2OC9A

Crystal structure of human purine nucleoside phosphorylase mutant h257g with imm-h
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
284
structure length
278
Chain Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANGEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neighboring Group Participation in the Transition State of Human Purine Nucleoside Phosphorylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 84
structure length 278
sequence length 284
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oc9A00
1PBNA 1JDSA 4P54A 1A9QA 4BMXA 4OEHA 4MCIA 5B7QA 3BGSA 4F3CA 1T0UA 3E9ZA 1RSZA 1VHWA 4NSNA 3UAYA 3DP9A 4DAEA 3T94A 1JDTA 1ODKA 4E1VA 1U1GA 4DA6A 4DAOA 4YNBA 1JE1A 1TCVA 1JYSA 1K3FA 3PHBE 4GLJA 2Q7OE 1Z37A 5EFOA 1OTXA 1ZL2A 4EB8A 1Y6RA 4TTJA 1PR5A 1WTAA 1Z38A 3NM5A 4M3NA 3KVRA 3FWPA 4TYMA 3PNPA 1OU4A 4BMZA 3DF9A 4UC0A 2HSWA 1Z39A 3EEIA 4BN0A 1JDVA 1TCUA 1SD2A 3D1VA 1PKEA 4QARA 1RT9A 4OGLA 3FNQA 3OOHA 5ETJA 1U1CA 4KN5A 3F8WA 3IOMA 3DDOA 4OY3A 3FAZA 3MMSA 4WKPA 4WKCA 4R31A 4TTAA 3IEXA 4TXNA 4F3KA 1RFGE 1VHJA 1Z5PA 1RXYA 2A0YA 1PK9A 3EUFA 2QTGA 4TXHA 1TD1A 3UAVA 5B7GA 4TS9A 3OZEA 1A9RA 4PR3A 1A9PA 2XRFA 1V3QE 1RR6A 1K9SA 5IFKA 1PK7A 1OV6A 2I8AA 3E0QA 1T8SA 1SQ6A 4R2WA 1U1DA 2PGAA 5B7PA 1NC1A 4JP5A 3ODGA 3LBAA 3GB9A 3DJFA 4G89A 1QE5A 5F7XA 1LVUA 4RJ2A 4L6IA 1Z5NA 5F78A 1ECPA 2IQ5A 3KVVA 3OZDA 4WKNA 4LKRA 4EARA 1G2OA 4L5YA 3NM4A 1SJ9A 5CCEA 1B8OA 2QSUA 1YBFA 4MCHA 1T8WA 1PWYE 1VFNA 1ULAA 5F7JA 1V41E 4MARA 1A9OA 4L5AA 1YQUA 2P4SA 4DANA 4QAQA 3P0EA 1OTYA 4F1WA 3UT6A 4GMHA 3BL6A 5I3CA 3OZBA 3OPVA 3GGSA 4D8XA 3ONVA 2ISCA 2AI1A 3O6VA 2GUWA 3OZCA 4YMLA 4QEZA 4TS3A 4YO8A 3UAXA 4YJKA 2I4TA 3K8QA 4D8VA 1T8YA 3ENZA 4QATA 2HRDA 4GKAA 4U2KA 3INYA 5IU6A 4R2XA 3DPSA 4TTIA 1PR0A 2H8GA 1A9TA 1Z35A 4TXMA 4NS1A 5CYGA 3KVYA 1Z34A 4LNAA 4LDNA 4I2VA 5CCDA 5CXQA 1TGYA 1VMKA 1NC3A 5B7NA 1LX7A 5CXSA 2A8YA 5CYFA 4K6OA 3KU4A 3BJEA 3EMVA 4DA7A 1LV8A 2RJ3A 1SD1A 2QPLA 5C80A 1CG6A 1A69A 3EUEA 3U40A 3NM6B 5JPCA 4X24A 3OF3A 4M1EA 5F7OA 3OOEA 4FFSA 3KHSA 4H1TA 1PF7E 1RYZA 3FUCA 3MB8A 1JPVA 1U1FA 4PNPA 5DK6A 3NBQA 1Y1RA 4F2PA 1NW4A 2OECA 3C74A 3QPBA 1JE0A 2OC4A 1Y1QA 1Y1TA 3SCZA 2OXFA 4IP0A 1CB0A 1YR3A 4JOSA 1PR6A 1Z33A 2QTTA 1Q1GA 3LGSA 2BSXA 1V2HE 1ODLA 5F77A 1YQQA 4TXJA 2QDKA 5EUBA 5FAKA 3O4VA 5KB3A 1OVGA 1Z5OA 3KUKA 1RCTE 3FB1A 1PR4A 1JDUA 3K8OE 3UAWA 1K27A 1JDZA 1PR1A 1YRYE 3TL6A 1ULBA 4OJTA 1FXUA 3PNSA 1Z36A 4DARA 2A0XA 4OGKA 4DABA 2OC9A 2HWUA 2A0WA 1T8RA 3BSFA 3E9RA 4G41A 1B8NA 1RXUA 2AI2A 4D8YA 4LNHA 4LZWA 4BMYA 3FOWA 4NY1A 4L5CA 4GLFA 1A9SA 1C3XA 1Y1SA 4G8JA 4D9HA 4D98A 5K1ZA 3P0FA 2AC7A 1XE3A 1U1EA 1ODJA 4QASA 1RXSA 5EPUA 2B94A 1ODIA 4WKOA 5F73A 4WKBA 4QFBA 4L0MA 3LA8A 4OF4A 4DA8A 1Y6QA 4ECEA 2ON6A 4JWTA 1V4NA 2HN9A 4TXLA 5F76A 1TGVA 1ZOSA 4DA0A 1M73E 1JP7A 1V45E 3OCCA 1N3IA 2AI3A 3PHCA 4M7WA 1I80A 1PR2A 1V48A 5F7ZA 3UAZA 4F2WA 1RXCA 1PW7A 1OUMA
chains in the Genus database with same CATH superfamily
5DIZA 1O9HA 1ZICA 4KLZA 2M1XA 2WAYA 4KXYA 4YJ3A 1RWMA 4Q37A 4P54A 3B1KA 3KQUA 3ZLJA 4CQLB 1VL8A 5F9FA 3QJ5A 3KQTA 4NWIA 1J5XA 1LC3A 1VMAA 2XQIA 3DKVA 3COZA 4TLCA 4YYEA 4IOKA 3OZAA 4QUKA 3GD7A 3ZHOA 4DCNA 4LY6A 4ALKA 5JU6A 1WXFA 3AI1A 1KWGA 5BURA 3QG1A 3KT6A 1ZGBA 4XH9B 2PVCA 4TLDA 3CGWA 1NBHA 1JEJA 2KX7A 5EFZA 4Q3DA 2FPRA 4UQLA 3OQNA 2ZTSA 4PRYA 4CEHA 2XB4A 2Z0MA 3EASA 3UEOA 1SXQA 1R3UA 1YQWA 2A3NA 1N4AA 3ED5A 4I50F 4RZ3A 4BMCA 4CMIB 4JHLA 4KB5A 2JIMA 3NVKI 2H16A 5E0OA 4CPDA 2RARA 4PHCA 2FSPA 3KWMA 1UBNA 4XX0A 5WRFA 1TQHA 3R75A 5B5SA 3AG6A 5EJ7A 1EWQA 3NBUA 3A4YA 4HH1A 3AL2A 4HSEA 3UV7A 2GO7A 2RI0A 1U80A 1E18A 1VL2A 5J1SB 1RLUA 2OKGA 1ZVVA 3R6TA 1FRQA 4D6PA 1YRHA 1WMBA 2HW8A 1E8NA 1G18A 1NJ6A 2PZJA 4ZWNA 3VOSA 3W3ZB 2YUTA 1Z6TA 3P26A 2PSSA 4TLEA 4EY4A 3EYAA 2DJ5A 5L4NA 1MTZA 1KO8A 5IANA 4FYMA 1BG6A 9LDBA 1XJWA 1YI1A 1HRKA 4MRMA 3GCXA 5KVQA 3W3AD 3ZV4A 3G9UA 4YRZA 1TIBA 4H3VA 4BN0A 5JTUA 4HLDA 3CLVA 2OYRA 4OHYA 5THQA 3SE0A 3AI3A 4JVSB 4S35A 2W4IA 3NZEA 1Z63A 1QTNA 1EINA 3L4JA 1D8TA 2PFKA 4ZCSA 5GIOE 5FEUA 2FR8A 5KVAA 1S2NA 1KOFA 4R0NA 1NQOA 1CPYA 2JAQA 1W4ZA 4QPZA 3UA3A 2H7YA 3C41J 4IXNA 2AJLI 1STOA 3F5DA 3ESAA 5ELXA 3LXMA 3LCVB 1DIRA 4P2BA 5IM4A 1D04A 1MT0A 3H83A 4D26A 2WK1A 2RAFA 2FE4A 3JWPA 4A91A 1WPGA 2FY8A 2VXBA 3B6KA 3ER9A 2IE8A 5AUOB 2OZLB 4O4IB 3NX4A 3MMSA 5TQ2B 4WKPA 3C48A 4DREA 3MQ2A 1N34B 1GPLA 4ARZB 1JQ5A 3AHJA 1DJLA 3KDSE 5EIOA 4BZZA 4AXXA 1UODA 3N8IA 3HVUA 4L0QA 5FKJA 4F1KA 3IEXA 1FDWA 3VX3A 4RPGA 1Y3AA 3W7VA 3B13B 2OBMA 2QN9A 4UBIA 2ZUEA 2TMDA 1ZNQO 4WBNA 4RTPA 2C94A 6LDHA 4ZVOA 3I76A 3A1CA 3S27A 4CKYA 4PLHA 2O8EA 1LWNA 1K6JA 1II8B 5F1YA 2FUKA 2B1JA 2XVYA 4Q4LA 4R98A 5IUJC 4I55F 3Q9UA 2QZSA 3B2EA 3K2BA 1G0NA 1T9GS 2OSVA 2H57A 2XYHA 2YZ2A 3FWNA 1T6BY 4PFJA 3OICA 5EWLB 1JXMA 2FXVA 4FQ8A 2JZOA 2A1UB 4RDHA 4C3ZA 1U0SY 3I37X 3PRJA 3A9TA 4JGIA 2EKPA 4JT8A 3QXJA 1K9SA 3LIIA 2P2CA 3R2JA 1DAKA 1FRNA 3PUXA 3G1WA 4OK5A 4V2UA 4EHFA 5MN6A 3I1IA 5DX8A 3PX7A 4RD1A 1KEUA 3BWYA 4TV9F 3WNDA 4CM1A 5IS2A 1FFYA 1LRJA 3AHFA 3RVJA 5BN5A 4COOA 