2OBYA

Crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Putative quinone oxidoreductase
total genus 98
structure length 334
sequence length 334
chains with identical sequence B, C, D, E
ec nomenclature ec 1.-.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2obyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2obyA01
5BNIA 1F12A 3K96A 3OJLA 1ZO8A 1B14A 2V6BA 3K92A 5G0TA 1UH5A 2W2LD 1UDCA 3IKVA 3ZWCA 2J5QA 3OIDA 4R51A 3DB2A 4DLLA 3UW3A 3D1LA 3F9IA 1ZVMA 2Y1OA 4IDEA 5FYDA 4JCOA 4RVHA 2HAEA 1HDXA 1DIBA 4N7RA 4IQGA 4R68A 1QMGA 4CM8B 3PRJA 3VPHA 3E1KA 4RF2A 1P44A 1K6IA 2BELA 1DHRA 4AFNA 1YL6A 2HK9A 4UVHA 1LI4A 4CLOB 1P0FA 1GR0A 4E2XA 2DUUA 4TKMA 1JAYA 1JU9A 4UAGA 3JQFC 4Q3EA 3QLJA 3MWDB 1YS4A 2FN7A 2CSUA 2CNBA 1ORRA 1QYCA 1I32A 4Q3NA 1GU7A 3W6ZA 1NFFA 3FTNA 3H2SA 3WBBA 3KLMX 1RKXA 1EVYA 4P4LA 5T5QA 4O0LA 3WMXA 1RYEA 3H5AA 1X0XA 3C7CB 3ZW8A 4Z9YA 3TWOA 2IRWA 1TB4A 1PSDA 5COQA 4Z9XA 5JO0A 1UXGA 1Q0LA 4CM9D 3U9LA 1UXHA 4GKVA 3BZUA 3F47A 4CLXA 3F1KA 5T57A 1KOLA 4X54A 3FBTA 3MJEA 2AG8A 2XPCA 1I3MA 1JKJA 3HB4X 1PJ4A 5C7OO 4AJEA 2O48X 4Y8VA 4NJMB 1JQBA 3KSUA 3SLGA 2QRJA 4M55A 4N5NA 1O9BA 4R9SA 4FIZA 3STHA 1DC5A 2O2SA 3GEMA 3P19A 2P4HX 2JCYA 3L77A 2AEFA 4MVJF 2JD2A 4A03A 4PG7A 2P9GA 5B4TA 4CV1A 2PFGA 1I2BA 1VL8A 4Q39A 1A4UA 1Y9AA 1GL3A 2TMDA 4E2YA 1PWZA 4L4SA 2X0JA 1RM5A 1GV1A 2IEBA 4FOSA 4N54A 1E3LA 1ISMA 1YDWA 1LXCA 3GZNA 3PQEA 1SC6A 1T2EA 4PVCA 2NQ8A 3G17A 3AI3A 5ITVA 3WYCA 1E3IA 2X5OA 4HFMA 3RBXA 1L7DA 4P4GA 4I9UA 1KEPA 3GZNB 1NPTO 3ZWPA 1HE5A 3G79A 4OKIA 3FWZA 4R3WA 2ZB4A 1Q7CA 2BD0A 5TLSA 4J2HA 3AUSA 4RVGA 4J3FA 4ZQGA 2VWGA 5IG2A 4BVAA 5ICMA 4YAJA 3CMCO 4RDHA 3DZFA 2CVOA 5JCJA 2Z5LA 1XLTA 3AU9A 3QY9A 1QKIA 3DC2A 4EYEA 4CQLA 2O23A 1HZJA 3UAGA 4XEHA 1DPGA 1ENYA 1YB5A 2GGSA 1ZJZA 1B8VA 3PDJA 1CJCA 5JYDA 5HA5A 1PQPA 3AOEC 4XR4A 4NPCA 3VHRA 1N5DA 1ZW1A 3R6DA 1GV0A 1P1JA 4U8GA 1DJQA 1X1EA 4HFNA 4I5EA 4MVJE 3DO5A 4BGIA 1ZEMA 1EVZA 5F21A 3C1OA 3BMNA 4NBVA 1HWYA 4NNJA 2NTVA 1W8DA 4WCFC 1TI7A 3EW7A 5JO9A 2PH5A 4N5LA 5TS3A 3TOXA 2D5AA 2HSDA 4BB5A 4BL5A 4TWRA 4GX1A 4FJ0A 1ONOA 1KVQA 1KVUA 3E03A 5JCXA 1R4NA 3JQ8A 3KEQA 1NR7A 3NJ8A 2OZPA 2QQ5A 4EZBA 4UUMA 4CL3A 3PK0A 3PEFA 5L4SA 4KQWA 3JQ6A 3KEOA 3PVZA 3L4BA 4DVJA 3HJAA 3U4IA 1XYGA 1IZ9A 2O50A 3P2OA 1A7KA 5C37A 4Z0HO 4RJTA 2IYOA 5DBFA 2IZZA 5L7WA 4PG5A 2CUKA 4CM8A 2GSDA 2BKAA 1PJBA 1BMDA 1F8FA 3GVXA 2X0IA 3DAFA 1DRVA 1ENOA 1LQTA 3GH3A 2C82A 2JHGA 4RLSA 1KY4A 4PLHA 1PQWA 5F1OA 1ZK0A 4BKUA 1U7HA 3QW2A 5ICSA 3D64A 4JP3A 2VYVA 3B70A 2RIRA 5DZSA 4BNTA 3WSWA 2VUTA 4HX5A 3X2FA 2PZLA 3GHYA 3H8VA 4DRYA 6ADHA 5A02A 5CHEA 1XDWA 1HZZA 1NASA 1DAPA 3MEQA 4E13A 4NH4A 1ENZA 3WGZA 3ENKA 4HP8A 4XYMA 4YRBA 3VVBA 2J3JA 1W73A 3P7MA 3DZKA 4DMMA 4CLOA 2G76A 4YB8A 2D1YA 2GPTA 2I65A 1HT0A 5JCJD 1ZCJA 4JQCA 3KYCA 3CUKA 3TJRA 2C2YA 2CFCA 2ZJ1A 2I99A 3ZV6A 3GC6A 3QRWA 3H9JA 5G4KB 4JXKA 2WJPA 2YDYA 3AW9A 3QIVA 4II3A 2E37A 4YJGA 5JDCC 4IGEA 4B79A 2YUTA 4EJ6A 4D3FA 4FFPA 4MKRA 1ARZA 5KJCA 2ZQZA 4Z0TA 2NV6A 1ZMOA 2X9NA 1VL6A 2Q2WA 2Y1FA 3JD0A 5IXSA 4H16A 2O7QA 3W8DA 2Q99A 2H1SA 5GY7A 5KJ6A 1XELA 4IIVA 4WLOA 1LBEA 3KBOA 3UOGA 4F45A 2YV2A 3OIFA 2OHXA 2EXXA 4L75A 3W4KA 3L6EA 1DC3A 3ONFA 2FMUA 4FW8A 3TZKA 2EJWA 3IDSA 4EBFA 5LCXA 3KETA 4E2ZA 4RORA 1PGOA 3KB6A 2OOSA 1XU9A 2R00A 3CSDA 2Y0DA 4YT4A 4B7CA 3ONEA 4JLWA 4YDRA 2RAFA 5HBRA 3ZNNA 1U2DA 4GKBA 4D41A 3KZVA 4LGVA 4NJOA 4HKTA 3V2GA 5I9NA 2G0TA 2V6FA 4KDFA 2ZKLA 3ZWVA 1QYXA 3RD5A 4F6CA 1PWXA 4MP8A 5KVSA 2NQTA 3ZU3A 5K9ZA 3JQDA 3BHMA 3ZWXA 2FPGA 1JVBA 1RWBA 1HSOA 1UDAA 1LDNA 1ZK4A 2D59A 3PQDA 4J16A 4OAQA 2OMEA 2NVBA 2HMSA 4CV2A 2QIOA 5AXCA 4IBOA 1LDMA 3H5NA 5KJ1A 4QQRA 1E3WB 3A06A 4IXWA 1AXEA 1D1SA 1M75A 2NVUA 2BFOA 2YFQA 4XKJA 1HDCA 3H6KA 3PHIA 4DPKA 3JYOA 4FGWA 4AJJA 3VZSA 1E7QA 4XRRA 5FEUA 4A7PA 2JFGA 4KUGA 2H63A 1U3WA 1FK8A 1VM6A 4IDGA 2EHDA 2RHRA 4DMLA 4YWJA 1U3TA 1NWCA 2UYYA 2Y0EA 1HEUA 4OSOA 5AOVA 4ALMA 7ADHA 1TEHA 4H15A 4YA6A 3RUEA 4R1SA 3CXRA 3PTZA 3FPLA 5A5EA 2E6UX 3TL2A 1LDGA 1P1IA 2IZ0A 3H9UA 3QE3A 5GZ6A 3NDRA 1EQUA 3E9NA 4PLFA 4BKOA 3VKUA 3MTGA 4I5GA 3ZHXA 1EUDA 2C0CA 4WJZA 3DBLB 1X13A 3AU8A 3GMDA 1V6AA 2Q1WA 1EFKA 4TRNA 4XR9A 1PJLA 4XGNA 3E5RA 3CE6A 3I9NA 2D2IA 3BTOA 4ZGWA 1N7GA 2V65A 1GEEA 4N5MA 3AUTA 1LRLA 2C7VA 1I3NA 3AUAA 1ZXLA 1ULUA 2Q4BA 2D3TA 1U28A 5CFZA 1LC0A 3RU7A 1TT5A 2J5KA 5CEEA 3GDOA 4GGPA 4B7UA 3C24A 4MVJH 5IF3A 4RQTA 2EKPA 4NHEA 2VHXA 3GG2A 1SPXA 3TNLA 3QWBA 1HYGA 4Z3DA 4KWIA 5JDCA 3OJ0A 3GRPA 4DGSA 4P22A 3WOHA 3JV7A 4BB6A 3GG9A 4LK3A 3E9QA 1XHLA 5JC8A 2DBRA 3ON5A 2W8ZA 3Q1LA 3U3XA 2AW5A 1SNYA 3IC5A 3KHUA 2I3AA 3PGJA 1XA0A 4LSWA 1E6UA 2AE1A 4NFSA 4ZQBA 4GI2A 5KVQA 3BMQA 3G1UA 3ABIA 3C7DB 1ISJA 1JDJA 4PG6A 5HRUA 1ULSA 3H9GA 3Q6IA 1E6EA 5G4LA 2PGJA 2BFAA 3IJPA 4BIIA 3FNFA 1RM4A 4J1QA 4YXFA 1EE9A 4FFMA 1VI2A 4ESOA 3OFSA 3DHYA 4ONEA 1C1DA 2B37A 3KYBA 4FGSA 5L7TA 2W2LA 2Q2VA 1SMKA 3OMLA 5COAA 2VHVA 4E0BA 1PJTA 2FY8A 1ADFA 2VHWA 4BMNA 9LDBA 2DQ4A 2BFMA 4ILKA 4BO9A 1NVMB 1KC3A 1CWUA 4NQZA 3SEFA 2YZ7A 3EDMA 4NBUA 4KZPA 