2OC9A

Crystal structure of human purine nucleoside phosphorylase mutant h257g with imm-h
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
284
structure length
278
Chain Sequence
b'MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANGEEVLAAGKQAAQKLEQFVSILMASIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Neighboring Group Participation in the Transition State of Human Purine Nucleoside Phosphorylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 278
sequence length 284
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oc9A00
1ODLA 1Y6QA 2IQ5A 4WKOA 1PKEA 1PR2A 4F1WA 1YBFA 1YRYE 5ETJA 5F77A 4MCHA 3OZEA 4WKNA 3T94A 1Q1GA 4MARA 3BJEA 4RJ2A 5I3CA 5F76A 1T8WA 5EFOA 3UAZA 4X24A 1Z39A 3F8WA 5F7OA 1NW4A 4LDNA 1JP7A 5KB3A 3O4VA 3PNPA 4L6IA 1A9OA 4LZWA 4OJTA 4GMHA 3K8QA 5B7GA 2A0WA 1PWYE 1V3QE 1G2OA 1RXCA 1RSZA 2HSWA 4DA7A 1U1EA 1K3FA 1RT9A 2B94A 1YQQA 3P0EA 3K8OE 4F2WA 5F7XA 1TCUA 5B7NA 3ODGA 3SCZA 4D8VA 3U40A 4JP5A 4WKBA 1A69A 3PNSA 3ONVA 1JDSA 1OV6A 4DA0A 2QDKA 1PW7A 4H1TA 1V45E 1RXYA 4KN5A 3UAXA 3DP9A 2QPLA 4YO8A 1OTYA 3KU4A 4F2PA 1Z36A 2OC4A 4YMLA 5IFKA 3UT6A 1QE5A 3PHBE 3E9ZA 1PK7A 3OZBA 1JE0A 1A9PA 3UAWA 1RYZA 3UAVA 3DPSA 4R2XA 4TYMA 3OCCA 2A0XA 4TTIA 3FB1A 1OTXA 5F73A 4YNBA 5EPUA 1Z37A 1TCVA 4GKAA 4R2WA 2I8AA 1LVUA 4L5CA 1U1DA 1Z33A 4G89A 5CXQA 4TS3A 2HRDA 4TXNA 2HWUA 4IP0A 1ODIA 1K27A 3KVVA 1ODKA 1Y1RA 1NC1A 1T0UA 2H8GA 1PR4A 4DANA 1Z35A 3EEIA 1PF7E 4EB8A 3OPVA 1JDUA 1LX7A 3FWPA 4LNHA 4WKPA 4F3KA 1Z5OA 4NY1A 4JWTA 1Y1TA 4ECEA 5JPCA 4L5YA 4L0MA 3KVRA 1Y1QA 3KUKA 1OU4A 3NM5A 2QSUA 1T8YA 1V4NA 2QTGA 1K9SA 4QAQA 1PR5A 2Q7OE 1Z34A 4TTJA 3C74A 3QPBA 4UC0A 4TXHA 1N3IA 4QATA 2AI3A 3O6VA 4G41A 3GGSA 4DAEA 1SD2A 3P0FA 5F7ZA 1LV8A 3EMVA 4PNPA 2HN9A 4TXJA 1TD1A 4BMYA 3NM6B 2OECA 4QARA 2QTTA 5CCDA 3OOEA 4DA6A 4R31A 1ULBA 1JDTA 3MB8A 4GLJA 5IU6A 5CXSA 4QASA 4OY3A 1OVGA 4D8XA 4M3NA 1RR6A 3MMSA 3OOHA 4BMXA 2ON6A 4M1EA 1RXSA 4EARA 4OGKA 1V41E 1VFNA 3OZDA 2RJ3A 1Y1SA 1NC3A 3OF3A 4NS1A 4GLFA 5B7PA 5F78A 4F3CA 3NBQA 4TXMA 3ENZA 3NM4A 1ODJA 4D8YA 1YR3A 2ISCA 1VHWA 3IOMA 3DJFA 1FXUA 1YQUA 1SD1A 4TS9A 4DABA 4PR3A 4L5AA 2AI2A 3FNQA 1V2HE 3OZCA 2AC7A 4M7WA 3BL6A 3FAZA 1M73E 4LNAA 1SQ6A 1JDZA 1U1GA 1SJ9A 2OXFA 5CYFA 4FFSA 1PR1A 5FAKA 2P4SA 1JPVA 1CB0A 5K1ZA 1VHJA 3DDOA 3UAYA 5F7JA 4YJKA 5CYGA 2AI1A 4DARA 5EUBA 2XRFA 4DA8A 4G8JA 4OF4A 4QFBA 3FUCA 3BGSA 1RCTE 4QEZA 1RXUA 1V48A 3E9RA 3EUEA 3PHCA 4BMZA 4TXLA 4OEHA 1I80A 3LBAA 2A8YA 4NSNA 1B8NA 3LGSA 1T8RA 4D98A 1T8SA 3BSFA 1ULAA 1C3XA 1ZOSA 2PGAA 4WKCA 3GB9A 4BN0A 1VMKA 1PK9A 2A0YA 1Z5NA 4OGLA 4P54A 1U1CA 1A9SA 3INYA 1U1FA 2BSXA 1RFGE 4JOSA 4LKRA 1PBNA 1TGVA 3TL6A 2GUWA 4DAOA 2OC9A 1JDVA 4TTAA 3KHSA 1JYSA 3DF9A 1A9RA 5C80A 1PR0A 4E1VA 1A9TA 5DK6A 1Y6RA 2I4TA 3LA8A 4U2KA 1JE1A 5B7QA 1PR6A 3D1VA 1OUMA 1CG6A 1ZL2A 1B8OA 4MCIA 3KVYA 3IEXA 3FOWA 1WTAA 5CCEA 1ECPA 1XE3A 3EUFA 1Z5PA 1TGYA 1A9QA 4D9HA 1Z38A 4K6OA 4I2VA 3E0QA
chains in the Genus database with same CATH superfamily
4ZXPA 4MQUA 1GRQA 2F8MA 3RSHA 3PC7A 1PKEA 2RAFA 4MW5A 4I0WB 2R79A 3A9UA 3FWNA 1TUGA 4R3WA 5J23A 2E49A 2XUDA 3T4UA 2C9DA 1VHTA 2K4MA 1M74A 3O5AA 1HMPA 3MERA 2KLBA 2LD4A 4HJXA 3QZUA 4GNKA 1XGKA 4RGBA 3MJFA 3ONWA 3PUZA 4BMNA 2DR0A 3C85A 4OK3A 2PPLA 1MD9A 5F1YA 4CV1A 2O8DA 1GZ3A 3B5IA 4G9EA 4KG7A 3PDWA 4MARA 2YRFA 1IDN1 3TTVA 5C35A 1HF3A 2ZBUA 1ZGGA 4PVDA 1SOMA 2FR0A 1E9FA 2HMTA 3DE1X 1M6EX 2R87A 3G2QA 2YUTA 3AGQA 3GI1A 1CUFA 1HI9A 2P0AA 3F6YA 1XG5A 1I1NA 4PGHA 1TM7E 2XNKA 3C14C 4G56A 1CDDA 4N9QA 1ORTA 3OEHD 2QL9A 2QSYA 1ZZEA 2E2WA 5EGSA 3WGIA 3SSAA 4LY9A 4N7RA 3HBLA 1GKLA 3UANA 3WGOA 2II6A 4OJTA 2PBZA 3PHIA 2AGVA 4GC5A 3A3YA 5HRUA 1WY5A 1VL0A 3K8QA 4UE3S 3KM0A 2FUG6 3W2EA 3PFIA 1P0IA 3P5SA 3PQ2A 1RHJA 3ZQJA 4KLCA 5JUWA 4ZYXA 3SOZA 4MR9A 4R83A 4W5HA 4YONB 2IITA 4ZRNA 1P7ZA 4EGAA 5JDIC 4C7OA 3NUZA 2V7PA 3D3KA 2HADA 3EGVA 5LOVB 3HA2A 3E7WA 2B94A 1YQQA 1OXKB 1SG9A 4L8LA 1QK3A 3RRZA 3RW9A 1YHYA 5KSWB 1NHGA 1QJ4A 4V0LA 3O74A 2FW9A 1QYCA 1ZN9A 2O50A 2OLKA 4TMVA 2GZMA 2Z6VA 4HBZA 2RHWA 2OO3A 4QFDA 3HFJA 3WG9A 4G4GA 1SXJB 1YOVB 3DKVA 4B73A 5DW3A 4K0KB 4MKFA 1PFWA 1N7HA 3BDVA 1XWIA 4HH1A 3PVSA 3GFBA 4JUAA 2GKOA 4CLEA 2W48A 3IUPA 4IY1A 2WVJA 4PX2A 1UBEA 4Y2HA 1U0BB 1FNNA 4KXLA 2XHZA 2ZSHA 2P2NA 3NVAA 1JR3E 4AECA 5I51A 3L8HA 4NX2A 4B2LA 3FGZA 1F2UB 3ST7A 1S7GA 2XECA 3G8BA 3KEQA 3S99A 2Y1GA 3WO1A 5JH7A 4WFQA 4CKWB 1DC7A 4L22A 4E70A 4Y7DA 3B1XA 1KZHA 3LP5A 2QIOA 1OTYA 2Q4EA 1OXTA 3H4TA 3HDTA 2W0SA 3QUBA 4HMQA 4P80A 5TR9A 3H5VA 2AQHA 1T34A 1NFRA 1MF7A 3HJTA 3LQ2A 4PG4A 4QEDA 1JKJA 2RHMA 2VWPA 1L7EA 3DDWA 3HY6A 1E6EA 4F93B 1ODSA 3WGNA 2FJPA 1FFAA 2GHTA 2QPOA 2W8BB 1JTVA 3NR2A 2DHRA 1UAGA 4KXVA 4LBVA 3GH1A 4O4LB 5T4BA 5JCZA 2ODPA 4G5OA 3CWCA 1A9PA 1H0SA 2WB4A 4FJ2A 3RB8A 3URKA 1QHHA 1L7AA 2PFGA 3H65A 3O21A 5JYDA 1KIMA 2C84A 4TYMA 2JIBA 1MEJA 4MQMA 4POOA 3NQ41 2VAVA 1QSGA 4PTYA 1K5DA 2QD1A 3MWJA 2ROQA 4XJTA 2FFBA 4YNBA 5H0IA 4LTDA 4QO7A 5AVKA 5A6VA 2D0DA 2AOUB 1I3LA 1IOWA 4FLFA 5SZHB 1TRHA 2J41A 3PC3A 4GSYA 5HJEA 1AKEA 1E3QA 1LVUA 1TAGA 4G89A 