2ODBA 2V7UA 4KE9A 6CHYA 1AKNA 1UKEA 2EYUA 2GDJA 3BS4A 3R3XA 5IG2A 4K9DA 3UJAA 4LZPA 1DWQA 2LDXA 4EY8A 1NRWA 1L8XA 3ES9A 1NG9A 2B6HA 2YRWA 4FONA 3ZLVA 3A6JA 1QE5A 1USIA 2B4AA 1H3FA 2P9BA 1VLVA 1CF4A 1E5DA 2XV1A 3GJYA 1UBLS 3QUSA 4NJMB 1E66A 5LBIA 5C8DA 1TFRA 1Z75A 2NTVA 4BWYA 4TM7A 5HEKA 4DL9A 5DNEA 1N57A 1P72A 4YLGA 3F5SA 1J9GA 2Q1TA 3OEED 4JVOA 3TQIA 2EX4A 4IQFA 4A92A 4EARA 5FWXB 2PS1A 3PHJA 1DC6A 3B9RA 1NN5A 3K6SB 5EWJA 4HRYA 4XDZA 1GZVA 3PGXA 3PQ3A 4PXYA 1AQNA 1JEAA 3BSSA 1WUKS 3N2ZB 3ZZ0A 1NULA 4U2BA 4EFDA 1LH0A 1P2TA 2VWHA 1YZQA 4C6TB 4KR7A 2WWTA 1N0HA 3GEHA 1WPRA 4OQYA 4QPJC 3TZBA 2HHCA 3IVGA 2C9DA 4RD4A 3HVKA 4RVCA 3EEBA 4Y2VA 1HDOA 3C1UA 5REQA 1W36D 4XJTA 2CZQA 4HGQA 2D1QA 3CVXA 1XDSA 2E21A 1ULAA 3OPYI 4Y6QA 3KKPA 2VIIA 2C3MA 3OURA 4PXAA 3R6DA 4CKWB 2PH3A 4NFSA 4G65A 5LQJA 2H1LA 3R7AA 2V54A 2P4SA 2AF3C 2G7ZA 3TRHA 4DANA 1LQ2A 4JXKA 5A5DA 4M9XA 2OXRA 1YZFA 2OGUA 1GCIA 4EMTA 5AVYA 4E08A 3QHQA 2NN3C 3DZFA 2QM7A 4KRGA 5LVAA 3C97A 4QRIA 3GGSA 4YP0A 3DZ8A 5CM2Z 4R1LA 1A04A 4Q34A 3GDWA 2RGEA 3KZKA 1QH1A 1P18A 3JW8A 3MSCA 2FZVA 3IDAA 1ESEA 5LCXA 2O6HA 4L9AA 3EAFA 3FJ1A 3T1VA 3VDXA 1PS9A 5ALNA 4DKJA 2G4CA 4G5GA 2RMKA 3OIUA 3RJ5A 3ZWMA 4E30A 1PSZA 4WECA 2ID9A 1SBCA 3THYB 3L7CA 3CNNA 5E8JA 2VPWA 3NHBA 2UZAA 1JQBA 1FJXA 3SJAA 3W5IA 2XJ4A 1VYVA 1W0CA 1J23A 4JROA 4FZVA 3W5AA 2IW1A 4RHXA 3INYA 1TT7A 4TTIA 2YY7A 1S2MA 1GA1A 3LT0A 3M1IA 3QLVA 3IKJA 4LISA 1ZK4A 2BZSA 2X23A 4B6SA 2HWKA 4JJ8A 3TF5A 5BW5A 5CYGA 4HYEA 5MFZA 3WAGA 4K86A 5DGIA 3DPUA 1EXNA 5AHKA 3GFQA 5CJJA 1RU3A 4BZXA 4QO8A 3GRVA 3HU5A 3HC7A 3T4EA 4LDNA 3QFFA 1UKBA 1DQYA 4OREX 1E1YA 3WGZA 1KOGA 1A4XA 4WLOA 4UOZA 1WXEA 3NTVA 4GWGA 1DC7A 3H16A 2I2AA 1JIVA 1J90A 1TGYA 1V1JA 3K2EA 3L6UA 3RF6A 2VTBB 3U7FB 1GLNA 4ZTUB 2QUBA 5CT6A 4K26A 1JBKA 2C58A 1ODFA 4HATA 4Z7JA 5L7WA 1U7OA 5A9RA 4D8XA 1NBAA 3IQHX 4OOFA 3HV0A 4JCCA 5EESA 2BGKA 2IXFA 2P62A 3E7FA 4PPNA 1ZJJA 3P9IA 3L01A 2ZYAA 1QCZA 4KVAA 1XZ8A 4CGYA 5ALWA 4OMFG 1EIWA 1TVMA 2NNWB 3RWBA 3ZIAD 2FWIA 1TM1E 1CY6A 4C4OA 5EMHA 4LE0A 3SHVA 5H70A 5AHOA 3BCSA 4F21A 1JSLA 5ITWA 1M34E 4EI8A 2GN0A 1FVHA 2I7XA 2WWFA 1SD1A 3HBMA 3QMWA 4B45A 5BY2A 5C80A 5K8VA 1W2GA 3RG8A 3PWSA 3JWEA 3FWHA 4PBSA 4ZV4A 1OXUA 5JISA 3TFWA 1FTNA 4ONEA 4A0SA 2JAUA 5A7GA 4RK5A 4D5GA 3BG5A 3QNUA 4J0FA 2BPOA 3OFVA 1ML4A 3G59A 4UTZA 4M1EA 2Q1SA 3I5AA 4PZYA 1HTBA 1Z22A 2D8AA 5JVDF 5JYBA 1DXYA 4H6PA 1BJRE 2EEZA 1KMNA 4HX9A 3TLJA 4YUZA 5H68A 5LDGA 2UZIR 4RAQA 3NWJA 1GIAA 2HGZA 3P9RA 5BW6B 5JVDA 3LX4A 3ET5A 1L5QA 1RYZA 1EFAA 4FX2A 2C3OA 1WZCA 3F46A 1J2RA 3NBQA 3KTFA 3FPJA 1XRNA 3BD6A 1PLLA 3OLYA 4TMZA 1BFDA 2IU3A 1A50B 1K7EB 1RWKA 3ECCA 2ZYRA 4L22A 5J4HA 4KNYA 1SELA 3QVOA 3WWPA 1TT5A 4X94A 3IAM1 4BNMA 3BFXA 2AKYA 4M6WA 3ZHRA 2E49A 4WRRA 4N41A 3RJTA 2ZJ0A 1NQTA 4NX2A 1UMCA 2J3IA 3P2JA 4HB0A 4HYTA 4P6VF 5D86A 3DZHA 5TARA 2XE4A 1VE1A 4EQ6B 2PE5A 2FUG1 3GV0A 3ZI4A 5LQMA 2FWBA 4OHVA 4P5PA 2WU3A 4HZUA 3T34A 3ZNNA 1WCWA 2QR3A 5FJJA 4LSZA 1SXHA 1XQYA 3IJEB 4IZHA 4YROA 3O2NA 4UXIA 5CNJA 1OAOA 3F1LA 3NAMA 3VOAA 4K6FA 1QP8A 4EGFA 2YHIA 2XWSA 3HSKA 5FA8A 3UMCA 2DY0A 3EVNA 4ON9A 3KTDA 1BHSA 3D0OA 4RPKA 4FIDA 3BIJA 5BSRA 3WB0A 4YRIA 2R86A 3FLMA 4KQIA 2CCGA 4YRCA 1YS6A 3IL2A 3W1VA 1XF1A 2XOEA 4OYYA 4C0KA 2PWZA 4V0ME 1EHIA 1R66A 3GFSA 3LVBA 1ZQ9A 3T5BA 2VT2A 1GADO 3I72A 5DP2A 4C6SA 5AXCA 1M74A 4TTTS 2XCOA 1ZOLA 3L6RA 1GZHB 2GGSA 2D5LA 4W5WA 5EERA 4C2BA 3CVVA 2IC5A 4MYSA 3WYBA 3L7MA 4DF3A 4CFZA 1CEYA 4YQZA 4N7RA 1VJDA 2WHQA 1SCNE 4RIHA 1GNVA 1VDZA 4WXEA 4OJTA 4BRWA 4C29A 4M53A 1Z0IA 3BHMA 4REOA 3HBNA 1PJZA 2H4JA 4X93A 2CKMA 1UPTA 1R15A 1M2KA 3ABQB 3PFIA 3RFTA 1HNZB 2BSQA 3ZNQA 3KE8A 3A4MA 3NGMA 4B3JA 4R8LA 3IBGA 2WIJA 1X0VA 3I4CA 4DMCA 1D7OA 5IJAA 1JWAB 1M33A 3FNGA 5IDWA 3L82B 2X0NA 1KJWA 4ER7A 1ZK2A 4A36A 3R0QA 1FTSA 1MHPA 4MZDA 4X8OA 1SBNE 2NADA 5JANA 1B2RA 3MW8A 4UHBA 3K0SA 1ORHA 1T3ZA 5GTDA 4N40A 4HC4A 3S28A 2YFHA 3KJZA 2JGIA 2FLKA 2OMEA 1YDHA 4H16A 3H3FA 1GDHA 3SZLA 2G8LA 2XB9A 5HYVA 4F4DA 1Y4ZA 4XIGS 4WL0A 3VI3B 3MJDA 1OI7A 4G41A 1ZHHA 5C18A 1CQJB 1MC4A 1E9BA 2BOVA 3UGKA 2L2QA 4AJPA 2FEOA 1G38A 4C6RA 3DTVD 4WH0A 1GM5A 3M7IA 4FE4A 4IUBS 1P7PA 3ZE7A 1YB6A 3CH6A 5JQWA 4NY1A 1E6MA 1GTG1 3TOCA 4F6CA 4ZDJA 2B2CA 4NFYA 4UJ5A 5DDIP 5C32A 3M81A 3N8KA 2RDMA 5FRDA 3WHLA 2PWAA 3P97A 5AW4A 3GLIB 2HXSA 1U9CA 2G1JA 2JHGA 521PA 1Q77A 1O6ZA 3LBIA 1XKQA 4Y9DA 5BN4A 1Q44A 3QA9A 5C53B 5EPUA 2OAP1 2B94A 3LWZA 4JP1A 3QW2A 4TWAA 2HKIA 1NFQA 4ENRA 5KEIA 1U2EA 4PN3A 1RW4A 2XB6A 2BEUA 1Y7IA 1E7RA 1K06A 2NUPA 2XGJA 1Q21A 4XOUA 3K4HA 3UK2A 1JPJA 2VNIA 4B3BA 5AQEA 5ECWA 5JH7F 1E5VA 5H3HA 1NVBA 3GGGA 3LA8A 4NXNB 3W8DA 4NBNA 1ZVJA 3FTPA 1A2BA 2I4MA 3D3QA 4UDOA 1EA7A 3L0SA 2QZPA 2P2GA 3SAJA 4QOSA 4OKSA 4I5EA 1KS2A 1YVUA 2ZYVX 4QQFA 3W2GA 4CE6A 5M7EA 2V65A 1TM7E 3KLOA 4Y2QA 1NW8A 3F6RA 5HOQA 4WFQA 1VE3A 2H1FA 1K08A 2HN9A 1GRVA 4TXLA 2IH5A 2C5AA 3HNPA 4OFXA 4RESA 1WV1A 1KR5A 3I1JA 1D4ZA 3HB4X 4OHUA 1EBFA 2VI5A 4NCHA 4J07A 1I4LD 5J47A 2HWWA 4UQOA 4MR9A 1O03A 3UJNA 4ZQHA 3VNSA 4RDCA 4X97A 3BILA 4DNQA 4Q7MB 4CCAA 4P38A 3EGOA 