2OCCH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2occH00
2EINH 3ABLH 3X2QH 1OCRH 3ABMH 2EILH 2EIJH 3AG4H 2EIMH 5B3SH 1OCOH 1V55H 3ABKH 2EIKH 2ZXWH 5B1AH 1OCZH 3ASNH 3AG2H 3AG3H 1V54H 2OCCH 1OCCH 3ASOH 5IY5H 3AG1H 2DYSH 2Y69H 3WG7H 2DYRH 5B1BH
chains in the Genus database with same CATH superfamily
2WAFA 3ZQLA 3GFJA 2DJNA 1VQOI 4KIFA 3HOUJ 3K4LA 1U2WA 3LL7A 2FXAA 3E5XA 3OL3A 3FHZA 1E0EA 2DTZA 1YRNB 3N4MA 2V1XA 5ERIA 3S3OA 2BVMA 4RMNA 4B3XA 2O9LA 3CC4I 3LSIA 2K9NA 1FBUA 2K02A 5FKOA 4LMYA 2ISYA 1UAAA 2HXIA 2Y30A 2CQQA 5F27A 1QBJA 3QAHA 3CJNA 2H6BA 1I3AA 2R5YA 3U9GA 5EG0A 3EUHA 3ABMH 3KCCA 3TOAA 3L2RA 2EIJH 2HDCA 4HPQA 3EYIA 1R71A 1I27A 1ZAOA 1BC8C 2EV6A 1SAXA 3ABKH 2GAUA 4MEYF 2F5DA 4BQNA 4DOZA 5IT3A 2MC3A 4BEHB 2WAQN 3TO9A 2JVHA 2Z1DA 3CJQB 2GOXB 2MW8A 4F93B 2ZJPF 1ZR2A 3DTEA 2BEOA 3F3XA 3DLLF 4I02A 2XAJA 5BNGA 2BOLA 3RKWA 1STZA 2W85A 3BG7A 3IC7A 4CCMA 4MEXF 1D5VA 3T8TA 4GXOA 2BW3B 3GW2A 1MNEA 1RC9A 2PEXA 4D5FA 1OCZH 4BQOA 3KP4A 2XC7A 2EFNA 2W82A 3U1KA 4UUSA 2HQ5A 2R7TA 3GX4X 4XNFA 3V42A 5E3LA 2GXBA 4Y33A 3GBGA 2K9MA 1YLFA 2KL4A 3BLYA 2AXTC 1D1AA 2O0YA 2V4JC 1PVEA 3E6MA 5BOXA 1NK3P 4O6JA 4XMYA 4HZFA 2IGKA 5F64A 2NS8A 5J3LA 4Q4ZF 3VWBA 1S29A 3K6GA 5F0CA 4H4KC 2E1CA 4M9ZA 3QYFA 5C3EJ 2VC0A 2HU9A 2VASA 4LB6B 2CV0A 1IXRC 3ZPLA 3W6VA 2XF5A 2EB7A 4O5VA 1ZG5A 4IQJA 4DYCA 3ZOBA 3H3UA 2IA1A 3OS2A 3ZXSA 3I64A 3S17J 4G94A 1GT0C 1QVTA 2VE9A 1SVLA 3F0CA 4HOBA 1KU7A 2NYXA 3PL8A 5FO5A 3I54A 2WTEA 3SDGA 3OIOA 3CUQB 1OR7C 1Z0XA 4OIPF 4I09A 1X3UA 2F2EA 3TP0A 3WTZA 3ZRGA 4AM3A 4JP0A 4B43A 4BHBA 3BR5A 2FJ1A 3PSFA 4V2GA 1F43A 4LITA 4IOAF 3JAMZ 1DPUA 1J2XA 3RPQA 4AIJA 3S3MA 1IG7A 1O7LA 3D1NI 3DKWA 1FNNA 1BR2A 3G1MA 1U78A 