4ZEXA 5KOHA 3L1HA 1S89A 4JZYA 4KOEC 4PVCA 2QJWA 2GZAA 2WJ4A 4B71A 2ZUUA 2WKSA 3FD8A 1NATA 2JFNA 2GXAA 1N5OX 3C41J 3AF4A 3CUUA 2FG5A 1GKUB 4HNSA 1DHTA 4RQTA 1H6AA 4JLNA 3BMOB 4GX2A 3PDJA 1VGQA 3BF8A 1KQFA 2ATCA 3C98A 3FF1A 3FVRA 1UZLA 1PF7E 1BCRB 1UMKA 2YY7A 4EB8A 5IWCA 4C89A 3GLUA 4P53A 1FYWA 2P77A 1AO3A 2R1TB 4H7IA 2VRCA 4WLOA 3D4BA 3CRZA 3SMQA 4IQFA 3IT0A 1I1QB 1XVUA 2XUJA 3RSOA 3SNKA 3SLKA 1LS1A 3B8EA 1B0UA 2HK6A 3S8EA 3OX3A 4RKEA 4YXWA 3SQNA 1MZVA 3DXYA 1E66A 3N07A 4JSRA 1J20A 4JT2A 2KWIA 5KPJA 2BBWA 4IIDA 3MTAA 2O2JA 3TD9A 4YECA 4ZDJA 3WLMA 1MOQA 1CUGA 2QXYA 4P98A 5CK4A 2UZ1A 4G85A 1XKTA 2PXCA 3IIKA 2GXQA 2GXUA 4UKDA 2NO6A 3AXTA 4G1MB 3B9RA 3IA2A 3D43A 4XX1A 5H9VA 3RTEA 4I50A 4B34A 2VXBA 1QGED 5K3SA 5BUCA 1GTL1 1H4VB 3O3CA 1VJ0A 2AF4C 3HE3A 3L6CA 3ZCQA 1QVWA 1Z73A 3IVCA 5EXTA 2PWPA 4BNVA 4KSCA 3JZAA 3IELA 3S5UA 1YS4A 4ZCLA 5TEWA 4MWDA 4OKSA 3N58A 4DLVA 5LZ8A 4N0EA 1J8DA 4X7MA 1NZFA 2E1RA 3WB2A 2EZ8A 1ZJWA 5TVGA 3UWKA 1P7WA 3IP9A 3H1BA 5TS3A 1NX6A 1RHMA 2CHGA 2J85A 3B70A 3DYIA 1M6YA 4UC0A 4LGCA 2P6RA 3WL7A 5DM0A 1G19A 2W2KB 3GLHA 1KI1A 3H9JA 3MJ4A 3I09A 1SKYB 1IZ9A 3EWAA 2BIFA 4OHXA 4LF8B 5G40A 4BOYA 2JLZA 3IIJA 1QGAA 5IZ4A 3ROZA 5HRCA 5KYYB 1X7YB 5ILGA 4EB0A 2NUPA 4EJSC 3GJRA 1LPSA 2GN2A 2FSVC 4M0EA 4P3KA 5KMGB 1D1PA 1YC5A 3H13A 2OZVA 4PSAA 2QTBA 2YZMA 4DAEA 3ZDYB 3Q2OA 4ZI5A 4BCCA 5JC8A 1SD2A 4LXIA 1JRLA 4M9ZA 3ZLJA 1VBKA 1EX1A 1BVYF 3EGXA 1E3DA 1U0TA 5NULA 1TA4A 3ZHBA 4H1UA 2PTHA 2W2QA 4TTTS 5HUJA 4PZAA 3OQMA 2OAP1 3AUJB 4R7TA 2RDMA 1N2EA 1Y9DA 1ZK2A 4HMOA 3NRJA 4FMPA 4YHBA 3ANNA 3NM6B 4Y6RA 3W79A 3WMFA 3WYBA 4FHDA 2PYIA 2Z5LA 2HXYA 2QTTA 2X0RA 4JX8A 4M0CA 4MLCA 5K3CA 3GBVA 1WEKA 1ULBA 3QEJA 4X7PA 3V4FA 2Z2JA 2WSSA 3K73O 1C7JA 4WZAA 4D5EA 4BJHB 3V8BA 3W7VA 1OI7A 4HL6A 5TXGA 2VSXA 2Q0QA 2GO7A 1CB7A 1PNQA 2ZYTX 4I08A 4UD2A 1E9SA 2H5IA 2XIJA 4ZT7A 4BZQA 3RYHB 5KZMB 5KYTA 1IXYA 4QWMA 4J0EA 1P61B 3PFCA 4ENUA 2ILTA 2WIDA 1WSAA 1JN0A 3PGVA 3AYXB 1LRJA 3KHKA 2VZ8A 3MTBA 1ZC4A 3PA6A 3D3WB 4B45A 5AUNB 4UZEA 1VFNA 4Y2YA 2QROA 2NXNA 1TMOA 4OA5A 4RH0A 4EKDA 3SQWA 3N5KA 2I6XA 3CWQA 2HZBA 3EOBI 1RQ2A 4JUDX 2ZJ3A 1CRQA 3KAKA 1NNI1 2Q5QA 5DOVA 3ZYCA 2GBGA 3LT5A 3DV9A 2E4AA 4IIUA 4Y8VA 3T06B 3TG8A 3RWBA 5CVCA 2BMFA 3LVFO 4I55B 4BFSA 2YV3A 2AX4A 4KVAA 2ZI7A 3DDNA 2HDHA 4HGYA 4IG9A 2Y0BA 2ZSBA 1W5EA 3SICE 4PSUA 2ZRAA 2NO9A 5KQGA 2O14A 3IR7A 4KO8A 1GZ5A 3OC6A 3QFCA 1R4MA 1L6RA 3PXDA 2XNCA 2ZJBA 4XIFA 1QFZA 1T5LA 2QB5A 5C51B 3G0IA 3MTIA 3G0OA 3N3BC 2XE4A 3CZQA 4BV8A 2ZAGA 3WZMA 2G77B 2C5HA 2FSIA 1SXJC 2VYVA 4HDRB 1KYWA 4QYSA 1B7GO 3R3SA 4G5XA 4RIHA 1EUYA 3O9ZA 1F1BA 3IOMA 4NCKA 1P9RA 1UJMA 2I87A 3M83A 4OMDA 1NVKA 3FVWA 5K0TA 1PJ4A 1SKAA 4LYJA 5CLLA 4TT8A 1MHPA 3IDQA 5SYAA 4D7AA 1U5BB 1B6RA 1JBKA 4RA9B 2JGDB 1V2HE 2QW1A 2UZ4A 4Q1EA 3E0XA 3T7IA 4YGYA 4ID9A 4KN8A 1E9DA 3EGDB 2PKCA 1MX3A 3GAMA 4WOCA 4C04A 5CDGA 3I5AA 5KHOC 3QUQA 4KIGA 3BULA 2PG3A 2VYQA 4KO2S 2X4IA 1SEVA 4EPWA 4QUHA 4CMIB 1E1QD 1QS0B 4CQJA 5L9AA 1PWHA 2PQ0A 2XDQB 3AG6A 3MTQA 1KYIA 4N48A 1H22A 3KC2A 1PR1A 4R1OA 1NMZA 4LJLA 2GPJA 1CVRA 3UJAA 1R0ZA 1YR1A 3SR3A 3DDOA 4XDYA 5CGZA 1J25A 1YE3A 2RHOA 1AX9A 1GFWA 3TSCA 2QTCA 2XYPA 5L3RA 3T3NA 1BTOA 3X2SA 1CCWA 3HO1A 4N82A 3ICEA 1O7JA 1ZI9A 3ZZNA 1GYQA 4I6JA 1R6AA 1VP3A 4KQHA 4MWTA 1UKBA 1EJ0A 3C43A 2FB9A 3SVZA 2H5JA 3DMRA 2YHIB 2E9SA 2CLLB 2GLXA 5K6AC 2CLHB 2WD7B 1JHVA 1KIFA 3AU8A 4H7DA 3W3AH 1GRVA 2PKQO 4OF4A 2WWFA 2GM5A 3MCAA 3PUKA 4KX5A 4Q9JA 4ZCPA 4EQZA 5IABA 3SEFA 3PXBA 5HNKA 3WLLA 1H4TA 4YB8A 5LQAA 4EITA 3PITA 4TV8F 4FMCF 4BGVA 2M2IA 3G49A 2YL2A 3KOOA 4UEQA 5C34B 3IP1A 3GEGA 3BZUA 4K6HA 5KYKA 2XYQA 1Z74A 1UBSB 2BGJA 5G3ZA 4KQCA 1S9DA 4QVGA 1YA6A 1E5XA 1CHNA 4KDEA 3R9XB 3EXAA 5IWAB 2VPZA 1Y89A 3OLVA 4GYYA 2EDCA 3ZIAA 3TW4A 2X58A 4LE2A 3G2PA 1N92A 4NG5A 3RS4A 2RKOA 4NSNA 2VOJA 1BW9A 1Q1QA 1GM5A 1KJ9A 2X22A 4L4YA 1GXSB 1ORHA 4XCQA 4PX3A 4OHUA 1RTKA 2EOAA 2Q21A 3SN6A 2X0IA 3AZOA 4OJNA 3L1KA 3COJA 2EJCA 2PGAA 3KXLA 4CDGA 5JVDF 3UOGA 4U9HS 4XARA 5AVUA 2AKEA 2MCFA 3KE8A 4RPJA 2MYTA 4WZ6A 4XEUA 4BLQA 1P91A 5AUPB 4B44A 2Y1WA 4RGQA 5ITWA 5JBNA 5KX5F 1EVEA 5F4BA 4LZNA 3OLWA 5GV8A 4R3UC 2D1TA 4HEA6 5IMBA 3REOA 3VYRB 3LZ6A 5HS6A 4ZHQA 5BMVA 4PAMA 1P80A 4KQGA 1DBPA 3QIAA 3WKAA 4UFPA 1A96A 1XZBA 2BFDB 2P8SA 3TUJC 3CW8X 4MR8A 1IN4A 1GNVA 4AZTA 4F5DA 5I8PA 1DCKA 3QJGA 4HNQA 4LKRA 5E3HA 5EJ9A 4QL3A 3TLEA 3G2MA 4LWOA 5CNIA 1M8JA 5FTMA 3AP3A 5BR4A 1GADO 2PZGA 5DGCA 4CMKA 4OO3A 4UDOA 1WUHS 2EL9A 2REQB 5ED4A 2ZSEA 3VTKA 3KHSA 4C7VA 2PGIA 3VR6A 4QPDA 2VXCA 4EAQA 2JFHA 1T3SA 4AF6A 3V4RA 1KAQA 4WNAA 4YPVA 1Z4NA 4E1VA 2BGWA 3A6EA 2JRCA 2I8CA 1MAAA 2JGEA 4XQ9A 1EHYA 3TQHA 3WK8A 4M9QA 1NVUQ 1YKGA 4YJHA 2IUYA 3NMUF 3HNOA 3F2VA 5I7FA 5FI0B 5JNRA 2XBLA 1QH1B 3MUFA 1W8DA 4W5OA 3HYLA 2ZUDA 5KSZA 1KOGA 4XJSA 2FPPB 5BOSB 3VNAA 2UUBB 1Z0UA 4LXHA 4NMMA 2P41A 4LRUA 5A4KA 3ZBTA 1GAXA 5TF4A 1Y1PA 2PO7A 4PHFA 5FTNA 1NOIA 3ZCUA 2LIVA 4S0XA 4ASUD 5BSUA 1ZL2A 4FFPA 4CNQA 4P38A 4CM5A 4AZ0A 1U0HC 2LDBA 2Z6AA 3BXGA 2PSEA 1EKXA 1N5JA 3DOUA 4GKVA 3W5VA 5CD1A 3HWSA 5CCEA 2O3SA 3VISA 