1K97A 3VOTA 4W9MC 1QP7A 1J2EA 3IXQA 2J3MA 2WM9B 4K6HA 2XNSA 3EVFA 3UWSA 1DADA 4TV9B 2GCPA 3CG4A 3LXXA 5BWNA 2FH5B 1DRJA 1B15A 1FP4A 4WHMA 3T5MA 1LU9A 1QGUA 2VHTA 2WJJA 5FPSA 4ZVTA 1QWOA 1KI4A 4U7TB 3G13A 2O06A 2H52A 4PG8A 4OX9Y 1AOXA 2GYUA 1CY8A 2JIBA 2JFBA 3O8QB 3OZXA 4UFNA 1J20A 1GKLA 1YDGA 4ALMA 5FUWA 1MP0A 4QE3A 4CMGA 1NXVA 2A4KA 1U6JA 4QTTB 2BFOA 1BFUA 5MDHA 3RODA 1TAGA 1LF0A 2LKCA 3IOYA 4KP7A 3VC7A 3K7EA 5CBPB 4RVOA 1RQXA 1TTPB 2HF2A 2VAWA 4HB2A 2INGX 3GU3A 4GI7A 3KQMA 4QULA 4BFWA 4C6TA 1WZNA 4R8KA 1OX4B 3KWFA 1PU2A 3EGCA 3MB5A 4ZQBA 4JBXA 3E9ZA 2H54A 3DQQA 3X1YA 1T9KA 4MAAA 5CJPA 3T3NA 2H31A 3LOPA 4INOA 3MD0A 2NO6A 5FI1B 5HIJA 4DBLE 1KO1A 4K9NA 2HFKA 3B8EA 5EZQA 2CLLB 4PC3A 3O4IA 1DRWA 1KJIA 2WVGA 3A1SA 1EVYA 1QFMA 3PUWA 2QU7A 2WVJA 2MINA 3CIOA 5HJ7A 1MEJA 4FMBB 1D2CA 1DUIA 2JIDA 2QVGA 1NW3A 1O6FA 2VDVE 3H3XA 3JQGB 2M32A 4ISBA 4DMMA 5IWAB 2W11A 4U7DA 2C7BA 2DQZA 3BB4A 3JV7A 3C1TA 4JY7A 4MGHA 4YS6A 3VR5A 2GEFA 1CUGA 2YIVX 1IG3A 4TTJA 2H2HA 3OMXA 2X1MA 2X76A 3G7NA 4OLAA 1H2FA 3LKDA 4YAWA 4HVCA 5DBGA 2B69A 3EGXB 3FF4A 1MOQA 3UA4A 3JAMA 2IVZA 3N2EA 1CNFA 1WP4A 1SKMA 4CT0A 3AM4A 5ICMA 1L4NA 2XT9A 1SHZA 1HF3A 2VT3A 1RYMA 2VK1A 1JFFB 2IHZA 4DTIA 2A1UA 4KO1S 3NVMB 1U9IA 3PFFA 3D2CA 2Q46A 4IR7A 5AO9A 3DFMA 5L3QB 1UDRA 1Y48E 3C3DA 2RC5A 1Y8AA 2C82A 3CMCO 5BYJA 1USUA 4MVJD 3UUEA 4DRYA 4KCGA 1L5HB 4J0QA 4KBGA 3CW8X 4PC1A 1UWCA 5HJ5A 4LJLA 3H7IA 3GRUA 1XZCA 1PKEA 2DWUA 2P27A 2ZUTA 5JR3A 2FG6C 4KPYA 1HXHA 3E9EA 1EJ6A 3BF8A 3IALA 1ZIXA 3BJIC 5A3QA 1ZHOA 1K66A 1I9CA 2PBFA 5ES3A 3UAGA 4CR8A 4JP3A 2BR4A 5I8WA 2JLWA 3V8EA 3RC8A 1ICEA 1JJBA 1UZNA 2CF6A 3PIRA 2ZI7A 4BB9A 5AFSA 3TJZA 5HGXA 3GJ7A 1Q5PA 4II2A 4AY6A 2ZT7A 5DYNA 1I32A 2SKDA 2WF8A 5LMUB 4YJ2F 4CLOB 1XDDA 3AY0A 1ESZA 4ZT2A 5FTKA 4F2HA 1QK3A 1A8HA 5T3YA 3SVLA 4OFBA 5KSPA 2QB5A 1FDUA 1HDCA 2ZI5A 3NBFA 5ALMA 3IKMB 3GRPA 4UHDA 4HEA1 3ZWKA 4MV6A 4PRKA 4OMCA 3SMVA 1H5QA 5T57A 4GP6A 1FP6A 3OFSA 3UUGA 4O4LA 1FNSA 3Q5EA 1X80A 1SIUA 3E5MA 2I91A 1GZSA 2ZYIA 2TSYB 4PGHA 3F7NA 2O7VA 4LNUA 1R0WA 2XYVA 3W3AA 4LJ9A 1E59A 1GPWB 4LDJA 3PV0A 1N0VC 3RK4A 2ZBGA 1ULSA 4P3PA 1NQVA 2RHGB 5CFOA 2JLXA 1F51E 3FYDA 4Y0VA 3FJYA 4OFZA 3SE7A 5FA5A 1XDBA 4NEQA 2QVBA 2XMBA 4O1IA 4DMLA 3V8VA 4RZQA 3GFRA 4KHPB 3VPFA 1KPGA 3BMCB 4MPPA 5E6UB 1SOVA 5ALFA 2XLCA 2ID4A 4M38A 1WXIA 1JNYA 2X2FA 3TSOA 5B6JA 4J7CA 4PYMA 4Y6SA 5HFNA 4EJSB 5B7PA 2I78A 5JSZB 2UUAB 4LI0A 3I0NA 1T5DX 1DBWA 3O1LA 4G9EA 3GB9A 2P6UA 3ZZUA 2O0JA 1KEPA 4ZHQB 3UF0A 1J42A 3JAKB 3A6ZA 1D6NA 1Z28A 3B1ZA 4G3XA 4Q3AA 4RD2A 5ERYA 5EHXA 1FFBA 1CB7A 1QHHB 4XTRA 3L92A 3RHTA 2ZSKA 4M9UA 3ZWBA 3IUBA 2ZWPA 2XRMA 2DSTA 3D6AA 2WF5A 4EA9A 1VLMA 5DYIA 5U1PA 1G2OA 4OHKA 3M8KA 4TUYA 1NUPA 4GM4A 3UJCA 3TKAA 1PTJC 1C4KA 3RFVA 4AN1A 2ZG6A 1EFVA 2YUIA 3IUPA 4RF4A 4XXHA 1FRZA 3MJVA 5EL0A 3L8YA 1O95C 5IAAA 2PO7A 2GWHA 3GFBA 4PSKA 5HDQA 3FB4A 3CRZA 3PNBA 3ILYA 1A1VA 5A0TA 5B3JC 2O4CA 3IO3A 4IXMA 3ZHZA 4EPTA 4Q0MA 4NE9A 4TVKA 2WIDA 3LDAA 4F3YA 2E5LB 1Y0BA 3WYCA 2DSNA 4CG3A 4UMDA 3A3OA 4RV5A 1T2UA 3KP1A 1BCSB 3AP2A 4Y2GA 2UVDA 5UKDA 1EUCB 3LCCA 3AUKA 2R4UA 3GLVA 4JJFA 5G0VA 3N8NA 7ADHA 2BFEB 2HQSA 2QTWB 2HYDA 4FCWA 3EIFA 4GMKA 1GPH1 1MR3F 1QB8A 4F8JA 2XYQA 1N6PA 2LZ0A 3C3CA 3HSYA 3IIEA 3Q3JB 4MVJH 4XGRA 5E3HA 1QX4A 3ZCPA 4INJA 2NP7A 1VI2A 5G3ZA 3NYWA 4LXGA 4DT1B 3D4BA 1C30B 1E3LA 4D96A 2FZLA 1P1BA 4C4SA 3I9V1 4HN2A 2QM8A 1MJGM 3WTBA 3RUIA 5DNCA 1XLWA 3AQIA 1NNSA 3TZKA 4BNGA 1PTJA 1Q20A 4X71A 1T2CA 1WKVA 1YR2A 5JS8A 5J3JA 1V26A 3KD3A 2PN1A 3CEMA 1YE3A 5FTLA 5K0CA 2CVOA 1NJ2A 1Y9EA 3OZCA 3QUBA 4N8SA 1Z2AA 4YO8A 2A92A 3TM4A 4W4TA 4YC7A 3U0BA 4TUYB 2XZDA 3K8QA 1JU3A 2GNOA 1LI4A 2DTXA 3I0ZA 4UVGA 4L4UA 4N7MA 3L8FA 4JL6A 3VAZA 3VKVA 1QRAA 1OYVA 1W0JD 2AFRA 3EH1A 4IDQA 2IBSA 1JXQA 3MAAC 1RM4A 3BIOA 4L3VA 1X2BA 1AKMA 3TQRA 4CTMA 4F3TA 1L4FA 3GPBA 3EEQA 1ZINA 5J2UF 1QP0A 4W63A 5JSFA 4KI0A 4QIHA 2RGWA 3IULA 4IDFA 5EJFA 4D42A 1RJFA 3QF4A 2IEZA 1A9TA 2VCEA 1ENZA 2ZJ4A 4HNRA 1TU0A 3E05A 2RGUA 1PD1A 4FUQA 3SEQA 1QJCA 4BCCA 2NMVA 2RH5A 2HCJB 1D1PA 4F4JA 4AAYA 3S2GA 4ZCMA 1UH5A 1CJSA 2E48A 1H66A 3KJQA 4NZOA 2YJ3A 4AMBA 1XA0A 3L7DA 1VZ3A 2XCQA 3GA7A 1XLVA 2QBYA 4FB5A 1B1CA 5CDTA 5JXIA 1YFKA 2GM9A 4LXHA 2P1DA 2PH1A 1ESNA 3AL3A 4BASA 3R0JA 1V9SA 2EQAA 4OHMA 4CMEC 2BTEA 4H27A 1SVOA 2JRLA 4HJRA 2GCEA 4RGQA 3SSOA 1V6SA 2ODWA 1SUBA 3FBWA 4Q19A 3N2YA 5CXSA 3NNDA 3NTLA 4AN0A 1RHMA 2O8BB 4JBIA 3VSBA 3HCRA 2EKQA 1YC5A 5K8JB 3HJAA 1P62B 1SCUB 4EWLA 4C5BA 3LVQE 3EMVA 3MLBA 2V5VA 4DDVA 1Z4IA 4I4NA 4C5AA 2XWPA 4N3BA 1OXTA 2RJ3A 1EFUA 4IWYA 1NGSA 4XRRA 2Z98A 2Q45A 4YLYA 5DFAA 3WGQA 5K3AA 1ML3A 5IKMA 4N01A 1REQB 1M6VB 2BKUA 1N36B 4MUMA 4JVNA 3WYGA 5IVKA 4DIEA 1T6YA 1E2MA 3A4NA 1BCRA 1BKSB 3O8LA 4IJMA 1MJHA 4Y30A 2OL4A 3ZV3A 4MEBA 4DIBA 1ISHA 4H08A 3OF3A 4LC1A 3W3AH 2QT0A 3KOUA 1Q1NA 2ZJAA 2B0JA 4KJXA 1GA4A 3FYUB 4M0KA 1DKNA 1YTUA 2B2NA 2QNRA 1PIWA 4IVNA 4G4SP 2W4MA 2YJ6A 5ALKA 1HBJA 5CDSA 2C2GA 3E48A 3F5MA 1K89A 5FXMA 4DC1A 1MH9A 1IC6A 4EUNA 4ZT7A 3WK6A 2HPZA 4U63A 4B6RA 2ZVDA 3ZQKA 1S96A 3OESA 3AGPA 1GYRA 1OLXA 