA 2A9OA 3SPXA 3MUNA 2BFAA 3HY3A 1A71A 1X3LA 4YRJA 3GJYA 4AWBA 3THWB 7REQB 4D44A 3H65A 1VIVA 1R0XA 4ZVUA 4C0QC 2PZMA 4I5IA 1IOVA 1DWOA 1QVVA 4JIMA 1JB9A 1OJ7A 3F3SA 3R6TA 4QO8A 3SQMA 2GPWA 1QQ7A 3AEKA 1A1SA 4ZJYA 1KOFA 3R77A 3CX6A 4C76A 3B20A 1DAMA 5FPKA 5I7EA 4P8RA 1BEZA 4CKZA 1RD4A 2BELA 2ZB4A 4ARVA 3AUUA 4UPEA 3OZAA 1VC2A 1XVUA 2JHPA 1R66A 3K53A 1KO8A 1UBHS 2HSJA 5TQ0A 2RHJA 3U26A 1K3TA 4XX1A 3ACBA 1JDJA 2HJWA 5CTJA 3UT5A 1JHRA 2QVZX 1RIIA 2GH1A 1U1CA 1FS6A 4MVXA 3E2IA 4OXQA 1FQOA 1ST3A 1K27A 2I7CA 4R81A 4S24A 5ETJA 5H70A 3BWDD 4RD1A 2VQSA 4AJEA 1J20A 3CRW1 4MWCA 1DJOA 2AKEA 2W6MA 3GC6A 4W5OA 5KYWA 3D7KA 4RDHA 2Q62A 4WADA 7ADHA 1Z63A 1D1TA 3UBTA 4MA4A 4NCJA 1LH0A 1XP5A 4NU6A 3BYZA 5CM8B 2ADFA 3O9VA 3P96A 2JJMA 2C5AA 1I2BA 1SQFA 3WRXA 4FHEA 4OQYA 5IJ9A 2AZXA 2JCXA 4BQOA 2JIPA 5H4HA 3L6BA 3TNDA 1JHPA 4BNGA 1VMDA 3PXEA 4X3OA 2XXJA 4U9UA 1U1DA 3GV0A 3JXEA 4MS1B 5A02A 3O8BA 1FUYB 3G2MA 3QBTA 3H4IA 3I9LA 2IIVA 4KQXA 5JSUA 1SBIA 2Z9BA 2QW0X 3EVBA 1JJBA 1LJUA 5ICGA 5JCXA 5KX5A 1UZUA 4HZUB 3PP8A 5ED0A 4KQGA 4PICA 1G5RA 1TCBA 2ZQ5A 5GONB 3H5IA 4L28A 2GBCA 4ZI7F 2ZROA 3F6PA 4MP8A 2A5YB 4OOEA 3GCDA 3VDMA 3AVUA 2X19A 2BKUA 5JZBA 1HGXA 3AUXA 5JC1A 2IDMA 5ICSA 2QX9A 3HO1A 1I0ZA 3AESB 2CHVA 5AW2A 2XDWA 3DVAA 3KT6A 3ZWKA 2WHXA 3ADCA 1JHVA 1YL7A 3STVA 1U28A 2PNFA 5FKJA 3R41A 2QZPA 3IKLA 4U02A 1FFCA 3ZCTA 4JR0A 4KN6A 4BE4A 3H1PA 1QYDA 2X1VA 3ETNA 3M5DA 2OL4A 3W0LB 3C97A 4UTPA 1RHQA 1W0JA 3O4GA 1ZW6A 2V4ZA 4YJKA 2AFIE 4WNIA 2DFPA 2XAUA 1AMUA 5KYVA 2AJ8A 2R96A 2ORIA 1JV2B 3W8RA 1QYVA 3QVJA 4AJ4A 2QE7A 4MVJP 1LDYA 1O95A 4IOKA 3WRXC 1F5NA 1O5TA 4B43A 2DUMA 3W2EA 3PVCA 2TECE 3HSYA 2OXRA 1AB6A 1KBQA 1SMKA 3ND7A 4Y6LA 1OBFO 3WGHA 4KR0A 4DPMA 1K68A 5CAEB 5KYXA 1Z3IX 2NX2A 2O1XA 2V7QA 3DTVB 2BF7A 1Y4DE 1E2NA 1Z07A 1T36B 2F6RA 3O4RA 4K9QA 1MKYA 1KL7A 1I32A 