4BMVA 1W7AA 2P4EA 5TJ9A 2QTHA 2G70A 3QEAZ 1UDWA 1XZMA 3OA0A 6AT1A 1EVYA 5JZOA 1EK1A 2NO5A 2Q0XA 3FTPA 1NYQA 3GJ8A 3KTOA 5BSMA 3MJRA 4M49A 5A9TA 3AERA 3HDHA 4HMPA 3KZXA 1C8VB 3QBVA 2NTNA 3BILA 3HU3A 3OX2A 4CNBA 2IQ5A 2OBLA 1MENA 5DIZA 3VNVA 2QAIA 5K0BA 2DHCA 3O26A 4AJ2A 3A6FA 1E9EA 4MKXA 4WFKA 5CJ2A 1T5DX 4YREA 5TGDA 2CT8A 3S7ZA 4ESEA 3JS5A 2PKYX 1Z8DA 3O03A 1JZQA 4F45A 4Q1DA 3F9IA 2E18A 1UOEA 3HA5A 5JDCC 3ZZ1A 1V37A 3ECSA 1TUBB 4RM2A 3R7BA 5BNTA 4JITA 1GQQA 4TS1A 1JH9A 1QB8A 5BSVA 5B1IA 2PZKA 2YTZA 3BIFA 2JBWA 4PSKA 3T99A 4RESA 2G9QA 2GESA 3HM9A 1VDMA 1O95A 4GZ6A 4PQFA 4MPTA 4CM4B 1ECJA 3AKZA 5IS2A 1Z0IA 5IJAA 1ZUNA 3L4SO 1E62A 3QVTA 3QXXA 2BFEA 4PC1A 1R0WA 4KREA 2WUDA 4RZIA 2EF1A 4URWR 3CC8A 1QHXA 4KXQA 2E85A 1XROA 2VJPA 2PNFA 2DQ4A 3OPXA 3S2GA 5G53C 4CTMA 4X84A 4ZIRA 5IJ0A 2PEZA 3DMGA 5JH7F 1JLLA 4PFSA 5D87A 3DTYA 1E4VA 3PG5A 4CQMD 1TVKB 1F5SA 1LUAA 3IPAA 1TYBE 3GU3A 3JQDA 5KTNA 3FZEA 1VYTA 1O03A 2JFBA 4BNKA 1XTJA 2P90A 2C8JA 3GEBA 3OQ6A 2XQGA 4IFTA 2AHRA 1THZA 3ZJ5A 3U6KA 3OF2A 5BVHB 3FNHA 4JI3B 1CIPA 2OV3A 1EVKA 1T4CB 2BMAA 1J22A 2W9XA 3P20A 1WR8A 3QX3A 1DC3A 4WPGA 2IP4A 2ISQA 2V5VA 5SY9A 5JWRA 1PFKA 4QYIA 3PDCA 3RTBA 1DG3A 3H84A 4DLNA 3KYCB 4CIBA 1Z4PX 2WM9B 1ABEA 4WN9A 5JNWA 4HUQB 3V4LA 3HZOA 5A4FS 1PE0A 4WKBA 1EX7A 4IQGA 4TSFD 1JECA 1EP1B 3ZOZA 3IQDB 2A3RA 4UHHA 4UXJA 4I3HA 4YAJA 1P81A 2CXOA 3Q7QA 1RQGA 5JBIA 3IL2A 4BP1A 4C6RA 2N47A 2NIPA 1PTJA 3TS1A 1CYEA 2ODWA 1A8SA 4H1TA 5C32A 3ZDFA 5BQ5A 821PA 5BPFA 2ZU6A 4X3CA 3W9YA 5CBKA 1C7QA 2HPAA 4WBNB 1CE8B 2FETA 4MVWA 3TJMA 2QVYX 1Q50A 3R5HA 3UAXA 2QVLA 2FDCA 3RTCA 1Q3HA 2YVAA 3HO8A 1E7MA 2XCOA 4MROA 1ZZGA 4K3UA 4NYMQ 1EPUA 3FCEA 1MQAA 2QRNA 5BV8A 3U60B 5BSKA 3CRW1 3PQFA 4WY5A 1KFEB 2YIMA 4MAMA 5LA6A 1RBYA 2MU1A 4NCXA 3PDIB 3F46A 3NEAA 1NVAA 3MG9A 4Y18A 1YJCA 4TKUA 1TI7A 3A6JA 4MV6A 1GPWB 1SUDA 4J76A 2JKVA 1U8CB 1KEVA 2ATVA 4TM7A 4A9AA 2L69A 2DFDA 5EKSA 4CMGA 2ECQA 3QPDA 1RYZA 3O2NA 5I9SA 1VPEA 1U7WA 2EIXA 2D00A 1EDEA 4GPEA 5CJPA 3V55A 4JBYA 3W6UA 4ITRC 4NABA 2EARA 3HSKA 5F73A 3T7JA 5IF9A 2KYRA 3MBKA 2RI1A 1TCVA 3DT8A 2O2CA 2B4AA 2D8MA 5DGTA 2HSZA 2YWDA 5HKLA 1RJGA 4E3WA 3DHWC 1WU7A 1V1JA 1LNSA 1P9OA 4B8WA 1OKKD 4DC1A 1R8QA 1YUNA 1FC0A 1ZJJA 2P9YA 4DM4A 1X8XA 3TFQA 5M2QA 1H1DA 4BHTA 1HY3A 4GBED 1B74A 1COZA 1UJBA 3ILSA 4I14A 3LKBA 4M1SA 3KXPA 2C5FA 2WKQA 3KIPA 1N3LA 1E63A 1XPUA 4I50F 2YFHA 2XD4A 2FE4A 4JH0A 3MAJA 4OQXA 2GTHA 1Z35A 4I1IA 4JSYA 3FWZA 4R9UC 1WBJB 5E6RA 3FDZA 2F1HA 1X9GA 2RFLA 4JXXA 1KERA 4P4UA 1A7AA 1E2LA 3EDRA 3KQQA 2C57A 2UXBB 3VR4D 1EGQA 1O97C 1BX3A 2FK8A 1Y6FA 1RPNA 1V43A 3G85A 1YI8A 5HKOA 2E0IA 3DZDA 1KKUA 3Q3HA 4L85A 4OQEA 1GYRA 1WIWA 4TYQA 2CB0A 3A3KA 3EC1A 3KSDO 3GFFA 4NNPA 2FXIA 2XVMA 1IUOA 5JS8A 3HBFA 3W06A 2VCEA 1UEXC 3C5VA 3Q7IA 3VZDA 4CLOA 4ND7A 1PX0A 3DMTC 3PUIA 3BHIA 2QSUA 1NP3A 7MDHA 4KXMA 4ZO7A 1GUFA 2W98A 3LJKA 3L04A 2YMLA 2DRIA 3JQCA 3P4UA 4CM8A 3JQGB 4ERXA 4G8DA 3U26A 4IMJB 3GJTA 4XM1A 4F7WA 3THYA 3FZNA 1YI0A 3FUUA 4YK7A 3LBYA 4P93A 3ME5A 4JLSA 3PFNA 3GFRA 2TMGA 3AHIA 4WOJA 1U3UA 2AYYA 4XASA 5HHTA 2HLDA 3P19A 3P52A 1E94E 3A06A 5K0CA 2X2OA 3WQSB 5TQ2B 2HSDA 4NVRA 3E3LA 4MYRA 3FPCA 5AXCA 1JX6A 2VATA 4ND3A 3HUTA 1BHO1 1EFPB 2OFWA 4RK5A 2GFHA 3PWZA 3CH6A 3L7NA 4TWAA 4KPGA 5HKKA 3CZ4A 4OYLA 3NXSA 2CL0X 5LBUA 3B6JA 3ZCPA 3LY5A 1RS0A 1DRJA 1QAOA 4KHZA 4DTIA 4JB0A 4JMLA 4M88A 4EG4A 4UHKA 2OV8A 1NG9A 3EX7C 3O8QB 2P6PA 2HDNB 3MS4A 1W0KD 1TM3E 1FBTA 4MSUA 1W9HA 3ECCA 1N5KA 3O84A 1ZD1A 4K88A 1LQ2A 1V47A 3P0FA 4LVCA 4N49A 5CGQB 4DDTA 3QV2A 3JQ9C 3KSMA 1IRXA 1H4QA 3H9EO 1SKMA 1BKDR 1VPDA 3NHKA 1BN7A 4LZLA 4Q4HA 5FWYB 5BYBA 1AF4A 3LPAA 3UCXA 3IEMA 4XDZA 1RYHA 4BVAA 1E5LA 1TD1A 1Y4SA 4F8YA 1AS3A 4TWZA 4UTZA 2F64A 2C31A 2Z57A 3LP6A 4NATA 1T13A 2WD9A 2OECA 1UDCA 3EVGA 3LHDA 1DAOA 4LRYA 3RVBA 2BD0A 5FV7A 4DA6A 4R31A 4ZI7A 5JO0A 1XD2A 2CCGA 4HAOA 3PT5A 2CY0A 1QO9A 3GZ4A 5CXSA 2NLOA 3S2UA 5BVGA 3JALA 4KUGA 4ACBA 1XA0A 2AW5A 5DSZA 2VZ0A 4E7PA 2Y1LA 2R2AA 1E6CA 2ZDQA 2FMTA 4LF5B 2HMAA 3AW9A 1DG9A 4J43A 5HG0A 5GZ3A 3M3HA 4OHFA 3H6GA 4MRRA 5A4IS 2A57A 3KWLA 3L7IA 1AT1A 1G5QA 1QTRA 4BFXA 2JL1A 1ZISA 3MTEA 3NEPX 4RVSA 1ORVA 2CXPA 4FWIB 3A04A 3OAAA 4UUPA 4YRIA 1T9BA 3CF6R 4X8HA 2HRRA 1U9JA 4DR6B 3L0IB 3LCJA 1U0JA 2Q6LA 3BIXA 1BMFD 4AY6A 4O4HF 3VTFA 3GA0A 5B58C 3QOXA 2B36A 1IAQA 1WXFA 4HB0A 4IMIB 4UMVA 5F23A 1L1QA 1UKAA 2CMHA 3TD2A 4AX8A 2QNRA 3VTAA 4CG0A 3YASA 1NJ8A 2D0OB 1I5RA 4R0MA 3DV2A 5BN1A 1JXMA 5HOQA 3IBGA 4I1UA 4OJQA 1NY5A 2ZW9A 4PBRA 2YV4A 1WW2A 2FEKA 2N42A 3E5NA 4QYXA 5E4JA 1N2JA 2AC2A 3RT9A 2EBWA 3R0VA 3KWMA 4P3OA 5K3BA 3ZW9A 1SBHA 4GI2A 3BEDA 3U9TA 5JNVA 1RWMA 1TQ6A 3COPA 1TAHA 4QGFA 3RLIA 2LDXA 1VKRA 3MT7A 3D0OA 4GXRA 4O2AA 1W88B 4ZZ1A 3K9FC 3V8MA 1FJHA 4HQFA 2VHEA 4UU0A 1V8ZA 1DFIA 3K09A 3KO8A 1VKNA 2QMOA 3AV3A 3WSVA 5CITA 5H4GA 4PLHA 3VC2A 2OCYC 3CGGA 4KH0A 5I4BA 3LFTA 1ZR4A 1EX6A 1YB1A 5KCMA 3ZTYA 1JAIA 3GJ3A 3OC0A 5KTTA 1FSPA 5JSQA 3WC4A 3KS9A 2OO5A 3KSUA 3GLHE 1WXEA 4R81A 1R18A 5JXWA 4EUKA 1Z0KA 3GP3A 4B33A 4EVSA 1FXWF 3DAYA 4NEHB 4BNHA 1G7CA 5JG7A 1CIJA 