1VQ1A 2G4VA 3HY3A 4JFRA 4ME6A 1GXSA 3GH1A 3GWZA 1JN0A 1KQ3A 3QPBA 1P31A 1P6QA 1WXWA 2OHJA 4HUQA 1AGNA 3ADCA 4JC0A 3PUKA 3H8WA 1LW6E 1XTJA 2DUJA 2G72A 2OC4A 1BN6A 1I7NA 4NLLA 1ZGJA 2P11A 4XIYA 3X1WA 4F84A 4YCSA 3WGJA 2F4NA 1KH3A 3FG9A 1TK3A 3U7IA 1BFKA 2V5AA 2ZRJA 3CX4A 1SU7A 4PGAA 3UT0A 4BV3A 4G1UC 1E96A 2PNJA 3LZDA 2J3KA 4P7JA 5BSMA 5CFLA 4QYTA 2XNJA 2NTJA 2CMDA 4RORA 3UANA 1CVLA 4M55A 4F5DA 3D8HA 5J23A 1G21B 4WE3A 2M6LA 4Y2UA 5JAOA 3ICOA 5JZVA 2XKJE 1Y42X 1U3TA 2A7QA 2KW5A 2PSFA 3GPCA 4CM7A 3THXA 1N5KA 4RGYA 4ZC1A 1KAQA 1OWPA 1MW9X 1L7XA 5EVJA 1EGHA 4RTLA 3EX7C 1F7VA 3OQPA 4ENVA 3KKMA 3IUYA 2PLAA 1GAJA 4MI1A 2HC9A 3L7YA 1F3LA 2QQEA 3CRMA 2O0KA 3I5UA 4Y9RA 2XBLA 2RH9B 3MA0A 1RBMA 3Q85A 4Q4JB 2EERA 3BQMB 5AKHA 4V2IA 2NUTA 3O31A 1MRZA 3KTAB 2F9MA 4QQKA 4KIUA 1U3CA 4WEQA 1KE2A 5JBIA 3EN0A 2C3YA 2J3QA 2HMUA 1GAQA 3G0BA 4JP8A 4RS3A 3CEAA 4MCJA 3MBOA 1E2DA 2VHXA 3HA2A 3LQFA 1TKRA 4Q6WA 5ALHA 1LDNA 1NQAO 2FFAA 2O14A 4G86A 9ABPA 2O1SA 4P3NA 5DYGA 5CIWA 4DARA 4HP8A 4IS3A 3V1TC 3R9XB 5IC5A 1F9AA 1CR4A 1MF7A 3AWIA 4IBOA 5B4TA 4F4IA 1ID1A 1DTWB 2EYQA 4BNWA 3ICCA 2J6CA 3IP1A 2UUOA 3EULA 4ZVLA 4BMSA 4Z9BA 2HCBA 3IMCA 3WIOA 5BV2P 4Q93A 5G3YA 2FSVC 2FX3A 2GA8A 2HOQA 3ICVA 4MZXA 3ZGYA 1OV4A 2HZBA 4J1QA 4I2NA 1UPCA 2QVZX 5AESA 5BOSB 4EYSA 3EWIA 1HH4A 3VUFA 3UQYS 3LUGA 4GE3A 1KH1A 3M49A 1I24A 1OSNA 1SBYA 3K1JA 4KQMA 4EG7A 5IM4F 3OQMA 1KI6A 2PVSA 4XGKA 2VRNA 3SYLA 3WMFA 3ZKAA 3CUEF 1RC0A 4D3YA 2PZAA 3H0KA 3L77A 4L15A 4JV5B 4JN6B 1E1RA 3RE1A 1NFFA 2PRZA 3U13A 2FMFA 2QQFA 1VRVA 3KB1A 4NYJQ 3Q8WA 4U2FA 3UV6A 3JAKA 5BN5B 3MINB 1L0BA 4DBLC 2Q5EA 3NJ8A 2WIBA 4XGQA 1QGDA 2Q2VA 2PXHA 2F7SA 3P0IA 2I54A 4GPTA 5MN5A 2WHXA 4E5YA 1Y1SA 1R0SA 2NXEA 3F2IA 2Q1XA 4EHHA 1UFQA 2ZRFA 3L8HA 1JJAA 4MQFA 2WFZA 1IDOA 1GGMA 2AC7A 2IP2A 3RS7A 1JHZA 1ZAKA 2PX4A 3F7MA 2JLCA 3KYIB 3DZKA 5IBCA 5LXTA 3OY7A 3L7OA 1QMPA 2XGMA 1Z83A 2BCJQ 1XJCA 4DNXA 3TE7A 4A8HA 2XZPA 2OBNA 1HFEL 3LRPA 4LZZA 2ODPA 1UT8A 4KPFC 2R62A 3ILVA 4Y0AA 2J45A 4UEQA 4WK4B 4AQ7A 2O23A 1NXXA 1R6BX 2V98A 3FFTA 1PN3A 1RMQA 1AO3A 4MUKA 4NTZA 1Z26A 4OF4A 5JXHA 2NUPB 1NXOA 1KZYC 3DLHA 4AECA 4FINA 4QAJA 1UC9A 2ON6A 2VKQA 3VM6A 4TTPA 4R1TA 1NHGA 3R1IA 4L9SA 4AZSA 4PTYA 1XMQB 5CM8B 2W0MA 3WFIA 1SVWA 2ZIFA 4L2IA 4W8GA 1CVRA 1E3IA 1OBOA 5L3SA 5ILOA 3K5PA 4TMXA 5JAMA 5JZOA 4OLHA 2YMPA 5G0UA 1SIWA 1A5BB 2BJVA 5COQA 2ERCA 3TL3A 1W4LA 3IQFA 4PG7A 2YZKA 2Z8XA 1DE0A 5K2MA 1NXSA 4MUJA 4GM1A 2RBGA 3KT8A 1UMDB 2E1RA 1PVOA 3VKUA 4CKCA 2AW5A 2JNWA 4BBAA 4DBVO 1ISFA 1KEEB 1CIPA 3DDSA 1ORWA 3NJRA 1CRPA 2W2KB 4MVCA 1SU4A 4PZ9A 3QPWA 3BRWA 3H05A 3AHCA 1XA3A 4IDAA 2EVWX 2QR2A 3VSDA 2AX3A 3KPVA 3CZPA 1WETA 3NP9A 1N5LA 3HKBA 1VE7A 3W5SA 2O6LA 3VSCA 5SY6A 3TIFA 1FP2A 1NQUA 2H6EA 3L84A 4UOQA 4F2WA 3N8GA 2P9TA 1Q0HA 1TQ8A 5M2QA 1D6JA 3TVTA 3CRW1 2QY6A 4E5KA 4YR7A 3MELA 1GYPA 3SR3A 1EG7A 2Q5HA 2YRXA 4FDLA 3GAAA 1W75A 4LYGA 3H04A 4MK4A 3UXHA 4MV3A 5EI5A 2F6RA 1PFVA 3MWJA 3A9VA 4DE5A 3UHPA 4LJ6A 3PQEA 1RSZA 1KTIA 1AY0A 3I0MA 5HRAA 1NF3A 3A10A 2JAXA 4OXNA 2Q3CA 4QEKA 3B9PA 2O1EA 1RWBA 3B9BA 4I7EA 1BJTA 3DP9A 3FNHA 4HH0A 1XVIA 1ODKA 1TYAE 1YZGA 1JG4A 1IIBA 4E1VA 3I34X 1U0NA 3GPDG 4ZVQA 2P8JA 1OWLA 3D64A 1XWIA 2ZVPX 1PS0A 5ALYA 3MCTA 2REOA 3H84A 4JVLA 4DIMA 2ZIZA 3QY0A 4OQMA 2JLUA 5C1IA 1G55A 4B32A 2XTJA 1BZYA 3ANXA 1Q7RA 4MWEA 5FFMA 1Z37A 2C8KA 2AG1A 2GZ3A 2ZE6A 4JWKA 4RQUA 1S6YA 3O75A 5KTOA 2ORWA 3IP6A 2UUCB 2GM4A 1ISMA 2HMVA 4B34A 5KSZA 4AX8A 4A2QA 4PHFA 2PSEA 4WN3A 5ADUS 3TB4A 2IYZA 3HL0A 1SCJA 2NV2B 2OO3A 1QYWA 1SOWA 1G98A 1U65A 2G5TA 1RE1A 2ZAOA 3OJ0A 1E62A 2CN1A 2V7PA 3QF4B 1OYWA 3OUUA 2WMYA 4NPAA 1Q92A 2V58A 2I4IA 1GAWA 3R09A 4MAMA 4OYRA 2Z3ZA 3UN1A 3ZG6A 4AO7A 4RHTA 4ZXPA 4H1UA 4HGPA 3NIBA 3U49A 3LLSA 2XOKA 3NRJA 3D7NA 2JW5A 4KLAA 5SZIA 5C8YB 3CPJB 1EX9A 4YMVA 3SQLA 1ORTA 1W35A 2PG3A 4N48A 3UJBA 1PUIA 3KKQA 4WLVA 2FW0A 1GU7A 3FTFA 1G7TA 4OGLA 4U7JA 2CXRA 2GZ2A 3R6GA 1X74A 2N3ZA 3GLUA 4MR8B 1W30A 3OQOA 3EZFA 3BMNA 3AJ9A 4INZA 1RYNA 4JB8A 3ENWA 4KV7A 5FL7D 2NUAB 2W5UA 2YMMA 1FMFA 2ZQ5A 4KN5A 1DDGA 2VCHA 1TYEB 4US0R 3FZNA 2XCRB 1XZGA 3I04A 1ANKA 1BDBA 3WIEA 5KYTA 4G0NA 2OZVA 3EVEA 2QTZA 4QFDA 1A4RA 2PT6A 4RV9A 2MSEB 1PJTA 4TXNA 3BMNB 3A6LA 3GROA 4KPEC 2VNHA 1Z4OA 4F97A 3NHJA 5D5PA 3O94A 1D1QA 2WLTA 3WGOA 3VA7A 2A6PA 1P19A 2AA3A 2Q5CA 4WCDA 1PK9A 3FE2A 4R7ZA 3OAAD 3ZTTA 4BMOB 1EP9A 2VSXA 4XIJA 3I9V6 4OA8A 5CU7A 4WCFC 1TNDA 3R5TA 3DCNA 1ZW1A 2PYIA 3EF3A 2IDKA 5DV9A 1UXJA 5C4GB 3FSRA 1G6Q1 3TSCA 3KIPA 3UB3A 1G16A 1ATIA 1DKLA 3AJAA 1P33A 3UJDA 5K0BA 3KSMA 3M9LA 1E4VA 1TQ2A 2C5GA 3GZNB 3I4FA 2Y6UA 4XGIA 4WNAB 4ZCQA 1RR6A 1PEKE 4KNVA 2FPGA 2JZNA 3PENA 3QQ5A 2AQ8A 3KQPA 1CJVC 2YWRA 3WLFA 3MNFA 2E7ZA 1OROA 2C98A 2TS1A 1GTJ1 4FU0A 4JLKA 4M1WA 4YRMA 2PGAA 3RIXA 2VNKA 1P0IA 2B83A 1J0XO 3TOZA 4LCBA 1NJSA 2DLNA 3HYSA 3ORYA 2P9YA 3CE9A 2ZYWX 3RRNA 3BWXA 3QU9A 1SUAA 1LBHA 1YS7A 2ARKA 3NI2A 1UPXA 3UT5B 4EJ6A 1O95D 4QEDA 4RPLA 4M1QA 3RU3A 1HX7A 3WLTA 3GLGE 2P9CA 4AN4A 2REBA 1JYFA 1AKTA 1XYGA 4LVNA 2Z6QA 1BSVA 4ZCRA 2C4KA 1LSOA 1P7WA 1J06A 1T9DA 1ZIYA 4BFTA 