4QDXA 3CGGA 3A26A 3D54D 3HJAA 1D2GA 2ZBUA 3SS7X 4H59A 1HORA 2Q1UA 3KS9A 3F7OA 5EIWA 5IANA 1K06A 2MT9A 4PPQA 3T3IA 3JSXA 1ICIA 5AUQA 1AKEA 2X23A 5FULA 5HCIA 3VH4A 4EOGA 2B83A 1QU2A 1HFJA 4HB4A 4B3JA 2C84A 4LEIA 2BKAA 2COKA 1R8SA 3IBGA 2I6XA 4LJYA 2WWFA 3I6ZA 1IHUA 5H7XA 2NGRA 1SCQA 5CFLA 3PU6A 5EJ4A 3UKJA 2QZJA 3EDOA 4MPDA 4OTZA 5EXDA 2HU7A 2BEUA 2C57A 2B61A 3EIXA 1Q16A 2PY6A 2IP2A 2R8PA 2XVAA 1R9NA 4TYNA 5FWXA 1L5MA 4CDGA 2PFSA 1C4WA 1M5UA 4BEWA 5AKYA 4AKHA 5TLSA 5I4IA 4BFXA 4ER5A 2O19A 1F8UA 1J56A 1LK5A 3WSWA 2Q5JA 1BSVA 2GGSA 1OZAA 2VBIA 1M33A 2JZCA 3OPQA 3AP2A 3QE0A 1PR6A 4JJAA 1MQSA 1E64A 2PR2A 3DBLB 2B4RO 4NS4A 1E5DA 3QG1A 5BMOA 3NC0C 2NSLA 5CB4B 3JARB 3GXBA 1YCDA 2IYTA 1QZUA 1P0CA 4XAQA 5K4HA 1XMXA 5HQ3B 5AHXA 2HMUA 2IYLD 2P5UA 1NVKA 4E5KA 3UKDA 2Z98A 3B78A 3WMXA 1TCVA 3TI9A 4O33A 3U0VA 1HDZA 3H2JA 2QAGA 4KMMA 4JU8A 2NN3C 4D3YA 1Q22A 1TYAE 4OQ4A 4YDSA 3QMPA 3FUXA 3WNBA 3EZ9A 5CJPA 3FAZA 5ILOA 3AY7A 4KQIA 4JL6A 3GNSA 2C58A 4P80A 3L79A 2H16A 1NW7A 4BJHB 4C03A 1GPJA 4NZ9A 2WINI 4OHBA 4PAQA 1A1VA 4F85A 4HDSA 2C2GA 3PXCX 4MYUA 5AHKA 5DLPA 3E4CA 1K2WA 4MPRA 3SEFA 4C4TA 1PUJA 2QRNA 1ZIOA 4UBKA 4X9XA 1OLSB 3WGOA 3AF5A 1AOXA 1N3IA 1VHTA 4INJA 2GCGA 1ENPA 2C61A 4GMDA 2EJTA 1GY8A 2Q5FA 4JELA 4DN6A 4EMBA 2NP6A 2L17A 4O2BB 1RAFA 1R64A 3PEEA 2YFQA 4CW7A 3D3KA 4MB2A 4XDYA 4ZJUA 2V7WA 3BG5A 3NNDA 3F6CA 3HBNA 5ALZA 3WKAA 4JP3A 3GY0A 4AB1A 4CBVA 4O5AA 1QRRA 5ELLA 3IQWA 1N3BA 1OOEA 2P75A 5DJ5A 1CDEA 1L0BA 1VL0A 1LPBB 5EKSA 3RDPA 3RIMA 4EQ6B 3L9XA 1JALA 3KQWA 3AX6A 4DV4B 3WS7A 1PHPA 1RJDA 1TIBA 2JL1A 4CM9A 3I04M 3RVBA 3DBRB 3ZWAA 3T4UA 3IJ5A 4AP9A 2H5EA 2CKMA 5HA5A 3UANA 4EFNA 1N8SA 3JQEA 4ZCSA 4M22A 2XT9A 5ISMA 3OQOA 3CPEA 2HD4A 4F4DA 4B4KA 4CKYA 5FEUA 3TLZA 5J1SB 1L5QA 1S8FA 3LSTA 3OE5A 1I30A 1LTHR 1V5IA 2IT1A 2O23A 3BBPA 4LXTA 1ZCFA 5AO9A 1CVRA 