4PZDA 1GG8A 1GCGA 5EKUA 2J45A 2GCOB 2IZZA 4TSKA 4QA9A 3SE0A 3GFPA 5IYZA 2BEJA 1GPJA 1CF4A 4DJTA 1YIOA 3MCTA 3O4RA 4FCWA 2ZRCA 4GEKA 3JQAB 2WU0A 1P0PA 5K0LA 4JJKA 4KIWA 2XOKD 1GNTA 1IE3A 5A4AA 5KKCA 1DB3A 1WZUA 3DZ8A 2XCSB 2DUWA 5EC8A 3W4JA 3PRKE 3SF8B 1E3SA 3KR9A 4CXMA 2ETVA 5B4TA 1FRFS 2R8XA 3H3XA 1LXCA 1RPJA 4KZKA 3VA7A 2CN1A 4ARIA 3MIZA 4D92A 4DY4A 4B4VA 1ZD3A 4HFMA 1EFHA 2CXQA 3HDYA 2V5AA 1E0SA 1NRIA 3R4CA 2CSUA 1Z7YA 4ZOLA 4EVQA 2C04A 3KLMX 3LVRE 1HGXA 3PX7A 3RVDA 1E5TA 1EK2A 3TBKA 1XP5A 4WZAE 3O0DA 2HMWA 5GVRA 1GIAA 4C14A 4FE4A 3WO0A 1JR3D 1Q16A 4HLUA 2AMVA 1QIFA 5EMJA 1XTSA 4I4TB 5BSWA 1Q0SA 5DIFA 4UW9A 1DRWA 3VNBA 1XTIA 4J1SA 4GM4A 4UD6A 4ZDKA 3SEQA 5ICSA 2F00A 2WF6A 1GYPA 3BCSA 1L2TA 1A95A 3CKKA 1GT6A 5I7EA 5REQB 2FSVA 3H2GA 4U6QA 1UWLA 1JEDA 4U7HA 4F92B 4MTLA 4MDFA 2F1OA 5TF0A 4CN9A 1L3CA 2IHTA 3DVQX 1MNQA 2G88A 3TZKA 3WZLA 1P4RA 3MWFA 3LLMA 1SG6A 4CKYA 4CDRA 1NVBA 1B73A 3ISJA 3TBHA 2LIPA 5FTWA 1DAHA 1RVDA 2CDRA 3ZE9A 3WAJA 4Z9BA 4LRSB 5CVJA 1Y82A 1CJUC 4IDFA 2WSBA 1AHHA 4FZ5A 2ZQYA 4GP7A 4IDPA 4Y9SA 5ALIA 1LWNA 1T5TA 2CUTA 4QBKA 2B3DA 1A82A 2QUJA 4NOMA 4CIVA 1MPXA 4MK4A 5AHKA 3PNOA 1Q7EA 1U9CA 3B60A 3AEUB 2B4KA 3DDUA 2JGIA 2VJYA 3Q2IA 4XOUA 5C31A 4EFMA 2V1XA 1YS7A 1C7FA 2WHYA 2BFWA 3KSRA 4KDFA 3DC2A 1RLMA 3F8SA 3H83A 4KWHA 5FP0A 2J9FA 1XNQB 1UMCB 3KPVA 4PNEA 1VM6A 2GZ3A 1TECE 3B2NA 1WZCA 4HTFB 4KODA 3U7GA 5JMPA 4MYUA 1T10A 2ZZNA 2IZ7A 3LM8A 1MGOA 1U63A 4H7HA 1P39A 3IVXA 1E6KA 1GG9A 4OUDB 1J1IA 1EMDA 4YJ2F 1IAVA 2VJQA 3WRWA 3ZOKA 2NAPA 5ICCA 5KYGA 2XJ4A 4AJHA 3K5PA 3R77A 4FYWA 2MWMA 3VHLB 3COWA 3DBVO 4PIPA 2BELA 4OXKA 4BB0A 1X7GA 5DJ5A 4DAOA 2NN3C 2E4XA 1Y5IA 3AR8A 4FPXA 4Q3LA 3WKBA 2O23A 5LWQA 1G98A 5FA8A 3QU7A 4C4YA 2GLUA 2Q2WA 5KWIA 5EZYA 5LNK1 4P86A 3T5PA 2E5LB 2UYYA 3CW9A 3AI3A 3EUWA 2EZUA 3CUTA 3HP7A 3JWPA 4DE5A 6GPBA 1HKUA 4OAQA 5AM3A 5CFRA 1QRSA 2BMDA 4L75A 1ULUA 1Z4LA 2C97A 3I72A 3JATB 3AJDA 1A2QA 1VJ5A 3R6TA 5LOVA 1D04A 3QHPA 2O7QA 1FUIA 1SZCA 2GEUA 2Y8EA 3CN7A 2QW0X 1SM4A 4MB0A 4MV3A 4Y2GA 3FOEC 1PJ8A 4HH4A 4ZVPA 3UAOA 1ZGBA 3AY0A 5A3QA 1V8PA 1YZFA 4EMBA 5DLDA 2DZDA 1TZBA 2QRGA 1CJSA 1QO7A 4FOTA 4J4TA 4XWYA 3IAEA 3P71T 1MC4A 1VSUA 3MC1A 4E3ZA 1WDTA 3RJMA 3PWSA 2M32A 3HCRA 4IDNA 4WZBA 2ZAMA 1I1OA 1XLVA 1YOVA 5CA1F 3G3EA 5CAEA 3EZNA 1W47A 3QEKA 3K1TA 3IO5A 4MKZA 3FA2A 2COKA 1PVOA 5FNZA 2J0QA 2X15A 2JCGA 2FZGA 2AXPA 2A1IA 1OYOA 1TO1E 1BQEA 1WHSB 2VPWA 4LZAA 1CY8A 1Y42X 3RIMA 3V7YA 4B47A 4B3MB 2Y2UA 3W8RA 4BV3A 1A5SB 1OREA 3OIDA 3WLFA 5KTSA 1OZGA 1Z38A 1AQUA 3MQFA 3SYMA 1XLTC 2RGWA 3H2KA 3LY9A 4KH1A 4X65B 1XVAA 2D1FA 2XQKA 2NO0A 3A6PC 2BGUA 4YV1A 3BCRA 2D0IA 4RE6A 1PR2A 4ICIA 1R6VA 1SIBE 4OHKA 3LX4A 1V16B 4KLRA 4WJZA 5HM8A 4LXQA 5IJXA 2OPHA 1SXPA 4W5NA 2VA8A 3MPOA 5E4TA 3ROKA 1KP3A 1M2WA 3OZIA 4CI0B 4W82A 3GDGA 4XQCA 2PIAA 1YR8A 3LXMA 1AKQA 2M9MA 5FF9A 2W8BA 3HR8A 4C0SA 4CKEB 5IDXA 1LDYA 2HOQA 2J3KA 4O4LA 2GASA 3B1WA 1VRCA 2WNIA 1QYVA 1YTUA 3DH0A 1KC1A 1T8WA 1V9CA 3HJHA 1EXVA 4E2FA 4I9NA 4AN0A 2A5YB 2JLRA 1G5RA 2DYKA 2J87A 3KJGA 1WCYA 2OK7A 3BSSA 3P9SA 4ITUA 5AM4A 1VZ3A 2ZLBA 3KCQA 5CB8A 3PQ6A 4NICA 4DREA 4D82A 2FQWA 5ERXA 5IF3A 3O4VA 2WF5A 3B1JA 3B52X 5JT1A 1YCHA 2H4HA 4IVNA 4P3NA 4C0AC 5JZBA 2XUIA 4P4NA 2B2XA 2CVZA 1WSWA 2JEYA 2VHYA 1BX1A 2A7QA 2VCYA 3SR0A 3EPHA 2P2ZA 4LE0A 1ZD5A 1DQYA 5JPIA 5CTJA 3LY7A 5FWAA 3TSYA 4DS3A 2ZM6B 1ZM3A 3KTAB 2FOLA 1CW2B 1NT2A 1I24A 4E33A 1K3FA 4YAIA 4UHDA 2Q5EA 1OH6A 5E38A 1IMJA 1TQ4A 2CEAA 2PGXA 2ZT6A 3HXKA 4G9BA 4M2LA 3DHEA 2ZI4A 3GX1A 3IYLW 3NGMA 3R0IA 3RF7A 1A71A 5A1JA 2PNJA 1BU8A 3OD1A 4LOLA 2JFUA 4A5SA 4BC0A 3AK4A 2B6HA 1JNXX 3B20A 2D7DA 4CEHB 1BCRA 1Z2DA 4IINA 5BY2A 1WF3A 3D6AA 4TROA 4FYYA 1JIXA 4A6PA 1CF9A 2WU3A 4BPBA 2RHBA 4X6LA 2XCTB 4IJUA 3R1IA 1T29A 1HFKA 5EP2A 5BPHA 1XZIA 4MA0A 5CFZA 1CJVC 1SOWA 2WA2A 2NZWA 1KYVA 2I66A 5CG1A 4Q1AA 4IXDA 3OJEA 2P7HA 3RIHA 5P21A 2QTMA 2DETA 4HOYA 2UXDB 2X9QA 1JQ5A 3MW8A 3UEOA 5A71A 3U61B 3H4VA 3QA9A 2CVFA 2E4UA 4PONA 1GGMA 3ANSA 1JXAA 1T1EA 4BZWA 1E61A 4GOOD 4ZVRA 3RG2A 1Q7GA 3VPXA 3UMYA 2WA1A 1UP4A 2PKEA 3BZWA 4YO8A 1DC4A 4AJPA 1UZAA 1PV2A 4KACA 1KBZA 1NAIA 4G4JA 5KOIA 5YASA 1JBQA 3EAQA 3HLKA 1NBHA 4D9EA 1WVIA 1FS5A 5M29A 3K1AA 3VUEA 3MT0A 4O3FA 4Q19A 2DTXA 3OLCX 4EY6A 1NHWA 4C6SA 4IWXA 4P22A 1K1EA 3GD5A 1U0RA 1K89A 2QVBA 3FKSD 1MC5A 3DCYA 3LDFA 2CLCX 5C1PA 2PMDA 3NPMA 3A05A 5JD3A 1SY7A 4A5OA 2Y99A 3P9PA 2O48X 3KJQA 3T7TA 3TVTA 4QT4A 4U2FA 2W6OA 1UP6A 3SX0A 1Z4QA 2JFGA 3RVKA 3MRTA 2PCJA 2B34A 2GETA 4O2BB 2C8LA 1JLMA 1NJFA 2V6GA 4IOJA 3H11B 1OX5A 5D1NA 1EGVB 1KDTA 1M34A 4MYSA 4ZQBA 2C0PA 1E32A 3MIIA 1NF9A 3FGNA 3KUUA 3PCTA 4OCZA 2HRDA 4RS3A 1X14A 2DE0X 2XWPA 4HQ6A 3ZHCA 3F7TA 1WEHA 2D1QA 3DXFA 3IR6A 1ODIA 3DOEA 1TF2A 3DHNA 4FHEA 3RANA 1XZHA 4Q82A 3QG5A 3F5SA 5H9WA 4Y1RB 2OXTA 3FIJA 3KLBA 4XYGA 2QNIA 1TJ3A 1ODKA 4C7JA 1AQIA 2P11A 4X5OA 2IHKA 1IHXA 4IDOA 2BLLA 1UOOA 3DMHA 4J8PA 3MQ2A 3VPCA 3K70D 5EIAA 5GZ6A 4N65A 3VNQA 4Q7LA 2GGSA 3M33A 1IJBA 1TO6A 1T5BA 5IN4A 4MVJA 1DTSA 1BX0A 1NR1A 1WMDA 3PKIA 3HO6A 3THRA 4FT4A 2QE7D 1NI4B 2LKDA 3A4NA 