2OC9A

Crystal structure of human purine nucleoside phosphorylase mutant h257g with imm-h
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
284
structure length
278
Chain Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANGEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neighboring Group Participation in the Transition State of Human Purine Nucleoside Phosphorylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 84
structure length 278
sequence length 284
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oc9A00
4OY3A 1C3XA 4DA8A 2HN9A 2QTGA 1A9OA 1YQUA 1NC3A 4LNHA 1U1FA 3OPVA 1T8YA 3FB1A 4EB8A 3DP9A 4TTIA 2A8YA 2AI3A 4E1VA 1Q1GA 1LVUA 1Z5PA 4L0MA 3OZCA 1A9QA 3FAZA 1OTYA 1YQQA 4UC0A 2ISCA 3E9ZA 3OOHA 3PNPA 1RXYA 4QAQA 1B8OA 4K6OA 4QASA 3LBAA 1PR4A 4DA7A 3ENZA 3FNQA 1A69A 1N3IA 1V45E 2I8AA 3OZEA 4YJKA 3UAYA 2HRDA 4I2VA 1JE0A 3UAWA 5KB3A 4YNBA 2OXFA 4M3NA 4YMLA 5CXSA 3BL6A 1ECPA 1XE3A 5F77A 4RJ2A 4BN0A 3PNSA 1RSZA 3NM6B 4MARA 4F2PA 1PR1A 4F3CA 1VHJA 4DANA 5F7OA 4G8JA 1NW4A 3DPSA 2A0XA 4BMYA 5F7JA 4LZWA 3EEIA 1A9TA 2PGAA 1RXCA 1M73E 3BGSA 1YR3A 2AI2A 1JDSA 1TCVA 5CYGA 1V4NA 3K8QA 3KHSA 1OTXA 1Y1SA 3GGSA 4ECEA 1T0UA 1RXUA 4L5CA 3KUKA 4LDNA 3INYA 4QARA 1Z5NA 2QDKA 1V41E 1Z5OA 3OCCA 1VMKA 4PR3A 4TTAA 5CCDA 4WKBA 4OGKA 4OEHA 1SJ9A 3D1VA 1U1EA 1PBNA 1Z39A 4WKNA 1RT9A 2RJ3A 1Y1QA 5B7NA 2B94A 2XRFA 4GMHA 5EFOA 1VHWA 4QFBA 3UT6A 1SQ6A 4D9HA 3PHBE 4JOSA 1JE1A 5EPUA 5EUBA 4M1EA 2BSXA 5I3CA 4DARA 3KVRA 1LX7A 3U40A 2AI1A 4GKAA 2Q7OE 5FAKA 4GLFA 1JP7A 4TTJA 4F1WA 3MB8A 4KN5A 2QSUA 1PR2A 4EARA 1B8NA 1RCTE 1NC1A 3IEXA 1YBFA 3BSFA 1PR6A 4F3KA 1PW7A 1OU4A 1ZOSA 2QPLA 1TGYA 3OF3A 4TXJA 4GLJA 3KVVA 4TXHA 2IQ5A 1Z37A 3O4VA 2I4TA 1V2HE 4IP0A 1T8SA 3TL6A 3UAXA 1SD1A 1RR6A 4DABA 1A9RA 4P54A 1TD1A 3NBQA 2OECA 5ETJA 1Z33A 1LV8A 3FOWA 1ODKA 1PK7A 1PR0A 4MCHA 5F7XA 4L5YA 1OUMA 4F2WA 1CG6A 4JP5A 2OC4A 5CCEA 3DDOA 1Z36A 1JPVA 4G41A 3KU4A 3LGSA 1K9SA 3C74A 3IOMA 2A0WA 4JWTA 1G2OA 3OOEA 4LKRA 4WKPA 4M7WA 5DK6A 3UAZA 5C80A 3P0FA 4WKCA 5K1ZA 3FUCA 4DAEA 3KVYA 1Y1RA 3BJEA 3SCZA 5CXQA 3ONVA 1U1CA 3LA8A 4L6IA 1TCUA 2HSWA 1JDZA 1JYSA 4QEZA 4DA6A 5JPCA 4H1TA 1JDUA 3OZDA 4D8VA 5IFKA 1Z35A 1JDTA 3EMVA 1SD2A 4NS1A 1PK9A 1ODIA 1V48A 4DA0A 1K3FA 5B7QA 4TXNA 1OV6A 3E0QA 1A9PA 1PWYE 4TS3A 4MCIA 3T94A 1RFGE 1PF7E 2GUWA 1QE5A 5F76A 4D98A 1RYZA 2AC7A 3GB9A 3DF9A 4TYMA 3QPBA 3ODGA 1PKEA 1U1DA 1Y1TA 1ULBA 4LNAA 1RXSA 1V3QE 4TS9A 3NM4A 4TXLA 2HWUA 3UAVA 5F73A 1WTAA 1PR5A 4NY1A 1ODJA 3PHCA 3O6VA 1VFNA 4R31A 2P4SA 1ODLA 2QTTA 4D8XA 3NM5A 2ON6A 1CB0A 1YRYE 4D8YA 1Z38A 1TGVA 3K8OE 4L5AA 5F78A 4PNPA 1K27A 1T8WA 1A9SA 4OJTA 4G89A 4NSNA 4OGLA 1FXUA 3DJFA 4WKOA 1OVGA 4DAOA 4TXMA 1T8RA 4YO8A 2OC9A 4OF4A 5B7GA 1Z34A 5CYFA 5IU6A 1JDVA 4QATA 1ZL2A 4BMZA 3MMSA 4R2XA 4U2KA 3P0EA 4X24A 2H8GA 2A0YA 4BMXA 1Y6RA 1ULAA 4R2WA 3F8WA 1I80A 3FWPA 5F7ZA 3EUFA 5B7PA 1U1GA 4FFSA 1Y6QA 3E9RA 3OZBA 3EUEA
chains in the Genus database with same CATH superfamily
1SA0B 2IHVA 3BXHA 3MQFA 5HJ5A 2PSJA 3JYHA 1LQTA 3NTVA 3T7RA 4PCAA 3STUA 4Y2SA 2JCSA 3TSAA 3KFLA 5KYTA 1SRQA 4I1OA 5DV9A 1BDJA 5LYJB 1W5EA 3CRZA 2ZSUA 5JBIA 1NQWA 5JASA 3U6KA 5KDDA 1OC4A 3IIEA 1DSSG 4PZYA 2NZUG 1E5LA 1TLTA 3JVIA 4RV4A 4Y2TA 4CBVA 1YFKA 1G20A 3DP7A 5ALMA 2AXEA 3U7QA 4ZQGA 1R00A 4ZVTA 2XOEA 2HREA 1YO6A 2FPPB 4G37A 4MV5A 4QPDA 2OENG 2I6SA 3EE6A 3SEQA 4F5ZA 1LVUA 1XZAA 1Z5PA 6Q21A 2NUPA 4LC0A 1Z0DA 5IWAB 1EUDB 2GEFA 4RD3A 1EX1A 3Q10A 5ALOA 1WSWA 2JI4A 2Y6VA 3K92A 4KQWA 3A4MA 3SFTA 3ZBTA 3I9FA 1ORDA 4CM6A 1FMJA 1QH8B 3DM9B 1MUUA 2ATVA 3SSAA 2BM0A 1BOOA 1HM5A 3E9ZA 4HNUA 5J4KA 4M46A 3AVUA 1EZ1A 1M8PA 2N9UA 2ZR7A 3LUCA 4HAXA 2OVBA 3G2IA 2FEAA 3JY6A 3QEKA 1C9NA 5ECYA 3PXGA 2Y1OA 1WZIA 3AY6A 1YOBA 4LWQA 3GUZA 1C4XA 4E6PA 4OATA 1RZRD 3G2PA 4DLLA 2JW5A 1KK0A 3WGVA 2P1DA 5FUQA 2P3OA 1WZ2A 1P81A 5HSGA 3H18A 3TZLA 3HO1A 3SXJA 3WLEA 1T8UA 5EZ5A 3E61A 2WAAA 4CL3A 4O0MA 4CNQA 4CTNA 2JLXA 2H2GA 5CFPA 3GRZA 1DBVO 1HLDA 3L7DA 5I8PA 1ID8A 5C32A 4KV7A 4DV0B 3OC0A 1SWWA 2EGGA 4X8MA 4E2WA 1JE0A 1JU4A 1Q0HA 2PJRA 4H3VA 2PX6A 3U5TA 3ZWVA 4K3UA 2YW2A 3K6SB 3AVQA 5IHXA 5K51A 4V03A 1ANKA 1UBLS 4LJSA 2F4NA 2EJBA 1T1IA 3DE7X 3TWOA 1DEXA 4BMOB 1M6EX 3ORFA 4NV1A 3TEMA 4NE9A 1WBJB 3F7MA 3K5PA 2F59A 2JLCA 4OHOA 4RJ2A 3WJAA 1SCAA 3FRIA 5ALKA 1HWYA 3LQ1A 1OWLA 3UT5A 2R751 1QFMA 5G40A 3WYCA 1AMUA 1T9BA 4JQSA 2IJGX 2IEIA 1MFZA 1I51A 1YQ9A 2OOSA 1SBYA 2QD1A 3NT4A 4MARA 1GZDA 4ABTA 2UUBB 2VWHA 2HLDA 1K68A 5LBIA 2ZJ6A 4P53A 1MIOB 1JT2A 3OZ7A 1JJ7A 4WUVA 3KC2A 2C2OA 3K8ZA 1Y0BA 1KORA 2G1JA 2QRJA 4IIHA 4XD7D 3UC9A 3V4FA 3WLKX 4BNYA 3QLEA 1T43A 1FS6A 2NO5A 3B12A 2ZE6A 3SN6A 1QH1B 1KY4A 4FZRA 3T5PA 2QTCA 4IF6A 5D6OA 1UZAA 5G2OA 3DC2A 3ICWA 1JSLA 3JQAD 1YCGA 2FRDC 1DG1G 1YVDA 3D2BA 3ESYA 1FFGA 3JZMA 5IBCA 5ILQA 3W6ZA 5HMLA 1RYHA 2OBBA 4CLEA 4WXPA 3VISA 4RDXA 1FSPA 2G07A 3LUJA 3SC2A 1M6HA 3DO6A 2IU6A 2NX2A 5HS6A 1SQSA 3HMKA 3DF7A 5IP5A 3VO1A 2CF6A 2E82A 3DL2A 3PT5A 3AM1A 2BPOA 3PL1A 3OLYA 1GR1A 3HY3A 3GIDA 5ERXA 2RHJA 2VYVD 1E5DA 4LXHA 3CLVA 2ZIVB 2ZULA 3GRAA 3VBEA 