2W1OA 3CDLA 3HEFA 3HTUA 3DEUA 3FISA 2PQ8A 2HPIA 4Q48A 3OIQA 4ZC3A 4A12A 2K3PA 3C3WA 3A01B 3HKZA 1B72A 3P9KA 4EV0A 2LKSA 1FTTA 3WU1B 5FLVA 2Y9ZA 2O03A 3CF2A 3M4OJ 1ETXA 2V9KA 4BHCA 2QSFX 4TV7A 2LBFA 3ULQB 1J0RA 2VKDA 2L01A 5LRRA 1U5TA 2TRTA 3FBIB 5JR3A 5LD2C 1LE8A 1C0WA 2V9VA 3SJMA 2C6YA 1XG1A 1J7KA 4C9YA 5E1ZB 3VB2A 2YSRA 3FM5A 1B59A 4DNCA 2XHKA 5GADJ 3KE2A 2MLGA 3B6CA 4NUBA 4DZPA 5DM7F 4XLPF 5D5VB 4PUSA 3SFZA 1BW5A 3J81Z 3LOCA 2K40A 1P4WA 4UY8I 3A0HC 2EA4A 3QYEA 1ZELA 4II3A 1J9IA 2JZYA 3G73A 1UMQA 1BL0A 2XPVA 3IWZA 3E5QA 3HPGA 1HDDC 5EGOB 1WWXA 5DTDA 2ZJ2A 1ON1A 5JLXA 3AG1H 2CW7A 1G2HA 1MMSA 4EJWA 4A3IJ 3M1EA 2W7NA 3K2AA 2CUJA 2A61A 3LSKA 2BY2A 3BROA 1LJ9A 1ZG3A 1PP8F 1CGPA 1VQLI 2K3FA 3K4JA 2JA5J 4CA0A 1ETWA 1GHCA 3KEYA 4RAZA 1W0TA 2CYYA 2HDDA 3K4CA 3OMYA 2VKEA 4D7NA 2ZNZA 3OYFA 2XDVA 1ZLJA 1R49A 1I5ZA 1X1DA 3GLLA 4OWRB 2M4GA 2XUBA 2OZ6A 1N77A 2QSHX 1MZBA 1MJAA 2XB5A 1R5ID 2RNJA 4FQGA 1K4SA 3AFHA 2G7HA 2OF7A 2V26A 2HS5A 3EYYA 2DO7A 2W57A 3DEWA 1VQ6I 3G3ZA 3T5XA 1TNTA 4F52A 4WK8F 4XRMA 3H1CA 2LY1A 3CCEI 3ZMTA 2D1HA 2VQHA 3HOVJ 1ONVA 1D8KA 4U88A 5LGNA 2VKVA 1WHUA 3HDDA 3R0AA 4WXCA 3MFKA 4ETSA 5ICEA 1LVKA 4HG2A 4R79A 2BHZA 3FWEA 3KP2A 1UCRA 2ELJA 4PGGA 3CCJI 2DK5A 4LIVA 1UELB 2ZMEA 3PFIA 1FOKA 2ZKZA 3LSRA 2W00A 3S3NA 3GTKJ 1YX5A 3BC8A 1NH3A 1L0OC 1Q1HA 3OYGA 1ACIA 2M34A 3S2DJ 4ENNA 1DU0A 4CCOA 1JKOC 4PSXA 3RZOJ 4RB3C 3LAJA 1T0FC 2WB1A 5ICCA 1BIAA 1VI0A 1TWHJ 1T95A 1YW8A 2JJ7A 2OPTA 5E3NA 1HW2A 3DPTA 4FE7A 1FOXA 4IQ4A 5L3DA 1MNDA 3BG3A 2KFDA 2OJED 3TEDA 3I55I 1NG6A 3FXKA 5DUKA 2K86A 4A2UA 1G3WA 2IVMA 6PAXA 3J7AO 3WTWC 1U0JA 2Q0OA 1XGMA 2WADA 1VTNC 3COAC 3HUGA 3F8NA 2A5YB 2OAZA 3HRTA 3HOTA 4YFNF 3CUQC 3DKYA 