3WNDA 4ILKA 4F3KA 3ND7A 3QGMA 4U7FA 1D9ZA 4LJ6A 4P7BA 4CETA 1ESMA 2JJMA 4QKQA 5BV2P 1W93A 2WMDA 2VJMB 2IXDA 3LCVB 2WOOA 5HEKA 5BN3B 1H6CA 2ZIFA 3TRDA 3VPSA 1LI7A 2C5SA 1F0PA 4PCVA 3WL8A 3G0BA 4DMLA 1Y5LA 3T61A 2EHJA 5A4MS 5EUQB 2PGNA 5CIYA 2CHUA 2HAEA 4MLPA 3KQVA 3L8DA 3CSUA 4RCYA 5JDCA 4A15A 1Y8CA 4AYTA 5JLJA 1WLYA 1OVMA 1EX9A 4AG5A 1AC5A 1MCZA 3I5MA 4R01A 1JXOA 1RWXA 3W6ZA 1NFFA 1IVNA 1NVGA 3JARA 2DQKA 4EUFA 2GYUA 3V1KA 2ANBA 5ED0A 3S27A 1MW8X 2Q6KA 2EFYA 4I55A 2DG2A 2WFMA 5I7AA 2WHRA 4C0XA 1C7EA 1B00A 5ADWA 1Z34A 2X0NA 1NI5A 2ZWPA 3I30X 2UUPA 4P33A 4QG7A 3O4GA 3BXOA 4TTJA 1NMYA 3WK6A 2D7CA 4ZI7F 1KK1A 2C9YA 5JE8A 5DU2A 2VHZA 5JANA 3HJUA 2AUNA 3W0LB 1WCXA 1XU9A 4V02A 3FPJA 2HUPA 5J40A 3SZRA 1TQHA 3LRTA 3PU6A 1R5JA 3MAGA 4GC9A 4GO1A 2B99A 2AI3A 4FE3A 4JIGA 4Q1VA 1G8SA 2ZU0C 3UVEA 2VDRB 3TX6A 4S35A 2QEQA 4BO2A 3D6FA 3F74A 4RHCA 1K7CA 2ADOA 4P7KA 1UFRA 1KKMA 1EK0A 4G41A 3U48A 3U4AA 4RA9A 5J1SB 4P7JA 1K8XB 2XB8A 1BMTA 4JS0A 3HDQA 3O3NB 4GMGA 3EGDA 5GGYA 2PR2A 1QIEA 4LYDA 3T34A 2RH5A 5TMBA 3GCXA 3EVAA 4M83A 1HLGA 3L7LA 1RWPA 1MFZA 3GELA 3PQ7A 1NSFA 1K92A 5EJMA 4AJJA 5A2QA 1G20B 4MW7A 3I6ZA 5F52A 2ORWA 3HKDB 3OZXA 4LOKA 3VU0A 4CMIA 2VF4X 3OO1A 2Z83A 2PEYA 4F4CA 1HE4A 1M2GA 3M5PA 1OI4A 1DJOA 4ZV7A 1ZQ9A 1N4DA 2J6BA 3MJEA 3U4DA 1DCMA 5L3VA 1DX6A 1NYTA 3VU9A 5FV4A 3NC0C 4WEOA 4O4IA 1GG5A 4OHPA 4ENWA 1OXUA 2SBTA 2P40A 5EXPA 3A0RB 2CZCA 3FHOA 3I6YA 3MJCA 3QY9A 4ES6A 2VAWA 2BEWB 2QWXA 4EHIA 2WPNA 4GYWA 1WBDA 4OSPA 1XQ9A 2JGMA 3JRNA 4BMDA 5BURA 3RC3A 4UM9B 4O2AF 2OAEA 4AI6A 1XMIA 1P7PA 1D6SA 4JU8A 5CR9A 1N25A 1W96A 1OBCA 2XADA 4NZZA 2GDZA 2WD7A 5IX8A 5E95A 4EW6A 1BNCA 3KQYA 2H5LA 3C7KA 2CNLA 4RHFA 3MXTA 3UV7A 1SPXA 1NQOA 2EZ4A 5BSHA 3Q5EA 1GZ4A 1U81A 3SS7X 3EWNA 3BFJA 4IR7A 2G0AA 7ADHA 5C1DA 2DPGA 3F3SA 3FTDA 4K46A 2IPNA 1R6UA 4LC0A 4A1OA 2MR6A 4O4JB 3ZDQA 1M1ZA 4GQBA 3V8VA 1USWA 2YRWA 4F84A 1LPMA 4YT8A 5IUNC 3FYCA 1UMDA 2ZVJA 3K1JA 5DLQC 2WHEA 1ZXXA 2HM7A 1HSOA 1NE2A 4L78A 2R00A 2WNHA 3FUXA 1LZLA 4TXMA 5ALEA 5B37A 4R3NA 1DEXA 1MA0A 3AFHA 3UB2A 5A3RA 4JWKA 3NIWA 4L4ZA 4MLZA 1K3UB 1OFTA 1THTA 4I4CA 2O05A 2ZOSA 5ES3A 1QVZA 1XYVA 1C29B 1EDBA 2PR7A 1X19A 1L5YA 4K9MA 1OHHD 2W6PA 4RTQA 1DQRA 5C81A 3NTVA 4KJXA 3H4MA 1NWHA 2EGGA 3OT4A 4KUEA 1UXJA 2JFFA 2CJPA 3AHHA 1F6WA 4IKEA 1A88A 3IMCA 1N6RA 1IONA 2JHCA 3KYBA 3NVMB 4PR3A 4DABA 2XCIA 4L5AA 4DG5A 4RIEA 2O2EA 3ETJA 3NBUA 4D56A 5B57C 4KNYA 1T8UA 4YCMA 4QU0A 4ZOLF 1PEAA 5AJYA 5JJLA 1A5AB 4UTRA 1J2UA 1G38A 4WRRA 1JDBB 4O2LA 4G25A 1HL7A 3ZGOA 1JYFA 1F8YA 3MB5A 4JFRA 2UKDA 3DLTA 5SYNA 3OOJA 3WKCA 1S2MA 3HNPA 1GPDG 5ILQA 4DLAA 4DR4B 1HSZA 5F21A 4O1MA 2QLBA 3N59A 3RUFA 4QJ4A 4ARUA 1EUCB 3KVNA 3ZWDA 2JASA 1U0FA 1FRVA 3M1IA 4EVIA 3SKVA 4RX1A 3RGGA 2PRJA 2GWHA 2GZRA 3A8TA 4OHMA 3B53X 2WP8J 1YE8A 3D4OA 3CH7A 5K3AA 4BB5A 1L5RA 1NJ6A 4IH4A 2Y0PA 4RQAA 3WXMA 1Q7CA 4DCOA 3T5TA 4J1TC 3DMTA 1EYZA 4HLQB 8OHMA 2I2BA 3OQHA 1J2RA 2C2ZA 3MWEB 4MQ6A 4QQNA 1N8SA 2OB2A 3AUKA 4FR2A 1DFGA 4JC4A 3WQBA 5B3JA 1UFKA 3VHRA 1Z0AA 3PE6A 3WLTA 3KYJB 4MZDA 2A4KA 3NHLA 2G1UA 3EPJA 2X9GA 3RV4A 1ZNQO 2EW2A 2AI1A 1F0NA 3QLJA 1QH1A 3WRXC 3GUYA 4YAGA 1E1LA 1XVIA 2BTQB 3PDUA 4N39A 4YUXA 1DIRA 2GVDC 1J7JA 3VHQA 3R3XA 4CL2A 1ECLA 1XT6A 2C1XA 4G4SP 3ICQB 1K97A 1ULTA 1NXOA 4UBIA 3RYFB 1ID8A 3MTGA 1W2HA 5AHOA 3SSNA 1RLUA 1CZRA 3CUEF 1RE1A 1G4AE 1TL7C 2XRYA 4HZGA 4KE7A 3UJPA 4P2BA 3PGMA 2H4YA 1E2NA 2JRLA 5FR1A 4H7KA 1GLVA 4N5LA 5HBGA 3I83A 2JW5A 3E9RA 1A7KA 1LK5A 3B5EA 5C5IA 4OL0A 2ECOA 2FXVA 3PHCA 1O4VA 2F3QA 1JDPA 1Z5VA 3FNRA 4FZ3A 5AKIA 4AX4A 4HKTA 4DV4B 1C0KA 3RYIB 2HF9A 2HU5A 3K0AB 1QGOA 2HJWA 2PD3A 3CVVA 1JF8A 1F51E 1L8QA 2X5XA 3D6UA 4DEXA 2Z3VA 2OV4A 3S2IA 1U9YA 4Z4IA 2PD6A 1T8SA 3WLPA 5LJIA 3D31A 1ZN2A 2ZDHA 4PO3X 2HY7A 2BM8A 4L57A 2YWFA 3C3PA 1OBOA 2H1CA 3NFYA 4R7ZA 1ZOIA 4JBIA 1ZN8A 5AKKA 1ZK1A 2H7CA 2Q3HA 1DWUA 3OPQA 4RW0A 5ESRA 5F64A 2PSDA 4E03A 2WWYA 5LOVF 5T8KA 2C92A 4QJ5A 3CUVA 3GB9A 2NQ2C 3W90A 1JEYA 5JS1A 4WHMA 3VR3D 3TINA 5FTJA 1Z5NA 2QRKA 3DEHA 3I9JA 1J0AA 5TC4A 1AHNA 1TCCA 1H1TA 3GRYA 1TUBA 1L5ZA 4Q4AA 5J47A 3GQBA 4LRQA 4AUKA 2GO1A 3KPJA 1GFIA 1H85A 3QE0A 4WK0B 3IDSA 3A32A 1J8MF 4C05A 2YZNA 1FSSA 2QYOA 4NJEA 5E2IA 1DIBA 5HQJA 4CQNA 3FPSA 5LP1A 1TYDE 3QF4B 1QO0A 2FWRA 4CM4A 4F4JA 1J07A 4L9AA 3UA4A 2FEAA 4QGBA 2WI8A 2HB6A 1GGKA 1M1XB 4WIAA 2ZI6A 3VSEA 2H9IA 1K75A 1OGIA 3E03A 3NT4A 3ZHXA 2YVUA 3CPHA 3TAHA 4RTOA 5AVRA 1QAQA 1FMTA 3MBIA 5HIMA 5B1YA 3AVQA 3O8BA 4E15A 3RF6A 2AC4A 2WSMA 4ZQFA 3ES9A 3L6RA 5HCNA 4DW8A 2C95A 2B82A 3RKUA 3GJYA 1TVKA 2HJVA 1RJ9B 1OU0A 1R6BX 4DR1B 3RYCB 1HUQA 1N0HA 3PX3A 1P1KA 5CW2A 4LY6A 2KW5A 3UFXA 1J8VA 2VUIB 5J4VA 3HL4A 3MD0A 5ADVA 1DBQA 1GNQA 5LVAA 1UBFA 5HILA 1YRHA 2YUIA 3HYTA 4G1UC 4REQB 4OBBA 5DM2A 5FLEX 1VCOA 4DVJA 4MJ7A 3VDXA 5JHHB 2H9AA 1WTCA 2FUKA 5BORA 4URHA 1R4NB 3ZZTA 4E07A 1FDRA 2NNLD 4O4LF 3CNNA 3CBGA 4NFHA 1ZCBA 2ODEA 4Z9YA 1J1UA 3KVYA 1FYEA 3KYCA 4NAHA 1Z22A 3U4CA 1KHTA 4PC3A 4HUQA 2Z6QA 3EUAA 1M2EA 3A1UA 1RRVA 2ZS7A 4MS4B 1W2GA 4L5IA 4EPRA 5BXQC 2AOWA 3B2QA 4XVUA 4GWLA 3U5TA 2EQAA 1GSHA 