3KXDA 4BO1A 4G65A 1DRUA 4FDAA 4NDNE 4UUOA 2HMVA 1A27A 3LVFO 1NAHA 4GX5A 4CLHA 1MB4A 1GAEO 5KKCA 3DAGA 4DIBA 1YOVB 4PLZA 4IJVA 2VYND 3WMWA 4A0SA 1Q0HA 2OO5A 2GRAA 2IDZA 4XJTA 3AI1A 5A9SA 4RDIA 4RLHA 5L45A 3OP4A 4HV4A 3WJAA 1GYQA 4E6PA 1IZ0A 2BRUA 4J7CA 5JW6A 2EP7A 1I30A 2ZTUA 2Q1TA 3ZWYA 4GSKA 4N18A 1XGKA 3ANLA 4IDFA 4OGWA 4YPOA 5I9LA 3WBFA 5A05A 2HQ1A 4NU5A 4ND2A 3X2EA 3S2GA 4XDYA 2VYNA 3EZYA 3KV3O 2O3SA 1KVSA 2Q1UA 3U4CA 4EJ0A 1X7DA 3KVOA 4JBGA 4XYBA 1EUCA 1GZ4A 5TF4A 2OXIA 2OL4A 4K1LA 4CM9A 4F3YA 4PRLA 4HUJA 2BI7A 3GAFA 3ORFA 4R1NA 5ADHA 5H82A 1HSZA 5ER9A 4YAIA 4R41A 3DMTC 1KEUA 3NAQA 3MJTA 1E92A 1R4MB 4DC0A 1OMOA 4ZD6A 1HL3A 2NWQA 2FOIA 4GH5A 5BT9A 4CM3A 3ONDA 1NR1A 4JBHA 4JX8A 4FJ2A 4RVSA 5JE8A 4YVFA 5L53A 4RPJA 2PZKA 4YRAA 4PG8A 5L7YA 3HFSA 3TF5A 2OGUA 2B5VA 1LLCA 2NTJA 3GN2A 4BGUA 1QLJA 1E7RA 3PYMA 2GZ3A 2AMFA 1MGOA 1ZIDA 5C3MA 1R37A 3JQ9C 4A2CA 1R0LA 4E5NA 3LT1A 4LMRA 1C1DB 1UXKA 1CERA 3WX0A 3I6QA 4BQRA 3WLFA 3WQQA 2IEDA 3VC7A 4LCJA 3WGIA 2P9EA 1VRWA 1PJSA 5DP1A 2FWMX 5CDGA 2GZ2A 1QP8A 4W7IA 1VJ1A 2B83A 3WGHA 4A26A 4J7UA 1DFGA 4YQZA 1GADO 1GFSA 3TZQA 3PYLA 3ADOA 1E7MA 2C07A 3JD3A 5A3JA 1ZK2A 2GR9A 2DU8A 4AJ1A 1U7TA 1ZFNA 3VZRA 4QT0A 3EVNA 1Y5MA 2P91A 3D5QA 3A28A 1SCUA 3OJEA 2HMUA 3DQPA 4NBTA 4WCFA 1XU7A 3V1YA 3LT4A 4WECA 4BNMA 4A27A 3F46A 4LISA 3TL3A 3N58A 4WNCA 1B3RA 1M67A 2EW8A 4ALKA 3V1TC 1QYWA 1D1TA 1H6CA 2Q3EA 2VZ0A 4E5YA 4DBVO 3K8ZA 1BDMA 3V2HA 5CPBA 2HRBA 4E5KA 1OOEA 3FCOA 4EW6A 1HTBA 4Z0PA 3L4BC 4GAEA 1V9LA 4JJGA 2FZWA 4M1QA 1EDOA 1D3AA 2IXBA 3G49A 4RV9A 5DOZA 2O2YA 1GDHA 4GMFA 4IJKA 3DWFA 3L0DA 1YE3A 4MKXA 4ZRNA 5ILGA 1EVJA 1U4SA 2X0NA 2IZ1A 1H0KA 3ANNA 2PZJA 4WKGA 1NBOA 3O26A 1BVRA 1T24A 3T4EA 3WIDA 5EERA 3DR3A 1UR5A 1N92A 4WUVA 3SC6A 1ISGA 4BUCA 1GD1O 3HADA 1UZMA 3LF1A 2C29D 1WW8A 3AJRA 4CM5A 4R16A 3U4DA 4S1VA 4AJPA 4D0SA 4J9UE 2VWPA 2RHCA 3VKVA 1R0SA 3AM3A 2VWHA 3F4BA 1MA0A 3RJ9A 4XQEA 3ASUA 2I66A 4CR6A 4BNHA 4ALIA 1DSSG 5L4LA 1MC5A 3DBRB 3BIOA 4UVIA 3ULKA 2YHIB 1YBVA 1E77A 2WYWA 5K6AC 1PL8A 3ADPA 2P68A 3C1AA 4D7AA 3I3OA 3GA0A 3O03A 3ZN2A 1H2BA 2VWQA 1LDYA 3R1IA 2JHFA 4O63O 4ND1A 2XAAA 4OJNA 3Q9NA 1ZUD1 4WLFA 3PJEA 3RI3A 4DQUA 3QQPA 1V8BA 1B8UA 4CMEC 3AOEA 4XWYA 1GCOA 3ZNPA 1CYDA 4YJGB 3QVSA 4WCFB 5KJFA 4R1TA 2EERA 4U7WA 2AEJA 2DPHA 3WDSA 2HJRA 5BSHA 1QRRA 5TQVA 3V8BA 5I7SA 4QX6A 1OC4A 4YT2A 1QXSA 3LT0A 1OC2A 1GY8A 3IAHA 4BNLA 3NYWA 5H83A 3WG9A 2PKQP 2ZTLA 4ALLA 4J7XA 2PD6A 4MVJP 2JAHA 1JKFA 3CKYA 1UZNA 2WE8A 3UUWA 1PJ2A 3L07A 5BSEA 1T4BA 4GL4A 3GPDG 3E9MA 1I5RA 4BV9A 5ITWA 2O3RA 4O1MA 4DA9A 1ZKMA 2VRCA 1VPDA 1HDYA 3OJOA 1Y6JA 2G5CA 4MIEA 1AN9A 1GQQA 3GNTA 3V5NA 4WCDA 3PWKA 1H9AA 3K2BA 5ILOA 5KVVA 2VZ9A 1Z7BA 3WGOA 2VTDA 4E5MA 3VPFA 1W0CA 4BKPA 2Q49A 4KMSA 1DOHA 1ZH8A 1JKIA 1T25A 1GPDG 2E4AA 1DFIA 1UUFA 1VJTA 2QX7A 3BMOA 4XRGA 3ZHYA 4FC7A 2PNFA 4IQ8A 4JK3A 3M2TA 2DFDA 3TZCA 1V3TA 4TSKA 1HDOA 3HDJA 2AXQA 2VHZA 5FI5A 1RPNA 2ZYDA 3ROMA 1DJNA 2QW8A 4OXYA 5DCWA 5A4DA 1D4FA 3OA2A 4M54A 4CV0A 3RSHA 4U0KA 3OH8A 1P45A 4UREA 2ZIZA 3KO8A 4R01A 3BMOB 2CDBA 1FDTA 4KTTE 1O6ZA 1H2HA 3ICPA 3JYLA 2ZJ0A 4OXKA 4R4JA 1FJHA 2PKQO 1VLLA 1PX0A 3ZHZA 3C8MA 2GUGA 4MIOA 4TRRA 2JCVA 3RC2A 4B8WA 3GK3A 2ZYGA 2EF1A 1UXJA 3C85A 4CPDA 2JKVA 3LZ6A 3WWZA 2A9FA 5EPOA 4XJSA 3C7AA 3I9KA 2JD0A 4OO3A 2JD1A 3W6UA 2GF2A 2XOXA 3I9JA 2GLXA 1R6DA 2X5KO 2E49A 1MXFA 3QVTA 1NVTA 2I67A 2IXAA 5CDYA 1E5LA 1EBUA 1HE3A 5ES3A 2QHXA 3DEYX 5EL0A 2CY0A 3T7CA 1NHGA 2AHRA 5KIAA 2QYTA 3RC9A 1K89A 4CMIB 4DWVA 4CL8A 2VCYA 1NFRA 2GD1O 1Y81A 3D7LA 1FDSA 2BGMA 2DPGA 4KQXA 3UGKA 2H6EA 3FNEA 3WS7A 5MGBA 4Z9FA 3T4XA 4JP2A 2CVQA 3D4NA 1JWAB 4XB1A 3RU9A 2GASA 4PZEA 4H7PA 4XQ9A 4GGOA 1YQDA 1P77A 1T26A 1MXHA 1T4DA 2CF6A 1E3EA 4WPGA 4O5OA 1WWKA 2YV3A 3LSYA 3MCVA 2HDHA 4Y6PA 1ISIA 5DDIP 1MV8A 4OH1A 5EMHA 1Q7BA 1ZXBA 1GUZA 1YRLA 2YHUA 4CQLB 1KYQA 3HB5X 5KKAA 4W7HA 1R66A 2WE7A 1PQUA 4B7XA 5JDIA 2FR1A 2QRLA 2YHIA 1IE3A 4YR9A 1CF2O 2B4RO 1YDEA 1CIVA 3SC4A 5IDWA 2EKQA 5DULA 4J0EA 3VH4A 1Z74A 2YQ5A 3F5SA 4U6SA 3IP3A 3AY6A 4QECA 2DFVA 3OIGA 4XIYA 3PDUA 4BNYA 2PR2A 5JAZA 3EHEA 1XQ6A 1WDLA 3JQAB 3ETDA 3KLPX 4OSPA 1C14A 4EEZA 5JLAA 3E8XA 5AXDA 2YV1A 3BTVA 5B4VA 4IM7A 1UP4A 3DMTA 4DL9A 4TKLA 4BNXA 1LDBA 1ML3A 3FHLA 2W98A 1YJ8A 1ADBA 4QO8A 1PZHA 1N1EA 4B4WA 3I5MA 2G17A 1U2GA 5TGDA 3OF2A 3LC1O 3PJGA 4PZDA 4CM4B 1NQOA 1X14A 3ENNA 1BXKA 4R5MA 1R16A 1VSUA 3OEWA 2EP5A 4GX2A 4NIMA 1SEPA 3JTMA 3FD8A 1LX6A 1WP4A 3GGOA 2O7SA 4XD2A 3ZWBA 4PLCA 2WD7B 3DFZA 4WE3A 3RQSA 5BNTA 4M86A 2NACA 1XSEA 4WOJA 3U62A 4D44A 2UAGA 3GR6A 4XGIA 1YQXA 5L3ZA 4U6QA 4E4YA 3WIEA 1P9LA 3INTA 3GLQA 4YEDA 4BO3A 1NPYA 3EYWA 3AI2A 3NJ4A 2RH4A 2DC1A 4B3HA 3IL2A 1CRWG 4EDFA 4XQCA 2ZQYA 2H5LA 1W6UA 4CMGA 3WQSB 3W8FA 4LRSB 4M49A 4PLGA 4RL6A 3NDIA 4FFNA 3N74A 4TRJA 1YVEI 1XR3A 2NVWA 4FFLA 2VTEA 1ID1A 3BTSA 1B2LA 2DVMA 4Z6KA 3AK4A 3VTFA 3ZW9A 4IDAA 3RC1A 1N7HA 2BMAA 2W2KA 4FCCA 3OSUA 1MFPA 5KJEA 3KTDA 3EC7A 4W82A 8ADHA 3PWSA 3TDKA 4R3NA 4JIGA 1M66A 3DZJA 4LVUA 4R1UA 4KP7A 4UVGA 3BA1A 3I52A 3WWYA 1PL7A 1MC4A 