4AKHA 1RZRA 2IIVA 2C3PA 1N0VC 4AZ0A 4O2AA 2E1RA 1JX6A 2ZQZA 4PGHA 4Z5XA 2JGFA 1AUVA 2OV4A 4IIXA 1J0EA 1V8ZA 2RAUA 3AUFA 5JI3E 1EGVB 1XYYA 4TOIA 2C4VA 3H0KA 2FJUA 2PBRA 3NUZA 1IMJA 1YAHA 2IZ7A 5DYIA 3MOSA 4IXMA 3CPHA 3NLLA 5DTQA 1A2QA 2PM8A 3OZRA 4O2BF 3EHEA 4KK4A 5ALJA 5DOZA 3H7IA 3SGLA 3TNYA 3VPGA 2YY5A 3M1YA 4JVLA 4WKBA 1QOPB 2ZUEA 3ASUA 1B2LA 4U7FA 3GJZA 3L06A 4DR4B 1OA0A 1VL1A 1Y1PA 3HDVA 3HXKA 3Q3IA 3FF4A 5JYEA 1Q0UA 3O03A 3L0SA 3MLEA 4OHUA 1NN5A 3HRIA 3UCFA 3KOOA 4PZ0A 2HCJB 1GCUA 1PL7A 5CDYA 4JT4A 5FPKA 2WQZA 3SFZA 2RJ3A 2Z56A 2OBLA 4LY9A 3IBFA 2I3GA 2HW8A 4HR7A 3ET5A 2KMLA 3E9DA 2XUQA 2AZ4A 1K8ZB 1ESEA 3N59A 4UMEA 5SV2A 3RU9A 3T7DA 2BRUC 4CRWB 1ULZA 1VHWA 4Q3KA 4C4TA 2JFPA 5LSAA 1Z4KA 2DHRA 1X38A 4QD3A 1NTRA 4BO4A 2EX4A 2ZGVA 5EJ9A 1WVMA 5A3RA 5K0EA 2EDAA 3C6ZA 1E1RA 2O1XA 4HZGA 1NRXA 4CMKA 1ZMBA 2FZ4A 4BX9A 1Q0QA 5KPDA 4ENQA 4OHRA 5ALWA 4L5JA 1TF5A 2NNLD 3QWHA 3WAKA 3SDBA 1CJUC 2FZLA 1J8YF 3PICA 5LOVB 1YMUA 3RFFA 2H2IA 3LJKA 2JCBA 4HX9A 1E2GA 2IHBA 2VP3A 4WZAA 5EHGA 5LWQA 5FQNA 4QZVA 4JL5A 1L7NA 1V37A 3M82A 4JIMA 4K9KA 3PXXA 1Z0KA 2WILA 1R0CA 3CLTD 2EJCA 3HKDA 4RPLA 4YT4A 3KKLA 2WJHA 3DO5A 3UWSA 1DGQA 4RO0A 3KYDA 4H7EA 2Y1LA 1PJ4A 3Q7TA 1Z4PX 3ITKA 3C3XA 3NKLA 4K1LA 2H4JA 1WXHA 4KN5A 4NS4A 4ILKA 3P8ZA 3ONDA 5H3CA 5AVVA 4M89A 1HNXB 3DCYA 5BR8B 2H7CA 2V9CA 3KYBA 1LEHA 4E08A 1UM9A 1GIAA 2ZU0C 2PEYA 5HQ3A 4UNPA 1YK1A 1SCUA 3OJCA 1WDTA 5JJCA 3PWTA 1S02A 1Z2PX 2AEMA 2BW0A 2N1MA 4R0NA 4MI9A 3GK3A 4Z2AA 5K0TA 3PGA1 3CO0S 3C3DA 4UNQA 2CFRA 1Y7LA 3EZFA 3PUYA 4NJEB 4X63A 4D4JA 4TTVA 2OD7A 4RHEA 2OO5C 1MX1A 4LHEA 3BXZA 4QICA 4Z0NA 3E05A 1COZA 1G55A 3HDGA 3O8DA 2DQ4A 4PQYA 2PNJA 3TQRA 2IYFA 3HP7A 3IDZA 5BQ5A 1RCFA 4UPEA 3W78A 5B1YA 1EFLA 2JAWA 1YKFA 3NTLA 1IBKB 1NVKA 1D3AA 5FL3A 3HKBB 3RROA 2YZNA 3F97A 4AKEA 5EE3A 3R9XB 2CLIB 3E9CA 4PNEA 4O2RA 1KSHA 4AO6A 1VRWA 2VNJA 4GFDA 1FRFS 3KSZO 3HZHA 2XODA 4ZC1A 1RR6A 3OCJA 1BXRB 3CJRA 4MUYA 3TQCA 1K5DA 4TV9F 4LJLA 5IBRA 1Q83A 2PT6A 4RA9A 1NIPA 2W2QA 3PDUA 2ZBFA 1V4BA 3SPXA 3WLJA 4MV7A 2NQ8A 4B35A 2V0GA 4QXRA 1Q74A 3OQ1A 2Q6VA 4Y9SA 1EGHA 4CNBA 3JAMA 4BGIA 1MN6A 1EVEA 4BC1A 2JGLA 4GEKA 3IHTA 1CFJA 3D8RA 3WWDA 2X3YA 5TGTA 1CG6A 4JCOA 4NAHA 2XYGA 3IRVA 4NARA 2W6CX 2ECQA 3S1AB 4RTMA 4DGSA 1GAQA 5HDBB 1BYIA 1RRKA 3MSCA 2X0RA 1Z29A 3IOMA 1YRLA 5ADWA 3E48A 3LC0A 3K53A 3TNDA 1UFOA 3P45A 3K7EA 1DKPA 2MYTA 3THWA 2Q62A 3W8FA 1KARA 1KU0A 4G0YA 3AQ4A 4D3ZA 2Z9DA 1RNLA 3DG9A 3QLTA 2VNKA 2FEMA 3GOQA 1CUFA 3GCDA 3LKVA 4FB5A 3R6WA 3E7XA 4PRKA 1LBHA 2ZYGA 4PBRA 3W1EA 1N6IA 2C31A 3A7DA 3C43A 4MUKA 1DKQA 1MB4A 3RJTA 1SAYA 3PFBA 1U1CA 4NYJQ 3EIUA 3L9XA 1T5TA 4LV5B 4OU5A 4ZAGA 1ONOA 1N0WA 1T5LA 9LDBA 1B6GA 2IZ5A 2BHTA 4M1TA 3X1DA 4O63O 5HF5A 4YRMA 4GT1A 4PTLA 1IHYA 2BUCA 3FPAA 3WS7A 3ZGLA 1EFKA 4OJMX 5LFAA 2AFIA 3DTVA 2I78A 2GXSA 1D04A 4TMXA 1OYWA 2AQ8A 1Z0AA 4PGFA 3L5KA 1NVFA 4C01A 3TOVA 3TD6A 1IAQA 2P67A 3NH6A 4NS1A 1XV5A 1U99A 2I6XA 1QC5A 4YCMA 1G8PA 3T7TA 2DBVO 2FNAA 3C98A 1VFPA 4HLCA 2P3QA 2X5OA 3B36A 1OV6A 1GA1A 2C07A 5ED0A 3PDIB 4ZEVA 4FDLA 1A98A 1U5BB 1ZJ6A 3OPYI 3RC2A 1E69A 4YMHA 5K6AA 1Y9JA 3B9QA 4Q37A 1VMEA 4FNAA 4BCDA 5BOSB 3VR5D 2WWYA 2YJ4A 2FB9A 1S5PA 1ZNWA 1C81A 4L72A 3TSOA 2JRCA 1R16A 2MTBA 4R1TA 3VXKA 4D98A 2WTEA 4PG6A 1X87A 2QLNA 4ATNA 2RKOA 1LV7A 4KQ1A 1RQPA 3HFRA 3NGXA 2I2BA 2Z5LA 3LTEA 4PEVA 1DB3A 3N86A 2WA1A 2PMFA 5DHPA 3W9YA 3ZQJA 4XPZA 5DN6A 1Q14A 2WJAA 2CVPA 3T99A 1MJFA 4DV1B 4D9NA 1GNSA 4YN3A 1BEUB 4L5IA 3S2FA 2CUKA 5A7FA 4ZAVA 1FRVA 1V5GA 1KL7A 1D5CA 3R6GA 1GG2A 2R4TA 5CX4A 4D9MA 4OI4A 2IF0A 2IXTA 2SHKA 1L7VC 1Y8AA 2H1FA 3DUWA 3CG0A 3HYCA 4ZO9A 4B83A 5LQNA 2Y0EA 4ZQIA 4A5SA 1NF2A 2ORIA 1N77A 3AVYA 3FSGA 4MULA 1I4EB 1D8AA 2O7VA 5JMOA 6GPBA 3ADBA 2PLNA 3W5HA 1YVUA 3P2JA 4RC9A 3X1XA 5DN6D 3T15A 4KHZA 4A0FA 4HEA6 3C5CA 3KTDA 5KAPA 2E85A 3VR5H 3WNBA 3FOFC 3LVFO 5NULA 5JZMA 5CUQA 1QIGA 4DM3A 5G3YA 3HY4A 5K3CA 1CY0A 1CQPA 2VSFA 5B2EA 1SA0A 2QGFA 3A70A 2HJWA 2C20A 4RZ2A 4DZRA 3RK1A 1CHNA 2BUAA 3PA8A 1RP1A 1UBTS 4YRBA 3U7IA 4NPHA 4MCAA 4YO7A 2IS2A 4E5MA 3F5DA 4JKOA 3SR4A 3BMQA 2WYWA 3GZTB 1A27A 4HRVA 1RXWA 4ZO6A 4P6VF 3VPHA 1DIRA 5CDFE 2QUAA 1KGSA 5JLAA 3B5JA 5JZSA 2WG0A 2F17A 5JS2A 2WZDA 3ETEA 1DG3A 1L5KA 4QWMA 1KJNA 5CNIA 5B1HA 1PSDA 2JFZA 2I7DA 3SYTA 1GZ3A 1ZISA 2QN2A 3MYRA 4UTPA 1NIJA 3PIRA 1LRLA 5E6SA 4M76B 1ZGCA 3VX4A 4JR2A 1VIAA 4QXQA 3IO3A 5AKGA 5L51A 3VAYA 1GZ5A 2NZWA 1T4CB 4EW1A 3JQ7B 3AZOA 1U3VA 2AFIB 4DAOA 3I05A 3OIYA 5KMGA 2RGCA 1GRNA 3GH3A 5ISMA 1G5TA 3RYIB 2XECA 3ADPA 4YONB 2O59A 1H1LB 4WOKA 3K0AB 4YAWA 1B1AA 1K8XB 4AKSA 3KUUA 1NU6A 5JVDA 4FFRA 4YJHA 1ITZA 3JD3A 3NB0A 3IUSA 4B80A 1GFZA 1BSVA 4C4RA 1ZN2A 2CMHA 3SS7X 4BWGA 2OHIA 3L1IA 1EP2B 3PV0A 4GLOA 4LBWA 5C1PA 1YL7A 2GUGA 1E1KA 2LCQA 1ZGZA 1NI4B 4PLWA 2C2KA 3WBJA 5I5EA 1GYRA 3FM9A 3R5FA 4U2KA 4Y2UA 5BN3A 3DTYA 2G28A 3MS4A 3DOHA 4LDJA 4LXIA 5DN9A 4ZI7A 4LWZA 1DI0A 2JK1A 4BMDA 4KGVA 5KIAA 2VSYA 5EG5A 1RABA 4JI3B 3BFJA 4JDPA 4IOLA 3ZD6A 1OFIA 4K9MA 1HETA 3AR7A 3RT9A 5KYWB 2Z30A 3LQ4A 3RUCA 4ZICA 2HJHA 2WKPA 1H22A 3TMKA 1CYEA 4JB0A 