4MYTA 1O8CA 5DH9A 5HIJA 1G8FA 4TV9B 5HFNA 1MX9A 3GQVA 3H04A 4X7BA 3G9QA 2WAOA 4K6OA 2ZYHA 1ZAYA 1QIDA 1ECBA 1XDGA 3OZRA 5EHQA 4IJ6A 4LK3A 4PY2A 4X45A 3M7IA 3SHVA 5KUTA 1Y6QA 2I3ZA 4WKOA 2GBPA 2FK7A 1X1CA 4HS9A 1VBFA 2EIHA 2OEPA 1K9VF 3UIEA 3A2MA 2LCIA 3UG7A 3CW2A 4HDSB 4AKIA 4LQCA 3PDIA 4JLBA 4IDDA 3D8HA 4TKVB 4NK5A 1OJ7A 4W5TA 3FUTA 1KU6A 1U1IA 2PUBA 1XBTA 1QG0A 3QPAA 4D99A 5FO0A 3WLAA 1P0QA 3T94A 3AOGA 3VU3A 4II3A 3ZE6A 4Q39A 2D1SA 2WPDD 4KMSA 5I3CA 2V7VA 5F2EA 3TEMA 1UKZA 1YRAA 5HK8A 2C9BA 3K94A 4YP0A 1UOPA 1YA4A 1ZJZA 4RLQA 5IT4A 2YMPA 4AKHA 3L79A 1Y8RB 1ZM4A 5KB3A 3OT1B 4EKGA 4P4LA 3W6NA 2C0CA 3AZPA 4PV7A 4RCZA 4RZUA 2VTDA 4QUEA 5GTDA 3B51X 1KR5A 2C88A 2XMGA 4E08A 1W36B 3FLBA 1JLKA 5HA5A 2JHAA 3RRMA 2IUFA 3HI4A 2C4NA 4WK2B 3N86A 4AG6A 4DWWA 4YRSA 3MWYW 2XUQA 3CH4B 3OEWA 4CPDA 3DEKA 3FTCA 3R6GA 1YH3A 4R98A 2MT9A 5DGHA 3ZCXA 3AVUA 5FA6A 2P1ZA 1P1FA 1JFLA 3DZKA 2PFKA 3LCCA 3U4QA 5ALPA 5AICA 1KVUA 2AJLI 1GZVA 2XTMA 3L8CA 4LV8B 2M6KA 4CW7A 1XK7A 2MMGA 3TVDA 3PPIA 4E13A 1X7XB 1TCUA 1LDNA 1JDBC 4U6SA 1AKWA 3WYFA 5CEEA 5AW4A 1VFPA 4IFEA 2VJAA 3LL4A 3HYCA 4EHDA 5ALZA 4AWBA 2EFDB 4JOQA 3U40A 2WG0A 2VDWA 2OHFA 3DC7A 5ALNA 1JV2B 2PLAA 2E3JA 3LT4A 3AR9A 3L4EA 1G55A 2VRCD 2PZBA 1XV5A 2XTAA 5BQXA 3IAM6 1QCCA 1GQYA 3AIOA 4JDPA 4G81A 4QC2A 3WMRA 4DA0A 4KVFA 1PW7A 3MELA 3S81A 1XAGA 2QM0A 1PJBA 4BWGA 5EUCA 5HM6A 4YXWD 2AVNA 2AFVA 3FFAA 1M0EA 3FKJA 2RK3A 4XTRA 5EIFA 4INJA 3AEZA 2Z8YM 2V45A 4EUEA 3KU4A 1OV4A 2GPNA 4I66A 2H2WA 2JBAA 2OC4A 2XYGA 2I2WA 5G02A 4LXTA 4XLLA 5IFKA 5COAA 3BK1A 4MNTA 1YB5A 4QHTA 3UBMA 5CDHA 1KI7A 1DXOA 3EVTA 2ONJA 4HWRA 3KQMA 4Z9XA 3QWHA 1S8NA 1F20A 4UHCA 1BSVA 4MWGA 1T2AA 4XUCA 5DEOA 3UHOA 4JP3A 5LIRA 5DTRA 1JE0A 4PCLA 1B4DA 2OCKA 4NU0A 3B38A 5DXFA 4QTZA 5AW9A 4ZVQA 1S96A 5TQ2A 4KQXA 5EI5A 4Y30A 2WG1A 4Q18A 3BA6A 1XTPA 1N1GA 2OZLA 5ESWA 3RUIA 3ZXUB 5KREA 2R1UA 5KSYA 1GPMA 2PT5A 3BSYA 5ALKA 1E2PA 1EFPA 1PV1A 3C3BA 4UPEA 5EIXA 4BGUA 4BFTA 3ITEA 3JD4A 5IEJA 4ZAGA 2E21A 3WDSA 1T6ZA 1Y7IA 1ML3A 1HEYA 3O4JA 6ADHA 1GLNA 3ZVKA 4EA9A 4D0NA 5KIAA 3FDXA 2O2GA 4D5GA 3FI9A 3L7KA 4TVKA 2HHLA 1N5IA 2IXBA 3THWB 5K0NA 4TQAA 3K16A 4S12A 5FULA 2R48A 1SVLA 4Y6PA 4TKLA 3IKJA 1BCSB 1Y1RA 3H17A 4J94A 2QPTA 3IPXA 5TMEA 2I22A 1XFDA 1ZOLA 4TN5A 1TQ2A 2EU8A 2HK7A 3B6MA 3EPRA 4I55F 3WYGA 1QQBA 2AE1A 2WV7A 2C1EA 3UB3A 3IXMA 2PUFA 2JLVA 5G0VA 4NBRA 2H7XA 2AEMA 3B6IA 3GLRA 5DNVA 2P68A 3PXUA 1I2BA 2YKGA 1E7QA 5I7UA 2EQBA 5KDOA 3HI6A 3DAOA 4BO0A 2GF0A 4IDAA 1U3FA 1ZXLA 2BP7B 2QAGC 3D0KA 2C7PA 3LKZA 3WLQA 3VSCA 5EJ8A 3K6SB 1FJGB 2GM3A 1KYTA 4HNTA 3FPGA 4Y6SA 3AUUA 2AS0A 5TB5A 4GGOA 4UNQA 1RE0A 2F67A 2NV2B 1SOVA 4X20A 1Y1LA 2H08A 3TQCA 1EB8A 1QOQB 2QHXA 3HC7A 3PHGA 3Q6IA 5K2MA 3DDSA 4OQLA 2VJCA 2ZBFA 4EQ6B 3BWDD 1EBUA 2ZI3A 3KALA 4BO7A 5JQGA 1L3IA 4IDBA 3GNQA 4YI3A 5KAPA 2PAAA 1JI0A 2H8KA 5AI5A 5L95A 3PRYA 4EY8A 1FZTA 3LOPA 1AQNA 3WY9A 4NU5A 2HQ1A 3KD2A 2Y27A 1RMYA 1M6HA 4JI1B 4YTEA 5DXAA 2PKRA 1DOHA 3EDQA 2IXEA 4AMBA 2C7BA 1QBGA 1SUEA 1TYCA 3HEBA 3VC7A 3OQBA 3NO4A 5H1YA 4TN1A 1PEYA 1CR6A 4KO3S 4QDXA 3HZZA 4HEQA 5DCWA 1XTQA 3T4PA 2FR8C 1QYRA 1IYZA 5EE5B 3PE4A 5F9FA 3BD8A 3IRUA 3WJ2A 2OBBA 3NIGB 1S7CA 1T2CA 3P26A 3LTEA 4PQEA 4RL6A 4RH3A 5FXMA 3WS7A 1TJYA 1XQWA 3GCGA 2E5FA 1YMVA 2ZIVB 3PIDA 4UUNA 3S1AB 4R5HA 3WYDA 1E79A 5JSZA 3CRVA 4RIIA 4EYSA 2VYVD 5U4QA 1Z3IX 4Z4HA 1WSDA 1W88A 2DGDA 1G8HA 2HF8A 3MPUA 3ZV6A 1BA2A 2DPHA 2QMHA 3LXXA 3ICPA 2GTIA 2ADMA 4HQNA 2AK2A 3VR4H 4BAGA 2W4IA 4EHLA 4AJ9A 2HBZA 3QLTA 1IG0A 3LWNA 2WT8A 5G4KB 1W1IA 3R3JA 2C2XA 2BFCB 4YBRA 3CLVA 2GWRA 4M1WA 1M2HA 3HP1A 1GAEO 1SKYE 2A0FA 1DBWA 2FPOA 3QVVA 2Q2VA 5DLEA 3ND8A 1JFTA 1YBHA 2OHVA 1M34E 2EKPA 3UA3A 4HRAA 4ZP1A 4PLFA 5AVSA 1KARA 2C7RA 2GCOA 2IYRA 3AWIA 3E8MA 4PFKA 1VBMA 3TGWA 4YYZA 5AESA 1Y6ZA 5DHPA 5KJ6A 4KR3A 2XRMA 3CPSA 1JDTA 2AZMA 3KPYA 5IU6A 3NRBA 2HTEA 2VAXA 3JQAA 1PJRA 2F43A 4RMJA 4YJ3A 2XF2A 4MP6A 2OV1A 4JL6A 2JGAA 1LW6E 3MAAC 4IWNA 1VC2A 2O4CA 2OP1A 3A6GA 4OBEA 3O93A 5KVQA 1ZPDA 5TPZA 3X1WA 3GHHA 1MC1A 2JAPA 3F6BX 3EC2A 1A97A 3JVVA 4MPRA 1ZSNA 3S1LA 3F67A 3CB2A 3HRHA 4JB2A 3A1EA 1KZ4A 2I78A 1SQ5A 3FZYA 3HXTA 2A1UB 1LQUA 3JU3A 4MVJE 4IRXA 3B85A 4ZOEA 1EA7A 2A5LA 3OQIA 4HLNA 4Y2RA 4L27A 5ALMA 2GOYA 4EG0A 1TQ8A 2HJSA 3QYPA 1W36C 1YMUA 1OZAA 1WV1A 3AHCA 3GWZA 2YC4C 1QP7A 1OI2A 3TGLA 4HF7A 4X66B 1P33A 2P35A 2J6IA 4AS2A 4B3TB 1LLFA 4YRNA 1YJQA 1SKQA 1M6VB 1Z7EA 3VKGA 3ASZA 5F78A 5FBZA 1P72A 4ARZB 4ND1A 1V5EA 2RG7A 2Z4RA 2R47A 3I2KA 3LWZA 1NLZA 3TL2A 2XQFA 2WWHA 4URYR 4H16A 1W5TA 1U28C 1WX1A 1H0KA 1NJSA 3SQLA 1YR3A 2BTOA 1WMSA 1HFWA 1QRAA 2X1MA 4LC9A 4HDNB 2VS1A 1LS6A 4LBYA 2XMZA 1JB9A 2ZYDA 4DUGD 3D3JA 1M6NA 5F3RA 2MSDB 4QRHA 3LHIA 1V9LA 1DCTA 4PO1A 3HKBB 3CMCO 5FOUA 3G6KA 5LKRA 3FPLA 3H9BA 5DV9A 4J0QA 5H81A 3ZDXB 4REOA 3NDIA 1KAOA 1DWPA 1XIVA 3S5JA 3K9GA 1Z45A 4W8OA 1LVHA 3O94A 1AQLA 4MPJA 3JQFC 3OZCA 1JJBA 4KN9S 3A1TA 2H1LA 3AEUA 2Q45A 4R51A 4YASA 3SHWA 2ACKA 4RKRA 3FFWA 5JSHA 2NZ2A 3CINA 3ADKA 5IFLA 4Y2QA 4ZC1A 5EKTA 1C3OB 4HTFA 4IV8A 5F1KA 4F6RB 5FNVA 1IY0A 4O33A 1WP9A 4BTEA 1L7DA 