4D8UA 5JDIA 2KLBA 4O33A 2QN7A 1UBFA 3M5DA 3H18A 3BGWA 3ZBTA 3EEYA 4PQFA 5CBPA 2EZ4A 5CCEA 1YVRA 1JLLA 1DAEA 2EV9A 3VISA 5TR9A 4A6PA 3AM5A 3ZWWA 3ABOB 4OHRA 1RZRD 1OZ0A 1DTEA 5A62A 4GL2A 1FDVA 4B71A 2J9FA 4BO3A 4GZMA 2V97A 1SCQA 1YDEA 3C8HA 3DW1X 3M70A 5F12A 5EMJA 4ZKEA 4BVHA 4ER5A 3FIUA 3ZCUA 1LS6A 1JKJA 2HXYA 3QU7A 4R2JA 3A2MA 4BYGA 3RHSA 4DUZB 4BO9A 1ZISA 4I46A 3BRWD 3CF2A 4EFLA 3PQCA 3NUQA 2O8CA 2QEQA 1QOPB 2VDQB 3OOSA 3BPSA 3P0RA 3WLOA 1DCKA 2EP8A 4E1BA 4ABYA 2Y1GA 1DVRA 1Z29A 3KYBA 1WCIB 4MV9A 1LLQA 4P31A 4DR6B 2R0QC 1Y9DA 1E1RD 5J4KA 4GLOA 4B2PA 2DFPA 1F60A 4X60A 5E1MA 2R5NA 1A1SA 3E9NA 4KN6A 1F2UB 1XSEA 4UU7A 3SP1A 4YXFA 1IPFA 2P2YA 4YAOA 5AIAA 4AY3A 1E2HA 2RHOA 5CNIA 3TJRA 2IWHA 1KBQA 3SZOA 4NONA 3TW0A 2BGRA 1JR3D 4D2IA 1Z8NA 3CLHA 3KZMA 3UAXA 4LFAB 3KLMX 1G1MA 2AOTA 3IURA 2I4TA 4FUTA 3OM1A 2C2ZA 4QJ5A 1CY4A 3EVGA 5JDCA 3JQFC 3GUUA 1T8TA 2IPMA 3I12A 5SYNA 4LWQA 1GYQA 1S0UA 3F8TA 1S8OA 1QDLB 2QW1A 1XCPA 2I3ZA 4ZPJA 2RJNA 2ZIGA 3OIFA 1YZ3A 1W2HA 2G6BA 4XD7A 4C4ZA 3ESQA 1J8VA 2C99A 3N2KB 4F93B 5JBQA 5JSYA 2Z56A 1SCUA 2VZEA 4PANA 1B00A 2GVDC 3PYXA 3FFBA 4IO1A 2LIVA 4P53A 3G9QA 3TNFA 3LC1O 2QN6A 4IYRA 2UVPA 4WZBE 2ZIWB 1N32B 4QGBA 1A96A 3OKPA 4PLCA 1ULUA 5BSTA 3OZUA 3PI7A 3DHEA 2PV0A 3U62A 3F3MA 3VYSB 1K8QA 3I9NA 1SKQA 1P8AA 3ASVA 3LAWA 4FZJA 1DTWA 1LEHA 1KA9H 4Z9FA 3Q0TA 4HJXA 4YCDA 1VMKA 3IQIX 3WKBA 4AJEA 3I9FA 1U9ZA 4HLNA 4XPIA 4ZYZA 1DIGA 3TOSA 3UY4A 1ZI8A 4KQXA 3V1UA 2C1XA 1VHTA 1YH3A 1RRKA 2JFNA 2HBQA 2ZUUA 5CYFA 5EC8A 5LL6P 3BJEA 3RS2A 2Y99A 3GOQA 4FDUA 1A8QA 4HRVA 1BYIA 1H05A 1Z0JA 4YAGA 3V7YA 4OQ4A 2VHCA 1DQSA 1U0EA 2GZMA 5BNZA 2JFUA 3MG9A 2FJUA 3V32A 3U09A 2I71A 4IH4A 4LBYA 1IY1A 1B6GA 4JZYA 4D4JA 1AHPA 3D81A 1RC8A 1I4EB 2GDZA 2VF7A 4G5YA 2HHLA 1SEVA 1GUAA 1LNZA 1U2RA 1HTWA 2VWGA 1MB2A 2GT1A 4GSKA 4HQ6A 3FVVA 3BXFA 5KNLA 4RD6A 5C5IA 3MC1A 3KQQA 4F04A 2XRZA 2I1WA 2QYOA 1H69A 1YKGA 4L3OA 1DL5A 2BL4A 2MR6A 3B52X 3OCUA 3ZDAA 4JI7B 1Y5NA 4B6JA 3VKHA 3A6KA 3AESA 3NPAA 5BVGB 1H4VB 3AGQA 1ID8A 2ZSJA 1PF7E 1I7PA 1RAAA 3X1DA 3NWPA 3CSDA 1JPVA 2PQ2A 3VNRA 3FVTA 1J5PA 2WSMA 2J6HA 3JWIA 2CK3A 4QYIA 3MXTA 1KARA 2YS7A 2C2WA 1UM9B 2H5EA 2WPNA 3F47A 4Q1VA 2FETA 3ZWQA 2ZB8A 4MA5A 2ZUDA 3BQ9A 2H7CA 2IOHA 2GERA 4Q9JA 2UDPA 1M10A 1Q0SA 3MWEA 3U1VA 1H6AA 1ULHA 2BN4A 3D0QA 1EFKA 4IDPA 4KE6A 3EGEA 1G3RA 2I29A 5IN4A 1GP2A 1U9YA 2CLOB 2IXAA 1UOEA 3C39A 3DFZA 3DVAA 3GQVA 3K9NA 3MUEA 4AL4A 4RNDB 2NYRA 3IRVA 3NEYA 5DVZA 4TLAA 2P75A 2YN0A 3ZQJA 2F17A 3AWDA 3IMEA 1TQDA 1E9SA 2YDYA 1NBWB 5EWJB 2GESA 5GAJA 4MQUA 3RO7A 5B1SA 1VECA 1QF9A 4QC2A 1TQ4A 3U26A 1IH8A 2HLDD 1E3DA 2JH9A 3QI2A 4LVOA 2WJWA 4FCTA 3RGGA 1YAJA 2P69A 4LZNA 4ENQA 4GRDA 3GLIE 3F6BX 3ONDA 4PSUA 1YQQA 1ZOIA 1OQAA 1F8UA 5HJEA 2NU9B 1WBBA 1FYFA 1IK4A 1E2EA 4AKSA 3NH6A 2BFFB 1Q0RA 4Y7CA 1TXGA 1DKUA 1FXSA 1MA3A 3DMYA 4LOHA 3LCMA 3LQYA 1T5HX 2GAJA 4J3FA 4Q1BA 5NLLA 1XI2A 2GYYA 3TTYA 1KJZA 2WLSA 2ZRMA 4YI5A 3PXUA 2EAUA 4B8YA 2COUA 1LRLA 4QDXA 1E1QD 2ZWAA 4QUHA 3F8SA 1JALA 1PWXA 1QYXA 4E15A 2QRHA 3K9GA 5TT0A 2G9VA 1NNUA 1X7XA 1V7PC 3VJMA 3S7ZA 5FNVB 2EBHX 3JVVA 2ZR8A 3EH2A 4RXTA 3O2JA 2WSBA 5DGXA 3NKFA 3HZRA 3C6QA 2ZCUA 3DLIA 3SIRA 4URVR 1JDNA 2ZTVA 4BIMA 4G01B 3C6ZA 2I2DA 2P65A 4YT8A 2AMVA 1HOXA 1VM6A 1YGYA 3BH6A 1WOMA 3CUTA 4YUWA 2CXHA 2HO4A 1AMNA 2F8SA 2QU8A 2R6GA 4BYMA 2DFVA 2SCUA 4AJHA 3UTDA 3UHFA 2BYTA 1GKYA 4U6NA 3NDBB 3C3MA 1O3YA 4IQ0A 4PPQA 4Q82A 1ZUIA 2X13A 1UK9A 1K7FB 2IPXA 1EJ2A 1KDTA 2A0UA 3HRIA 5IDXA 1IXRC 4BKUA 3A4IA 3RTBA 2H9AA 3FYTA 4L8GA 4R2HA 4UHEA 5DPMA 1OAOC 4ZVPA 4DC0A 1R5BA 3DL2A 3BXXA 3KL2A 3RVLA 2WEKA 2FP4A 4WN9A 4TL7A 4UD2A 4ALLA 4DG8A 1O2DA 3H0CA 2O8DB 1UP7A 5LU9A 1QQBA 2ZJ1A 1KYIA 2GJKA 5FUYA 3RYIB 3G5MA 4H1WA 3QMVA 4AVYA 3HXQA 4Y0NA 4D8YA 2JFFA 4F5ZA 4BLSA 2YH2A 3W06A 4DEVA 1VJ5A 3EQZA 3P0HA 1SVSA 4LZWA 1EK2A 3MWKA 3WAKA 2HQ1A 3TWOA 4F45A 5GY7A 2GAOA 1EU1A 5GQSA 3DEKA 2PO5A 1AS0A 1DCMA 4TQUS 1S02A 4FGSA 3JWJA 1T35A 2J0UB 3DDUA 3FI9A 4U0JA 3DTVA 5LQAA 3KSRA 3X1KA 2Q9AA 2YRFA 1Q7GA 4ZALA 2FSVA 2PRIA 5K1ZA 1FNCA 3ZVRA 3UFXA 3ULKA 5FR2A 1XL1A 3UYKA 4EF6A 1OFIA 2R7MA 1ODJA 4RHUA 2ILVA 1BE0A 3V7FA 4EYQA 3F6CA 4L75A 3WLEA 2G06A 2YR0A 1EUQA 1ZA1A 5F73A 1MG5A 3WYNA 4WKBA 3HRKA 3IOCA 3ASZA 2DWPA 5CNKA 3RIYA 3KELA 3L05A 2ZJ3A 2HA3A 2L17A 4PZEA 4COKA 5KYWB 1PRYA 4URYR 1KMQA 3T1QA 1JHMA 5FCDA 1JZQA 1RTKA 4UPEA 1Q22A 2IKQA 1NW9B 1Y6QA 3PWZA 1C50A 3C85A 1JEQB 4NFLA 1JLHA 4FD3A 3E84A 3S2SA 4Q4AB 1TJ5A 2GN2A 3OO0A 4JGBA 3R74A 3NEJA 1V4NA 4B6PA 3RCBA 4YV2A 3O84A 2MIIA 2DXIA 4Q7LA 2O19A 1SBQA 1IUOA 2HMWA 1DT3A 3BBPA 3MTAA 4JEHA 5KAPA 1QHGA 3CLSC 2I6UA 1ZOSA 5AKZA 1A3CA 2Z95A 4PHGA 1JP7A 4IH9A 3DDHA 4UKDA 3W5JA 1CR2A 5P21A 4N8DA 5KYUB 5F3WB 4PYKA 2JJQA 2VRCA 1DEHA 3ICWA 2AFIA 2Y1EA 1WW3A 3VR6A 2HV8A 4PX3A 2H4ZA 5LDDC 5F52A 2P79A 4L4XA 5IW8A 4KXWA 2IOFA 1GITA 1NYLA 5LNK1 4GEKA 4NBSA 1NBEA 5FV4A 2WSYB 3AERA 4ZGGA 4PCVA 1CWUA 2P3SA 3IAM6 3N05A 3HYTA 1H0HA 4YJ3B 1W49A 2AXNA 3QVKA 2HUNA 4YCJA 4DMKA 1KSHA 2DFKB 3AZPA 1XPOA 2X0RA 3QQPA 1B16A 3OZIA 1XCLA 2ZANA 3ECAA 3LHDA 1B8UA 1NVEA 3KSUA 