1ETOA 4WWCA 2L5QA 4E7KA 1PDNC 2EFQA 1FOYA 4IF4A 2GZWA 3K2ZA 1OCCH 4MNUA 2E1OA 4UV9A 4QIWN 3GZ6A 4F3QA 9ANTA 2X6OA 3OYNA 4HDUA 5JI6A 1X1CA 4RB1A 5EEHA 1FT9A 3KP6A 3DF8A 3ZN0A 2XRNA 2OD5A 4UHTA 3K4BA 3FMSA 2O8KA 2UV1A 5J1UA 2VI6A 2FBHA 4XK4A 2VQGA 3S1QJ 1ZYRF 3PSIA 2DOFA 1B1BA 3O8HA 3CDHA 3VEPA 4E7JA 1FY7A 3ABTA 2L2OA 1J09A 1TLHB 4M74A 3TMOA 2JA7J 3HOZJ 4PGHA 4IHTA 1SD6A 2W84A 3BR0A 3W2VA 2HQNA 3WTVC 2IAIA 2ZNYA 1QZZA 2R7FA 3RCOA 1K61A 3K1PA 5FB2A 2FNPA 2P81A 4UNOA 3FXQA 3D5LA 1RZ4A 2M1BA 5LLQA 4XLHA 5IPAA 1HKTA 3OS0A 2K9SA 4RLQA 2M2EA 4I6ZA 4BXUA 3F9KA 1BN5A 3I58A 5J47A 3BDDA 1TWCJ 4I99C 3TOBA 4RS8A 3U21A 2EBIA 3JW4A 2KRHA 2L4MA 2KRFA 1F36A 5ICFA 1T38A 3S1MJ 1S7OA 3G4SI 3V8KA 1W7PB 2O6GE 3A1YA 2G0EA 3I59A 4L9VA 5FRNA 4B09A 1IN7A 1Z9CA 1WVRA 2KPMA 3WGHA 1D1BA 2CW8A 2V79A 4IRIA 1HA8A 1X4OA 3J80Z 3ECOA 1MW7A 4HA8A 3I71A 1A5JA 4Y4RA 2Q8KA 2IS6A 3C7JA 3I3LA 3ZQFA 3ASNH 2LG4A 4F7ZA 3V8JA 1I3QJ 3KPHA 4HX4A 1TQPA 1I6HJ 1B9MA 4KDPA 1BM9A 2LF8A 4A69C 3J7ZI 2Q1ZB 3MKZA 4BBSJ 3SYTA 2MD5A 3RQ4A 2HKOA 4IL6C 1BR1A 1R36A 4BE1A 4FCYA 2P0WA 1U9NA 3IRRA 2VJJA 1SVOA 2A6HF 3BT9A 4XICA 1HDPA 4FE4A 3QOPA 4E70A 1G59A 4BHPA 2Q2EB 1OR7A 3H9QA 5CVIA 1GVJA 1TTYA 4CO8A 1BR4A 3BCAA 3L00A 2R7VA 4EM0B 3QYBA 1OLTA 4BJTA 4L5JA 2DA2A 1JHHA 4HSRA 1JTYA 3C2HA 1S72I 1PUFA 2KP6A 3E6CC 2IA0A 4A5MA 3BG6A 1KGSA 2KMUA 5IT9Z 2L0KA 1YYVA 2HNHA 5DCFA 2V9PA 1W1WE 4U87A 2CRGA 3FXMA 2VLAA 4CYDA 2XASA 2QQ8A 4AIDA 1N78A 1UHWA 2NNNA 1BA5A 3CMEI 2PG4A 1A04A 2GLOA 4DZJA 1QPIA 4M3EA 1OFCX 3JR9A 4F55A 3O8GA 1VQ9I 2HEOA 4A5NA 1XC5A 3WE3A 4IKFA 5DS9A 3PUBA 4E4HA 3M3YJ 1TP4A 3HB9A 5KCMA 3S16J 1P7JA 3JRGA 3L2WA 1UHSA 2GQQA 2EIKH 5JVTA 2F4MB 2R5ZB 4JQFA 2OQRA 3LA2A 3BY6A 