4IJUA 5L51A 3HG7A 1C1XA 3NT2A 1KS9A 3JQFA 4JN6B 5TJ9A 4EUHA 2JFHA 1P3DA 2Q4EA 3F1LA 3RAJA 4AJIA 3A9WA 5L95A 4BKQA 4CLRA 1X7GA 3GGPA 3DHEA 1GUYA 3A1NA 4B4VA 3DOOA 4DREA 4IGFA 4HADA 4K6CA 3GFBA 4E33A 5IDQA 1A71A 3ANMA 3I4FA 1P31A 3GEDA 5TRTA 3FNGA 4XYGA 3HN7A 3S2FA 5JSFA 3GDGA 4BNGA 5DT9A 4I9NA 1P1FA 4DQXA 2EG9A 1CEQA 1KEVA 4ND4A 4YT8A 1HLPA 4BO5A 5BR7A 3IIEA 4XX0A 5JAIA 5CPFA 4XGKA 2Y1CA 1QG6A 2Y1DA 4J4BA 1I0ZA 2RCYA 3W1VA 1T2AA 4QSMA 4Z3KA 3GDFA 5B37A 3NT5A 3PJDA 2B36A 5CAEA 4Y98A 1B7GO 1J4AA 2VT3A 1YONA 4MVJD 1JN0A 4CM1A 2X6TA 3VZPA 4E3ZA 3BYZA 4PCVA 1I24A 1F14A 2P5UA 3OA0A 1VSVA 4BNVA 4E32A 1E1NA 4K28A 5T6BA 2YDXA 2VHYA 3IMFA 5DBGA 2POQX 4LVCA 3ZH2A 3ICCA 2YFHA 1IB6A 1YWGO 5T8KA 3OQ1A 2B0JA 2WSBA 4UUPA 3NTQA 3ZU5A 3LU1A 4RGBA 1QSGA 2QZZA 2YJZA 1X0VA 1E5QA 4J4HA 5TNXA 4B4OA 2O3JA 5HWSA 3E18A 5CP8A 2YYYA 4FD3A 4CQMD 1A72A 4CLRB 2HK8A 2XXJA 3A14A 3FN4A 4FPXA 1PZGA 1X7HA 2FSSA 4IS2A 1JVSA 1V3VA 1VL0A 3NKLA 3JQCA 4YJFB 5JYEA 4PLVA 5TJHA 5CDSA 3B6ZA 1AUPA 3PJFA 1G1AA 2V6MA 1T2CA 2FR8A 1F17A 2Y93A 3B1FA 3B1KA 2JCXA 3AY7A 4UVEA 5BSFA 3LLSA 4AJKA 2WDZA 3UXYA 3SXPA 4B8ZA 3I9OA 3SBOA 4CM4A 4D46A 5A06A 2OORA 2XXBA 2YQ4A 5CDUA 4CMBA 3JD2A 2LDXA 2DBQA 4QEDA 1O8CA 3LDHA 1R0KA 1J5PA 3WNVA 2PZMA 4L4RA 4OM8A 1DDOA 2WMDA 4RVDA 4YTEA 3RFXA 3SJ7A 5JAMA 4P38A 4WASA 2TMGA 4MVJG 1PR9A 4CMKA 2EV9A 4PFJA 3MTJA 5HS6A 1S7CA 2EJVA 2J3HA 3QV1A 3IOYA 4NR0A 4HY3A 3E82A 1H6BA 3HE3A 2G82A 4P8RA 2DBVO 4B3IA 2AQKA 1H93A 1VKOA 4OIMA 3O38A 2DKNA 4S3MA 2CVZA 4FQ8A 4E31A 5JNLA 2FSVA 3RIHA 2Q2QA 3PQFA 1HRDA 3RUDA 3E6AA 4QFCA 4BO6A 4C4OA 3M2PA 1YXMA 3DBHA 2FPIA 2EW2A 1ENPA 1M6WA 3PXXA 1BW9B 3F3SA 3U49A 2ZTVA 3ZNQA 1YB1A 5JC1A 1NWHA 3CPSA 3VOSA 4B3JA 3PHJA 3FNHA 1Y8QA 5IAAA 1UDBA 5JMWA 3RCBA 1XQ1A 2H9IA 1DLJA 5IN5A 2NVUB 3VAZA 2VYVD 3DBRA 5MDHA 5GMOA 1DEHA 3R0IA 3ZDFA 3DZIA 4PIVA 4M89A 1PEDA 1EE2A 3K73O 3VPXA 3NX4A 1IPFA 3D3WA 5F5LA 1YO6A 3BMNB 2FHSA 5A03A 5I7VA 4MP6A 3R3JA 4GVLA 2GZ1A 3GVPA 2AG5A 1HDGO 4KTVE 2PD3A 3KUXA 1MP0A 3CMMA 4WEQA 4TZTA 1BXGB 4ALJA 2J6IA 1EFLA 4J49A 3BAZA 2BLLA 5KWEA 1ONNA 1IULA 3ZHBA 1UP7A 1ZZEA 4HNGA 2I5PO 1BTOA 2FP4A 2VOJA 1BXGA 3I4CA 3M1AA 4LSMA 1YQGA 2Q1SA 9LDTA 5HS4A 4C7KA 2GN8A 3ZNOA 5F1KA 1WLYA 3PGXA 3KYDB 2YW9A 5DCYA 4AG3A 1HDRA 2HKIA 4EUFA 2UUOA 1QLHA 5TT1A 3GNQA 1NQTA 3GF4A 3ROQA 3L9XA 5L4NA 4NZ9A 3Q11A 4CMCA 4ZQHA 2HK7A 2A4KA 3DTYA 3P5SA 1I10A 4QFDA 5LDHA 1O5IA 1LSSA 3COSA 4AJNA 5CEFA 3DZHA 3QVXA 4ID9A 1FDUA 4GSLA 1BG6A 3TN7A 1BXZA 4BV8A 4RO0A 3JQEA 2OP0A 3KOUA 5T67A 1YKFA 2C59A 5IJZA 4MKZA 4Q3BA 3EY4A 3EMKA 1QV7A 1E1KA 1Q1NA 3S55A 2I6TA 3CH6A 1KBZA 3DOCA 5JY1A 1B15A 3HFGA 2DLDA 3RBVA 4CJXA 4I5FA 1OAAA 3V1UA 1PIWA 3LT2A 4XA8A 2DT5A 1VE9A 4YJHB 1PGPA 2X9VA 4YJFA 1EVIA 1XKQA 2BGLA 1YBAA 5EESA 3MJVA 3ROKA 3NEPX 3FF4A 4BQPA 2HMTA 3RUCA 4IS3A 4UUNA 3D4PA 3FR8A 2NU7A 1F0YA 2W90A 2DBZA 3I6IA 3NGLA 3QVOA 5JFOA 4B4UA 4BO0A 4DUPA 4Y6RA 3BTUA 3D5TA 4P4NA 3KYCB 4IUYA 3NV9A 5AYVA 3K6JA 4Q9NA 4JNKA 4MO2A 1F8GA 4XCVA 3KM0A 5KNLA 4CUZA 3AOGA 3HHPA 1EK6A 1L7EA 1RM0A 1E0DA 4G5HA 3UCFA 4RF5A 4PN3A 3ZCXA 1R4NB 1U4OA 2X1HA 1GTMA 2PGDA 4LMPA 2VRBA 4E2WA 5T64A 1HF3A 1DC4A 4TMFA 4Y6SA 4NMHA 4INAA 1FF9A 1Q7GA 2GN4A 2X4GA 5CG2A 3ETEA 4TVBA 3KRTA 4J6FA 5L9AA 5ENVA 1I33A 2D4AA 3HN2A 3PZRA 5LDGA 3WGTA 2WM3A 1U8FO 4AL4A 3L6DA 3GHHA 5U1PA 2ZATA 2GCGA 2ZK7A 3T7EA 1GQ2A 1E3SA 1NXQA 3W8EA 3I9MA 3O4RA 3EK2A 4MDHA 1ZSNA 1NVGA 1K2WA 1ISHA 3MWEB 2Y1GA 5IZCA 2OBYA 3B1JA 3NT4A 4IY1A 2HMWA 1U9JA 1IY8A 2Y66A 5AXBA 5JAQA 4DIFA 3QSGA 5C7LO 1JWBB 2NM0A 1PS9A 1TLTA 4BO4A 2C5EA 1O95A 4Y67A 2O3TA 3BMCB 4DLAA 3LLVA 3LYLA 4IXTA 5A9RA 5A1TA 4DLBA 4BNFA 4IMPA 3QA9A 1U8XX 4QO7A 2J8ZA 3OICA 2HU2A 5B1YA 2SCUA 2F1KA 3AM4A 4MPDA 5BQFA 1GZ6A 1J6UA 3C1TA 2R00C 4IDBA 3HUDA 4GLOA 4YBZA 5I9MA 2P2SA 4AICA 1GYPA 1X15A 3VDQA 2PLAA 1UAGA 1DC6A 1U3VA 4AJ2A 1NP3A 3HZZA 1LDEA 3FR7A 5A9SB 1JAXA 4FC6A 2C5AA 1UZLA 3DDNA 3TFQA 1JLLA 4BKRA 1YOVA 4FFRA 5IZ4A 4EUEA 3CZRA 2ZCUA 4TZKA 4XB2A 2F00A 4WOKA 2PK3A 4O6VA 1BVUA 5GZ3A 1T2FA 4H3VA 4AJOA 4D0RA 2NSDA 3FTPA 4FJ1A 5L40A 5U9CA 1S6YA 4CUKA 3IUSA 1QORA 1Z73A 2O3QA 4HBGA 3O8QA 3RASA 2PKRA 1U5CA 3H4VA 4HFJA 4WLUA 3L9WA 3PZBA 4J2OA 3UFXA 3WTBA 1G6KA 1HXHA 4UEOA 1WZEA 1H6DA 4IPTA 1FDWA 3DTTA 1GEGA 2X8LA 3FWNA 1MLDA 3GVCA 3GNSA 3ZV4A 2X7HA 2Y68A 3WTCA 2NLOA 3RJ5A 3I9LA 3GMSA 4U5QA 4I9HA 5HM8A 3JQGA 4FS3A 1WZIA 4ALNA 3GN1A 4ZU3A 3IQDB 2Q45A 2GYYA 5A5FA 5EQDA 3DZBA 4PLWA 5DNAA 1P1HA 3JD1A 3TZHA 1ADCA 3JD4A 4PVDA 4CQMA 5B4UA 4CQMB 2GERA 3IKTA 4MOWA 5TX7A 2ZTMA 5FF9A 1G0NA 3FSRA 1PS0A 1QV6A 3BHJA 1ZSYA 5TT0A 2C20A 1UJMA 2GN9A 3HQ4O 4OHUA 5K6AA 3WFJA 1BGVA 3JQ9A 3E48A 1V3UA 3H5RA 2RBEA 4OOEA 1I36A 1GQYA 3S8MA 3SLKA 4MP3A 1DHTA 1YB4A 2OUIA 1X1TA 2EGGA 4FBGA 2B69A 5DN9A 5G2OA 4DXHA 5AVOA 4MVJM 1NHWA 1B3BA 1Y7TA 2HCTA 3RROA 1NNUA 4J43A 1WPQA 2VT2A 1DO8A 2UDPA 2P4QA 4I8XA 4AJHA 3HNPA 1LU9A 3GUCA 1HLDA 2EIHA 1Z82A 4BGVA 4L74A 4MVJA 3GY0A 4NK5A 1WMAA 1LSJA 3DBLA 3ZWNA 3OHSX 1TXGA 2D8AA 3B20A 1LQUA 2Y99A 3OEYA 4Q3CA 3HWRA 1GZ3A 1AHIA 3JQAA 3WB9A 