4LUCA 3RAEC 4CMCA 5J2UA 1O8BA 3IEIA 3SS8A 1ZR4A 1QYDA 2J7KA 1NV8A 4MO2A 4RY0A 1E1QD 1Y37A 2A9VA 2VPWA 3PRJA 3BMXA 2XQVA 2A5JA 2AHOA 4DB2A 2G1KA 2COUA 2O7SA 1VLQA 1G17A 1RWNA 4DR7B 1FJ2A 3EFBA 1DC7A 3DZBA 3GVHA 1NAIA 3GUVA 4U7TB 4UHBA 1PNOA 2OZLA 3VHRA 3KJQA 1RACA 4IW3B 4PICA 5GY7A 2VHCA 4WQMA 5ALDA 3DTTA 2FW1A 3I5MA 2HI0A 2A1IA 2WYOA 4U00A 2HYDA 3SZOA 3T3IA 3WLAA 1ONNA 2Q49A 2ZROA 3IAM6 2EWMA 1CIPA 1QS0A 3H2HA 3ILYA 4B3HA 2HRCA 1YQUA 3DAHA 3PD1A 3Q2IA 4TM7A 2WT4A 5LZ8A 3SC4A 4C06A 2BFBB 1Z3IX 3BKXA 3D4IA 4JBWA 2GVNA 5TF4A 4MQ5A 3TE7A 4CUZA 4XIJA 3WGJA 5ADVA 1EDBA 4M9SA 1IN5A 2V7PA 2OUKA 4Q4HB 2PIDA 3VSEA 4V2IA 4X7MA 3JAWA 3SSMA 2P9BA 3GPBA 4NKRA 1XROA 5TGZA 3UT0A 1E5QA 2QZJA 3GIWA 4I9NA 4BVEA 3NFYA 2R5NA 4FS8A 4E33A 3P2OA 1MOQA 1KK2A 1W2WB 4MVJP 5MF6A 2J3MA 4RF2A 5FB3A 1UJ2A 4PR0A 2P6PA 1UKBA 4FT2A 4WINA 3ESQA 1TCAA 3PNBA 1W1IA 4Y2HA 3OOHA 1J39A 4P8RA 3NIFB 1PEYA 3H4IA 4EAQA 4H0FA 1YS1X 1Q3TA 1L8XA 3L92A 4MQEA 3QX9A 5HOEA 5DYNA 2L17A 2H2AA 3N3AC 1L9XA 2FWAA 3MPOA 4MUFA 4YA6A 1XZDA 1TI7A 1BMQA 2EKLA 2OBMA 4M4SA 4DA7A 4IMPA 2W5UA 3Q6MA 3BBLA 2FUNB 2EVWX 4C3ZA 1N36B 2INGX 3QUSA 1CC1S 1GPUA 4RVHA 4ZU6X 4YVFA 3U3OA 5BT8A 5CBKA 1GV0A 3VJLA 1GSIA 3FE2A 2JBWA 4MB6A 2A84A 2G6BA 2AD1A 3I58A 3T0FA 4PSCA 3QFFA 1KI6B 2OCLA 4FYWA 2QGZA 4MLCA 3H75A 4X92A 4HP8A 5D5QA 1C7IA 2F9LA 1XAHA 2QS9A 2WWXA 5KB3A 5K8JB 3IPLA 1GVHA 4YMLA 1PEDA 4BO8A 2N47A 2HCRA 4NMWA 4XARA 1QWSA 4JYCA 4R4JA 2RGNC 5AXDA 2DECA 2A9QA 3M5WA 4IV8A 4PHTA 1QANA 1Z5UA 3O5AA 1FBTA 2H2HA 4TUYA 4J75A 1FNMA 2OFXA 3EODA 1E3IA 5HJEA 2JJ8A 1WPQA 1ZNYA 3ZCTA 3EZ7A 3FH0A 4DTCA 1XZPA 1X80B 4UATA 4X85A 5B12A 1R88A 4IIJB 1AUXA 1MORA 1T24A 2NVOA 3CZ5A 3D0QA 3JATB 4QYIB 5G0TA 1KI7A 1I36A 3OESA 3NEYA 2CGEA 3TLYA 3K16A 1UEJA 1U0EA 3AH8A 5D3ZA 2PGNA 2WB2A 3L84A 3CYFA 1DWPA 1PFKA 4EF4A 5KNDA 4L4ZA 3WLMA 2R7LA 3TRJA 2Q1UA 3SSNA 1ORTA 1QB8A 2VP6A 2WWTA 4PLPA 1QIDA 5DX0A 4JZYA 3U1BA 2IYTA 2WM2A 1PJQA 1X7YA 4ZI5A 3LW7A 5FRDA 3A6ZA 2G4CA 3SR3A 4Z8YA 1M76A 2NUAB 3WNDA 4DUGA 4LOJA 3BMNA 1WU7A 4P3OA 1OI7A 3KQWA 1LFDB 4MHOA 4OHCA 5AVSA 3HFJA 3TFOA 3ZWWA 4KVGA 4UZFA 4AS3A 4W9NC 3PS9A 4LY0A 2PAFA 3IEUA 2P91A 2PVCA 2XWBF 3MWEB 3RHFA 1NG1A 4LFCB 1V4NA 3WRWA 1P0QA 4J07A 4CKBA 1ZUNB 5A9SB 2O8NA 1AKWA 5AW2A 1S2NA 2V7GA 2YIDA 1JAHA 2ODTX 1YS4A 5I9IA 3BE4A 1L3BA 5HYVA 1ZITA 1W36D 3INTA 2J5BA 2QRPA 3EVDA 4DLAA 4HGYA 4QBKA 2YXEA 3IP6A 2OHHA 1T0UA 3G3EA 5DK4A 2I22A 2Y9PB 3CVVA 1H5UA 1O6CA 2G1UA 1UL1X 2PAAA 2ZSFA 4L5CA 4OBEA 4RQTA 3B3AA 4QO8A 1KH2A 3GRCA 2QT0A 1DJLA 4LJ5A 3SJZA 4BNWA 2FQ1A 1EP3B 1YIOA 5IUKC 1NTOA 1YCHA 3H5VA 4Q00A 4EIWA 2VQEB 1JDJA 2QW1A 1O97C 4HX5A 1SGWA 1PWZA 3THSA 3V97A 2OKGA 1CJMA 1JG1A 3I9V1 1SXJD 1VMKA 2B3TA 3OICA 4KTTE 4LMAA 2LW7A 4BNNA 4DRXA 4EVRA 5IEJA 2RCNA 4OGKA 1KMHA 1DOHA 3I2FA 4OYLA 1ZXXA 4U2DA 4YV7A 1LJUA 4G01B 3C0KA 4AT1A 4U5XA 2WZCA 4UDYX 2FKAA 4INZA 5LNK6 3QP9A 1U2ZA 1WEHA 5IT0A 1OCEA 1AUPA 1M74A 4MP6A 4OVKA 4N8DA 1SKMA 1E0KA 3Q0EA 1V7PC 2O7RA 3QYAA 2QM8A 5ENDA 5J4VA 2IE0A 3G0CA 1E96A 1AKUA 3W3AH 2ZYVX 3KBOA 5FR1A 2C4TA 3ZG6A 5KCMA 4ZT4A 5FNVF 3K35A 4CMAA 4D9FA 4FEAA 2JJ2A 4URWR 2EYUA 3RE1A 1LDMA 1SUEA 4H9GA 1V26A 1MD9A 1WDWB 3PNYA 4UFNA 1UEXC 1H69A 4JR0A 2PUFA 1U0TA 1XTJA 4RGVA 1PW5A 3W9UA 2IH5A 1YULA 2RAVA 1ZCJA 3LQKA 2A5GA 3PXBA 3FDFA 3O93A 2K87A 1U6JA 2Y1KA 4YMGA 2BFFA 4OXRA 1NP6A 3NC4A 2OPHA 4F11A 1GDTA 2HEIA 2Z09A 3IJPA 4GVXA 5H9VA 5C4GB 1FJXA 1VJCA 1ONSA 3LMKA 3FKQA 4CQMB 4M0UA 3SYRA 3U80A 2PX8A 3HJGA 2O3JA 3OFJA 1UZLA 1OYOA 1XXHB 2PCLA 4YUVA 2UYGA 2ZT5A 4K8OA 1UDAA 2WFZA 1YVPA 4D8TA 3EGCA 2F62A 2P4QA 3M6WA 4FHZA 3T5MA 1SM4A 2X86A 3DT8A 7AT1A 2C7QA 5AUOB 1N57A 5E6UB 3W3AD 4WCDA 4GXQA 1IIRA 1HL7A 4U8GA 1ESNA 3QYJA 2EFGA 4RK1A 4WUTA 3WGOA 3ZHBA 1H2AS 1SHJA 4Y9TA 5HILA 3UJNA 1A9XA 3UJCA 4DIOA 1HG1A 1YJBA 1Y8ZA 3N1UA 4NWIA 1YJQA 1TZBA 1EVLA 2AMFA 2B21A 3NT2A 3T61A 4N82A 3TKYA 5LP6F 1NR1A 3KKOA 3MCTA 2VT2A 3NALA 1DHRA 4F7DA 1G3RA 4N65A 2DR2A 3TQIA 1N7IA 4K6FA 5AXAA 1GKKA 1GU0A 2HMTA 3BEOA 4Z9AA 3UTCA 5A6SA 1FXSA 2H3HA 3F1LA 3Q85A 4PX2A 3K72B 5AKYA 5EXEA 1O77A 4Q3EA 3FMVA 4FB4A 1R9NA 2ZTMA 4LK2A 4Q1BA 4FONA 4BQNA 3U9TA 2VP0A 1C3OA 2B8JA 3KHTA 4IH9A 2HMVA 3I6IA 5GIOE 1C0EA 2PL9A 2O4CA 5MDHA 2IW1A 1FDRA 3WL5A 1MXHA 2AN1A 2HLDD 4IUCS 3RS5A 1CVIA 4DXDA 5EXTA 2NAFA 3HMQA 2IS4A 2XRYA 4KUEA 4WGGA 1F8XA 1N7JA 3GLTA 1ULSA 1XMJA 4R3WA 3O7WA 1QP0A 1V2HE 2EQ5A 2J9FB 1JXOA 2K7ZA 4KPUA 1AA6A 5T8KA 1L6RA 1UBRS 3PEYA 4QGAA 1DP4A 3R3JA 3H5LA 2ZK7A 3FLBA 1ODSA 1IOWA 5CJJA 5DTJA 5IDYA 4AZ3B 4C22A 2Z6VA 1RI4A 5ETJA 4QRIA 3UUEA 4DG8A 1Z33A 4ZTUB 4KDCA 4M60A 2XHEA 1UCFA 3GI1A 1TM7E 4OX9Y 1PK7A 1GITA 3CMMA 1OZGA 4EEXA 3QX8A 1CD5A 2ERYA 1O54A 5B4VA 4X1YB 1OH8A 1BU5A 1G8JA 4UULA 3E2MA 4BNHA 2V98A 3GRPA 1U7UA 3BHIA 3ZPXA 4HBZA 4Y6RA 1Z36A 2ZITA 1M0TA 1NDHA 2J3IA 2OV6A 3LRTA 4G5XA 5JNLA 4HYEA 4WJLA 2Q27A 1NLFA 2Q7DA 3EBPA 3I1FA 1R8YA 5KX5A 3EARA 4IKPA 2R8RA 1TAUA 1EE9A 1DBWA 1ZD9A 3CEMA 4HDQB 1VJGA 3BB3A 4FS3A 4QU5A 2IV7A 4J16C 1RI1A 1II0A 2R6ZA 1RQ7A 1ILWA 1F5SA 4QPJC 4TZKA 4O4JF 2B8NA 2FR8A 4WFJA 4URZR 4NCBA 