4UUBA 5IT4A 2YFKA 1VLQA 3ZOZA 2Q3FA 5A3VA 4BVEA 4H35A 5J5CA 3K6SA 3NGLA 4AKGA 5TMPA 3TDNA 4PLVA 3GLTA 2I80A 5ENDA 4MVJA 4ZAYA 1OXKB 5JH7A 3KTAA 4ZZIA 3GL9A 4WESB 2AXEA 4X64B 2H2FA 4PZCA 1C1DA 2O3QA 1R12A 2KE5A 3AF5A 3SJZA 4EG8A 2IX3A 4JJ6A 1U98A 4C78A 3RKRA 4QTYA 2CNBA 3P45A 4FR5A 4RIEA 4Y18A 4DQLA 4IIEA 4IX1A 1QZZA 1X14A 2HA5A 4DA6A 1KWKA 3C70A 4E11A 2P4UA 4HAWA 5HF5A 4AZWA 2DFDA 2NPOA 3VJRA 2UXBB 1TCVA 3RYIA 4DUGA 3GLFB 1K3FA 1RKVA 1PLJA 4EVRA 1A8PA 3GCGA 1L1RA 2KLHA 2QLBA 4JQOA 5C31A 4RMJA 3G8DA 2EWVA 4R8SA 1OTXA 3MM4A 5GPBA 4G8BA 5FJIA 1Y6RA 4AWXA 2R7AA 4EKGA 2MCFA 1F48A 3IIJA 4J0EA 1WVGA 3CNBA 1A98A 1EHYA 2H4HA 3EGIA 1EGQA 3TVYA 3VU1A 1R2QA 2ZKIA 3JARA 4AMGA 3M5CA 1RZUA 3KOYA 5EWLA 4B0PA 4AUMA 1BA3A 2OM2A 5EE0A 5CVDA 4JQSA 4P4GA 1EFRD 2GZSA 4I1IA 2O1XA 5FNVF 1TQ6A 2NVBA 3QKIA 4Q9IA 3JASB 1G6KA 1SHTX 3D4PA 3DMRA 3HY4A 4ZI7A 4Z8XA 1JKFA 1D2AA 3ZZ1A 2VYVA 1MFPA 4M8KA 5BQXA 3R7SA 1GTMA 1SCIA 2VDJA 4DCPA 1TCUA 2R8OA 4WW0A 5C1PA 1Z73A 2VRBA 5TY0A 4EY5A 1CBUA 4JAVC 3D6VA 4HQRA 1ZC4A 3F2VA 3QXGA 5CX4A 5JD6A 4KYIB 5EZSA 3IERA 3T9EA 1ZSNA 4B80A 2FW1A 5FV7A 5CMLA 2IV7A 3W9YA 4LXTA 1G6OA 1UOQA 1JLSA 3RJMA 2W4QA 3RRFA 3THRA 3EIXA 3A37A 4FEEA 5TQ2A 1V39A 1G66A 1HT3A 1QR6A 5LYJA 5C4IA 3ZUGA 4BAGA 3IMGA 3TR0A 3VQTA 1NE7A 1YRWA 3B36A 5C51B 4U02A 1ZBDA 4W5NA 3F8WA 3EFBA 1AKVA 1P6UA 2GKOA 2GK7A 3PS9A 4K7JA 2CLIB 2A67A 1BMTA 2L69A 3NALA 4KMOA 4MULA 4MRPA 5BSUA 1USKA 3Q8KA 3ZJTA 1NLUA 1YBVA 4CKXA 3VDMA 4D99A 4R31A 4I50A 1Q57A 4MV4A 2XMRA 4HNSA 5B55A 5ENZA 2WWWA 1XF9A 2YOHA 4OKNA 1GSHA 4TN1A 1K86A 5KNCH 1N9KA 1XN1A 1Z5PA 1KZ9A 3WSVA 5CAEA 3CT6A 1UKCA 1JHRA 3O8OB 4ISCA 3E8XA 4O4HF 4BRZA 2VAMA 4F9FA 1TM2A 2DECA 1AQLA 3UW1A 3NU1A 1WWKA 4O4JF 1J8MF 2FCRA 3ELYA 4BQEA 1M1YE 5K3OA 2NOAA 4I1RA 3TK1A 2VAXA 1JWLA 1A9PA 1B41A 1BIFA 3PX2A 2R25B 1QRUA 4JHXA 4I4LA 4EGAA 2XRYA 2X8LA 2J4FA 4LSWA 4PZAA 3RR2A 4NIMA 3MS2A 5C8ZA 3HWSA 1G20E 2K6GA 2Y0CA 1JB1A 1BJKA 2BGIA 3L0IB 5KCMA 2OA0A 1L1EA 5E4FA 3AXTA 1VIDA 2DKOA 1EDDA 5EIXA 2GPAA 4PY2A 5I7FA 1UP4A 2VC2B 4FCVA 3P9ZA 5FR1A 5K0EA 1WS6A 5C52B 1A27A 3VNUA 3DBHB 4CHTA 4P32A 3DEIA 3DJFA 4LKOA 3ROTA 3WYFA 1GGJA 1YUMA 2HPHA 1LCIA 5KJFA 3K6RA 5H16A 2GCNA 1IN4A 1DKOA 1D2NA 1OZHA 2ZSHA 4PM4A 4BVFA 4B3CA 4CQJA 4TWJA 3GNLA 1Z6ZA 3SIPA 3AVYA 2FZ5A 3SSAA 5ARCA 5HKKA 3AINA 5AK3A 1Z15A 3HRHA 1XDWA 3EZ2A 1WUHS 4PZPA 4TKUB 3I2YX 5KYYA 1Z0UA 3E03A 3V00A 3STHA 3G7UA 2M9MA 4U7WA 2FX5A 3I92A 2J0QA 5A6SB 3WO0A 3EXG1 1RKQA 4WT7A 4DZZA 4KAJA 5K3DA 1ZA2A 2DEUA 4PPYA 1VFPA 5LXTF 1WAMA 5FPTA 2VJDA 1AK2A 3WZ2A 2YWGA 4DLXA 1LDGA 4DS3A 1VJCA 3V34A 3HJRA 3MT7A 4OTZA 3RAJA 5CNMA 4CM9D 2AOUA 4C1NA 4HDKA 1FE8A 5HTOA 4GX2A 1L5HA 6REQB 4DQDA 2GLUA 2EU8A 3DO6A 2ZJ8A 1AGPA 1CZKA 1HDYA 2WYWA 4J43A 3GPLA 4CJXA 1USGA 2PX2A 2UYOA 1TCAA 1TMOA 5DP1A 3C5EA 2WFLA 3FOAA 3KJGA 4HWPA 4DCVA 3JZIA 4R84A 4BGUA 4QXMA 4F1WA 5BWBA 1BD3A 1UL1X 4MQ6A 5ESDA 1D1TA 2E4UA 1Z6AA 2ZBPA 3MTIA 5DLDA 1S1CA 1ZM4A 4DMRA 2ZCJA 5HIMA 3N0WA 5AXAA 4QYWA 3AKEA 4HY3A 4N3CA 5GONB 3ZI0A 2ISCA 3OE1A 3R7FA 1Q1BA 4IIJB 3N70A 1WMFA 5E2AA 4LEIA 2Q5FA 4HG2A 4KODA 1ZITA 3I39X 4OBWA 4HFRA 4QEZA 4B7ZA 3BL8A 2QUHA 2OOSA 4BX2A 2JS7A 4RJTA 2O3JA 5KOHB 1ZMTA 1C30A 2UV8A 1NBMA 2OPHA 3AR5A 1W2WB 3IQWA 5EE1A 3GFFA 4A0GA 4BJ5A 5CA1A 2B1IA 2QD2A 3HXLA 1M2VA 3CEJA 4GKAA 1P81A 2Q8NA 5KPJA 4G1VA 4JITA 2YVQA 1GN9A 4QXPA 2VL7A 2XD4A 5BV0A 1N7IA 4JJAA 5BORA 1QOQB 4Z1MD 1GV0A 4J4HA 3OIYA 1J70A 4IHQA 4YQEA 5E0KB 2R87A 1RXVA 3IP5A 1S01A 2Q4DA 2OXTA 1NM5C 4EG1A 3M9WA 3BD7A 1PZXA 1SXJE 2JCBA 4RNCA 4CFYA 1Z34A 3UFXB 3RVKA 4B33A 2IYWA 2WNHA 4AMVA 1PZNA 1RI4A 2QLFA 2WWRA 3HBFA 1LDMA 2DC1A 5CB4B 4AUKA 2Q1YA 1W96A 2Q3BA 4LBWA 4LX0A 1J7KA 5EJ6A 3HB9A 2NSJA 4UHHA 5BXQC 3DW3X 3NHSA 2XA9A 2FDXA 2EJCA 3AONB 3BYZA 2BJWA 3GLHB 3OJLA 4ZQGA 4Q4HB 3N2KA 3VPBA 5AM3A 2CVHA 1ISSA 2G0AA 2VYVD 2Z2ZA 4S1NA 1N0IA 3GFGA 4MP8A 4QG3A 3QE0A 1Q3KA 1GQ2A 4QGGA 1Q1QA 2JGFA 2XIJA 1Y6GA 3HJBA 4B2IA 3U7HB 3QZUA 1NI4A 2FMIA 1UBCA 1HM5A 2FR0A 2YJ4A 4WN9B 5IARA 3SJCA 1MO2A 1JILA 1OFGA 4MO2A 4UDNA 4BMVA 1ZBQA 2WHEA 3JZAA 4G8CA 5ALIA 2JLRA 1XFDA 3QFSA 4NV1A 1YI8A 2Q0HA 4EGSA 4Q9DA 1M2VB 2QYHA 4MAFA 2LUOA 4DEYA 1IBMB 1JHVA 1J99A 5KYVA 2EKZA 1ZIOA 1ACJA 4N54A 1NVVR 4MPDA 1ENYA 3DAYA 3AEXA 4IIJF 4UTOA 4WZAB 3GQBA 1OLUB 5JPCA 3V5NA 2B34A 2Q2WA 3IJPA 3L1VA 3T5AA 4B73A 4EW1A 2NTYC 4N4AA 5TT1A 3OOEA 1QKJA 1LQTA 3BRQA 3KHSA 5CW2A 4UQPA 2XTNA 1T9AA 3FKQA 4C4YA 1DBVO 3OBIA 5DHQA 3U3MA 8ADHA 4TL9A 1G5PA 1E9DA 2IZ1A 4J16C 4FHZA 2BMFA 1G3QA 1X9IA 1AGXA 1DOZA 5L8VA 3RVQA 4PO1A 1XNJA 1JH8A 4PNHA 2JANA 3FOCA 3PPWA 1EVLA 3OSZA 4DQXA 3OFNA 1RHJA 2H1IA 2R6JA 2QSZA 3PC7A 4L8WB 4DBZA 4IIDA 1FRVA 1XMPA 4G23A 4P3XA 4ACAA 4YYZA 3REFA 3SCZA 2Z04A 1T4BA 4LK2A 1NN0A 3VH1A 4IP0A 3EXFB 2P0EA 3AF6A 3NOOA 1PGQA 4GOND 3T1TA 2VYFA 3LBHA 1K8RA 2ONYA 3WQHA 1NY5A 5YASA 2PT5A 3R20A 1UC8A 1UBUS 4JLUA 3TMKA 1XKTA 3ORQA 3VDQA 5LWQA 2XCUA 3EIHA 1DSSG 3KJXA 3QEOA 3MILA 4KOAA 4UE6A 4C7VA 1O94D 3VYTB 4CV2A 5KC8A 4UNNA 4ZO8A 4OU4A 2DGDA 3HZZA 2ZIEA 3UUFA 4RTQA 1H2AS 3EMDA 4QL3A 2PIAA 1A2KC 3LTEA 