1DB3A 1RYDA 1I2ZA 3H9EO 3HDYA 3TPCA 4KDEA 2AE2A 3ZGYA 2OFPA 1A9ZA 4BNIA 4CM6A 4IZIA 4RQUA 3PWZA 5AXAA 2D5CA 4IIUA 4QTZA 1N9GB 4URFA 1P1RA 3ST7A 4GBJA 1R12A 1C0LA 1GPJA 3UCXA 2ZB8A 3MOGA 1B16A 1KC1A 1SBYA 1FMCA 1AXGA 4BOYA 3NTOA 1JTVA 4FB5A 1EDZA 1W4ZA 2VNAA 1XCBA 3EGOA 3PI7A 3MJ4A 1GCUA 2PY6A 3JQBA 1HKUA 1D7OA 4ZQEA 5COBA 3BMCA 3VH2A 1R4MA 1Z75A 5DP2A 4G2NA 1TT7A 5A04A 1HYHA 4BO7A 4ZJUA 4IJWA 4PRKA 1ONPA 2LDBA 3RKRA 3WFIA 4BO2A 5HTOA 1PU2A 4GVXA 3TOZA 1QR6A 5JY6A 5FFFA 2I76A 1Y8RB 2GDZA 3S2IA 8LDHA 1OZAA 1NPDA 2VUSA 2P5YA 3U0BA 4LRTB 2CD9A 4M87A 4D79A 4OOFA 2AEMA 4F46A 5DBIA 1XIVA 5C5IA 2Q50A 4MJLA 3UN1A 4CR7A 1Z6ZA 4I5DA 5EN4A 4WLVA 2B4QA 3N7UA 1VKNA 5I7EA 3CEAA 4KUEA 5G0UA 3WYBA 2NU8A 1BSVA 2ET6A 1PTJA 1YL7A 1KETA 1LC3A 3HDHA 1Y8RA 3WYEA 2W2KB 3BHIA 3M1LA 4RZIA 1K0UA 1H9BA 4YRDA 4TQGA 4E5PA 2VRCD 5J23A 3NTRA 5EQFA 3ZU4A 4BMVA 4YAKA 1U1IA 2D0IA 3DFUA 2E82A 2VOEA 3P2YA 3OQBA 1D8AA 3ZU2A 2Q46A 1A5ZA 1TVEA 2BFPA 4O59O 4CLDA 1C0PA 2NADA 4YQYA 4DYVA 2UVDA 3LC2O 3E5MA 4LW8A 3JSAA 2AQ8A 1N9GA 1DRWA 3JQAD 1YGYA 1ZNQO 5FI3A 3VTZA 4K9DA 1TT5B 1O89A 4CR8A 3IUPA 4BNUA 4XZ3A 3IP1A 4RVUA 3PIDA 4CLEA 1CETA 5JXWA 3FBGA 1I8TA 4QUKA 2I3GA 2Z95A 4FN4A 1M6HA 4PGFA 2EWMA 1V0JA 2IYPA 2X5JO 4K6FA 3DZGA 5TIIA 1EK5A 1Q0QA 2NNLD 2Y0CA 3NDJA 3TSCA 4ZICA 2WTBA 4CM7A 3ZWAA 3PYXA 2VQ3A 4Q3AA 5K0ZA 1MFZA 3PP8A 4NBWA 1M76A 4CMAA 4L8VA 4TVOA 4E21A 3SX2A 3CTMA 3RUAA 1C0IA 1Y1PA 3VDRA 1Z7EA 2O4CA 3EAGA 4NFHA 2PD4A 1P33A 2J3KA 2AQIA 1I01A 4CV3A 4YAEA 1YH3A 1Y5RA 2CF5A 3OECA 5C7IO 1GYRA 1PJQA 5JBIA 1WDMA 2HRZA 4YJHA 1EUZA 2X23A 2PH3A 4RPHA 3INRA 4LCEA 1DLIA 4L4XA 1E7YA 1AHHA 2FPPA 1T1SA 5EIOA 4I08A 3QHAA 4ZRMA 3BXXA 5FWNA 2AQHA 4J1NA 3TZ6A 3KSDO 1KERA 3GRKA 3VZQA 1LLQA 3NRCA 3AY3A 1H6AA 1E3WA 4EI2A 2PWZA 4XYEA 4J1TA 1TA4A 3QVWA 3CIFA 4J0FA 4IZHA 2R6JA 3UH1A 1DBVO 3IS3A 4MIYA 3PHHA 2E48A 4D42A 4OMUA 1FXSA 1PZEA 4NFYA 1U5AA 4J90A 4HNHA 1EQ2A 1QYVA 2WEKA 4DC1A 1ZEJA 2FR0A 1BRMA 1IPEA 3EUWA 5A3VA 3QWFA 1LJ8A 5IFLA 4AJLA 1KY5A 3LC7O 4HWKA 1F06A 3K30A 4WLNA 1K6XA 1DIGA 3C3XA 5JMPA 3AUUA 5THKA 2HO5A 5G0WA 5EJ2A 5IN4A 4FFOA 3UHAA 3UCEA 1PL6A 4ZHSA 2X0RA 4HXYA 6LDHA 3MOIA 3ZWMA 3W4JA 1PZFA 1AE1A 1Y9EA 4R9RA 2DUWA 4RF3A 3PHLA 1DIRA 2DAPA 1BDBA 2DTEA 3H7AA 1YBMA 3I1JA 4GQAA 2EKLA 2UUPA 4KOAA 4R54A 4BNKA 5LC1A 4EEXA 3JQ7B 1SZJG 1YJQA 1EMDA 3PHGA 3Q0EA 1NQAO 3WR5A 4D3SA 2V6GA 3JYNA 3K2EA 2G1UA 1GUFA 2J5RA 4D43A 3MJSA 4XIJA 2VN8A 3UF0A 1IYZA 2AA3A 2QG4A 3AFNA 2C7GA 2NTNA 5CDTA 4MVJI 1E7SA 2XF8A 3WLEA 4FR5A 3RBZA 1SOWA 2QRKA 3ZV5A 3ASVA 3VH3A 2IODA 2ZB7A 5JS6A 1WXDA 3UVEA 3VPGA 4BMSA 2VNSA 5U4QA 5KOIA 7MDHA 4GMGA 3G0OA 4NI5A 3RFVA 2GN6A 4GPD1 1UAYA 1ISFA 4YT5A 2Y67A 4IDDA 4DIOA 4WK6A 4UVDA 1JW9B 3RUHA 1NQ5A 3D0OA 4XQGA 1G0OA 1I2CA 1RM3A 4PLYA 4XDZA 5B12A 1PGJA 4OKNA 4YCAA 2O4UX 1IHYA 3DHNA 4ZA2A 4PZCA 5G4KA 4R69A 1MUUA 4WLEA 3WJ7A 4K26A 1IOLA 2ILTA 1P0CA 4R5HA 2B5WA 3TFOA 4QXMA 1E6WA 3WNQA 4YAGA 1O0SA 5KTKA 3SJUA 4AVYA 1I3KA 2R2GA 1E7WA 1ZK1A 4U0JA 4DBZA 1BWSA 2W4QA 3FRJA 1P74A 3JYPA 3LF2A 2EEZA 3FI9A 4MINA 1B26A 2IE0A 4ND5A 4HFRA 3GVHA 3QJ5A 3JQ8B 2VUUA 1NYTA 3R3SA 2X86A 3QWIA 2WD8A 4BNJA 2RH8A 2CMDA 1A7AA 1N2SA 1T1RA 2P9CA 2EGHA 2WWRA 1V35A 2OBNA 4CODB 5CEJA 1DXYA 3GOHA 3GZ4A 1ZMTA 3GVIA 5G0SA 3WICA 3ITKA 2BF7A 5KVCA 2B4TO 3OBBA 4RF4A 3G3EA 1LRJA 1WNTA 1RJWA 3JQ7A 2B35A 4NU6A 3RFTA 2DTXA 4F6LA 3PLNA 3VH1A 3WGGA 3GAZA 4KWHA 1ADGA 4JROA 2DM6A 2VZ8A 5DF1A 1DIHA 3KYDA 2JAPA 3LQFA 4OQYA 2BGKA 3Q9UA 3ZWOA 1WDKA 4YACA 4RCVA 4I1IA 4WGGA 2ZYAA 1J49A 1LSUA 1XG5A 4W9NC 3GPIA 1PGNA 2PA3A 4L73A 2X22A 1DAOA 1WAMA 1B8PA 1FDVA 2PV7A 1ZSVA 2CZCA 2GO1A 3CZMA 4DPLA 1KVTA 4L76A 4CMJA 1K3TA 1K6JA 1ZJYA 3DAPA 4W9NA 4DQVA 2X58A 3VPSA 3K31A 1E3JA 3D4OA 1J0XO 3DBVO 3K9QO 1C1XB 1LRKA 2V7PA 1LNQA 1EBFA 1T2DA 4ND3A 1LTHR 3QWHA 2QYSA 3AFMA 4IQ0A 1LEHA 3GGGA 5EINA 3Q3CA 5TSDA 1HDZA 3PIIA 3QP9A 3JQBC 2BHLA 2PTGA 4YYZA 4CMEA 4RVFA 4RPLA 3PFFA 5CG1A 1M2WA 5JPIA 5BSGA 3BMQB 1Q2XA 2ZB3A 4PLPA 1SOVA 1PS8A 2J3IA 3Q2KA 4BS9A 1H94A 3L6OO 1I3LA 5A9TA 2HLPA 4FOOA 1OFGA 1E1MA 5ER6A 1NFQA 3QWAA 2HJSA 2A35A 1OBFO 1WVGA 1IHXA 4RPGA 4EGFA 2Y05A 4GWGA 3HSKA 3GEGA 3U4HA 5H81A 1BW9A 3EVTA 3H3FA 1E1LA 1YL5A 4JJIA 2JJYA 2Z1MA 1MG5A 3A4VA 3ZWWA 3DBHB 1U3UA 1Z45A 5TC4A 1IL0A 4TRMA 3RC7A 4ROSA 3H2ZA 3OM9A 3H9QA 2PGLA 4BHTA 2CDCA 3INGA 2C54A 3IJRA 1OI7A 3RWBA 1KEWA 1EEHA 1AGNA 3WGYA 2GNAA 3M6IA 3PPIA 3D3WB 4GLLA 1MG0A 3I23A 1N1GA 3GUYA 1PJ3A 4A73A 3H65A 4GX0A 3G1TA 3NUGA 5IDYA 4W6ZA 1QYDA 3HDQA 1L1FA 4A5OA 2WYUA 4ZVVA 4UULA 3L4SO 4KUHA 1SEVA 1K5HA 1Y8QB 4J4TA 3UICA 1EZ4A 3UKOA 3EZLA 4BNWA 1KIFA 1IUKA 1SB8A 3GFGA 3PLRA 1NTOA 2O3UA 5I8WA 2YY7A 5F3RA 4E30A 4NJMA 5I7FA 4D45A 1LA2A 4L0QA 4OL9A 3VVCA 1HYEA 4BGEA 4C7JA 1O94A 4J9VA 2BI8A 1XEAA 2WD7A 2HUNA 1UP6A 2Z1NA 4J91A 4OQZA 4TROA 5AQ1A 1PGQA 1ZBQA 1NM5A 5IXYA 4EJMA 5THQA 1UXIA 3U5TA 2A92A 2FRDA 3O8QB 4GWKA 3DMYA 4UEJA 4IMRA 3F4LA 3F5QA 3Q2IA 4LN1A 4NBRA 4WEOA 3ETGA 1HE2A 5ENDA 4PG4A 3JYQA 5F1PA 3DL2A 3WQRA 4NK4A 1KVRA 1ZK3A 1C0KA 5F5NA 4IINA 3LK7A 3H3JA 