3GROA 1P7YA 2P5YA 2UXBB 2J33A 2AJLI 1JHAA 2X5JO 1MC8A 3RLIA 4EQ6A 5TIIA 1M9NA 3CH7A 1KMMA 3MRSA 2QI9C 4EVQA 3G2MA 4NV0A 2FMTA 1L8LA 4M0FA 4UE3S 4WK2B 5BNFA 1T2AA 4BFSA 1YHYA 1P80A 5L3QB 1SC3A 2ZIFA 4RGBA 1JDBC 4MRVA 5I8ZA 3VR4H 4C7XA 1SOAA 3P9CA 3KV1A 1VGVA 3NWOA 4JB3A 4A6EA 3CVXA 2H1LA 1W9HA 5EZQA 3WJ1A 2R7AA 4A1OA 4B3SB 2VDWB 3BM5A 3PYLA 1DJNA 1KEKA 1JDTA 2XIQA 1QHHB 2JDIA 3E6AA 3WP0A 3GLQA 3I32A 1ULHA 1XEFA 4OJNA 4H7FA 1SWVA 1V48A 2XCIA 4NYIR 1RYFA 3KP1A 1CZHA 1FFYA 1NX6A 3E0QA 4PC7A 3VM6A 3D4OA 2C0QA 4REMA 2YTZA 3MFQA 1V11B 4TS3A 3BQNB 4INPA 5ALNA 5EKSA 3FHTA 1W94A 3G8DA 1PF7E 2JVIA 1ZIYA 4MKRA 2XI4A 4H3HB 4KJZA 3HDJA 1GPMA 4YCDA 3GL9A 2RGUA 5U4QA 1FXWA 2V6MA 3M4NA 3TZKA 4AN4A 2LWIA 1Y9EA 3EOAI 4AIIA 4QDTA 2ZZMA 3QPBA 3NDRA 3OKAA 4IF4A 3GLIA 1U1DA 2WKQA 3R3HA 5FTNA 4I81A 5CD1A 5HNKA 3DNFA 1S2LA 3DBRB 2B1QA 3KKNA 3T3MB 5JV5A 1QHHA 1QLWA 1EB8A 1IQPA 1MABB 1KYIA 2NW6A 3F7TA 1T8PA 1VPLA 2ICAA 1P72A 2P3LA 2DF8A 3F9IA 4DA9A 4L15A 2QWXA 2IOHA 2YRFA 3F46A 1GNPA 5SYAA 4Y67A 2JIMA 2XQGA 3KTFA 3O83A 1MB0A 2WUFA 2P2NA 2BJWA 3D3NA 4IKOA 3RPEA 1UM8A 4FINA 2V4MA 2PGDA 3OTHA 4LJ4A 3SZLA 4P08A 2IODA 5GZ3A 1YGYA 2ZI9A 2QMYA 4GC5A 5CM9C 1J0DA 1PZMA 2V5AA 2P69A 2PK3A 4J4TA 1OLUB 1V1MA 5I9BA 3WDMA 4BNKA 3TQQA 4B3JA 5JPIA 4TQAA 3T7KA 2JAOA 3WL8A 1GQRA 1U7TA 3BXGA 4NVRA 4ZKEA 4MS4B 4F8EA 4X3PA 4LV6A 1YVRA 3COJA 4DPMA 3S3TA 2DYKA 1RJFA 4D8XA 3QVLA 2EJVA 4NJMA 5LQCA 2AKAB 2QX8A 2YN2A 2YJNA 2P9YA 4ZTBA 4AF6A 3IQEA 2J5QA 1GGEA 3EXHC 5JD3A 2F67A 5MHTA 3PJDA 4IHJA 1W8IA 1CUYA 5EA2A 3D81A 4BVGA 4KFCA 1ZWKA 2MSWA 3I6BA 2YC2C 4IDPA 4PM4A 3JQAA 2CXOA 4W63A 4ZEWA 4RW0A 4RVOA 1VKHA 4F38A 4G89A 4CV1A 1GG8A 2G0TA 1D5WA 3A0RB 2GPAA 3T1QA 5BW8A 5G4KB 3P1JA 3PXAA 4GKVA 1G66A 2JD0A 2PS1A 1KWKA 1DRWA 2Y05A 3VX3A 3BKWA 1NRWA 2ODAA 3DBLA 5A2GA 2QX9A 3GFVA 4BBAA 4RGYA 4C89A 2XNKA 4S24A 3T5DA 2NSYA 1RKUA 9LDTA 1NMEA 1MO4A 2VKQA 3SQDA 1AIPA 2P68A 4WT7A 4F6CA 1SNYA 5ICCA 3OBBA 1H8EA 3A4NA 4MV9A 4OG2A 4K88A 4ER6A 1VHQA 2R1ZA 1QR2A 2VP2A 3V46A 1RBZA 3ZGXA 1DWQA 3L7IA 3IP8A 4ZXFA 3ZNNA 4GS5A 5BVGA 3HYRA 1FX0A 3LLMA 3PFFA 3TVDA 4EG7A 2CLLB 5U1PA 2PZGA 5H68A 4S0ZA 5JZVA 2F00A 3HO8A 4RKWA 1ZGAA 3H04A 3V4SA 5CB6A 3KTOA 1HE8B 1Y8QA 4JU8A 5DHFA 2QRUA 2W70A 1D2HA 4IZHA 4C4OA 1L4BA 1C3VA 2VNSA 3NHLA 3CKMA 3M6UA 1E3WB 3G5AA 4FSXA 3SJBA 3WOVA 2NPIA 2QTLA 5DWDA 1J0CA 5I7SA 1PSZA 3H0CA 3ZIUA 1X1TA 3VPCA 1AU9A 1TVEA 2DPYA 1K6JA 2DPGA 2VPXA 3FFTA 1LPOA 1LWOA 1DAHA 1UFKA 3GVIA 4FOLA 3W8DA 4EYSA 5CDSA 5LDGA 4GRDA 1RDFA 1MX3A 3IOEA 5GOTA 2G8NA 3DTVB 1U4SA 3B1VA 3V1TC 3MTJA 3N2KB 4EPVA 3ETNA 5BXYA 3U60B 4OXYA 1HA3A 1ZRHA 3I73A 4XWKA 2JD1A 3U7QB 3WRVA 4B82A 4EUSA 3IODA 4AJOA 1YHNA 1YHZA 2J3DA 4LPSA 3A3PA 3JD2A 4QNRA 2R1VB 1Q0RA 3UQZA 4JR1A 3DD1A 2VT7A 4OXKA 4K2HA 3Q9UA 2NSLA 1IONA 1FFXA 1ULUA 4E11A 5J3JA 2VS1A 4P5EA 4GWGA 2YWXA 2C95A 3PZBA 5IF9A 5KQLA 5LOVF 1VCMA 2G0AA 2JIQA 5J5AA 1SVIA 3UAGA 5CLHA 2VI5A 4YEDA 1WAMA 1OREA 4Q9KA 3VRHA 1AXRA 2B4KA 5JMPA 1JYFA 3B8HA 1XNJA 2ZJ8A 2BUBA 4CKCB 2X6RA 2Z2JA 1W76A 2DUNA 5K09A 2A78A 2PKCA 1TJYA 2KPOA 2OK7A 4M1OA 2CNWA 3HBLA 3W06A 3QVOA 2AOVA 2HUNA 2FZ5A 3EBOA 1CR4A 4OL0A 2WWGA 3KHKA 3VZBA 2I9PA 1D2AA 3SF0A 2VQ3A 1S7CA 1UC4B 4DXAA 3D6UA 2IXAA 3MWEA 4BX0A 2J0QA 1VSVA 3EIFA 5L8VA 1DLJA 2XWPA 1YQQA 5EJMA 2O2ZA 3J80A 3AUJB 2A9PA 1WWKA 5CA0A 1Z7YA 4UCFA 3TW4A 5BP7A 3DR3A 2PWPA 4IOKA 3TRKA 3HCBA 2ZCUA 3U4QA 3HJTA 2PS0A 2GRUA 4L4YA 4IFBA 3E18A 4O4JA 3JARA 5E3IA 3WK5A 3SC3A 4WEQA 2X3FA 2WP8J 3KUXA 4KIJA 4L3VA 3KJIA 3ND8A 2Y76A 2REOA 4Q12A 4R1SA 3ZWAA 5BMVF 1Y4UA 4DWVA 2CJXA 2ZRPA 1RFLA 2OR3A 4O2BB 5EZSA 1KKMA 1UC9A 5L53A 2V9PA 1ZVJA 3RJ5A 2C29D 4ZQBA 1QRDA 2RBEA 5AW7A 1YTUA 1NVUQ 3CW9A 4QOHA 5CNKA 2WP0A 3FD8A 3PCXA 3KB2A 2Z9CA 4PXAA 2X1HA 4BO7A 3TOSA 3RRJA 3QMMA 3NP7A 4C9BA 4J2OA 4YNBA 4A82A 2X5XA 2YJ5A 4H4EA 5KU7A 4NBSA 4UXJA 5D01A 4O4HA 2UU9B 3S7TA 1C50A 1I30A 2QNRA 1V3UA 2ZIAA 4JJGA 2EP7A 2VDOB 3BTSA 3HI6A 3HB5X 2Z57A 2OHXA 2P0YA 3F7OA 4BFWA 3IEVA 1LWNA 1KJYA 2MHCA 2O1WA 4KR6A 3RIEA 5B58T 2V59A 5LJLA 1RC1A 3T3GA 3S8MA 3LNTA 4IIBA 1U2RA 4MP3A 3ROGA 4O8CA 4A8HA 1US8B 3DZCA 3AWDA 1KPGA 3D6TB 4RZXA 3RAJA 2ZYHA 4MW2A 3WIDA 3OWHA 4UBIA 4DNFA 4ZHQB 4TRNA 4UHJA 5ARDA 1P1KA 3H42B 4JHLA 2HA0A 4MWGA 1U4OA 4L3WA 1BA2A 5D51S 4LXGA 1II8B 1OU0A 5EXPA 3HXOA 1TF7A 1JR3E 3KT6A 1ZH2A 1F1BA 2NV2B 1EESA 1A9TA 1IHUA 2W43A 3GJSA 4RMNA 2CWDA 4B9AA 5P21A 1OROA 2VUIB 1J06A 3OLZA 4O2AB 4XGKA 1YR3A 4FOPA 4ZYYA 4JEUA 1DUSA 4ZCLA 1I6WA 4Q3DA 3EZ2A 4LWOA 2IPLA 3GCGA 4FDMA 1OJ7A 1V47A 4FK8A 5AVJA 4EFDA 3REGA 1J0XO 2RONA 2BT4A 3PC8C 2ZETA 4PLYA 4P7KA 3HL4A 4EG0A 5FNVB 5ALVA 1WSBA 3GUYA 3BZUA 5E9WA 1EFPA 1N2JA 3B6EA 3MG9A 3ADDA 1P73A 1TIKA 4I9HA 1LW6E 1U1IA 3E4CA 2QT1A 5DTMA 4A8PA 4DIFA 1EK1A 4NFHA 4HNAA 2CEAA 4DV5B 5K8TA 2GF2A 3CSUA 3FCCA 3PQDA 1REQB 1RWBA 3TQOA 4CR7A 5C1DA 4F12A 4OHFA 3JQPA 4QPZA 2UVPA 1GZSA 1PQ4A 2O23A 4EI7A 4HPWA 1JWBB 4O4JB 2ZR0A 1XQYA 1CUEA 3JR7A 5AOCA 2JA1A 3HDTA 2O52A 4W1PA 2ZS7A 4HN2A 4U7PB 1E9CA 3OX1A 1ZVMA 4G5RA 2XMBA 4RSMA 5L3SA 4CMJA 3Q8MA 1JVSA 3DV2A 1Z6AA 2ZUWA 