3BBLA 2OXCA 4X45A 3FUUA 3A25A 1MXFA 2CL5A 1QCZA 2AVNA 4H7FA 4OMCA 4Y2HA 1PGNA 5B58C 2AQHA 4KQFA 4NG5A 2ZAMA 3Q85A 3QEJA 1A9SA 4A36A 2EQAA 5K0FA 3WE7A 1BE6A 4FFOA 2X13A 2DCMA 4Q03A 2NU9B 1KC1A 1UJ2A 3NTQA 3N0WA 4CIWA 3GEHA 3L18A 5DIFA 1AS0A 5K3FB 3UH1A 2BZSA 1QF9A 3O9ZA 3VVBA 3ZU4A 2EKPA 2A6PA 4UNNA 1W75A 2WTAA 3OETA 4KAXA 1CY8A 5EZYA 3JQCA 1YMVA 1ZNYA 2UYQA 1G8YA 3DEJA 3KR9A 3NS7A 3U3RA 2F1RA 3QBVA 4B6PA 4BX2A 4DCJA 3PC7A 4EJFA 4Z49A 1GZVA 1QAMA 1GA6A 1X92A 1V8PA 3D5TA 4HN2A 1EM6A 2A0FA 2FUKA 1KF0A 2NAPA 1E9VA 4JBLA 4LQ4A 3I6QA 2VUHB 1WWKA 1MO4A 4RVCA 1UKZA 2BFBB 2ID9A 3MWFA 5GONF 1XRRA 4C4OA 3GUVA 3NWEA 5JNTA 3G1UA 2V0NA 1LDMA 2V7PA 5GMOA 5IASA 3CIOA 2OO3A 5B2FA 1X7YA 3O7WA 5KNCA 4IIFA 2I1QA 4OSOA 2PKQO 4AG6A 1W0CA 5EKTA 4FYIA 5LUBA 1DBPA 3RB8A 4BMOB 2PSJA 2C7RA 1PQ4A 5ALQA 3PD1A 5JHGB 2R65A 2PGIA 2FVYA 2CJPA 2ZSIA 4XD7D 3ICOA 5BSVA 1Q2XA 2FSIA 2CUZA 2JFUA 2VEOA 4QTYA 1CJMA 1RQPA 3LECA 4CPDA 4FKMA 2Q45A 5JBNA 5K45A 3H8JA 5CLHA 3RGGA 1GM5A 1ZICA 1CS0A 2B8TA 1P31A 1SUSA 2GM4A 1GWNA 1EWTA 3N58A 1IFXA 2NU7B 1ZNWA 3I0MA 3TD2A 5EHIA 3BGOS 2IWHA 2EP7A 2J5BA 3EUAA 4RMHA 1J0EA 3T1NA 4YRGA 5IWCA 1HNXB 3ICQB 1Q91A 3ZHVA 4Q4JB 2G77B 3SJZA 4HC4A 1R9GA 2IW1A 2EX0A 2AE2A 3B9RA 1ISFA 1PEYA 2AS0A 1SA0A 2NUTA 1F2UB 2BIFA 3QKRB 2YFYA 3AB3A 3PQ6A 2UKDA 4G25A 5AKIA 5THKA 4AY5A 1FRVA 1B14A 5LA6B 2WWVD 1EI9A 1FDSA 3L92A 3I8OA 2BHRA 3H9EO 2ZUWA 5KYYA 1KWKA 1L7BA 4FZ5A 1AUOA 1C1XA 1NJFA 1SXGA 3H3FA 4JL5A 3ZQJA 2RGYA 2I2DA 2Y99A 3ND5A 3R7DA 3Q11A 3ZYCA 2RIPA 3CT6A 3M4JA 4HH3C 2QM7A 1ATIA 1Z5NA 3LX8A 4V0LA 4RSRA 3V97A 3ZWBA 4D42A 2CHEA 4YB8A 1RLMA 2C3UA 1BDHA 2A4MA 1T4DA 2E4AA 1FJHA 1H2HA 3LTEA 1MEEA 2FQYA 1UODA 2D59A 1KMCA 2CXPA 2RHGB 3LUGA 1JHAA 4KMSA 4WT7A 3ROPA 3W7AA 1T0IA 1IWBB 2OHOA 3MTEA 5EMKA 3SNHA 3EVAA 4BQFA 3LZDA 4H0FA 3CJQA 4NARA 2HPHA 1VRVA 