3JQGB 4PLTA 3ZV3A 3MJCA 4J1SA 3RUIA 3NGXA 1VJ0A 2X9GA 3D3EA 4ZQFA 4A10A 3GT0A 3V2UA 1A9YA 1CDOA 2DTDA 1LUAA 2WYVA 1C3VA 1H5QA 4UEKA 2FZEA 3SVTA 4Q3DA 4EITA 1N8KA 1DFHA 3WSVA 3OQ6A 2JL1A 4II2A 4RPKA 3TRIA 3W4IA 4DYDA 4JGBA 1SAYA 4M8SA 4XYLA 4AJ4A 1WMBA 3O9ZA 1P1KA 1CQJA 5K1SA 1HETA 1PR3A 2QZ9A 4BNNA 2NU6A 4OYRA 1LLDA 3ROPA 3AM5A 2Y1EA 2NUAA 1LLUA 2CDAA 5I8ZA 2ZCVA 4ZN6A 3F6YA 3ZI0A 2A94A 5IDXA 4OXNA 1BHSA 4RZHA 3KSZO 1XWFA 3OETA 4DTIA 3PFWO 4D3DA 4E12A 4JBIA 3K5PA 1A4IA 1NAIA 3FPCA 1LSOA 1HE4A 5JDIC 1VC2A 3DXFA 5G0VA 4CUJA 5DOVA 3JCZA 3GQVA 4G81A 1B0AA 4IDCA 3AWDA 2I9PA 3ZZNA 1JA9A 3OJFA 2JFFA 3S2EA 2NU9A 4W99A 3I83A 4Y9DA 3WGQA 3U09A 4CMIA 4NG5A 1CQIA 1SB9A 3TQHA 1PJCA 3DONA 1R15A 5GZ1A 3DOJA 4W4TA 2C2XA 1MX3A 1SO8A 4DPMA 2UV8A 5KCZA 4ITUA 5T8KC 5DCUA 3RKUA 3RUFA 3CINA 4BNZA 4JJFA 4WNIA 3S1LA 3RVDA 2BH9A 4L9RA 4CMHA 5BNFA 1DIAA 3ITDA 1NX6A 2OP1A 4FSHA 4YJDA 3MZ0A 3WXBA 4BO8A 5IZCC
chains in the Genus database with same CATH superfamily
1P1BA 4M9QA 1EFRD 4XM0A 3C7TA 1SA0B 1MAVA 5K4GA 2BI4A 1RYHA 1SUBA 3PCRB 3PUIA 2J5QA 1W5TA 4G5YA 3ZWCA 4E11A 4A1OA 1TIBA 4EB6A 3THXB 3D4LA 1NP6A 1KI1A 2A86A 2G4LA 4O8CA 3PXUA 4DLLA 2FN8A 5K0SA 3GJ0A 5HZGA 4KQ9A 2D54A 2JZNA 1EH5A 4XTCS 1JDZA 2Y1OA 2IA5A 5FYDA 4DAOA 1QOQB 1CE8A 3TRHA 3QLVC 2FMTA 4N7RA 3ZHQA 3OP1A 5CX1B 5A7HA 3GLGE 1PBNA 4R68A 4CM8B 4HAUA 4GKJB 2WAMA 4O4HB 2BELA 4D5EA 1IN5A 4P7JA 2H1FA 2FMXA 3U4MA 5TPWA 1YL6A 1QG4A 1G3QA 2QMUA 2HK9A 4D56A 1E32A 5LYJF 4GQBA 4CLOB 4JLBA 4BQEA 2PS3A 3ED1A 1RPAA 2DUUA 3C6KA 5ALHA 1PV4A 5BV2P 4BYGA 1RS0A 1JU9A 2XYHA 5BV1A 5EP1A 3SJCA 1F7VA 1YR9A 1C9KA 4IGKA 2O0MA 2XDQA 3UIEA 5HDBB 1XD8A 4XDHA 3GPBA 3TSOA 5JAOA 3LW8A 2WIFA 4Q3NA 3W6ZA 1HDIA 1NFFA 3RS4A 4TLMB 3WBBA 1Z5ZA 4P4LA 5DSXA 1GCGA 4FMCF 2AXEA 5T5QA 4GYJA 4TM7A 3KBBA 1RYEA 1TC1A 3H5AA 1KIAA 3HU5A 4HGZA 5EEGA 3WMXA 1CEXA 3VR6H 3GT3A 3HZOA 4Z9YA 4PPNA 4RFSA 1PSDA 5COQA 5ITZB 4CM9D 1NLFA 1Z37A 1Y4ZA 1Z5PA 2OZVA 3CLRC 1VBNA 3DMRA 3ES9A 3SIXA 2FUG6 1UEXC 3SC3A 1KOLA 2VG8A 3ID6C 3FBTA 1QOPB 2B2NA 3MJEA 3JAKB 1JKJA 1TQ2A 3D9QX 4FDMA 2FOXA 2IIVA 1OYOA 3F8SA 4L72A 3SLGA 1O9BA 3BWEA 2GNOA 4TWIA 4R9SA 1AHNA 3GEMA 3BH0A 3ETJA 5DU2A 3UAWA 1KSFX 5E8JA 2DFTA 5AM3A 1UPFA 2XQGA 4G1VA 3O7WA 2AEFA 1A9QA 3QEAZ 1TA0A 4MVJF 4MHSA 2G9VA 4ZWNA 2P9GA 5A5DA 2EG5A 1X2BA 2JI7A 2PFGA 2F43B 1Y9AA 1GL3A 4PCAA 1PWZA 4L4SA 5EUBA 1P4AA 4B6JA 1Q7RA 2JZCA 1VL1A 2VDWB 4GMDA 4L08A 4TMYA 1THMA 2GILA 4FOSA 1HFKA 4G0MA 4N54A 5DTRA 4DT1B 4AZTA 1PNRA 3OC0A 1AZWA 4MW5A 1LXCA 2XE8A 2BGIA 2I80A 1ZA1A 2A5YB 3FKSD 1G66A 4LI3X 4X1KA 3UT5A 1T10A 3T34A 3W2GA 3LCVB 1DEXA 4YLYA 2JIZA 2CUTA 1QCDA 3I01A 5ITVA 3PE3A 4HFMA 3LZCA 5ALRA 5IKXA 4BIMA 3TUZC 4FXPA 4P4GA 4R40A 5DPMA 4AKIA 1IWOA 1CJTC 3GZNB 2H5IA 2ZRAA 4O0MA 1FIUA 5K8IA 1VDZA 4ZKEA 1TYZA 1QB8A 1TU0A 1ZQ9A 2P30A 1S5PA 1QVZA 3EGDB 3G79A 3OFJA 1Q7CA 2LRHA 4OKIA 1QGDA 4N7MA 4R3WA 1XQVA 3GEEA 3NBKA 5L3QB 3AB7A 5ICGA 4PZAA 4BVAA 2P8SA 2F43A 3IHLA 3WFZA 4FX2A 5DHAA 4YAJA 3J7AC 1R5BA 2JZOA 3DZFA 4EDHA 1E5VA 2CVOA 3G82C 5JCJA 4A2PA 3Q4GA 4N1AA 5EIHA 1EG2A 1LPAB 3DC2A 4IUCS 4CQLA 3LXXA 2O23A 1M2EA 3ILSA 3R5FA 4OMCA 1ENYA 4XEHA 1YB5A 3I53A 4YBRA 4Z54A 2A57A 1OVGA 5FOXA 1G20E 4C88A 3OE4A 3WKCA 3GA5A 2IS4A 3SE0A 1CRZA 1Q6YA 1VE1A 2BHTA 1Z35A 2G1KA 4JIMA 5HA5A 5CB4A 2DR0A 3LHIA 2ZUVA 4XR4A 2BBOA 1M6NA 3UO8B 1SN7A 2B8JA 3ESDA 2A9QA 3H11B 4I5EA 5EY5B 1N2BA 2IW3A 1R0ZA 3L7AA 2P65A 3K6KA 3WISA 4DQLA 3N86A 1S4MA 3D6NB 3T9BA 3LGXA 3H1EA 4OHKA 1EM6A 2QQEA 3QFHA 4ML3A 1O95C 1SXJB 1Z6TA 3HKEB 3JZFA 4US1R 7YASA 1TI7A 4L5CA 1LPPA 2D5AA 1SBZA 2WTXA 4GX1A 3EH2A 1GUBA 3E9RA 4KIWA 1O3YA 4AROA 2FWBA 5DKFA 2I6XA 1BJRE 1UC4B 2V03A 2X7XA 3DEHA 4AZWA 1CUCA 1Y6ZA 1K9VF 3EFBA 4P3PA 2IVFA 3TYXA 1OTXA 3OY7A 4UUMA 2WILA 3A6JA 2AI3A 2BTQB 3T52A 3PK0A 1T8WA 4QPCA 1N2EA 2BDEA 1JR3D 3U4IA 3V2IA 2DT8A 3A9VA 2O0KA 4WZBA 1N5KA 4MCJA 3P2OA 1A7KA 1S2GA 5C37A 1N3LA 4X66B 1EP1B 4BUZA 3FOWA 4RS3A 2H4WA 3L7BA 5BVGA 2O57A 3BAFA 1EQAA 4X1YA 5FUXA 1SU7A 4CM8A 3T61A 1PJBA 4D9HA 3IVAA 2I4MA 3GVXA 3DAFA 1UBOS 1DRVA 1ZI6A 2PRIA 3GH3A 3LUKA 3R6WA 2VR1A 2NO6A 4XVCA 2OB1A 4PLHA 1ACLA 1PQWA 3K0AA 2QLFA 5F1OA 1N33B 1Y82A 3IEMA 4MLDA 3TRFA 1N6OA 2VK1A 1G18A 3AETA 2I91A 1XVLA 2XUZA 2ADMA 1FVFA 2Q41A 3B70A 1V8DA 3I39X 5DZSA 3WLHA 3CWZA 3EXEB 1LFAA 2JFVA 2VUTA 2OVBA 4HX5A 4IEEA 4MV6A 4PBTA 3WSWA 2VSOA 3GHYA 4XDGA 3UMCA 4G8JA 4BV2A 3SI7A 3MRSA 1NASA 2O7NA 2FW1A 2YS6A 3MEQA 4FZJA 4RSMA 4NH4A 1L5KA 5MGNA 3QVKA 4HP8A 5HUQA 2QY9A 2UXCB 3UMRA 2V4UA 1KMHA 2HZ7A 2RH5A 3RT9A 1RRGA 4IR7A 4AJ9A 1QAQA 1W6RA 3DZKA 1RYYA 3IUMA 4FHZA 2G76A 2OB2A 4QPJC 1HT0A 5JCJD 1MC8A 1V2HE 4WH0A 1BS9A 3BSSA 4HXGA 3KKEA 2ZJ1A 1X9GA 3I34X 5DWQA 3GGSA 4CU2A 1GTRA 1GPMA 2WVGA 1SC9A 2ZUCA 4YRMA 3ZV6A 5IU6A 2W2PA 4JXKA 1NBHA 2XTMA 4II3A 1TF7A 1U6KA 4IGEA 5EC8A 2HNAA 3Q85A 3ZCRA 4FBLA 3P2IA 3LPAA 3SHVA 4D3FA 4FFPA 3QJGA 1I80A 4Z0TA 2Y1FA 4X5OA 3UAZA 3EIXA 3Q3HA 2O7QA 4DLXA 2AKYA 3OZVA 3MHTA 4L6AA 1XELA 4JMPA 3R3HA 3N5KA 4QM7A 4IIVA 1GM5A 1T0PA 3UOGA 5JCZA 3OIFA 3CZ5A 