3CA8A 5JYBA 1XTTA 3FE2A 4JVLA 2EF0A 3RFFA 4G0MA 1X1BA 3AT1A 4GWGA 2Q1SA 1HFJA 4MUAA 2I76A 2X3YA 1XI2A 1NBWB 3ROMA 4ER7A 1ZINA 2B8TA 1CUBA 1R27A 3LW7A 3E1SA 4FFWA 4JR0A 5KU7A 1J56A 1M8PA 1ZH4A 5T41A 2XGMA 3AFNA 1NZDA 3GYBA 5D6OA 4CCWA 1ZVKA 3VR6D 1R66A 5AW1A 4N7BA 5FWXB 4DARA 4KV9A 4CG2A 3AUXA 1SIWA 2FWMX 4J2HA 1ZOOA 2R7AA 2ZR9A 1NW9B 3WJAA 3B13B 1QE3A 3BVPA 2ZYVX 3DTVB 3IMFA 5KYNA 1W29A 1O87A 2ETXA 4XM0A 3GYGA 5IKEA 2QSZA 4B82A 1C9MA 4EW2A 2GTPA 2DR2A 4C20A 1DRVA 2FMKA 4ESVA 3RSZA 1J8YF 1XKQA 1RXUA 1KDOA 1RZ3A 2VT6A 1JKXA 2YASA 3ETNA 1MQ9A 3Q7PA 4XUEA 4RPCA 3JVDA 4YP1A 5H7XA 4US2R 4Z86A 1E89A 2ZBEA 2CNWA 1NF3A 1V5GA 3MOGA 4JOCA 3GAZA 1OI3A 4IHQA 2B9EA 4LJ7A 3B12A 2QBYA 4IDEA 1MB3A 1ZX1A 4TXLA 2Q6TA 1JU9A 3VPGA 3DULA 1XD8A 2PZMA 5FBWB 4C08A 1UF9A 3RAGA 3DFKA 1BVRA 2FEPA 4DMHA 1LD3A 2O8NA 3QOYA 4I9UA 1B42A 1NQXA 5DULA 2P2CA 3RRXA 1B2RA 5CB4A 3E61A 4Q4DA 4UDYX 4DJFC 4QVIA 4R8RA 4QTUB 1C14A 2FF7A 1XEWY 1SULA 2B1RA 4IS2A 3BIJA 1YT5A 5HVNA 1NNLA 3FM9A 3FY4A 4DUZB 4PS0A 5IJ9B 2V1UA 2ZGVA 2ZROA 1A3CA 4ZVNA 1EM8A 1HKHA 1KVTA 2DERA 1ADBA 1CQIB 4N3GA 1DOAA 3SYRA 4CTKA 1GZ7A 3JYOA 1IXZA 3GGCA 2EW8A 2YY6A 5TPWB 2JD2A 5CM2Z 1Z17A 1LY1A 2FTKE 4KKXB 3IULA 3RHFA 4E30A 3HJFA 2W2PA 3M6VA 4G67A 4NOJA 4HNHA 1WF6A 3DVAA 1U6IA 3P7MA 2D06A 2PZJA 1U3CA 2JVIA 2OCAA 3V1NA 3IVAA 4EYKA 1ADJA 1SU7A 5H3CA 4G5RA 2WQZA 4PAOA 1KJQA 3UOAB 4WGGA 4Q24A 4ILEA 3CG0A 2H31A 4L51A 3BE6A 4N5MA 4HNRA 3ZZ0A 4F9FA 4PG8A 1RPZA 1BVHA 3FWHA 3T15A 4QM6A 1MP0A 1ZGZA 2C58A 2DCUA 2X2PA 2YMMA 2NYUA 3AUSA 3PC6A 4MUKA 1BDIA 4BJ5A 3PD1A 3V97A 2FUEA 4BMSA 4R8VA 1O95D 3A9TA 3JQ7B 3CLSD 4OLFA 1G1MA 1I51A 1TZ2A 2TMDA 1JYSA 2YBEA 3R24A 2OZKA 4HDCA 3U3RA 4DBLC 3BQNB 4FWTA 4B84A 4JHXA 1UBJS 1GPBA 4II2A 2FPGB 1JEOA 5EVCA 1T6BY 3KTAA 1DTWA 1ORWA 2DBVO 3DO8A 1Z07A 4LJ8A 3UICA 1NW7A 1N2IA 3RVRA 2KE5A 1FTSA 5EIEA 3ILVA 1H8HA 4HV4A 2QRVB 3PENA 3L02A 2CHVA 2ZYWX 3GNLA 3OOSA 4MDHA 4XIJA 2Q3FA 1N5DA 2HLHA 4TOIA 4PO8A 1CS0A 1C2TA 2ZXFA 1JJAA 5LXTA 2Z2KA 1CG6A 2DHQA 2BKLA 3GUVA 3ZYZA 4DQUA 1O6CA 1Z2CA 1PFUA 2XODA 1TJNA 2C4MA 3SS9X 4AJIA 1I7DA 3FNIA 3WIDA 1B8OA 1YKSA 3JYNA 1SC1A 2FWPA 3EIOA 1QIGA 1U2EA 3CRMA 2O07A 3TN7A 4YMTA 3MCVA 1BC5A 1I5OA 1KEWA 2VKQA 3IQWA 3AFMA 1Y0BA 5DX8A 3ZWWA 1W5FA 1O9BA 1N9GA 3CV3A 3OA2A 4URUR 3STYA 1IQ0A 5LYJB 4B3GA 2O4UX 4WESA 4N41A 1QHNA 1V1MB 2WSLA 4RENA 5EQDA 4HGRA 4DJJA 5AW8A 1J5PA 1A0OA 4HH3C 4DPLA 1PSDA 5D5QA 2BOVA 5EINA 3DXZA 1C3JA 1H94A 1KO1A 3JQBC 5D3MB 4UMEA 1H23A 4IV0A 3TWOA 2PJUA 2PY6A 2I7DA 2OL4A 4YQFA 5A5FA 4LSZA 4P4SA 2ACEA 3LUFA 2F1KA 1JH8A 1A5BB 1K6XA 3RWMB 4D02A 1VSBA 1OJLA 4URFA 5AO9A 5FLXA 2GAOA 3DJYA 3FJOA 2QU7A 1CNMA 3OJFA 4GR4A 3IE2A 2R4TA 4RPLA 2NU8B 1QZ3A 1V5WA 1E5DA 3A4LA 4U2CA 1G0OA 1YWGO 4K6FA 4C43A 1RU3A 4WOKA 5EIBD 1AGXA 2RGYA 3GW8A 3PIIA 3WKEA 5C7OO 1YK0A 4DHWA 1YCGA 2PE5A 5JC1A 4DSAA 3RJ9A 1QV9A 1RBZA 4H17A 4YAFA 1SGWA 1BXRA 5T64A 2ZIXB 2CL6X 3TTXA 2AZXA 1YZHA 4V3CA 2J7PA 4O2BA 3HFSA 3P9KA 2J31A 4IEFB 1MDFA 1RC1A 3SZOA 4DLBA 5HQTA 3H11A 5DNYB 4M8IA 3JYHA 2VKTA 1ZL0A 1CUZA 3LX8A 4QOGA 4B2YA 3AVTA 1MB2A 3F9CA 4PZ9A 3NH9A 3UHJA 5BV7A 4A0HA 2JI8A 2BCGY 2YIDA 2QVGA 1CJMA 4FQ7A 3B9QA 4LYGA 2C2BA 4DMCA 3N2GB 1J0BA 3OPNA 5E6SA 1H65A 3TFOA 2VTKA 3AVWA 4PYRA 1LPBB 1ACLA 2ZWVA 4Y1RA 4LOIA 5GJCA 1F9AA 3JQQA 1H1LA 2OYSA 3P0EA 4PYNA 5AOAA 4BQNA 2F2TA 4TZTA 4ZDWA 2TYSB 2CW5A 2YFQA 3VPBA 4YBZA 1K5PA 8MHTA 3KXKA 4OB8A 4DIUA 5KJFA 1KXZA 4WKGA 3UUGA 5IH7A 3AJEA 5JAHA 1LBEA 4DLKA 3WLIA 2IHZA 6REQB 4BFYA 2VSNA 3DFZA 4KEAA 4CLXA 2A5FA 2EL7A 2QT9A 5BV1A 1NI4A 1N2BA 3T3DA 1A69A 2XGOA 1YK1A 2FEWB 3GEDA 2J4CA 4F4UA 1O0CA 4KK4A 4MGIR 4XLZA 5HMMA 3QVWA 4QQRA 4XSHA 3FMPB 2IYQA 3M3DA 5BN3A 4BNFA 1CLEA 5TQ0A 4KXXA 1M1NA 4ARSA 2PGDA 4OP1A 4IIFA 3NCTA 4EG3A 4GXTA 4MGEA 2VSQA 4PG6A 5IK2A 1GLGA 1XXHB 1SG0A 1E2IA 3AHGA 3TW8B 2NU7B 3EXHB 4CUZA 5F5NA 621PA 2ZTUA 4IV5A 2QPLA 4N5NA 3D4NA 2ZANA 2Q9CA 5LQNA 1RQNA 3NHPA 1XRSB 3GRVA 1MRNA 1UJ4A 4GI1A 5C9ZA 4ZREA 1KE2A 3O8CA 1U94A 1CQPA 1V4BA 2R5NA 4OP3A 3UZUA 3QNWA 4I1PA 1G6OA 4Q1BA 2NVOA 3VZRA 1XU7A 2P2SA 1XPJA 3GVCA 3M82A 4M1MA 4HSGA 4QYTA 1EXNA 4URVR 3IKLA 1QLJA 3W8DA 3NORA 4BE4A 1FCJA 1BHQ1 2QD2A 3BMNA 3FDIA 3NIDB 1R6TA 2YV5A 3QENA 3TCKA 2N1BA 4WOBA 2V3WA 2HLDD 1N5MA 1NN0A 2ZJ1A 4D96A 1E4YA 3E7PA 4OG2A 4WN3A 4C6HA 4F04A 5L4LA 4L0QA 4PYMA 3UJCA 3F6PA 4ZALA 2ZR7A 1XZPA 1C9JA 2ODTX 2VDKB 3TOCA 5T4HA 1G64A 3K4HA 5FUXA 1AXEA 1ACMA 5CCBA 4TRMA 4K9KA 3VV2A 2M1ZA 3EVCA 3ZCVA 3ITNA 2FSUA 1SWWA 3EH1A 4BXOA 3R6WA 4BNIA 10MHA 4J4BA 1PDWA 2C94A 3HB4X 4CF7A 5AHXA 5GOTA 1SRRA 3FOBA 2Q3EA 1X39A 2CJWB 3H5AA 3IV9A 4Q3BA 5I9NA 3KXIA 3VXKA 1KNQA 4OU4A 5EXXA 2E5WA 4LXXA 3AR2A 2J3QA 5ALYA 3RD5A 3S2ZA 5JQGF 1TAUA 1LK0A 4AO7A 4G5HA 4ARBA 4C5BA 4MV8A 2H8GA 4DIEA 5AJZA 4UNSA 4R9RA 5G41A 4DANA 3A36A 4YUZA 1XALA 3IVMA 4LXUA 1F7VA 3PPXA 4F1JA 2ZCJA 3HKDA 1OXXK 3OZFA 1ZP6A 3L0PA 2HJRA 4MRMB 5BR8B 3RU9A 5CYGA 2O0LA 4MRSA 3DE4X 3PUXA 2VQSA 5FHQA 2VT3A 1MJNA 1MMFB 1DG1G 1XQ1A 3EB9A 3NV7A 4A36A 1H2ZA 1JMYA 5DISB 2REXB 2VQ6A 2ORIA 4FEYA 3KVRA 2BEWA 4I5IA 1RZRA 3O47A 