1SXJD 2E37A 2VYCA 1BOFA 2GPNA 1DKQA 2YW9A 4WBNA 4CUJA 1QPGA 3J81A 3EGDA 4RMGA 2J0QA 4IV8A 4PY2A 3IVGA 5L6MB 4LDAA 3OQPA 1ELOA 3K15A 5IDQA 2QUBA 3U60B 2BGGA 4M99A 3CEHA 5DHUA 1E2HA 3FNBA 2C5HA 3TOXA 3ITNA 3DC7A 2AJCA 2CVPA 3GDWA 3NHKA 4MDHA 3CN9A 3I28A 2NU6B 2JKZA 3ZLJA 1L4GA 1Q83A 3QLVC 3IJRA 2HYDA 1G8KA 3Q15C 3TEMA 3MS7A 4OJTA 5IKOA 3L06A 4BO3A 5BVGA 2QMHA 3VR3D 4N8EA 2FFRA 2TRSB 3UEOA 3FBWA 2QRVB 4XXHA 5A4KA 4HQ0A 4H6WA 4KQ6A 3TL6A 5BYKA 1E3WA 3ZCUA 4D8VA 4G8DA 2KW5A 1M2OB 4JEMA 1A3CA 5KC9A 5C31A 5AI6A 3SVZA 4R2KA 2QW1A 1B8UA 1KZGB 2Z83A 2ZITA 3ADOA 3STXA 5IJ0A 4D8YA 3AM4A 3FB4A 3FHJA 3BORA 2GRUA 3CJTA 1ATZA 3H9QA 1MB2A 3KOMA 2Q6LA 3EG9B 3KLMX 1M34E 4QSMA 1RYDA 1J2TA 3DTTA 1A98A 2Q8QA 3CT4A 3ZS9A 1U2EA 4CQLA 9MHTA 3SDBA 1VM6A 2VBCA 4IS2A 2VJMA 4CCSA 3AVTA 2AR9A 1R12A 2CMDA 1NQXA 1ECPA 1JMYA 5A3SA 2VZLA 1QZTA 1C3JA 2FKNA 5TDHA 3OJOA 4ARUA 3ETGA 1M2JA 1OZ0A 4H08A 5CNMA 3DBHA 3VYTB 5IFLA 1N2SA 1AV6A 1DI0A 3SC3A 1N5OX 2XCIA 3COZA 4LX8A 2BYTA 3NGXA 3WWPA 1EAYA 5DBFA 3MK31 1Q0ZA 2EKLA 3JASB 1S3SA 2CFTA 3KOUA 1GUDA 2XQGA 4H1TA 4WKNA 5FA6A 3TAUA 1DKUA 1NUAA 3A4YA 3EB9A 4JVNA 2PSEA 5JZVA 3DMTA 4G9EA 2E48A 3EZGA 3I01A 3B52X 4O0MA 5MN5A 2OTCA 3SIPA 1MW8X 2AOXA 4QECA 4MYCA 1ZH2A 1G9TA 3GDHA 1XXHB 3VDRA 4B2YA 4F7WA 5K6RA 4CU5A 5L3VA 1H6CA 2P2NA 3I2GA 4D80A 4NCBA 3HB4X 4FEGA 3HP4A 2WHEA 1IHOA 1HE5A 1LS6A 3TRFA 1XYGA 5BORA 3FGOA 4URFA 3QLJA 1Q3HA 1XDWA 1Z9BA 3WNVA 4FLEA 1XCJA 3BWCA 1NYRA 2VP0A 3V8EA 1U1GA 1DC4A 2PR7A 1OWNA 1VHLA 1U99A 2VDVE 3I6MA 1E60A 3MZ0A 2Q1WA 3PJGA 1EE1A 4FX2A 4IIDA 5EPOA 5BURA 1EQAA 1M1YA 4LRXA 1EP2B 4MYSA 4R84A 2WG2A 5H3HA 2ONKA 3W6ZA 1G21B 3B13B 3S29A 1YVPA 3U3KA 1YR1A 3ABRB 4KQJA 4QLBA 2W6NA 2HEGA 3GJRA 3ELYA 3PHIA 4I66A 4C22A 5IJ0B 2XT6A 2XDAA 2QD2A 2I99A 5DBEX 4YMLA 1IUKA 4JYZA 3PX3A 2ZREA 4Q39A 3ZZTA 4U2GA 4M76B 2RK4A 