3FJ1A 5DNCA 3BFPA 1U2TA 4GF5A 4L75A 5FHRA 4G9BA 2XIQA 1CUJA 3GP3A 1HX7A 2QY6A 3RE1A 1I6KA 1PGOA 1K7SN 1XU9A 3H97A 4V39A 1QGUA 1E2FA 1ZYUA 3B1WA 4YT4A 5LQNA 2CJWB 4FSDA 2GA8A 4YDRA 1QYIA 2AOUA 2J5BA 2VNKA 1A5SB 3AUJB 3LUPA 4U7DA 3AR8A 3C4JA 4EL5A 3TSWA 3N75A 4C07A 4AKHA 4F60A 1N3BA 4GKBA 1HKHA 2YVUA 4S24A 4EF6A 2K7FA 3KZVA 4LGVA 1M34A 4HKTA 3HY4A 5MFZA 4K6MA 1X7ZA 2PRZA 3UTDA 2V6FA 1OIVA 4X6LA 5I9NA 5EMNA 3ZWVA 2XUJA 3RD5A 1GPUA 1U5BA 5JTUA 1KYXA 2GFQA 4Z7OB 1O57A 2V4MA 4PHCA 2NQTA 3EPRA 5LP6B 3GAAA 3OE1A 3W5HA 2EIXA 2XA9A 2ZE5A 4OHBA 1TF2A 3KSMA 4OFWA 4QLAA 5LXTF 4ASUD 2V0CA 5HE8A 1RWBA 3A2NA 5JS2A 1RXYA 2AJLI 2D59A 4RHEA 4YYEA 1O0CA 4TTTS 4EI9A 2NVBA 3H13A 2AWOA 4CV2A 4K0KB 3RRNA 4DDWA 3DE3X 2FN3A 3AHHA 1WCXA 1LDMA 2OV6A 3KQMA 3LUCA 3PDWA 4I1YA 1E3WB 2FVXA 1JHVA 3MTQA 3M70A 1QLWA 2G8NA 4LEIA 4JI4B 4GR5A 4LFCB 1GKIA 1M75A 1X19A 3I12A 3RYFB 2GEJA 1U04A 4YMHA 4XE5A 2BFOA 4D25A 3C14C 3NVMB 4JL5A 1CYEA 1HDCA 1WDWB 3K0BA 4DPKA 4UFOA 3JYOA 3INYA 3NHJA 4FGWA 4RXMA 2WQ6A 1E7QA 4XRRA 2JFGA 2XCQA 2H63A 2YWCA 2XB4A 3FWHA 5CYGA 1U3WA 4IH1A 4ZV9A 4IDGA 5EG5A 3QE0A 5FTKA 4JP5A 2QK4A 2P62A 3OZRA 4HYEA 3MILA 3NBZC 1ESNA 1XD9A 1LFDB 4NENA 3O6VA 4ZO7A 4FM9A 4ALMA 4EIWA 5FNVB 3W3AH 4NMMA 1TEHA 7ADHA 4H15A 3H5TA 4R1SA 4ZIRA 1AKNA 1IDN1 2Z8XA 3VO1A 4JDUA 2BUAA 3VR4A 1P1IA 3CLTD 2D06A 4NMWA 4UM7A 4FCTA 2I3DA 4GWLA 4LZJA 3NDRA 4ZTBA 4BKOA 1ZOPA 4NATA 2MDTA 1G5RA 3ZHXA 2O2ZA 3WWDA 1JIJA 3RSGA 3TX2A 4D8YA 1QHFA 1X13A 2V5UA 3O3NB 3RFUA 1DAKA 1FL9A 3LQQA 2Q1WA 1KO1A 3ZXYA 5B36A 4MWSA 4CKBA 2E85A 4MS1B 3MAAC 1Q0RA 5K1ZA 1RAGA 3E1GA 2L19A 1MU0A 1QZUA 1J00A 5J5VA 1N36B 4IG9A 6GPBA 2JBAB 5AKZA 1GEEA 2XA2A 4G89A 3AUTA 1LRLA 1F8YA 1XK6A 1XVAA 4MUKA 4PGHA 4XGRA 1ULUA 2Q4BA 2D3TA 5I4BA 3AF5A 4NX2A 4PW0A 2X8JA 3OCUA 1TT5A 2C2WA 2J5KA 3GDOA 4MQFB 4JVLA 2JFBA 3R7AA 4BLPA 4B7UA 2HJ9A 1XL0A 4KAJA 2YL2A 1OBOA 2HLDA 1OXBB 2P9ZA 3CUVA 4QRIA 4AZ3A 4MVJH 5IF3A 4UM8B 1Z18A 2VHXA 1MQAA 3C6QA 3GG2A 2P9YA 3VPCA 1SPXA 1P17A 5CH8A 3O2SB 3QWBA 5ALXA 2OQIA 4Z3DA 1FBNA 1MX1A 1I6MA 1YACA 2ZU6A 4UBNA 4P22A 4KN8A 4A6EA 4DGSA 1XPOA 1ZCFA 1JJAA 3RR2A 2PSDA 1Z34A 1BHJA 2J5XA 3JV7A 3WKAA 4A92A 3KOWA 5KREA 3BJRA 1G8PA 2I8CA 3MT8A 1F0PA 3QVUA 3KJXA 5AWFC 2YBDA 5C4IA 3Q8WA 2DBRA 1X7YB 4QVGA 3SQXA 1ZMBA 2KPOA 2XZLA 1SNYA 2CK3D 3HKDA 5JRDS 5H5JA 1JHDA 4CG3A 5KVQA 4BE9A 2QM8A 2WWFA 4Y3UA 3LDUA 3STYA 3G1UA 5AOBA 2XT0A 1AQUA 4NYIR 2QN2A 1C80A 2Q6LA 2RGUA 4ZU1X 5IH7A 3K4HA 4RELA 4D6XA 1J25A 4U2CA 3L49A 3Q6IA 4NH0A 4HUTA 1AQ6A 3IX7A 4C0SA 2BFAA 5FT9A 1KRHA 5BQXA 3FNFA 1FXWF 3FFXA 4DR3B 2GZSA 3L0OA 4YXFA 1XCLA 3VC3A 4ESOA 1VI2A 3L7CA 3EIQA 3COPA 1PZMA 2QQFA 2GZRA 3OFSA 4ONEA 1TKAA 3FPJA 4OK5A 4HLUC 4K9NA 1SKMA 3B6KA 4GPTA 2HHJA 2O8CA 4LJ4A 5AJWA 2PUFA 1JG4A 1RBMA 1YZVA 3IUYA 3DV9A 2BGTA 1ADFA 1MEOA 1TJ5A 4I1VA 3T5CA 4BMNA 1OA0A 1XTPA 4LF7B 4LY9A 4YRQA 5FWYA 1EX7A 5DEOA 1NLZA 1HG0A 4L16A 1CWUA 4FUTA 1UMBB 2FQQA 3KKLA 4NQZA 3UB2A 4ENVA 1CY8A 2ZI7A 1DO2A 2IYQA 4KZPA 4RA9B 5CFLA 4JJ4A 1E9AA 1SHKA 2C84A 3C3MA 1E18A 1YAJA 2B25A 3BD6A 3KR0A 3PFGA 4G65A 4MH0R 4B84A 2VQFB 1Y4SA 1CZKA 1Q20A 1S8OA 4N41A 4GX5A 4CLHA 2IYVA 1D2GA 4IJVA 4UZSA 2XZDA 1EEXB 2IDZA 2O0LA 4G5GA 4OQEA 5LJIA 2C2ZA 4PYQA 3GUZA 3CF0A 1N9ZA 4TTAA 1LPBB 3ZZTA 1G63A 4RDIA 3T1HB 1DTWA 1C7EA 2A59A 3UAYA 1JEOA 2Z9CA 5BVHA 3G8CA 5I3ZA 1AKMA 2C8LA 4C14A 4Q1AA 3CA8A 1W44A 1PLKA 4K9QA 5EXDA 5B3LA 4J7CA 3G02A 5JW6A 2EP7A 4XX1A 5KNBD 5KUTA 3M33A 1MR3F 1G64A 2IXGA 2ZJ7A 3ZWYA 2A0XA 5JOQA 1IXZA 3GBSA 5FFMA 4URXR 1AKVA 2HQ1A 1I7DA 3NC1C 1KJ9A 3DGFC 3EZYA 5FLXA 1OBVA 2Q1UA 4Q15A 4REOA 4UU0A 2B92A 2W6QA 2OXIA 3U4CA 1IB0A 4IUBS 5TF4A 3T7TA 3WJ7A 4KK4A 4CM9A 1YB7A 3IR5A 1Y1LA 4A2WA 5IVDA 4KACA 4WK0B 2BI7A 5DX0A 1K6MA 1Z7WA 1MX9A 1FFSA 3BBLA 4R1NA 4CCYB 2OLJA 5ADHA 5LPNA 1J09A 2WFZA 1U0FA 4JA2A 4R41A 4ZVNA 3FE2A 4JGIA 2I7XA 4E1VA 5JASA 4WI1A 3E8SA 4WWHA 1YASA 3CM0A 1O9GA 1WQ4A 2OV8A 2NWQA 1PYOA 3UJAA 2FOIA 2VF7A 3L1JA 3ONDA 4JX8A 4RVSA 1DKMA 1QH1B 2I4TA 3GEIA 4FJ2A 4Q4DA 5JE8A 4RPJA 3ZWQA 4DVGA 3HDVA 2I1QA 3USES 4MA4A 2XQFA 5D5PA 4DG8A 4F06A 3GN2A 5B3JC 3MERA 1DIOB 1L9XA 5FPPA 3TCXB 3DMDA 1T3TA 1MGOA 2ILVA 5C3MA 2OAP1 2PWAA 3FPGA 1R0LA 3HCPA 3JQ9C 3LT1A 1P7CA 1DJPA 2G67A 3P97A 3SEAA 1EE1A 3OZWA 3WX0A 4J75A 1ZQ1A 2G6TA 1NI4B 3WGIA 1FU8A 4AF6A 2RGNC 4K88A 4QVKA 2HSWA 2A5GA 5IJAA 3LW7A 5JAUA 1Q16A 3KZ1E 4KW7A 3U7QA 3RHFA 1A7JA 2CFIA 4BZZA 4L6IA 1NSTA 1P61B 1TRHA 2ZDQA 3JVDA 3ADOA 3HVKA 5B30A 1T2UA 3EASA 5E8RA 5ESXA 1SELA 4EJSB 4EY4A 2AFHE 2AHOA 2C2KA 2DU8A 3PGVA 4QFBA 3DUWA 3RG8A 4AJ1A 4B0PA 3IIIA 1QHIA 1U7TA 1ZFNA 2EBFX 3VZRA 4IJ6A 4C4YA 1FP1D 3CRQA 3DDUA 4G84A 2P91A 2D2XA 2XMCA 3D5QA 4J03A 2EATA 2ZM6B 2V9CA 1M6VA 3ZI4A 1RRVA 2Z83A 3DQPA 1S9HA 5D85A 3SN6A 3V1YA 2EL9A 4Q02A 2PZEA 3TH5A 4ZMSA 1R6AA 2ASVA 2VKQA 2YWRA 1LPMA 3EIWA 3EWSA 3N58A 4LISA 4S0XA 4DJ5X 1M67A 3GLGB 2H5JA 3QV2A 3CU5A 3V1TC 4TL6A 2HW8A 4MNTA 4COKA 4EX7A 1XXHB 2Q28A 3V2HA 1KMQA 1ZH0A 2IXTA 2X8JB 4I46A 5F51A 1DKLA 2JGMA 2WU4A 1AKRA 4E5KA 1OOEA 2J0EA 1NUSA 4Z0PA 5SZJA 