2H11A 4OXRA 4AMYA 1YZQA 1JALA 3L5KA 5IUKC 3UKOA 1XMQB 1L7BA 4DEVA 3ZDBA 1KVQA 2CFTA 2WM3A 2Z2IA 4KYUA 1UDRA 4J1NA 4X61A 1U0NA 4OHOA 1N0UA 2FW7A 3DGFC 1REQA 3FPFA 4FSHA 4KLNA 4D9IA 2OG2A 2WG2A 5IVIA 5ELLA 3Q5DA 3QYAA 1FQWA 2Y68A 4PC6A 3I39X 5JYEA 1GA4A 3RVOA 1NV9A 3DD5A 1D9XA 3NOXA 5IC4A 5J59A 1W8IA 1IQRA 3KZMA 4KFUA 4BEVA 2ZBQA 4O4JA 3U4IA 4EIWA 4IIEA 4ALNA 1EG7A 3RK1A 1PJQA 4O02B 3I53A 3HN6A 4R1PA 1I3KA 4NC9A 2AFIA 1VA5A 5E9QA 3CISA 2PA3A 3GJ7A 2B21A 4JI6B 5KBYA 1JFFB 1NOJA 4UCQA 2LE0A 3IAS6 5KTOA 3GP8A 3H42B 1OT5A 3N3AC 1KFCB 2PRKA 2FFJA 3M5CA 4G1CA 1L0BA 2QIPA 3MGKA 4KGDA 2CXSA 2YJTD 4G2TA 5WRFA 5DLYA 4DV0B 3LVQE 3ZWXA 3K35A 1FSZA 1G8AA 1Y81A 4RJJA 4FFOA 2EQ5A 3KE9A 2XGJA 1GSOA 1O6BA 5EUMA 5EXEA 1OH7A 2B5VA 4QUKA 1ENPA 3TIVA 2BEVB 3DE0X 3SSOA 1SB9A 1YJBA 1YACA 3X1KA 1SCQA 1JMKC 4PNPA 2C07A 2EKBA 2RHHA 4S1TA 4RKYA 3F1LA 5LP6B 1UFQA 2BCJQ 2C29D 2IL1A 3NBXX 5LQDA 1ESZA 1QJCA 2R86A 2V9CA 5JADA 4IZHA 2NVUA 4XSVA 1U98A 4I4TF 4NV0A 4Z7NB 5I7HA 2Y66A 3L7JA 1BH2A 1GU1A 1HO3A 1R6XA 1Z6XA 1P7CA 4AXBA 1W5SA 1AQYA 2M6SA 4BO1A 3BDAA 4DTCA 5CT8A 1W4ZA 4MMXB 3MB8A 4H2DA 3FOZA 1JHUA 3GMSA 2IX3A 1NXSA 1CRWG 9LDBA 3H9QA 5MFPA 3GT3A 2R8PA 4FGSA 4ZOAA 5KKNB 4AQYB 4JT8A 1EWYA 2GZ1A 3AKYA 3C0KA 2OFOA 1Y6GA 1HXHA 1PDVA 2QN8A 4BVHA 3KV1A 3BKWA 1CY1A 2RHTA 2VO1A 1QIHA 2QK4A 4L4RA 3P0RA 1PCXA 1EK6A 1WB5A 1O94C 2BFFB 2AJ8A 3F6EX 4G8CA 4N3AA 3TZLA 5KWSA 1G3UA 3R44A 2B2CA 2GZSA 1V41E 2W90A 4GT1A 1NRWA 2RJ3A 3IAAA 5EP3A 3WGKA 2JIDA 1P3DA 2KBEA 4RZ2A 2P3LA 4D3FA 3TZQA 2YWXA 4V0MA 3O1JC 2FPKA 1EJBA 2QV0A 3VKHA 4TS4A 3RYFA 3QUAA 3NVDA 2VF5X 4XGIA 2H00A 2X40A 4BRSA 4ZJPA 4PCUA 5CX4A 2OWEA 1PD0A 1N8NA 2R8OA 2NVWA 1EVZA 2VF8A 3OY7A 3TLJA 3ZJTA 2W00A 1RNLA 1XVVA 3MT9A 2X0FA 5TIIA 2C3YA 4LN1A 3CT6A 4YRRA 2V8BA 2FLVA 4YMGA 4F3CA 2GRAA 3FPAA 1WXIA 3ZUGA 2JCSA 1ZW6A 3DO6A 4G86A 1IBCA 1RJDA 2OUKA 2XNSA 2XB4A 2EYQA 2O2ZA 3EBLA 2XDAA 4ISCA 5L40A 5I9BA 2QZ4A 5JFOA 2BI7A 2XT6A 3PEFA 4KIFA 3N7AA 1YU6A 2PMBA 1D0VA 2RH8A 2ZJ0A 4BNMA 3HKCA 4D45A 5JAQA 1ISGA 2UV8A 4JB8A 1SELA 4NAUA 4GAEA 1U99A 3FYDA 4QAJA 2COEA 2NWQA 4TS9A 5GWXA 3SNHA 3WGTA 4EB6B 4FR0A 3V34A 4LZZA 5F3DA 1NNEA 3VU1A 2DWUA 1VRVA 4BDSA 1WUJS 1D07A 5CH3A 2WUWE 1YTLA 3M1YA 2GSDA 4WWHA 1R4AA 4LRWA 4RF3A 1ESNA 3WK4A 1EZZA 4BWVA 1CUJA 2AC7A 3CO5A 1KSGA 5BWBA 3WP1B 2HHAA 2G0TA 1U2SA 1JG6A 2G3YA 4BTLA 3EXHC 4RWZA 3SYLA 3L0CA 3A1SA 2WD8A 1ZESA 3OPYB 2IWHA 1X77A 3OZAA 3CX6A 2H6EA 4Q4JB 5JFGA 1A4RA 2PWBA 2RI6A 3D81A 4J91A 2G9UA 4JLJA 4DDHA 1Q44A 1JDZA 3L6UA 1A1VA 3IV6A 1P4GA 2BT4A 3BXZA 3QF4A 4JROA 2WTNA 4TLLB 2RH4A 4E5MA 2O8FA 2BEUB 3EDMA 3BBLA 3GLQA 5KNDA 5IVDA 5C7YA 2OV2A 2ZYGA 4H0FA 4JVNA 4YJKA 4RXTA 2WUGA 3D6JA 3LI2A 4MITA 3L8YA 4BCDA 3FF4A 5LZ5A 2Q2NA 1ST3A 1FVOA 3R8FA 2OGWA 3EY9A 3IAXA 1CYDA 4KX3A 4ROTA 3OM0A 2FUG1 1HM5A 4BY9E 3SBEA 1RJ9A 3ANYB 5EUBA 1WE2A 4C2UA 1RHUA 2O7SA 4LI3X 3ER6A 5DHTA 1VL1A 4DMFA 1SPBS 1UWKA 1KVRA 1R64A 1BJRE 4GOXA 4REQA 2GJAA 1KP9A 1BYIA 1WDKA 3NP9A 4N8DA 5T57A 1MVOA 4X9XA 1LBQA 3Q6MA 2UUAB 4JQOA 4KWIA 1R4NA 4RBNA 5B5SA 5T67A 4CMCA 2FR8A 2ZUVA 5HRAA 5KINB 2GEDA 2Y93A 1P19A 3HDJA 4NYIR 1ZIDA 4B31A 2PXAA 2AR0A 2ORYA 2P9ZA 3I52A 4E6EA 3AY7A 5HWSA 3I01M 5L7WA 4AS3A 3H16A 4KAAA 4C0LA 3O0TA 1JQBA 1L5HB 1KDZA 1SEPA 3EISA 2BGIA 2D59A 5TE9A 3D0RA 3H6HA 2JGJA 5EHIA 3HL0A 1CSEE 4ETIA 1PIWA 2Q6VA 2YS7A 2H1OA 1A8UA 5D5HA 5HKAA 1LC3A 3CF4A 1JWBB 4TV9A 3UV3A 3KKLA 3V9PA 2DKNA 3URMA 2Y2VA 3AVVA 4D98A 3K7EA 3FG9A 4X1YB 3OE7A 5JS2A 1ZOSA 3KOWA 3PKZA 3PXXA 4YMUA 1VKZA 1E8NA 2VK2A 3VKVA 4ZCRA 1TB4A 1ZI8A 4LY3A 1HYGA 3AO0B 3NWJA 4HYQA 3IP7A 4I5EA 2JGKA 1FQKA 1NXQA 3OQJA 1SXIA 3NEJA 3DBRA 2IFTA 4QDOA 1IL0A 1CZNA 2MINA 3P9YA 3WJ7A 4BN0A 2LXNA 3DLHA 1E9BA 3NPAA 4ZVOA 5LXTF 2YY5A 4F3RA 4UEKA 1Q0UA 5K51A 1TTPB 4TKVA 1NXVA 1O1YA 2GLTA 2Z4TA 4KBGA 1MRSA 2EKZA 1DP4A 3G2KA 1OLSA 2HIMA 3TSZA 3ORYA 5SICE 3VO2A 3U1BA 3EZFA 3QY0A 1Q14A 1XJCA 4K1LA 5ALHA 3I6IA 1Z0JA 2JDIA 4D81A 5GIPE 3SC3A 4AZVA 2YX1A 1E7RA 3NTOA 4QQFA 2IDMA 2LCFA 2PVCA 1XDSA 4LGVA 2BGRA 2HV8A 4MRAA 3LHSA 1DAFA 1ECGA 5ECWA 3OT1A 1PS9A 5JWOA 3P5BA 3FCYA 4DEYA 4DWJA 4UBOA 4UBNA 4UHJA 1A9RA 1RRCA 4IMRA 1PR0A 2O8DB 4E14A 4FOOA 1NXXA 3BYZA 5B2ZA 1XOIA 3PNLA 1V8OA 3MQ4A 1IZ7A 4RGYA 1NA5A 4WASA 5HF5A 2ZZKA 3LYHA 5C4GB 3UCEA 2PA0A 3ABOB 4LXYA 2IDZA 3LPCA 2ES4A 1LK7A 4AQ7A 3A27A 1UODA 3U4MA 2Q3BA 1QWSA 3FSGA 1EP9A 3M4JA 4DCSA 1PJZA 1ZSYA 2ERXA 4GOMD 1KAHA 2PIDA 2IHUA 3Q9SA 2FHSA 1Z5ZA 2C1ZA 4M0LA 1PR6A 1K4KA 3ILXA 3OCXA 5K6AA 3WL3A 4RELA 5J4KA 2I3AA 1HT3A 2G4CA 1U28A 1X7XA 4OP2A 4YA6A 5LMNB 1XX6A 2FCAA 1EJ6A 1QFMA 4BFZA 4EYEA 4RL4A 4QO8A 2XY4A 2NACA 3BTUA 4AF7A 2FOXA 3EA4A 4MVCA 4N9WA 4H7PA 5LP6C 3UJ7A 4BYGA 2HA3A 4MR9B 3FTEA 2GF9A 4B4WA 3GDOA 1GP2A 4XFKA 3AJAA 5GM1A 5C52B 4P2GA 4O2BF 5G0TA 1Q3KA 4IICA 3GJ0A 4MS3A 1P1CA 1K7SN 4Y1EA 5HJ7A 2CVQA 1XE3A 1P1BA 1Y4ZA 2QQ5A 4R16A 1FS4A 3ZI4A 4YRMA 5BRNA 1E99A 4D9HA 3G1TA 4DJ5X 3DL4A 4DLYA 3NASA 1BEZA 4DZTA 2CXUA 2OMEA 4DHEA 2CC2A 3C1UA 4XWTA 1MO5A 1NQVA 4DB2A 1E1RA 1QPGA 4AZ3A 2A86A 2IYSA 4OXQA 1W49A 1YBFA 1E1YA 4INAA 2AR7A