3U1VA 4WX2B 1U5CA 1JEJA 1FMLA 3U3OA 2H7VA 1FBNA 2C8VA 2W8BA 4ZVLA 4E1VA 4AFNA 1HNZB 4GVPA 4R3NA 4E4RA 2Z57A 3PWZA 2BN4A 5KNLA 1BXKA 5JBQA 3IPAA 4Q6WA 3K1TA 3G9TA 3U17A 1F0YA 1Y6JA 4GAEA 3U48A 3FA2A 1V7QA 2J4FA 2DC1A 4IJ6A 4DQUA 4HL6A 2QVCA 2QYTA 4OYLA 2I8LA 5DLYA 6LDHA 1HDYA 2JKYA 2N1BA 2OV1A 3PXGA 2GVNA 1Q1NA 1QHXA 2XUDA 2CDRA 5FUBA 3UMFA 2HF7A 5MFZA 1F7UA 3VX4A 3RTCA 3UT6A 2RGNC 4DQDA 1DX4A 4BN0A 4GOMD 5KKCA 4UCWA 2RD2A 1ZOSA 2DY0A 3AI3A 1VSQA 4DDMA 3PT5A 4HUQB 3M2PA 4EVQA 4E46A 3GLIE 3M3DA 4RJIA 4TROA 1KVRA 1VZ2A 3HCCA 3TK1A 3ZDYB 1HDEA 1I1QB 3G8YA 2F3QA 4XFJA 1ZU4A 1MJFA 3LQ1A 2PSDA 5IKXA 2VK1A 1CQJB 1V1JA 4HNTA 1W2HA 3PPYA 4R9NA 4OL9A 4C7KA 3L7BA 1E7WA 4LPKA 1GEEA 2BR3A 4OKSA 1V16B 4ND2A 1H4SA 4QEDA 4TKLA 2QNBA 1ISIA 1WSWA 3AFGA 4GXTA 5EJMA 4E7PA 3PFGA 2AKAB 2H1CA 3NXKA 1D4AA 3QSGA 3KUKA 2ZUDA 1QTRA 2OT3B 5G53C 1O94C 1OTXA 1P2SA 1USKA 1TQHA 3L46A 5DTEA 1ZXBA 2SHKA 3U49A 3ZHRA 3TXXA 2DY1A 4FYJA 4IRXA 4MWSA 3CPSA 1YJBA 1ZITA 1WF3A 1ORTA 1TQ4A 3QY0A 4O2BF 3ONFA 4KQ1A 4UFNA 2OYCA 3W1VA 4A0GA 2WYWA 3W5AA 4M1EA 4EI2A 1FQWA 3FVTA 4DWWA 2X6TA 2JLCA 3KXDA 1K9SA 1NMZA 4LVUA 4BXOB 2F48A 2P30A 4EW3A 5KVCA 1AG9A 4QTXA 5HJ5A 1L7AA 1AHHA 1T9ZA 1IBSA 2VZEA 4LI3X 5KQGA 1IY8A 2B8EA 3OVMA 4WY8A 4TVBA 2RHBA 1ZUNA 2H2FA 2ZYUX 3D4NA 3PX2A 4CMIB 5LA6A 2R6CA 2Z56A 3DJYA 2Q4RA 2C2OA 1DWQA 2ZSHA 3EHEA 4YQZA 3W2FA 3S5UA 5IWAB 5IK2D 3MGKA 3WGKA 4BMXA 3A7EA 3JQDA 4L3WA 1Z62A 1SVOA 4ZOAA 3AK4A 3ICPA 5IW8A 5AUOB 1KFEB 2I9PA 2X1MA 4CL3A 4D43A 2YH2A 5E0KB 3HM2A 3A36A 4M9CA 3RYFB 5KNCD 1P1FA 2AQKA 1Y1QA 1KGDA 3JQ8A 2Q1XA 3QVGB 4OXNA 4BECA 4BB0A 3C6ZA 4IKOA 1JHXA 4QICA 1Y0BA 1YR9A 1ZGJA 2FZKA 3FRHA 5FRDA 4QM7A 3HCWA 3OUZA 1U2DA 3KP1A 5KAMA 3VHRA 4C3ZA 2ZUSA 4QGGA 5AKKA 3PLNA 2GN1A 2ZIAA 3OA0A 4LJ7A 3OIUA 3G0GA 4TRNA 2GESA 2ZWVA 2QM3A 4Q9IA 4IDOA 5TMPA 2FSSA 