4FKMA 5KNBA 4BE7B 3ANXA 2Q8NA 4JJGA 1NI5A 3OT4A 3VGPA 1XFAA 2IXBA 4HAYA 4PYJA 1L9KA 2GAJA 2GESA 2IH5A 2B8WA 3QUAA 5ILGA 1EVJA 2XB9A 1MO2A 3DLTA 2PZJA 1VPEA 4WKGA 3WL8A 2DP4E 1UK9A 2H16A 4CHGA 5IJXA 5EERA 2FSFA 2OLEA 1UR5A 3DR3A 3Q88A 4BFTA 3T4UA 5EGSA 4MV4A 5IYZF 1YTLA 3CNOA 2A14A 3H1TA 3AEXA 3FYCA 4NYIQ 5JJ5A 4O3MA 3SC6A 3EZ9A 1S2DA 1UZMA 3K6RA 4AMUA 4BQSA 2C29D 1CUSA 5H9WA 1G42A 1Q83A 2YMLA 4O4HF 4R16A 4CBVA 3U4DA 3HBNA 1EK0A 2OQ2A 1MDFA 3JARB 1TAHA 3M4ZA 4D0SA 3IRVA 3THWB 1QS0A 3LTEA 4OHWA 2VWPA 1ZGCA 1R0SA 1T8YA 1MA0A 2IQ5A 2ZRCA 3ASUA 3FMVA 5D7BA 2IY9A 2O9JA 5ALMA 1W47A 4BNHA 3D7NA 4TS3A 2X8AA 3DBRB 1SVSA 2EBHX 5J1TB 2YHIB 1YBVA 2DQYA 3STUA 4C7VA 4WNYA 1WUTA 3ADPA 4YCLA 1GGVA 1ZDMA 2P68A 2P9JA 3AEZA 4HXEB 4GMKA 1A8QA 2IUSA 3FVWA 5JVDA 3I3OA 3N6XA 4RTPA 1W1UA 4KBYA 3AT1A 4N0DA 3ZBQA 3V4RA 3L0PA 1QFJA 3GJ3A 1MRSA 2VWQA 1LDYA 1NRJB 3P2JA 4O63O 3G0BA 4KO2S 3IMGA 1VLMA 4OJNA 4A9AA 2WVAA 4XSVA 1ZUD1 2XZPA 4Z7NB 1DV2A 1I1NA 5GP1A 4ZAGA 3UW1A 3WYGA 5AHOA 3QQPA 4XVUA 3C41J 4OQFA 3AR9A 4KE9A 5DSTA 1H2FA 1U7XA 5FR1A 2ZBUA 2PYZA 4CMEC 3A9RA 4F9TA 2XADA 2PL9A 2G9UA 2Z1DA 2NTYC 3A4LA 3R6GA 2HF8A 4B6EA 2JS7A 3LPDA 4R1TA 1CUFA 4EUKA 1RWVA 3M1YA 4U7WA 4K9KA 2FQXA 1JB9A 1MAUA 4NEQA 4FEGA 2ZWPA 3WDSA 4GLFA 3UK2A 3JZMA 4RAOA 1IU9A 5HXAA 4ND8A 1K8YB 3CX6A 5AUOB 4LOLA 3PNYA 1DV1A 2E89A 5C8YA 1D1QA 4NICA 5CDFA 4YT2A 5AK5A 3LT0A 4ZI5A 2PZ8A 1GY8A 2ZAOA 3IAHA 3I01M 3MN1A 4YUVA 1SVOA 3A7EA 4BC1A 2BCGY 2QDXA 2ZTLA 4X6YA 3TTXA 4LE2A 2PD6A 3SQOA 2AG0A 3U7QB 1RE0A 1XNRB 4GI7A 2R1ZA 3BE6A 2B0CA 1EU1A 3GLHA 4G24A 4IWNA 3UUWA 1I4WA 4DG9A 3L07A 3STVA 2FI1A 5BSEA 4B2LA 1XX6A 4NBLA 5LQRA 2CCGA 1W581 2Q1XA 1I5RA 3L7JA 4PIPA 4X6UA 3QFSA 1JDBB 1JRLA 4O1MA 3ZHSA 4FNAA 4BV9A 2ZSUA 4C03A 1Z8HA 1F5NA 1ZKMA 1M9NA 3C43A 1HDYA 1OR8A 1DELA 1WO8A 1Y6JA 4MR8B 3DOFA 3I2YX 4MIEA 3TNJA 8ATCA 5FWXB 5BO5A 1E62A 1VHWA 4WCDA 5I5EA 2HBZA 5GQSA 2PLRA 4ZEXA 5BN1A 4E5MA 1D9ZA 1V5IA 4EYKA 1JLSA 1XV5A 3O92A 1KJ8A 4WOCA 4S1OA 4X97A 2C9CA 3V4PB 3WI7A 4UE3S 1H2AS 1DOHA 4ZDWA 1T25A 3TR6A 1GPDG 1TAUA 4QD3A 2QX7A 1VJTA 5JYBA 5FTNA 2V45A 3H83A 1CY7A 3GYBA 2FCAA 4QUDA 1UJCA 1NF2A 4GHWA 4QYMA 2YIDA 3W1WA 1W4RA 3QEJA 2QYOA 3M2TA 2DFDA 1D04A 2BW0A 1XTZA 2AXQA 1RPNA 4R1OA 3QVGB 2D13A 1M2HA 1OSNA 2J0UB 2ONYA 2HCRA 5A4DA 2PQ2A 3K71B 3BA6A 5EWMA 1P45A 4XXHA 5AKEA 4EO4A 2GCOB 4BVGA 2D5BA 2N1BA 1Y3DE 4Q16A 4D5GA 2VXBA 1H2HA 3K1TA 4Z86A 3ICPA 3S28A 3TM4A 5KQLA 1EXDA 7AT1A 1PX0A 5K8VA 1KAEA 1FU4A 3C8MA 2O1XA 4G85A 1JNYA 2GUGA 4F3KA 5H8WA 3R5JA 1H3NA 2CCJA 5EE5B 3RSLA 4OBEA 1NF8A 4LV5B 4WACA 3MD9A 2ZJOA 3GK3A 3WKEA 4BJHB 5KYWB 1PQ4A 4RABA 2ZYGA 1B8OA 2Y3IA 3W06A 2HSGA 3C85A 2HMYB 1UPTA 2JJ2A 4PC1A 3WWZA 3UMGA 3KWFA 3AL0C 1SXGA 1MB2A 2A9FA 3HGMA 1L4KA 5D3KA 4EFNA 1IEXA 3C7AA 4Q1CA 1FSZA 4PTZA 1DEKA 1FVOA 1HNXB 3PUHA 2GLXA 1R6DA 2Q4OA 3UUGA 1KQGA 1PKEA 3V8QA 2I67A 1WSAA 4AF7A 4JT2A 4XLTA 3ZD7A 4Z49A 5ES3A 1G2OA 4FKZA 4M8IA 5DLPA 2CLCX 1L5RA 5EL0A 4WA7A 2BFWA 3QY0A 1YUBA 1L4FA 2AHRA 2HHCA 1P5ZB 1LZKA 2DWQA 1K89A 1KEEB 1EWYA 4R0MA 1KFCB 2QD4A 4C5CA 1XVVA 3D7LA 4JOQA 4KQXA 5DGTA 2IU3A 2N3ZA 1DMRA 2H6EA 3FNEA 4DSOA 1S4QA 1UBRS 4D9MA 1QIKA 1SCQA 2JLWA 2MSLA 4YPFA 4C7OB 1MRNA 1OU4A 1HYBA 2Q27A 1JWAB 4XB1A 5HOQA 5KHLB 4JR0A 4ZO4A 4XQ9A 4IKOA 4W5WA 3EAFA 4WZAA 5K4HA 1TZ2A 1YQDA 4J0KA 2GETA 2XOKA 2II6A 3OM0A 1T26A 1E9CA 3NIWA 4WPGA 3LSYA 1ISIA 4E5SA 2H7YA 5EMHA 5KOYA 1WD7A 1I13A 2FK8A 3QPBA 4JA0A 1NMXA 5E38A 5JXGA 3OIWA 3H05A 1TCAA 5B1EA 3A7DA 4MZXA 5D1NA 5KKAA 2E5WA 3VZDA 1NY5A 3S0JA 4DCOA 1R66A 5DIZA 4IXDA 3TQQA 2PBZA 1AQLA 4QUIA 4M99A 2ZRBA 1WQ1R 2J33A 4FDVA 3SQMA 3V4LA 5BN5B 2QRLA 2W6JA 3QOWA 1JDVA 2H0AA 1IE3A 5CGZA 2FWAA 3RTCA 1WKBA 2H7XA 2WT9A 3BJZA 1CF2O 2VBCA 4CL0A 2MSWA 3H0EA 3MWYW 5HNKA 3VH4A 3F5SA 3K4QA 3AVVA 4UMFA 1N0UA 5E0OA 2CK3A 4CG2A 4AY5A 4GD3Q 3AY6A 2DFVA 2MR6A 2BH2A 3PDUA 4BNYA 1KDVA 2WVHA 1KJJA 4DABA 3GJZA 5B2ZA 2XMBA 3ETDA 2REOA 1C14A 3CH5A 1CSEE 2EBWA 3PQ5A 3E8XA 5JLAA 3AF6A 5FOVA 2WIAA 4ER6A 3D8HA 1SPBS 5AXDA 2YV1A 2JFPA 4CKCA 3FX2A 3DYBA 4IM7A 4KXVA 4RLQA 4ZO6A 4DL9A 3GFRA 3MAJA 3DVQX 4D9FA 3TD2A 3EXHC 2W98A 3I45A 1CTQA 1WL8A 3P9XA 2H08A 1D5CA 1CDDA 3MM4A 1N1EA 1N3YA 3I5MA 5K3AA 5TGDA 2FEAA 5GGYA 1PNQA 2EJCA 4UOQA 2ODTX 3A04A 4JUAA 1NQOA 1X14A 2QN8A 4F21A 4F2DA 4KPGA 2JJ2D 3WAGA 1M6EX 3ANTA 3SXUA 4ABYA 3JTMA 4IX1A 3ZS9A 2ANCA 4HZUA 3NH9A 2ZPUA 3V9PA 4RSHA 2ZJFA 3ZWBA 3OCWA 1T8PA 4J0GA 2G71A 4RY0A 1JHQA 4M86A 1RRCA 4FHEA 3L0YA 2QE6A 4AW9A 121PA 2UAGA 2K2QB 4XGIA 5DV9A 1IMJA 1VYTA 2ID4A 2VAWA 4NOKA 1VIYA 3QYPA 1GO2A 4I4TA 1VSTA 3I76A 1PNTA 1DWPA 1AF4A 1VHTA 3QEOA 4MRAA 4QUBA 3NC4A 2RH4A 2DC1A 4U00A 3IL2A 5BV8A 4DR6B 3AEUB 3JU3A 4HVAA 1KYZA 4L0DA 4C4XA 3ZJVA 1TTHA 1VZ3A 3RAPR 5FX2A 2V1XA 1JQKA 1WX1A 2HF9A 2Y8EA 4PLGA 4QRDA 4RL6A 5K3BA 1OWLA 4YFYA 3ADDA 2EX0A 3NDIA 2BZ0A 1SULA 2IOQA 4UARA 1Y1SA 3OG9A 1IZ7A 3HXOA 2GMWA 2NVWA 3C15C 1RABA 3AR5A 1W87A 2VTEA 1Z36A 1B2LA 2WKQA 1N5IA 2DVMA 1YRHA 2Y9MB 2ZIGA 3AK4A 3KQPA 3VTFA 5AW5A 1N7HA 3D0QA 5ETJA 3SS9X 4DNOA 4ER0A 1IBMB 