3BD6A 4LE1A 5HGXA 3BVPA 2WOOA 1MRZA 3PHGA 2GZRA 3OZAA 3QI7A 4O2LA 4PC2A 4CQLB 1EFPB 5K4GA 4JBLA 1Y1LA 4UQLA 1YJXA 1O08A 3DV9A 2I71A 1PBNA 2VHZA 2IYRA 3HNOA 1RT9A 5LQAA 4GL2A 5TB5A 5BUSA 1I8TA 4HNSA 3K1JA 1V1RB 1CQJA 5ALEA 2FZKA 4ZVQA 3U4DA 3K9HA 2GRJA 4UBJA 2V3WA 3VR2A 1A4XA 1NF8A 2PU5A 4Q21A 1JVBA 4CF6A 5E0OA 3CUYA 1A2KC 2JH9A 4RDHA 2W0MA 2VTVA 3I5AA 4IMRA 5FT9A 2G8LA 3I2KA 5TPWB 3JQGB 1Q91A 3W2HA 1U90A 2W2OA 2RKWA 2MINA 3Q3GE 2QMUA 5JECA 2AR0A 5TS2A 1MB3A 2VYQA 2WTBA 4YAEA 4QGFA 3H1AA 3NUGA 1NJ1A 1AVTA 4ZK6A 2WSBA 2PKXA 1Q7CA 3UXEA 4ARIA 4HUQA 1KXZA 3E3NA 3QFSA 4OKSA 4GXNA 1BA3A 1SK9A 2I1LA 4ITVA 3ZVKA 4XM0A 3RVBA 2K5UA 1XNRB 3QF4B 5F5NA 3AWIA 3OCZA 2Q1YA 4RD2A 4TRRA 2ECPA 3BJMA 3PUIA 6PFKA 1BQ4A 1J49A 5A1JA 2FX2A 1W88B 4RQUA 1PJ2A 4D4KA 1L5OA 3VMMA 3GFGA 4E1BA 1Q50A 2ZRBA 2YH2A 1ZS9A 2XLCA 2C9OA 3AHJA 4IEIA 4I55B 2PPVA 1G19A 3CE6A 4QDJA 4WN9A 3X3HA 1XWWA 2QYOA 4L85A 3JD1A 1N2HA 4M9XA 3BGWA 3KKQA 5BN5B 1FNSA 1AN0A 2P9EA 3GFQA 4CODB 5LXTB 2VJAA 3R09A 3DOOA 2VPYA 1RRGA 2RIPA 5DLQC 1TL7C 3AJRA 3TM4A 4GP7A 1SVKA 1N92A 1OD6A 1YBFA 4M22A 1EI9A 2C9CA 2NU9A 2YY7A 3WQSB 2G82A 2B5WA 2Z43A 4YYEA 4DRZA 4RPKA 2F1JA 2AX3A 4NENA 4Z99A 4AFNA 5KQSA 1P17A 2HNAA 2JJYA 1NZJA 1LSSA 2EJWA 2CHFA 1BW9B 2C2GA 5DLPA 4F3KA 5AM3A 1ZINA 5ERYA 4F92B 5JD6A 4HQOA 1XWIA 2A4KA 2P30A 5JRDS 3I09A 4BNFA 5JXIA 4C76A 1F9AA 4X91A 1NXTA 1YVEI 3OF3A 1C8KA 1H9CA 1NKTA 1RP7A 4GQIA 2MSDB 3KVVA 4OA5A 5CVJA 2YDYA 4G81A 2XUOA 4TXHA 5EJ2A 3TDKA 3FRHA 3ZY5A 2B6HA 5AKXA 3ZHVA 2UUPA 3WMEA 4C7VA 1D2RA 4QTXA 3NXKA 2QOEA 2QTBA 3FI9A 2QYSA 3JYOA 1U3CA 2Q3BA 3SYLA 5HE9A 1P5HA 1E20A 2HO4A 3UAXA 1V7QA 2X5NA 3DO8A 2BHLA 3ROEA 5KYXA 5A3QA 2R1VA 2Z0MA 5EOVA 1Z45A 2W58A 5F12A 5BRNA 5FUXA 5J4YA 3GQBB 1KJ8A 3QVGB 3TO5A 4JBXA 2GN4A 4RZHA 4A36A 3NHMA 2R5WA 4CM9A 3C3EA 1FP1D 3EISA 5LU8A 1HR0B 2XOKD 1M2JA 2VXOA 5FTLA 1GZ4A 2FK8A 1Y98A 3CCCA 3SICE 3K70B 1JWAB 1YZVA 2C4HA 1K75A 3O4JA 4YRCA 5AKJA 3AONB 2PLRA 2R6FA 3TQHA 2PZFA 1A7UA 2D7JA 2PVSA 3RBZA 4CMBA 3VKHA 5DTIA 3TCXB 4CL0A 1JNYA 4BCCA 1XHLA 5AXBA 4CKCA 3WHIA 4IOMA 1M2HA 5EHXA 1P2DA 5K3OA 2W93A 3BHMA 3E2IA 2IXFA 5GADl 3OCUA 4G41A 3LGSA 1IM5A 1UANA 5EQTA 2I2AA 2M6SA 1P0MA 4I1UA 2ZRAA 2B37A 3GT3A 4GM1A 4G8BA 4D8UA 4WKPA 4HK4A 1EFRA 2OV3A 3O3CA 2VSXA 2FETA 1D4OA 1OMOA 2WAYA 3GBVA 3UAZA 4DCPA 4DSOA 1X80A 2QN8A 3OEHD 4PZAA 1S9DA 2LNDA 2Y2VA 3KTAA 4MAMA 5KI6A 4WAUA 4J9UE 4MV4A 3OPQA 1EUDA 2XNSA 4A8TA 5K0BA 5CFMA 3UXHA 4DJDC 1WNFA 4B3BA 4WZ6A 2X0NA 4AL4A 1CJKC 3M5CA 1AE1A 2V6IA 3FPLA 2A9OA 3A4LA 3MINB 4P84A 4RWZA 1ISHA 1VJDA 3PKZA 2HF2A 1Z3CA 4R5HA 5FPTA 3QXCA 5GGYA 3U0BA 2Y66A 4EPRA 4DSZA 3PITA 1VZ3A 4XJTA 1CETA 1SFRA 2PQMA 3MT7A 3FUXA 4KI7A 3CG4A 1CVLA 3GUUA 4HVAA 4AJPA 2D8AA 1HDYA 2XOKA 1DQSA 1U3TA 1QGDA 3C70A 1DDIA 3JWJA 1QYCA 1GJRA 4ZQEA 4TVSA 1W35A 1ZICA 2C5SA 2V5UA 4EKYA 2C2XA 2CMGA 1XJQA 4AC9A 2JI8A 3GPIA 3NNDA 4RPHA 5AVKA 2WHPA 1E4YA 3EXEB 3FIUA 3ROPA 4C0BA 5HIAA 2ACVA 1R0KA 3CJQA 5KZMB 1SKUA 1V95A 2VSOA 1CEQA 5GAJA 5K0GA 3PUHA 4MR7A 4NESA 2JFBA 3RUIA 3T94A 4BB0A 4ND5A 4W9NA 5KDOA 3JALA 2B0CA 2GUWA 3FPEA 3REQA 1KTIA 2VHEA 5AJVB 5EIBD 5F3DA 1Q7EA 3I52A 2W6OA 2X58A 3FBWA 4TKVA 1SO8A 4UEKA 5HZKA 5I47A 2ZYTX 1UJNA 4UUPA 4C7BA 2H1CA 4DCOA 3I39X 4FOOA 3ZWMA 1U8XX 1D2MA 1JQ5A 5JLJA 2D2FA 2XV1A 1AM4D 5JAPA 1T36B 4BEJA 5CXUA 3CONA 2JLQA 2ZW9A 3C3BA 1O95D 1U5BA 4D5GA 3HWRA 4EI2A 4JX8A 3LBHA 4MO9A 5ESXA 2G76A 1Y8RA 2CBGA 3N0TA 5DHSA 3DW1X 2IUEA 3QEAZ 3UKJA 5CT5A 1IULA 4AUNA 2BTQA 2RBKA 1HPLA 1T6ZA 2BCEA 2QY9A 1JFLA 2HWUA 3FDJA 4M98A 1ZIOA 1OFUX 4V24A 2B1IA 3WI7A 4G4SO 1GL6A 1PR5A 4DMLA 1ZAKA 2QVBA 1Z13A 3JWHA 4FYIA 2CZQA 2DJ5A 3V2HA 1X1RA 1ZM9A 2B1JA 1FVHA 3PP8A 1U2DA 4LE0A 4UQPA 2JAXA 2GD1O 3NHUA 3SR0A 1XMIA 1PD0A 3CKYA 5LZ2A 1MH9A 2UYOA 3PFNA 3R1IA 4ZI2A 4KR3A 4XFKA 1RYDA 2H2FA 1GA4A 2IA5A 4QO7A 5J2TA 2PANA 3RIGA 4J6FA 2XZLA 3AXSA 3QA9A 1TECE 1UFVA 5HA5A 3URKA 2BJHA 1WF3A 3FVRA 3WB1A 4BKOA 1QM5A 2GA9A 2UV8A 2YHIB 5EUCA 4RTQA 5JI2E 4MVCA 2GAOA 2PUHA 3U4AA 1G20E 1M5RA 4MHSA 4HN4B 1CLEA 4W5JA 3W4KA 4FHCA 3SMQA 4C5CA 1XLTA 3I5YA 4OM8A 5EIEA 1QP4A 1DKOA 1XZMA 4BP9A 1DO0A 3M49A 1OIXA 1OI3A 1G41A 1GV1A 4NDZA 3KZNA 5HG0A 1ZM4A 1VJTA 1KJ9A 2F3UA 2Q1XA 2OK8A 3HCRA 1I5OA 3JWEA 3SIXA 1A5ZA 5K0LA 2NO1A 4GNKA 1SOUA 2C0PA 1HBJA 2CDBA 3LAWA 5CA1B 2YVAA 1XELA 4RCVA 4ID9A 3KKMA 1D6NA 5C7LO 4G0QA 3LBIA 1IRIA 1DUIA 1CUHA 2Z2KA 1QPZA 1USGA 4ROSA 1T8RA 3TLXA 1OIWA 2O3QA 4F9FA 1B73A 1GILA 4IS3A 1XMOB 3NS7A 3IT2A 3HQ4O 5CLGA 2CSUA 2HIGA 2XYHA 2AFRA 3AJ9A 1M7BA 3N2ZB 2Q6OA 4FR2A 1PG5A 5IU6A 3VYTB 2O0MA 2QSZA 3ESDA 4M0CA 5F1OA 1JDVA 3RF6A 1ZKDA 4AUMA 1FU7A 3JQQA 3ZEAA 1YBVA 4FYVA 4BNXA 4HLQB 3WL6A 3DBHA 1UDBA 3FCUB 3H84A 4YUYA 3VDXA 3R3VA 4G25A 4Y9DA 5IYZF 3ZYZA 4Z7NB 2VYNA 3N58A 2G04A 4CXMA 4JFAA 1H65A 1LNSA 4E30A 3C97A 5IDQA 5IVHA 4MW1A 4Q6BA 3H3XA 5IS2A 1ULAA 2H48A 4Z4QA 3PLNA 5K0SA 2OFFA 4R9SA 1M2NA 2GX6A 5CG1A 3BK2A 3U19A 3S40A 2ECFA 4GIBA 1KYWA 3PPVA 4BU1A 4QDOA 1C9MA 3N2GA 4WDQA 4OLHA 1ZR2A 2WQ7A 2IX9A 3VC2A 3T6KA 1VL8A 3CLUD 3H9QA 5C1BA 4B6FA 4AN0A 1NUUA 3G6KA 3HB4X 