4FD2A 2X0KA 4DOMA 4DV6B 1C7IA 2YZ7A 2XQVA 3WGKA 2IS4A 1P9LA 1Y1KE 2YWEA 3L04A 2W22A 2ZJ6A 2C5FA 3AFIA 1XVLA 4Q1CA 3KEOA 2Q21A 4P82A 3IKVA 3UT5A 2GR9A 2Q3JA 1BGVA 3EODA 4MGZR 3UCFA 1R5OA 5H3LA 2YJZA 3EVDA 4R7GA 2D74A 2E1PA 2PQ6A 1TK9A 2OXCA 4LMAA 4O08A 3O0TA 5H5JA 1P5HA 2FUCA 2X7HA 4KYTA 1MV5A 2SNIE 3HB7A 4LV8B 5D1NA 3AETA 3M6MD 4U8GA 3SDBA 4BNKA 2VNJA 1NWCA 4E88A 1BDHA 1T6XA 1PR3A 1BC5A 5BR8B 1JUDA 3V97A 1M5TA 1RAEA 2IDJA 1J6UA 1MABB 2VA9A 4D74A 4TROA 1L7QA 4BPBA 4FHDA 3VC2A 4B7UA 1DZ3A 5KJ6A 1H65A 1AK9A 1SXGA 3C8MA 1HYBA 2NTNA 2ZI4A 2HCRA 4C03A 2IY9A 1X92A 2V3WA 4GLBA 5H81A 5CD9A 5I3ZA 3KB8A 1BEZA 3VX4A 3A14A 3WDKA 2HHAA 1M2HA 5ER6A 1QRRA 3HUUA 5BO5A 2DPHA 2YQZA 3IUMA 1TMGE 3S6JA 4PVCA 1QDUA 1QFZA 3DHYA 3QLVC 1UJCA 3R3WA 3N86A 2PKWA 4LRWA 4X8MA 3VH4A 2A9OA 4A5OA 1QP4A 2PDAA 4MI3A 2NSYA 1N92A 4EG5A 2ZS9A 1XXHE 1RBZA 3PEFA 3ESCA 4MYUA 3W6OA 1CP2A 4ENSA 3N0XA 3PQFA 2VT6A 3JYPA 3VZPA 4FN4A 3WQSB 5LQSA 3DMGA 3TLZA 1Y7HA 4CEJA 2ASVA 4DDKA 3QEJA 5LU8A 3QE4A 4IDHA 4JA0A 2YV3A 2ZWVA 4EL0A 4GPD1 1LS1A 4LMBA 3WOVA 4BVGA 4MLPA 4P08A 3D3WB 3OPNA 2JCSA 2J7KA 3RU9A 4Q1DA 5CT4A 2JBAA 3EAQA 3PC8A 2PRYA 5D7NA 5F51A 4RW0A 3VVMA 1GUFA 4YRQA 2WM8A 4IIUA 1Q0ZA 4C87A 3KAPA 2JGEA 4UTVA 2FLWA 1UINA 2AXQA 3R3UA 4GLLA 2DWOA 3P0JA 1CQXA 4FGKA 1CHDA 3KAJA 4ROSA 1XMJA 2X2EA 3RSZA 2XQGA 4HGOA 2YXNA 4BQQA 1ZJ6A 3QE3A 2X9QA 1XOIA 4MLCA 3LDFA 5GOTA 4F8YA 4FYWA 2A88A 1OBFO 2H2IA 3DXZA 5CA0B 5JZSA 2HA0A 3LYUA 1S2GA 4LRXA 5AVQA 4TYNA 4MS1B 3RFUA 1E2KA 4AWBA 2V45A 1FIUA 2VYQA 1FLNA 2PWYA 3EAGA 4K6KA 2AFHB 3GA0A 1Q1AA 1LDBA 3A7DA 3MGBA 4NCNA 1GGVA 3UGQA 2VHJA 2A57A 5DSXA 3PXBA 3A1NA 4K9MA 1C9KA 4TTVA 3EOBI 3JATB 5AK4A 1J2YA 1K68A 1RD4A 5IBQA 4C43A 2CVQA 4ETIA 4RLSA 2XMCA 5I9LA 1PP4A 4BJ6A 1E6LA 1A2QA 2CNNA 3FBTA 3MLEA 5TIIA 2ZU6A 5ALUA 5ILQA 2G1PA 2QZZA 1NU6A 1H5UA 5FFFA 2QN8A 3NMUF 2XNDA 2ATIA 1U0HC 2PS0A 4L8FA 2ZROA 4N5HX 2BM0A 4HDRB 5CDGA 1YBHA 3AH8A 4PWYA 2E9SA 2JGDB 3TAHA 3F3SA 2V9ZA 4JLNA 5DI3A 1XXLA 3LFUA 4IGEA 4KQFA 4DPMA 4UOEA 4RF5A 2E4VA 4WX2B 4C7OA 4O2AF 1E3TA 5JY1A 2JL1A 3P2EA 2ZRLA 3PHCA 4JLWA 5L95A 2B5OA 4A7PA 5KI6A 1ZKDA 1BWSA 1P1RA 3PGJA 2G83A 2JFYA 4GC5A 5COBA 3ZIUA 1YVDA 4M86A 3UJHA 2CL6X 4ABTA 5ULLA 2XJ9A 4M7WA 1KDYA 1XLUA 5IJXA 4HVLA 3SYKA 3FFAA 1I80A 1NT2A 3AUJB 4WERA 1V8ZA 1C7JA 1YOVA 5DK4A 4XD7D 4RTOA 3L1UA 3AEYA 1PJAA 4R8VA 2EP7A 1OPRA 2ES4A 1MJFA 2YWFA 1VKZA 1GSIA 4MUYA 1OUMA 3KPJA 5I9SA 3SF8B 4TSFA 3I5YA 2DPGA 4HGZA 2BT4A 5JCOA 4PS1A 3L6BA 1X7WA 3AI2A 4E5VA 1ESMA 4WGGA 2P30A 2ISQA 1UC4B 2FPLA 2L82A 2PZ8A 3EW7A 4REQA 2Y93A 3QBEA 3QH4A 4G5OA 1MX5A 1BGXT 1JR3A 2ZUSA 3DE3X 2B6NA 4MRSA 1KVSA 3SX0A 1L7RA 4Z7QB 4YT5A 5CBKA 3MINA 3WS7A 3EIQA 3G2OA 3T94A 2IS6A 1HDZA 1SR8A 3NR2A 1VKHA 3VYUB 3L8CA 4CHGA 4ZO6A 4EMUA 4FFPA 3E7DA 1U02A 2IU6A 4RS4A 1N5MA 1XNQB 3BWVA 4H7HA 1KO4A 2BGJA 2GFQA 3H6KA 5B6PA 1WMAA 2YZNA 1CS4C 2Q8PA 2IYPA 4MV8A 3QLUA 3THSA 1DS6A 1LI7A 1J2JA 1IXZA 5CHYA 3PRYA 3U56A 2GN4A 3O1IC 2V7XA 5LLTA 2HIGA 3L7KA 3Q12A 2GJSA 3PUVA 4WXMA 5BQPA 4GW3A 3ETGA 4RZUA 5DJ5A 1UJ2A 3ZWXA 3OJCA 4PLGA 1X9GA 2Q6VA 4YV7A 5A06A 4MHSA 1I01A 3WOHA 4QOJA 1V3TA 1LPPA 2GEVA 4NZ9A 1GPKA 3L4KA 1FDTA 3EXEB 4Q03A 4F56A 2FR1A 1OU4A 3K9CA 3AETB 2CLMB 2Q6KA 2G70A 1KYXA 2YFQA 4XWGA 4HQNA 4AKIA 4R2KA 4D7AA 2VUHB 4BZWA 2EIHA 2QX4A 1JHOA 2JGLA 4CM4A 4QLBA 1JQJC 5EXSA 4PLWA 5HZGA 5ALJA 4CMEA 4WY8A 1DBRA 1GFZA 3VKWA 1B6TA 1WDTA 2W9XA 1QDEA 5K9ZA 1YVEI 1RT9A 2NUTB 2R2AA 1W8IA 4KAAA 4Q4JA 5FUBA 4YAIA 4LOIA 2DZDA 1PEYA 1UPAA 2NUBA 3LXUX 3UXYA 2XTZA 2JHAA 3BEDA 1YS1X 3U60B 1YQXA 1CQIB 4IJ6A 4UAVA 3PCXA 5FBZA 3T7RA 4IICA 1AO0A 1UEJA 3T12A 4LWZA 1MVLA 2AJTA 3FD8A 1Y9ZA 2MSWA 3A1EA 2VDKB 2P35A 3OIDA 1IHYA 2CNKA 4IMPA 1Q15A 3DG9A 3QU2A 4PFQA 3R7NA 4TTAA 4HWGA 2EW2A 1K0UA 2WHPB 1XDGA 3Q15C 4LV5B 4ZQEA 4C7MA 4EIWA 5BV1A 1UBGA 2RONA 2AEJA 3W7BA 5A0VA 2X3UA 3KUDA 1UAYA 3A1WA 2XKBA 3FCOA 4X7BA 4C7JA 2VQEB 1EDZA 5T64A 3SNKA 3CTMA 3L0YA 4G0PA 2FTKE 4B4KA 2DBRA 4WKGA 1CUCA 5AI4A 2AOXA 2JVJA 2WMNB 3H4VA 3PQ2A 2X22A 1TD1A 2FEXA 4X7RA 2HF9A 4C4XA 1QFXA 4TM8A 2CT8A 1YR6A 2FU5C 2AUMA 1QXSA 2UYYA 5HMLA 4ZI3A 3L8EA 1U28C 1I4WA 1FJGB 2NYUA 1MAHA 3TMAA 2W2XA 5ADVA 1FSGA 3BOSA 3GEIA 1DAIA 1HV8A 2MYNA 3OAAA 2FWPA 1Z47A 3AVXA 3ZGOA 1QVAA 2FPPA 1OLUA 2Y6VA 4JLPA 3PPXA 3HEMA 3GDHA 4H0FA 3SHFA 2AFHE 2BMJA 3HHEA 2HMTA 3D2AA 1YBAA 3JARB 5L4LA 3P20A 3AY3A 3I6QA 3JQPA 4HQOA 2R1TB 2YHBA 3C3YA 4HADA 3BMOB 3OCZA 1U0JA 2YASA 4LJYA 4IJVA 3L7JA 3OG9A 5AOAA 3TZCA 1CEEA 4OL0A 1L5WA 1YR9A 3HXTA 1U11A 4N5DA 1G9TA 3VKGA 4RK7A 1Z5UA 2FQWA 2A4MA 2W6JD 1ABBA 4L6IA 1ZD8A 1ZUNA 5HF9A 5IBRA 3T54A 5JJKA 1ORVA 3RLIA 2RGGA 4HDSB 4GX1A 3CKYA 4PZ0A 5CXXA 2AWNA 2WOOA 4CEHB 2VLBA 4IXTA 3BICA 4KRFA 4XX1A 1ZS9A 5M3BA 2XQFA 4FMCF 3WGVA 3VAAA 4FOSA 3CGGA 4MS4B 3U3RA 2GK3A 4J03A 2ZAIA 4MR7A 3ZQ6A 4EBFA 5AM4A 1C4XA 5GINE 1E2BA 4I5DA 3IR7A 2G17A 4RSRA 2GXSA 3JRNA 3OM9A 4QVIA 2QI9C 3FSGA 3LP8A 1AKYA 2DU8A 2SECE 2X5XA 4DJEC 1B14A 2J9YB 2KBEA 4K3VA 3IV9A 5ED0A 4X3CA 4UCFA 3BXZA 1EQ2A 5CPFA 1BXKA 3LP6A 5BRNA 4WGFA 1Z18A 3E1GA 1KEZA 4F12A 4Y6LA 