3AL3A 3J80A 2PMWB 1L3BA 2IYYA 2F8MA 1MFPA 5KJEA 4BZWA 3KTDA 5FUYA 3FLEA 3PUXA 3EQZA 4N8SA 4XEUA 2C4MA 4KITB 4G8BA 4R3NA 2R1UA 2XMQA 3ITNA 4LVUA 4UVGA 1KEEA 4KP7A 13PKA 2PCJA 3WWYA 1ZUIA 1MC4A 2XCOA 2O14A 4A36A 2JCBA 3C70A 4TLLB 5HR5A 3UT6A 2H85A 2D7CA 2QSYA 1UBLS 4TSFD 3IUJA 1GG5A 5TJ9A 2JFHA 1P3DA 2PS9A 2Q4EA 3WA7A 4CIDA 4BKQA 4R7GA 1X7GA 3A0RB 4S12A 1RSZA 3SG0A 1NYQA 1GUYA 3SFZA 2FUEA 3VR0A 4DREA 2DULA 3T8YA 1POWA 1B76A 1RWXA 2ZJZA 3NUQA 4HADA 1TU3A 2Y2UA 2WTAA 5HQ3B 1A71A 5F52A 2YXBA 1Z12A 2QD5A 1NX9A 1GN8A 2WMOB 4BP1A 2CFRA 1OX4A 3GI1A 4UBMA 2D7DA 4KZKA 4MW0A 4XYGA 4G5RA 3HN7A 4IYJA 4DM3A 3NB0A 4WESB 3U3RA 4KQHA 3G9XA 3GH1A 5FNZA 2BR3A 2IX9A 1E5DA 1P1FA 4I9NA 5E3IA 3WHIA 3BB1A 1U2QA 2BN4A 5JAIA 2YN2A 2NXJA 4XGKA 2Y1CA 3VO8A 3TSYA 5HKKA 2FYTA 4HN4B 2YJTD 1T2AA 4L9AA 1EHYA 3KQSA 4GXNA 3QTLA 5B37A 3IQWA 3R6LA 4LDNA 3K0FB 5CAEB 5AHXA 1JN0A 4UCFA 3K9LA 3FJYA 3T5TA 3ZLJA 4DG5A 2ZVPX 2TMKA 2BKEA 4WDRA 1G5QA 4FFBB 2V5VA 1DO0A 3O4JA 1KP2A 2G4VA 4UZEA 2XNKA 3LUHA 3N9IA 5K01A 5T6BA 1YS6A 1WOMA 4P3OA 2H18A 2EZ8A 5DBGA 4LVCA 4DWJA 1QX3A 1YRAA 5I6DA 3ICCA 3NNSA 2GXUA 4KRYA 5BW8A 1YWGO 1CJKC 2OC9A 5FOWA 5KTMA 2CGEA 2REQA 1IOZA 2BGGA 5KQMA 2R68A 4JKIA 3LU1A 2YJZA 4F8EA 1X0VA 5JNLA 2PE5A 4C78A 1IXSB 4F5DA 4DDVA 5CP8A 3VNAA 2YYYA 1H1LA 3PIRA 5CXQA 1PTKA 1WXXA 4PO9A 4CQMD 2AG6A 4ZOLA 4U8HA 4ZT5A 4A91A 4CLRB 4OYHA 3MGKA 2XXJA 2O1SA 3BORA 3KHSA 1U8CB 3A14A 3FN4A 3FNIA 3OZGA 1L5HA 3Q8MA 1NOJA 4P0QB 3BREA 3PC7A 1KO5A 4YJFB 5JYEA 3TL6A 1EYZA 3DEAA 2HA7A 5AH0A 5T4BA 1U2DC 1WMSA 5A4KA 3R2JA 3TR5A 1QH8A 5C7YA 3SC2A 1WUKS 1M2OB 4QTXA 3JW8A 3O82A 2I3ZA 5BW5A 2Y93A 5IDVA 3ND7A 5J2UF 3IPLA 4KN6A 4UAJA 4CNBA 1F38A 4LYJA 2F3UA 3I9OA 4IIBA 3SBOA 4CM4A 4YV2A 5A06A 5KX5A 4NPHA 4PWZA 3COYA 2YQ4A 5KSWB 3LBFA 2RHTA 6Q21A 3JD2A 1I4TD 1O8CA 3FHTA 3ILHA 2HI0A 5DFAA 3A2LA 1M7HA 1QBKC 2WINI 4ZEVA 2IIPA 2R751 1DDOA 4WZZA 3J81k 3KK0A 2FW7A 3SJ7A 4OVKA 1JKMA 1KJQA 1MB3A 2PBRA 2TMGA 2XUKA 3N2LA 4P38A 4WASA 3H1FA 5KEIA 3PEWA 5JCOA 3WP1B 2ZI9A 3ZIAA 4CMKA 5HS6A 5FV7A 4Q4AB 5L3RA 4EFDA 2J3HA 1NZFA 1YE5A 3TKYA 4ZGBA 4QM6A 1U63A 3HE3A 1NW9B 4HNAA 3RABA 4P8RA 2DBVO 3MRVA 1LNZA 3SOZA 1QFSA 2X3YA 3EVFA 3Q7QA 5JRJA 3LV8A 1K7XB 1H93A 1VKOA 3KJNA 3OO0A 4OIMA 4RKWA 2CVZA 2P2YA 2NUTA 2X8WA 1M1YA 5EWLA 2FSVA 1Z6PA 1IM8A 2XHEA 4YP5A 3E6AA 5J4HA 2WHPA 1IY0A 2GZHA 1N8NA 3ZGLA 3DBHA 2CXRA 3RDPA 3I5XA 2EW2A 4IKEA 1XZBA 4KPUA 2ZWOA 3PXXA 1BW9B 4Q3KA 3SBXA 3KVNA 1ACJA 3LP6A 2ZTVA 4FX5A 5H80A 3DDCA 3CPSA 2O6LA 3VOSA 3HNRA 1E5TA 3MUOA 2XYGA 1RZVA 2XODA 1LTKA 3V4VB 4KR2A 2NVUB 1DLJA 4BLVA 3ERCA 2CKDA 4YECA 2G9RA 4GRDA 1Z4QA 4CE6A 5GJBA 1VOTA 4JMLA 3CBQA 3WO0A 5E9AA 3SP1A 1V3QE 5MDHA 1PV1A 1RFLA 1M33A 1VSBA 3QTBA 1DG1G 2EAUA 2HYDA 3R0IA 4FOPA 2K4MA 4PIVA 1GQSA 3RHZA 3ZDFA 3DNPA 4AMBA 4HDNA 2JARA 3CV3A 1U2RA 3G2PA 3MQFA 5F5LA 3S2SA 3BMNB 2NG1A 4FYHA 1J0DA 2IX3A 3G0HA 3UV6A 1EB8A 2G0AA 3A4MA 2OM2A 3LWBA 4HPJB 4KYUA 1JA0A 4OFXA 4FDTA 1Z9BA 3R3JA 2QA5A 4X1KB 5EIBD 3UT5B 2GZ1A 1P72A 4FZ5A 5MHTA 1HDGO 1X1AA 2G83A 2WRZA 3DV2A 3KUXA 4O4LA 4QT4A 5LXTA 5KYKA 1MP0A 3CMMA 3WMRA 2QR2A 2CXSA 4KXNA 2IOFK 4OHCA 4WEQA 4EPRA 1KR5A 2PH7A 1AK2A 3OQNA 2QNIA 3IKJA 3B7GA 4ALJA 1Z0ZA 5KWEA 3AVYA 2V98A 5BW6B 4XASA 1QE3A 1UPAA 1KGSA 1U28C 1M7BA 1ZZEA 3JQQA 4ESVA 3IUEA 3AJEA 1DT5A 2B6NA 3B48A 4OLHA 4EFLA 4LSMA 3SE7A 1BXGA 1T9DA 5A0FA 3G9ZA 4XTRA 1YQGA 2Q1SA 3AP1A 3JATB 2GF0A 5KAPA 4C7KA 2GN8A 5CLIA 5F1KA 3ZNOA 4CN9A 2VPPA 2Y0BA 2C1ZA 2C9MA 3EVZA 1WLYA 1XTJA 3M6VA 3PGXA 4IGIA 3A1EA 3NM4A 1GTG1 4KXYA 2ICAA 5DCYA 4BNLA 4GW3A 4L3VA 4XUEA 2R7NA 4YRJA 1TL7C 1ISRA 4IV0A 3L46A 4R31A 4JLPA 3G2KA 4KXQA 4LQCA 4AN0A 3IKMB 1SBHA 2MT9A 3K1AA 3AL2A 4LXYA 5CYOA 3ROQA 3L9XA 3LECA 4PX5A 1XKXA 4PO8A 5BRJA 2PDAA 4GO1A 2GD2A 1G8YA 1M6VB 2WMNB 3Q11A 1AV6A 1QB7A 4QNMA 4V0SA 1QJ4A 1Y3CE 2RGAA 3KHTA 4CI9A 1PFVA 1ZVKA 2FXIA 4QPDA 1CUXA 4AJNA 3M83A 4B3BA 4DY4A 4M22A 4Z9AA 3UAOA 1EM8B 1NI3A 3TN7A 4A8JA 4N3CA 1QVWA 2K7ZA 2P40A 4HDAA 4IIJB 2CJWA 1OHHA 3JQEA 2DEUA 4JLMA 2C59A 3I0NA 1KZHA 4HDRA 1ZC3A 1J2JA 3EY4A 4Q3BA 1GG2A 2EP8A 4BQQA 2JVKA 1ND6A 1E96A 4EG5A 3DHVA 2J4FA 2I6TA 4R7ZA 3CH6A 1XHFA 3G2JA 1XRQA 1KBZA 1YQWA 2YVKA 3DOCA 4IHJF 4DQ0A 4JI2B 3HFGA 3RBVA 2PRYA 3KLNA 4CJXA 2BFCA 1OAAA 3R5KA 3NFYA 5JATA 3ZD8A 5KYWA 1PIWA 3LT2A 4PNHA 2OV2A 2MCFA 2JLUA 3I2HA 3M6FA 2I6FA 3DXYA 4XWOA 4YJHB 1J20A 1ZH4A 1BEZA 1EVIA 1CE8B 2EFJA 2ZE6A 3CF4A 4CKWB 2BGLA 4KOEC 1RP1A 2HPHA 3WYNA 2JA1A 1W25A 3W3AA 4UUNA 4F1WA 1WHSB 1LF5A 1DUVG 1OROA 1F0YA 2C83A 2DBZA 2H4ZA 2P79A 1KNQA 3I6MA 1I7LA 1JPJA 3PFCA 4B4UA 1JIIA 3NBMA 2ZRJA 2G7ZA 4OLFA 1EX1A 2VTVA 4KDCA 1WU8A 2RJNA 3D5TA 2E4WA 2HWWA 2WHEA 1GGMA 2Z8YM 4IUYA 1CY6A 5J2TA 4Q9NA 3ZBPA 3OOJA 1Y4DE 5EE3A 3T0IA 1IHUA 3KM0A 3PS9A 2WWGA 4CUZA 2C04A 2NUPB 5KNLA 1H4QA 3HHPA 2FEPA 1L7EA 3JASB 3IIJA 4G09A 4K5QA 2ZBGA 1ODTC 5F4ZA 4EMTA 1PT7A 3UCFA 4RF5A 4UAUA 3EARA 4PN3A 1Y0BA 1R4NB 1U4OA 3GT4A 3K9WA 4ZVPA 1T36A 2X0EA 1FUYB 4GE3A 3WWCA 4Y6SA 1AMOA 2BUBA 3T0FA 4FEAA 1M5TA 1C7FA 1N2CE 3LA8A 4MWOA 1WZCA 3KRTA