2HV9A 1K08A 1QIMA 2WPDA 3P27A 4UNNA 2BFEA 1C7EA 2H51A 4IINA 4INAA 4TMTA 1XRJA 1EVZA 5FFFA 5CLIA 1DTSA 4U2BA 4GH5A 1PI3A 5AVOA 1R6DA 4LOAA 2Z1DA 1RZVA 3ODPA 1VLJA 4PF1A 1MX9A 3IIJA 3NWEA 3OM8A 4BJ1A 1U2EA 4CFSA 3LTNC 3AVVA 2X4DA 3CF4A 4GI3A 4IHQA 2E4AA 5K5EA 4FYYA 4S1OA 3TGLA 1VPVA 4M0EA 1OBFO 5B58C 2RGAA 3GLGB 2FAXA 1DDOA 4EY8A 2JAHA 3MUNA 1T1RA 4B87A 5AVUA 2PKEA 4TUYF 5KNLA 3EUWA 3D7KA 4OP1A 1TM2A 5H4GA 3DE6X 4RQAA 1NBIA 5SY6A 4UUAA 1NBAA 3DNPA 4L8WB 4LNHA 4XYGA 5LP6A 7MHTA 1A77A 1L4GA 2XZTA 2WTMA 3JVDA 1F60A 2BZSA 3E5MA 3EWNA 3N8DA 4TTIA 2ZCVA 3OHPA 2AI3A 3AYXB 2OSBA 2B61A 1OKKD 3FYUB 1EA5A 3GLUA 3HKCA 1FJHA 5FI5A 4JD5A 4ZN6A 5IH7A 4R2LA 4BBPA 3V1UA 3TFQA 1XMXA 4BKRA 1TYZA 4JELA 2EW8A 8ATCA 2UUAB 3S2YA 3CR8A 4LECA 1O4WA 1P60A 3HJRA 1YD7A 4RA6A 1YE5A 3DLBA 2ZE5A 5KOHB 4TV9B 3H05A 3LE8A 4GMGA 1AKYA 2WMYA 3AETA 2XDYA 3COSA 4KB5A 1Z9BA 4PG5A 3TX6A 4EZBA 3PJGA 4DCUA 4Y3UA 5AJHA 1DFGA 4CG2A 5BR1A 3S8YA 1PLJA 3IULA 3NETA 4IQFA 1CY7A 3KQHA 4PFQA 4R2MA 1T4GA 1FIUA 4IO0A 4LF9B 4UARA 2H4XA 1DXHA 2HSZA 1S4QA 3H97A 1VRCA 4K6OA 1M2WA 3U48A 2P9FA 5DCUA 2YYYA 1LH0A 4FOSA 5IH3A 4UKDA 1SBQA 1Y63A 3C4JA 3CN9A 1Q7TA 3T7AA 3FGZA 2WE7A 3F1KA 1EVYA 3AOEC 2BFWA 1ABFA 3DR5A 2I29A 4WN9B 1D0VA 4LHXA 3NHFA 4D3FA 1N3IA 2JAPA 1A1VA 1GFWA 2E49A 3A4VA 2XX3A 2BEWA 4LOKA 4YJKA 1S2DA 3F71A 1IWPB 1H23A 1WMAA 4KYUA 2KLHA 3SWWA 2IYVA 2ZRLA 2VHWA 4G09A 2QUKA 2QL7A 1G8KA 4O3MA 1NURA 5FO0A 3TZBA 3T4EA 4QUGA 4GD3Q 2R8PA 4YJ2A 1BRMA 2O5RA 3Q7EA 4KXQA 5AK0A 1XNQB 3K4PA 5TRTA 3ZGNA 4F5EA 4R3UC 5T6MA 1R5BA 3IUNA 1TZKA 4X1IB 1J70A 3VH2A 4F56A 4F6RA 1YJ8A 3BL8A 1XCJA 4TTSA 3GEIA 5IT4A 4WSOA 1F8FA 2GH1A 3A3KA 4N12A 4JGGA 2HADA 5E0KB 3KJGA 2HQSA 4EW2A 1AKNA 2NZYA 1AMOA 3DBRA 4IICA 2D2XA 3ZY6A 3ZY3A 2PKRA 4J0FA 4BP3A 4UTVA 3LP5A 5F7OA 3V00A 1ZW1A 3L82B 2ERCA 5G0UA 2BI4A 4GPTA 3AGQA 4IPTA 3F47A 3UMRA 5B6JA 4V1CI 4RELA 2P9HA 3KZKA 1RKQA 5B2ZA 1QQTA 1G20B 5DXAA 5FWXA 3UV6A 1GPBA 2FDCA 1VPEA 1Q7BA 1IXKA 2I3ZA 1EKXA 2CLCX 2W2TA 3E23A 3EXFA 1I3OA 1KC3A 3LPNA 5KYXB 2NYUA 2RGXA 2LPMA 2IWHA 2NVBA 5KOIA 2C54A 3QEBZ 1MC1A 1GL7A 1Y8QB 3D5TA 4MWTA 5FI1B 2DUUA 1L5LA 5BWBA 4ZOAA 4JQYA 4X7PA 1ZY2A 1V7ZA 1WCWA 1RHKA 3CEAA 4YRPA 3GLIE 1LFAA 2DVMA 3NHBA 2HSDA 1TO1E 1N2SA 1QFYA 3FPFA 5K3DA 5K0CA 2C83A 3K8QA 2NP7A 2J87A 2YWHA 3KHSA 3ZHTA 3PQ2A 5F64A 1E3JA 1X6VA 2UYYA 4JVMA 4KXWA 4RA9B 5FTMA 1J2JA 1IH8A 2I62A 4QTYA 4Z7JA 4PHFA 3GGSA 1F8GA 2C9YA 3CLSC 4K03A 2FVYA 2RJOA 2FWNA 5F2EA 1BX0A 1MJGM 3I2GA 3MAJA 4RJLA 4KXMA 3L7BA 1TM5E 4EJFA 5EJ6A 2VBIA 3SFVA 3ZDDA 1EFUA 3CWZA 1Q7GA 3I6YA 3UMVA 2AG6A 2Q0SA 4Y1GA 2XZPA 3AF1A 1WB6A 4MA0A 4HNTA 3QLUA 4UDXX 4JA0A 1Z4LA 3GMTA 3IYLW 3THOA 2HPVA 2FCRA 3ACDA 3NCHA 2YV3A 1ZH8A 2W0SA 4MWOA 2KHZA 3ZY4A 3PF8A 1GG5A 2J3JA 3H4MA 3RJ9A 3NYRA 5FUVA 1YK0A 1M1NB 1BDIA 1EXNA 3VOAA 4EVSA 3JZDA 3DWFA 5JEEA 2WR8A 4RJTA 4AB1A 3ZZTA 1KKUA 1JHUA 1SJ9A 1MVNA 2OD9A 5KNCH 2WVAA 4C2AA 2PFKA 1NY5A 2E18A 2Y1GA 3DZDA 1XDWA 5EPOA 4LGMA 2Y71A 5GONA 4C04A 5I9NA 2D0IA 1U8FO 5A3JA 1W0KD 2E1PA 1PBTA 2M32A 1OPRA 2EZTA 2R48A 3DOIA 3DL4A 3LUKA 4DTIA 1M2KA 2XWJI 4Z0TA 1N78A 2VZ9A 4QJ3A 3U7HB 1J2EA 4EFMA 4EY3A 2GB4A 5LJIA 5GZ6A 5T4EA 5M7EA 3A2LA 2JFVA 1U6IA 1XVVA 4V0KA 2BEJA 1W6RA 2JZCA 3GWZA 4M88A 5LZ7A 3RUDA 2J9ZB 3K1AA 5BUCA 4E3ZA 5IF3A 4KR2A 4D3YA 3PJRA 2A30A 3GNQA 1GRCA 3S8EA 3OEWA 1Z16A 3CEPB 3EIWA 3PFIA 4L2IA 1JHPA 2CMDA 1ZK1A 2ODEA 2BR3A 3DXXA 4WLNA 5I3CA 4BBZA 4RKFA 4F3TA 2X5KO 5K2MA 4I3GA 4S1NA 3HJFA 1X70A 1YRWA 2QLLA 3PD7A 5DHAA 1IN4A 2YV2A 3SXUA 3WGZA 2FJPA 4B3MB 1CZNA 2QL6A 2X8LA 4IXTA 4LXUA 4ON9A 1HEUA 1W59A 4N5MA 4BE9A 2R1TB 2ZUCA 2WNIA 4D26A 4C4AA 3TIIA 4B48A 5LQRA 5EHNA 4CJXA 4I99A 3LYHA 1DUVG 1MXFA 1S2OA 3K5IA 2IK8A 2PX4A 4S1PA 4MIYA 5JBNA 1M6WA 3D5EA 3KHUA 1GTZA 2HQRA 3BTOA 4CLRB 1PJZA 5GM2A 1FFAA 2QJRA 2JI6A 3D02A 4QUJA 1WCIA 5ALXA 3S99A 3KEOA 2GZMA 4ZYTA 3FTEA 5GIPE 5D5HA 1JPJA 4ZJYA 4PAWA 4BLWA 2VRCD 5D1HA 1F2UB 5DH9A 1SU4A 3MINA 1EK5A 1Z4OA 1ZW6A 3I6QA 1NC1A 5C5EA 2J59A 4CM3A 1F4PA 1HDEA 4NTZA 1UR5A 4HGQA 2Z1MA 3KE8A 3KQTA 1WMFA 4LXYA 4YMTA 4MS1A 1B6SA 1FVXA 4OLAA 1D2NA 1HFJA 4FXOA 1TYAE 3NHPA 2CHGA 1J9ZA 1PYGA 1JAZA 2GKOA 2R68A 4AP9A 3AK4A 2OYSA 3UT5B 2PUEA 4D6PA 1D6MA 4N5LA 4L8FA 1IB6A 4MYRA 2D59A 1P29A 1RMQA 3N5KA 4HGRA 2I1WA 4AU1A 2Q3FA 2REXB 3O90A 2PMEA 3MWKA 2ZR9A 3TJZA 3O4IA 1XBTA 3O4VA 4OFWA 4LAFA 1RWOA 1SD5A 1XVIA 4E94A 1GAXA 2OWEA 2PKQO 4NYIQ 3TOXA 1LPNA 4R1PA 1L3CA 4E09A 2HBRA 4NFLA 1ZD5A 4JLKA 3RTBA 3V55A 3PEVA 4Y6LA 4WASA 3ZI0A 4D45A 4RIHA 1SVOA 4XFJA 1QV7A 4EOGA 3A2MA 3CNHA 1FSFA 3FMPB 1JFRA 2D1YA 4DMKA 1WZNA 2ZIUB 3QXJA 4PPQA 1XDDA 3SC2B 3BAFA 3QJ5A 4NNPA 2TMYA 3G9TA 2YIJA 3B9BA 5C8ZA 4IILA 3ECAA 3COZA 1H9AA 3DLPX 3ESCA 2CEKA 1N2EA 1FY2A 3R77A 1Q1NA 3I64A 4KLAA 3IL2A 3RANA 5AVTA 2YY6A 4RACA 4Z9FA 3T5BA 3PI6A 3CF4G 4R2JA 4E4YA 2XB2A 1Y5RA 3PQ6A 2RHRA 1LDBA 2Z4SA 4CI0B 1S2GA 1CT9A 4JLWA 3AB7A 3LUBA 4YI3A 1JSZA 4ZDWA 3O3NB 4AROA 4YK7A 1M0WA 2A4MA 5ADHA 1X7XB 2DHCA 3PYXA 1AGNA 1Z5VA 4QWWA 1C30B 3DVRX 4TN1A 4X5OA 1MRSA 5EHQA 4L07A 2PBLA 1KE2A 4A0SA 3PC3A 5AFSA 5C4IA 