4ZN6A 1YB1A 2C3UA 4QXRA 4L7VA 5BQOA 3F3YA 1IY2A 3TW4A 4KIGA 1N0WA 4X62B 2Z6UA 4FMDF 1J21A 2XZOA 3FTQA 3SJ7A 2IS2A 2ACKA 4QBHA 4K6GA 3QKWA 2V6GA 5TPZD 1CUEA 1CUJA 2B8EA 2GCOA 3JRWA 3JQ8A 2NVUB 4R83A 4DCMA 3GRRA 3PEYA 1V35A 1YQTA 3DE0X 3CISA 4QJ4A 4B17A 3HP7A 4WZAE 1P17A 3KJIA 1MRNA 5IJ0A 4NOKA 2XBUA 3LKZA 1H3EA 3O47A 2TYSB 4Y6GB 3EGXA 1DBSA 1A9ZA 1VJGA 3RFCA 3U7EB 4E32A 4KH0A 2P9JA 4TS3A 1GPBA 4XWWA 5L3RA 4H6XA 5ECYA 1ZDMA 3Q2IA 4B6OA 5AD1A 2JGMA 3EDCA 2ZR9A 3DNFA 3L93A 3FW1A 3NCHA 4IVQA 1EXDA 1V1RB 2IXBA 3GBPA 2BFDA 1T1SA 3GX1A 4IHJF 4TSFD 1GCGA 4CL3A 4CGZA 2W0SA 2H5IA 2O2ZA 2OOKA 2H3EA 4IQ8A 1KS9A 4MVJG 5KU1A 3K9FC 3TZQA 3OETA 3MCAA 4KACA 1XRPA 1HRDA 3NUGA 1CJTC 4RQTA 3VJKA 4WUTA 3B7WA 1GGEA 4G07A 5HGJA 3OLXA 3OZTA 1XROA 3I32A 3MUNA 4J1TC 2AOUB 3KVYA 1IPHA 5IH7A 1M6EX 3FCYA 4IHAA 1EQUA 1I0LA 1JIIA 3MCVA 1FFEA 1QCDA 3LY7A 1W5FA 4BNDA 1EXWA 5B1HA 1SXJB 3MQFA 2X0EA 3I42A 2J0VA 2YWBA 4DW8A 5JRJA 1NLYA 4YFYA 1KQGA 1HE2A 2RGRA 1DKMA 3EXHA 3AM1A 2BAGA 2II6A 4CMAA 1VKNA 1WE2A 3I01A 2GN1A 3TGPA 4MRRA 1IL0A 1YASA 3BC1A 1FB5A 4KFSA 2CBGA 2BGMA 2F1JA 3A28A 3RF7A 1U6IA 5CVUA 1FLVA 4DWVA 1YRBA 2PXAA 3K8ZA 4Q00A 1I5OA 1IJEA 5FB3A 3TSAA 1Y6JA 2ZB4A 3N76A 1ZESA 5M5BA 3FUUA 1BDMA 1XTKA 2DE0X 3E81A 3K6KA 2NO7A 3WBJA 4F71A 2QN3A 2V9CA 4AUNA 2QIOA 5DHRA 4UUAA 1NOKA 3BK1A 1YV9A 1M2GA 1ZJ4A 1ZUNB 3H5AA 2DPXA 3DOOA 4FZRA 2PUWA 3EUEA 3GJ4A 2EL7A 1DDIA 1L6IA 3G17A 2FP4B 3OMWA 3OPYA 2BM8A 3U40A 1L9XA 2I2FA 4BWFB 4GE0A 3AW9A 4Y7DA 4JYCA 2I4NA 3JD1A 4NJOA 3VR4H 5DNUA 4ZEOA 1Q50A 1I6WA 3RLFA 2RIPA 3PE3A 1Y37A 4RADA 5FUXA 1TCBA 4D82A 5G0TA 4BAZA 4HO1X 3QKSA 4DT1A 3GNSA 1M2EA 5BUCA 1FNNA 4G0ZA 2GRJA 2QWXA 3D3NA 4HPXB 3DPIA 4RJLA 5AIBA 1Z06A 1Q7CA 1VJ1A 3VTKA 3FROA 4KQGA 5IFLA 2O8EB 1RPAA 1U0BB 3MAJA 4ARAA 4HQ0A 3CLSD 4DRXA 1TJ4A 5IYZB 5KX5B 3IT1A 3FGPA 4XR9A 2ZP1A 1Z08A 1ZZEA 3K94A 1W93A 3BTVA 1YAHA 1YIAA 4YJGA 1MGPA 2APJA 2VHWA 4MLZA 2P3LA 3ZCQA 4D45A 2LXNA 3HJFA 3K30A 3P9CA 2IF2A 5CVCA 5BQFA 1UR5A 3USES 4XWAA 4BQRA 1UFVA 2IPNA 1TLTA 1B0PA 3QE2A 3EPLA 4LX8A 1IPEA 2X8AA 4XUCA 4E70A 2B37A 1G2IA 3GLKA 3W2EA 3QY9A 3T9DA 3V4SA 3PNOA 5AW5A 2RB4A 3R6LA 3D7MA 1K5DA 3DOHA 3PJEA 3HKDB 5AI5A 5LYJB 4MS3B 1P9WA 4EKNB 3GHYA 4NABA 4YGYA 5EJGA 5FAKA 8AT1A 1W9MA 1XEXB 3HFSA 4PSAA 4UEWA 4EAAA 3TUJC 3O95A 1I7QB 3EC1A 2AMYA 3QX3A 1QH9A 1Z5OA 1E0DA 5IZ4A 2YWDA 4XLTA 4WADA 1I10A 1YJCA 2MR5A 4FWIB 2O2XA 1W0JA 4RVDA 4QXQA 4QRDA 4WXRA 3ME5A 4RDXA 1ZH4A 1GNLA 3K8OE 4WLUA 2PD6A 1G2PA 1J4AA 5IEJA 1OLXB 2EKLA 4FFBB 5KOJB 4K9SA 5KINB 3T4PA 2RE8A 5CLIA 1RIIA 1KMMA 1ULBA 4ZKDA 1EX6A 1YZKA 1YCGA 5CTAA 3EZXA 1WW2A 1UBKS 3WIBA 5E7MA 4YACA 4MIKA 5L3VA 4JFAA 4M2LA 3QP9A 4D0SA 3FOEC 5I48A 1YZLA 4LYEA 2E37A 4C21A 1EEXB 4D3XA 3O8DA 4QNMA 5LJLA 1OXMA 3MTGA 3VR6H 1T26A 2QLLA 4FBMA 2J5RA 4WLNA 4RVUA 4ENWA 5JXWA 3BERA 3FOFC 3EQ2A 4LYYA 3ZY5A 5IAOA 1KXJA 4A0HA 4Q4DA 4IW3B 3MUFA 5DMHA 2I3BA 1P2BA 4R3NA 4S1WA 1T8RA 4C0XA 4Y67A 13PKA 3PT9A 4HI0E 1SUEA 4G5RA 3FKJA 3ETCA 2FMKA 3LQ2A 3R23A 2R2GA 3SY8A 3FTDA 5B37A 4MV5A 3ECSA 4PYLA 4NDZA 5IDVA 1LNQA 2MINB 5AJHA 4UULA 2R1UA 1KFBB 2SKEA 3WISA 1JEEA 3KQYA 5EUCA 4DCSA 1ZN7A 4DLRA 4HWOA 2ZI3A 4BMYA 2IPAB 4DWWA 2I9KA 3JVIA 2C42A 3OJEA 2E6KA 1QIDA 4IILA 1DQRA 4MVJM 3RTAA 5MFPA 2ECQA 4ID3A 2WTMA 4JBYA 2H48A 4L5CA 2AN4A 2OD7A 3DMHA 5D3ZA 3AXSA 3EUWA 2FA9A 4G8JA 3GN1A 1AGRA 1RJGA 2RFLA 4H17A 2WM2A 3DVAB 4B3RB 2WT9A 3HLYA 1NASA 3PC3A 1ECLA 4RVSA 4ENTA 2CB0A 4FBGA 5JFOA 2NO4A 4QD3A 4ZO7A 1ODIA 2GF9A 3H4TA 2PKQP 4KK4A 4S0XA 3SOZA 3ZZTA 4ED9A 3GPIA 4JASB 1YVPA 2OGWA 2B9VA 1EVEA 1GR1A 1J97A 5L3QA 2G0TA 4GSYA 5F33A 1SA0A 2PKXA 2W2QA 3W8EA 2I55A 4PG4A 2W00A 1T4MA 1ILEA 3I62A 3WMRA 4U7PB 3AUSA 1K88A 4JK3A 5BMVF 6GPBA 1EGMB 1G20B 1ECFA 3EGDA 2PGXA 5AW8A 1IXSB 4L0MA 3WB1A 6NULA 1JR2A 3A06A 3DWGA 4GRAA 1EXMA 3YASA 4KXNA 4BNUA 2W2OA 3EY9A 5EJ2A 2GO1A 5FBLB 2PY6A 4IKEA 3E7WA 3D7SA 1UIMA 4S2EA 3J81A 3TTXA 1TIPA 2E4XA 1QVWA 4Z6KA 2ZBEA 3SD7A 3WLQA 5IDQA 4MINA 1W88A 4IJ5A 4DB4A 4RF2A 1R4MB 1LI5A 5K8CA 1P8JA 4RHCA 3RTCA 4HV4A 1WY7A 1K8ZB 4RC9A 3VR5D 5HW0A 3C3WA 5I8ZA 4DA0A 1VCOA 4R1NA 1OWOA 3WRXC 1RI2A 2PU5A 3IBCA 2OORA 2PGIA 3QU5A 1BS1A 2FSGA 4BN5A 3RRXA 4BP9A 5HNKA 4J90A 2GNPA 3FA2A 1U6KA 4N6OA 4YHBA 4QBIA 1CZOA 4CMKA 2VT7A 4Q3NA 1OJ7A 1WVMA 2A30A 1TKCA 2GBLC 3LHKA 1NF2A 4QUAA 5IBPA 5LR6A 3NUZA 2X42A 3QFRA 4TS4A 4XSGA 4P86A 3SICE 2IYOA 3QPVA 4EVIA 3KQVA 4P33A 1GPYA 4DMHA 5B6IA 1H3NA 1E1DA 3ESDA 4GOOD 2YHAA 3WRYC 5AKIA 1T2VA 3DOFA 2VP6A 4EM6A 2AVNA 4J7UA 4A8PA 1GUZA 4DDTA 2BONA 1TZMA 1T6NA 2J9XB 3R3ZA 4Y6PA 5DLPA 4OM7A 4CMJA 4DIKA 5HKOA 1JKIA 1HMPA 1Z0AA 4QFMA 2MSKA 2BBTA 3DAHA 3RTDA 2EW8A 2EX1A 3UAZA 2XGGA 2FPIB 3QYPA 4HXGA 1JKXA 1GWNA 1QRSA 3L6EA 5G02A 1ZN9A 1QKKA 5CB0A 4OSEA 4V03A 3FDIA 1VHQA 1IQRA 3RBAA 4BU1A 3OX2A 4TTRA 2V7EA 2Q1WA 1ZK3A 2HWYA 2NTEA 2RAUA 2WHRA 2X5JO 4EVQA 1Q3HA 1SQFA 3ZC3A 1VHWA 2BEWA 3CIFA 4YRNA 3PD7A 1QVVA 4GQBA 2GEKA 2MOKA 1W85A 1DELA 2AYZA 1IM8A 1UJ5A 2IEYA 2Z8YM 4JSRA 3LKVA 4IH1A 2JVKA 2V7QA 4XOIA 3RC9A 3RWOA 4FFVA 4C0WA 5JTTA 4N3NA 5KWIA 4KPGA 4DAOA 2B4RO