1XK7A 2PSHA 2XYRA 1C29B 1XHEA 5LDGA 3AEQB 5JG7A 2GRJA 3G0CA 2JGDB 2FRDC 2AOUB 1BHSA 1GUZA 4R2IA 3U4GA 1PQPA 5CPFA 4KREA 1QAQA 2NYAA 2ENWA 3E8SA 3O4VA 4HWSA 4K40A 5E95A 3EOZA 4L0CA 1PK8A 3H3XA 1YUMA 2CFCA 1V8BA 2HV9A 3Q40A 3V2HA 3OZGA 5B3KA 1A9PA 1C0PA 1TAQA 4BNLA 1VGRA 4XH9B 4WFIA 3E9CA 1E58A 1Z5ZA 3JD4A 4QWWA 2KLBA 3DOHA 3JQQA 1K8YB 4I9FA 3SHOA 3AGQA 2D8MA 2QTBA 2G88A 1CULC 1M8PA 1Y3CE 3USZA 1NX6A 3EWIA 4RZIA 4WY2A 4DCNA 3LYLA 1VCOA 2PFGA 2Q0HA 3GUZA 4HSEA 1ISGA 4Q12A 5B3AA 5J2TA 4JGGA 3I61A 2JGRA 8MHTA 5JZ9A 1RRMA 1PP4A 3I64A 3MELA 5EKXA 1RXVA 1J09A 3AR3A 5FAKA 3ELDA 1CHNA 4FFMA 1ESEA 3RK0A 2WJAA 3DOIA 2UUOA 5FTJA 1Z28A 5TR9A 4BBZA 2O20A 2SKDA 4DF3A 4W5TA 1YCGA 2XRFA 3NCTA 4RKFA 5CVVA 4ZZ0A 5H5JA 3DSRA 3QXCA 3NWBA 1EAMA 4XB1A 5E4TA 3W2TA 2XT0A 3K1AB 3R5HA 1UPUA 1TJNA 4XJXA 5LLSA 2AG5A 3ENNA 5KQLA 2K7FA 3BDAA 2PV7A 3GZJA 4RJ2A 5LQJA 3NBMA 2ZJ4A 3OOEA 2H1LA 5FBRB 4ABTA 1AGXA 2VKQA 3FGNA 3SR3A 4DV6B 5MFPA 1POXA 3QFTA 3AONB 1UMBB 4C2TA 2B7LA 3BJRA 1T1GA 1CZOA 5DBHX 5L51A 3DBHB 4QUKA 1KAGA 2XA1A 4ZOQI 721PA 1NG1A 1P60A 5D5PA 3P2EA 2QWXA 4NPCA 3HCNA 3W7BA 4DLWA 3PHHA 1DUVG 3DKIA 4FWBA 4NSNA 2B0CA 1LQTA 3HKDB 5CYFA 5EZ6B 2BM9A 3L1UA 2HR1A 4X1KA 4N0PA 1EJ2A 1VPWA 1J22A 4LQCA 1W36C 3U4MA 4K86A 5B1IA 3DFZA 1CY0A 1YVDA 1T5IA 4C6TB 3U4AA 4ENTA 1WDLA 3TQFA 1V9CA 1T8SA 3DV0A 3GHYA 2AFHA 4HI0E 4WZBA 4EFLA 3QHAA 3QEOA 4W5WA 4EWLA 2A9VA 4AJ9A 3OM9A 2C9DA 1FX1A 1A9TA 2CCKA 5EQTA 4DSUA 1RFLA 2NYUA 3DE2X 1Q7EA 2VHTA 4MV8A 3Q98A 3UGQA 4QT4A 2PH1A 3TNLA 4N54A 5IEBA 3V2GA 3FCXA 3INRA 1QVAA 2YHBA 1C4XA 3C3AA 2PNJA 3TR0A 1GXSA 4MQBA 3Q6MA 4BNYA 4D5EA 1DGQA 4U7DA 4OB6A 3QELA 3I8XA 4EJSA 1P2FA 1E92A 1V48A 3STTA 1OXXK 2I67A 3FWHA 3RGWS 1XZGA 2QN2A 3QU4A 1ZR4A 2RHRA 1QV7A 1QLJA 3ACDA 3WHIA 4GYJA 2EG9A 2JAXA 3W6NA 3B12A 2W70A 5AVUA 4KIWA 4LF9B 4N0QA 2CNDA 1JR6A