2BH2A 2RHOA 4B75A 4B81A 4JUBA 2CHEA 2R0QC 4YAIA 2RH5A 3GFBA 3JSXA 1E7MA 4L1KA 4O4IB 2FVXA 2YXBA 5LA6F 1EWYA 2DTXA 3CA8A 4IQ8A 4II7A 1CR2A 1EK0A 1TB4A 4A7PA 1QO9A 2BMAA 4GM4A 1KA9H 1A2OA 1ACLA 1DCTA 3EG5A 4RV5A 3E1KA 3LK6A 3EG9A 2VQSA 1I7SB 5FPQA 3T41A 2XKBA 3RU2A 1VPWA 4IGAA 3HA7A 2FLWA 4HTFB 1NASA 2RSLA 2WVGA 2AEEA 4LMBA 1NQXA 4KAJA 4KI0A 4HH3C 3BERA 1H1TA 4WVLA 5IJ9B 4HX2A 4ZP1A 5TMBA 3H3FA 4TMYA 4I3FA 3CUKA 3KJFA 1P18A 4HDRB 3FNHA 2C84A 2WJZB 1WB9A 2CXTA 1AZLA 3BF7A 4MW5A 1GGMA 1DT5A 1ZUHA 2JNWA 3PIIA 6REQA 5LA6B 1NWCA 3JR3A 3LI2A 5JSUA 1JAYA 3G7NA 2IH4A 1G2IA 3UCEA 4UVEA 3INRA 2OGSA 2IEBA 2P1ZA 1B3RA 3NNNA 2CHQA 1X2EA 1BVRA 5T4HA 5LMNB 2RGYA 3T3HA 2IHZA 3PNKA 2QBYB 2PH5A 1SIOA 2LD4A 4LNAA 1IE3A 5TNXA 1H0HA 1PVVA 1KFBB 5AJYA 4KQMA 3VOSA 1WO8A 5ERGB 3R7LA 1P74A 3UG6A 1JXQA 3ZIAD 4ZV7A 1BU8A 3U4IA 2XGOA 3UC5A 1C1YA 2O8EA 3EVFA 4DQ0A 1XZQA 2EG5A 4MJXA 1P2UA 4DBLC 2IKQA 4NENB 1DJMA 2BMWA 2GZ3A 2AE1A 2GZSA 3N87A 3KZVA 1QNLA 2ZXEA 3FPKA 3GN1A 1RMYA 4R1NA 2PS3A 4IG9A 4XJSA 1X7YB 5FORA 4P5DA 1EUCA 3EDMA 3HVJA 2X13A 4DBLE 4LFBB 5AH0A 3CEHA 3L04A 2BF4A 2BZ1A 1CX9B 1PQPA 3FGOA 4RUKA 1IQRA 4R31A 3MTAA 2P4SA 4A0GA 3OTOB 2WICA 4R51A 1BCRA 1X0XA 2Q4BA 1SQ0A 2GCGA 4WOBA 3RVSA 3M6VA 5AKEA 3VUEA 4BXOB 4ICIA 3VU8A 3TR6A 2FHSA 1YAJA 3ROKA 2ON6A 2ZPTX 5FI0B 5FOVA 5A9SA 1BQEA 2JIDA 1W2GA 1ZI6A 3A6LA 2DBYA 5PNTA 1D1SA 3ICVA 4QAJA 4PX3A 1GQOA 4YJ2B 2B8TA 1J99A 4CKZA 4GRAA 4X20A 6LDHA 4BO5A 4X1IA 3L3BA 4ZFNA 1E1MA 1LVHA 2QJWA 1GN8A 5LR6A 3IT0A 1FZQA 2PIAA 4PQFA 3ZCVA 1AO0A 3CURA 1SEVA 2YJTD 3H6KA 1EM8A 1PJRA 2NG1A 1RIIA 3RUAA 1DO2A 1Y48E 1YR9A 5IHPA 3Q11A 4CG1A 4IJQA 2D4HA 2JFQA 4TYPA 5AW1A 1SPXA 5LOVA 2AOXA 1JAIA 2GK3A 2WDPA 3HKCB 4Z8XA 4F46A 4H7IA 4LF4B 1SVNA 3WJ2A 5K8IA 1Y3IA 3OZGA 4TRMA 4D02A 1ZAYA 3PHHA 2CVZA 1U2SA 3FPBA 1Q11A 3V7YA 3ZIDA 4HAIA 1G8MA 3HA3A 1GTSA 4RIFA 4BUJA 4WBNB 5I7WA 3PPXA 3KJEA 3BDAA 4CVNA 1GTMA 4GNRA 3OQJA 4OO3A 2HWXA 2PRKA 3HVUA 3P2MA 1CBUA 2PZBA 4KQHA 4LZAA 5JJBA 1JU9A 1UBNA 2JKZA 2E4YA 3H17A 4CGZA 1SXHA 2CW5A 2JDID 3HRHA 4PINA 3AZQA 2G4VA 2ID7A 2Z4TA 1VJRA 3PD0A 3N7TA 2C4KA 3MCAA 1NHWA 2FW7A 4UBOA 3O31A 3AR4A 3P0EA 1NJGA 1N2ZA 1F6WA 4XLLA 5P8WA 5HK8A 2XKJE 3RO7A 1P0PA 3T3NA 1YONA 3HBFA 2DTDA 3WKCA 5FBVB 1WDKA 3QTTA 5DNVA 1RM5A 2Q5EA 2J31A 1U0JA 1YZGA 3OETA 2YQ4A 3F8WA 5L95A 1U8EA 5FPPA 1SR8A 3EEOA 2VCEA 3W3AA 3SM9A 2O8CB 2HFKA 3WHLA 4AICA 1T10A 1U6KA 4RSHA 4H4CA 4G1BA 3UJ8A 2LDXA 1R18A 3L0PA 5BYKA 1GFSA 3BCUA 4G86A 4M8LA 3ZX4A 2IDZA 4YPOA 2HO5A 5HOQA 4DMCA 4FFSA 1VIYA 1Y6QA 5CVTA 1W1UA 1KYQA 4H7PA 1KSGA 2XVMA 3E9RA 4A9AA 4CLOA 2A2ZA 4NAUA 1PFWA 3Q40A 3VJMA 4FX5A 2ZYDA 1QIKA 4BOYA 4HI0E 3O8BA 1UMDB 2IUTA 2PKWA 4IUDS 3KQNA 2I6QA 3V4PB 3EEFA 3A11A 4NP6A 1QX4A 2NV0A 3TTXA 1OLSA 4DA8A 4LFAB 3GARA 1UBKS 3LD9A 2WUGA 2DXIA 3KIPA 2HN9A 3G49A 3NHAA 4JQCA 3V6LA 1M3SA 2Y67A 3FMIA 1H4QA 1CFZA 3DJYA 4NV3A 3QELA 1XN4A 3EXG1 4ES6A 2BSAA 1RJEA 2J6BA 4KQGA 2V1XA 4YJ3B 2GYYA 1JIKA 1MENA 4RCYA 2D5IA 4NULA 4YWJA 3S1LA 4IWXA 1E9RA 1KVTA 2HK6A 3R0QA 3ONEA 2ODBA 4MUNA 1RAFA 4DUPA 5JMTA 3MJRA 3TTTA 5A5EA 1TIBA 1G7SA 1Z75A 3UMMA 4G4SP 4RADA 1B2RA 4IVQA 1RAGA 3D3QA 1O4VA 3ZU3A 5FR2A 3ED5A 3ZX5A 5B6IA 1TD9A 4L8GA 1YZHA 2RH4A 4B3CA 2AOWA 3A4IA 3P5SA 4QU0A 2QHXA 2XT9A 4EK9A 4MWBA 2M98A 1NYTA 4HZUB 4GBGA 3F3SA 3O4FA 2DKOA 1BYUA 1HLPA 3ASYA 1QV9A 1EFVA 4MB0A 4OK5A 1JIQA 2ODWA 2OP1A 1DAMA 4F9TA 4YASA 2I4NA 2BY4A 3NONA 1MKYA 3TSYA 1TNDA 3ROQA 4AF8A 4DHEA 3TXXA 2FP4B 1L4FA 2IZ6A 1RRPA 4NAVA 2GYUA 2VWPA 3M8KA 4WRRA 1P7ZA 1W48A 5ELMA 1AD2A 5JWOA 5ILOA 1P9LA 3ZWOA 2DFDA 2FFAA 2RK6A 4KH1A 3AOEA 4DCTA 3IR6A 3O1HB 4YFYA 2E5WA 2GBFA 2Z5FA 1JSRA 1Y3HA 3H8JA 4KE8A 5T64A 4TV8A 1EEXB 5HZGA 1HKHA 2PV7A 4RAQA 4DQXA 1Z0FA 3ND7A 3PGMA 4LPKA 4CTOA 1MQSA 4PSAA 1N32B 3P19A 3U3MA 2Y1FA 3ZWXA 1TJPB 4GYYA 4XB2A 2K2QB 1NVBA 5AW9A 3D3WB 4R5MA 2IEAA 4EY4A 2QM7A 4A2WA 2HQOA 3OG9A 5BT9A 2TRSB 1E9BA 3ZE9A 3C41J 5H81A 3UBMA 1VI6A 3RVQA 5BWMA 1LDEA 3QW2A 3FNRA 4YRLA 4JX9A 4S2UA 2IHUA 2PE5A 3UK2A 4WK6A 4KUGA 1MEOA 1II8A 4GLLA 3WRXA 4ND4A 1MH1A 4YT8A 1IN6A 3CF0A 1JLHA 3AHEA 4ER5A 5JMWA 4ALIA 4PW0A 4F91B 1LK5A 3LUHA 5FPYA 2HYIC 3RYCB 2VNIA 2ZPUA 4ND8A 3RVDA 1K0UA 4EO7A 1CDEA 1C7ZA 3BC1A 3BXOA 3L79A 5FOWA 5EMMA 2RMKA 4G8JA 3CUSA 4OB6A 3AR5A 1D2GA 1SKYE 3IERA 4MAAA 4EATA 2ONCA 5KMGB 3OEEA 4Z7OB 1KI1A 3AYZB 3H5RA 1VIMA 1JZQA 1M54A 5DW0A 1CUCA 3EVAA 3S1SA 1AQLA 1VHDA 2Q7XA 5C51B 3QVSA 1V8BA 2Y99A 4UM9D 1EIZA 5TQ0A 3T3OA 1FE8A 1X7WA 1JWLA 3MCWA 3ZZNA 1ND5A 2ENWA 2HA7A 4FGWA 1M73E 4J0EA 4XYLA 2BFOA 2J9FA 3AUXA 3AL2A 2P6RA 1GNTA 3R4VA 5LZ4A 4F72A 4TWRA 2VOEA 2C61A 4U6NA 5J2TB 1GXSB 5BN4B 3KR0A 1H2ZA 4RNCA 1IVNA 2VHTA 4GW3A 3O82A 4JVSB 1CNMA 2LXNA 4OYHA 2XGJA 1PYOA 3RRMA 1PNRA 5EESA 4J0QA 1FTQA 2ZE7A 3RJZA 2EBWA 3DMGA 3VZSA 1VE1A 4ASUA 1QK3A 2E89A 2XPCA 1NU8A 2DU8A 2G9RA 3EVEA 3OQOA 3GNTA 1C9DB 4MPDA 3KFVA 4CF4A 4URFA 2I55A 1CIJA 3QIAA 1DOAA 3EQ8A 2DCMA 1VSBA 1YU6A 1UH5A 2VLBA 3CR7A 3EFEA 3EZXA 3G5TA 3IP7A 1T3LA 1T1SA 4WNAA 3RW9A 3U1TA 3H86A 4B6GA 2BFAA 4PC1A 4N6OA 4RLFA 2YV4A 5AQ1A 1RRMA 1Q0SA 4G9GA 2J41A 3QNWA 1I2ZA 3WE7A 3ZJVA 3Q7IA 4M36A 4CL8A 4XEUA 1L5MA 3HFGA 3WSWA 1U9IA 4EM6A 2JRLA 1E2QA 5ALIA 3NOVA 3UMBA 4BLVA 1PKXA 3AMVA 5JCOC 2XIJA 3ER9A 1TT7A 2O2CA 3R6DA 1DELA 2WTXA 3DSRA 1GAWA 3WQBA 3KOWA 1L7PA 3CNBA 1I3KA 3L02A 4FGZA 4V02A 3QQPA 4CCYB 5HKKA 2CNOA 1TVCA 1BCSB 1U1EA 1Z62A 4NZMA 1PP4A 3IT1A 3M9XA 3H8SA 3OZVA 1RPZA 2G08A 5IM5A 2EYQA 4CEHA 3A2NA 3ENNA 2RHTA 2QMZA 1QOZA 3LQFA 2R8YA 2WIBA 2XXJA 3CLHA 5GVRA 4E5NA 4DUGD 4HVLA 1U2GA 2NO0A 2OP0A 3F3MA 3H83A 3QENA 4DCMA 4E2ZA 2QTNA 4U02A 3WMXA 1KRXA 2ADFA 5U4XA 4Q39A 1K8YB 4OQQA 3T9FA 2OQRA 3H2SA 4RYDA 1IJFA 3RIXA 3RHTA 3AF2A 2BAGA 3IMFA 1EDDA 3KAJA 4G9EA 4YBZA 3RHSA 3IAUA 1IPEA 4DARA 2HA3A 4BKMA 4M83A 2M6LA 4YV1A 3FGPA 3MTEA 2OCYC 1QCZA 4BUCA 5DASA 3GPLA 4C6HA 5C5IA 1PZXA 1E9EA 1YUMA 2DGDA 2OB2A 4QL3A 2PGLA 1S8NA 1ONPA 1I5EA 2YW9A 1W44A 3B8EA 3IB6A 3BMCB 3MTIA 1F7UA 1YQEA 2W4MA 3UTDA 4FEYA 1JP7A 3CGGA 4HUQB 4OTZA 1MVLA 2D3WA 2R6AA 2GD0A 4TL7A 3VZPA 1NE7A 3FPJA 2ONJA 4IDCA 1E1NA 5BN4A 4MV1A 1B8NA 1RCTE 2Y27A 3H1BA 3KK0A 3MYYA 3PLRA 1EQUA 4KXNA 4UVGA 1ZVQA 2XYRA 4X61A 4E12A 1NBMD 3R23A 3HH8A 4P22A 4X84A 3QVXA 4C6RA 4E15A 3QKRB 3ZW9A 5HIIA 3ZWPA 4YJDA 4IIVA 4Q7QA 2LDBA 2YOFA 1ESMA 1EBBA 2JGNA 2Q3JA 3QVMA 1ZU5A 1JQLB 1XQ9A 2QSJA 4G0VA 3N2NA 4ZRNA 4B33A 4BO6A 4QGBA 1D4AA 3RHZA 1PW7A 2AZXA 2QPLA 1QUFA 3OIWA 2YWEA 3HE3A 2O5VA 3HY6A 3LH5A 4O1IA 2PEZA 3JX9A 2VXYA 4JBIA 4HSEA 2QLTA 1W75A 2P5UA 5JDCC 4DN6A 4EJ2A 1DCMA 2EWWA 4OI2A 4EJSC 1CUVA 3T12A 3QVJA 2I2WA 4P81A 5A06A 2CDAA 2VXBA 2IYSA 3BXEA 4ML3A 4BPRA 3NKFA 5KQPA 1HNWB 3VNVA 4I50B 4AKTA 1THMA 1TVMA 1YZLA 1ZXLA 2R8OA 3OQPA 3G8BA 1MNAA 1X1BA 4HBGA 2O54A 1TK3A 4CYMA 4N8EA 4R1QA 5FBRB 2HPZA 1OZAA 1SURA 4OHVA 3HCEA 4M2LA 1CY1A 1WUIS 4QFDA 2A59A 4GZMA 4MPPA 3SBXA 2NYAA 4FGJA 1JI0A 3MC1A 4P0QB 4WLOA 3CUTA 3M6IA 1E8NA 1GR0A 1LX6A 2JAQA 3JPYA 3FWKA 4P58A 4PV7A 4YMSA 5FWYB 5JSYA 2C7PA 1L5WA 3II6X 4KZKA 4ARCA 4M9UA 1PGJA 1IC6A 2RCYA 1N9GB 3AI3A 4MEAA 4COOA 2YOGA 4UM8B 1HDOA 1CDOA 1ZNZA 2YBDA 3R24A 1T1EA 1ZSYA 4FKBA 4G1FA 1GTJ1 1JEEA 2F9FA 4HOYA 5FD8A 5G4KA 3E8MA 4R2KA 2MCFA 4L5YA 4AAYA 1IBLB 2PL3A 4I0WB 3FNGA 4FNGA 4X8OA 4XGRA 5C8YB 5HX7A 4JLBA 4X8LA 4ZO8A 3S2IA 1X7ZB 4ACBA 3AVOA 5E4TA 1EVIA 2C4NA 3FSGD 2BKAA 2O1SA 5FAXA 3URMA 2Q9AA 4BQIA 4XRGA 4QG3A 1I7PA 1PJLA 4CR6A 5EWLB 1YMQA 1X1AA 1BMFD 3L8MA 4S1VA 3RTDA 1C2YA 5HZHA 2D5BA 2GLTA 3KAQA 2W6IA 1SQFA 4KDFA 4BGUA 1MX5A 4CCWA 2VL7A 1ZMOA 4JP2A 4XQ9A 2H4HA 1LBTA 2XF8A 1EFVB 3VR1A 4CEIB 2IGBA 4NK4A 4WBSA 1I24A 1JEQB 4MQFB 1R4AA 4OREX 4WECA 5DKFA 4AO7A 2W83A 3KX2A 1IN1A 4BAUA 4HDNA 1DXYA 4DJEC 5K0ZA 2W11A 2AVDA 2X8JA 1S3IA 1ADFA 4F85A 5T6BA 2ZEJA 5CK4A 4DQVA 5JXJA 1ZCFA 3CLKA 3DAOA 5L40A 2B2CA 4P4TA 5TC4A 3N28A 1QHYA 2AYXA 3LGAA 4KQ2A 4D4GA 2I6GA 5JU6A 1N6OA 3T95A 4V3CA 1UEIA 1G3MA 3B51X 3JALB 3U31A 3E5RA 3NIGB 2CD9A 2JBAA 2MJLA 1SULA 4X00A 4E0BA 3VYUB 4XVUA 3NUQA 3K2IA 2Q6KA 2J30A 1LBSA 3LXXA 4YRTA 4E46A 5LD2B 4EDHA 2NUTA 4M54A 5AQEA 3PK0A 4UDNA 1I33A 4CDMA 2JZNA 3TBKA 1LC0A 3NR2A 3WADA 2QJOA 3CNEA 4ZGGA 2WVHA 3SF8B 1K3FA 3VV3A 2IOFK 3DKRA 4CF5A 3K71B 2HF7A 2O2HA 1TT5A 3H4TA 3Q88A 4P4LA 2JFFA 4XDZA 4P92A 1PWHA 1QIHA 4PO3X 3A6GA 1Y9AA 4B4WA 4BQRA 3DTVD 4IYJA 3O92A 5CB4B 1P7PA 3H2IA 5ESRA 1G3QA 3MGKA 1QE5A 4KN8A 2BKXA 3JPWA 4QOSA 5F76A 2WD7A 5AW8A 1G6KA 4K9LA 1K97A 2VP5A 1HT0A 2CCGA 4NZYA 2EFEB 1QF6A 2CXHA 4LNUA 1MIOA 3ODGA 3VU9A 1L8QA 1M34E 2Z4RA 4GZLA 4TX1A 2Z8ZA 3V7WA 4ZCPA 3MEQA 2FEWB 1MQ9A 5D1NA 1DPFA 1OQAA 4HMQA 5BN1A 3OQMA 1V9CA 4W5TA 3KLOA 1X77A 2VHQA 3BL5A 2WJ6A 3QPVA 4DMUB 3I5XA 2CXPA 2PA0A 4Q4JB 1XTBA 1J23A 3HCFA 1TJ4A 1F8UA 1FJGB 1VKZA 2J0UA 3JYNA 3AUSA 3MXTA 1M2EA 3KT3A 1N1EA 5M34A 621PA 3GGOA 1BC5A 4M37A 5G0SA 4HMPA 5IW8A 1VOTA 1GLGA 4Q9IA 3EW7A 3IH5A 2YYZA 4C0KA 3AW9A 2VN8A 1NVTA 4OFXA 5TX7A 2AN3A 3VHQA 2YDXA 2HWYA 4BZQA 4ESEA 4EMSA 2IY8A 1GCGA 4WTOA 2NO6A 1OFTA 4QUIA 4RK7A 3IO5A 3HHEA 2GN9A 1Z07A 4NZNA 1UKVY 4AZVA 5KOJA 1RW4A 3F6RA 4JBHA 1L1EA 4KODA 4EB0A 5LP1A 4R8MA 4UUBA 3QXHA 2ZI5A 1OHHA 3EPHA 1MAVA 3IKVA 4PNPA 1XP8A 1DG9A 1SPBS 4J0JA 4YHBA 4ZA2A 1CJSA 1FFEA 2GNPA 2GEUA 2GO7A 4FYMA 4EI9A 5JO0A 1T8WA 3FWNA 1SCNE 1BD3A 5DXFA 3U4HA 2BELA 2D5AA 2Y1XA 3DEAA 3KL2A 3QFTA 3WMGA 2WMNB 1KEEB 1OXUA 3E3AA 5IEBA 2Z2IA 1FXUA 1SEPA 4KDEA 2NXCA 3FYCA 3ZU2A 4UEJA 3GP3A 4R2HA 4CMHA 3I62A 1T2FA 1WY7A 3ETJA 3ONFA 5KYWA 1EUYA 4IHAA 5E7IA 4AJKA 3QLJA 4CT4B 3E70C 1N1DA 5TPZD 1XPJA 5K2OA 4HD8A 5JISA 2ODNA 4OF4A 3BWEA 3TAXA 3WWZA 4Z4CA 5B7GA 3B1ZA 2Y93A 3FTFA 4QDXA 1GQYA 4KJXA 2Q3HA 3W5CA 2AIRA 3UW3A 4PZDA 4ZVNA 5B1DA 4QATA 5A02A 1ZL2A 2IPOA 4ZJUA 5JCJA 1USVA 2EAUA 4HMOA 4AN1A 5E4YA 1QYIA 2OCPA 3MMSA 1MO2A 3WY9A 4DJAA 3EF3A 2VDPB 4BLTA 2ROQA 4QA9A 1EU1A 4V0MA 4Z7QB 1NN3A 2RHDA 1U3FA 3HDHA 3VKWA 2HMSA 1Q1AA 2HRBA 2NTVA 1ZDMA 3O73A 3SM3A 3QUQA 4YMWA 1L5RA 2EGUA 5TSDA 4C6TB 1SCBA 3O4GA 4G5YA 2ETVA 3CX6A 1C3EA 1T4DA 4RZ3A 5COBA 4BYMA 5CB4F 2YFHA 4F4HA 3VYVA 3AG5A 3LKZA 1V71A 2XAUA 5DYGA 3OZXA 1EPUA 4I4CA 4RY9A 2ENUA 2J9XB 3S81A 3QPUA 4Q7JB 4A73A 2YHAA 3KEFA 4EELA 2ZWVA 3PQCA 3KKZA 2CLFB 3TAHA 1N5OX