5AIPA 1YRNA 3DFGA 2ZO4A 3HRUA 2DMPA 1Y56A 3KIOA 2E19A 4HLXA 4PJNA 1HBXG 4HF2A 2P8TA 2GM4A 3P5JA 4IHVA 2UXXA 4LJZF 2XAGA 4G9YA 5TISC 2OBPA 4JX5A 2X4HA 4Q47A 2NS7A 5HVQC 1IC8A 2XGXA 5DEQA 2J5OA 4G8XA 3E6DA 1TQIA 3BQYA 3PNVA 1N25A 2EPFA 2M3AA 3FDYA 3IRQA 2EJRA 4M73A 3H5RA 2DAOA 3DTIA 1JXSA 3CLQA 2Z33A 3BTLA 4NNJA 3VOEA 2K27A 1J75A 5C4XJ 3HOSA 4W97A 1JE8A 2DXIA 4MIMA 1FJLA 4B1RA 2QF7A 5D5UB 2Y0MA 1G3SA 1ZTRA 2DK8A 2Z5UA 4M71A 1XCVA 2M8EA 3JREA 3F21A 4Y3OA 1PP7U 3FKIJ 3EUAA 1E3HA 1KQ8A 2W48A 4E7HA 4BU2A 1IGNA 1WJEA 1ULYA 5EZGA 1X19A 5EEAA 3BJAA 3E97A 1IRFA 2JA8J 5EDNA 3L9FA 3E6BA 4KJZA 5H6RA 4ZYEA 4RB0A 2E2IJ 3OSGA 1T08B 5E17F 3E0JB 3CCRI 5F04A 2X9DA 1YX3A 3FIWA 4XORA 1BC7C 2QBYA 1FSEA 1IN4A 2DT5A 2W4SA 4XL9A 2ISZA 1DGWY 2BY3A 1U8RA 2RNGA 2HVQA 4F92B 2R7OA 3WU2C 4UB8C 4LLLA 3JRDA 1CF7B 1QO0D 4A3JJ 2IBDA 5FD5A 1FEXA 2IA2A 4KFCA 4U7DA 3REOA 4L9TA 4A3KJ 1W36C 3KLNA 1XMAA 4UUVA 2ME6A 1T0FA 3FXUA 5DD4A 2OZUA 5F0HA 3IV5A 1Y1VJ 3ML6A 2ESNA 5K5QA 5LGUA 3H92A 5M5WJ 1RI7A 5FROA 4EQQA 2CO5A 2VBYA 5DCMA 4A0YA 1IV8A 3DV8A 3H3ZA 4KIGA 4BQQA 5B5EC 3K1MA 4NBQA 3OS1A 1HF0A 3VSKA 4PFOA 2M7AA 3OOPA 3OYLA 3OYMA 1WJCA 4DQ2A 2ZCWA 5HS7A 4FISA 1IV6A 1OYWA 1YW7A 2KIMA 3ZMVA 4D9JA 1AKHA 2DA1A 1NHAA 4IRGA 2NVQJ 5D4SA 2KJCA 2CS3A 1NG7A 1ODDA 1KU2A 3RTRA 2FBKA 3IKVA 3K4KA 4G6TB 4QPQA 3CP2A 1ZH5A 3BR3A 3R0JA 1YI2I 4K2EA 3IHUA 2WA0A 4CCLA 4EJOA 1Z7LA 1IDYA 1WH7A 2NOJB 5F1JA 3S14J 3FXLA 2GIZA 4CDGA 1S8NA 5DV5A 2EFWA 1FLIA 2X6YA 4D5CA 3DXJF 3Q0WA 3HKZN 1QVUA 5B1AH 2XF6A 2IP2A 5DD8A 4QWQA 3A02A 3AG2H 3OR1C 2LLKA 1G8XA 2V1NA 4A3LJ 3QPTA 3HM5A 2X1EA 4M6XA 4LB5A 2HQRA 3FK6A 2GWRA 4G12A 3AKZA 4V2FA 4ABZA 3VDXA 4DGWB 4MFDA 3M07A 1AHDP 4AU7A 1R1UA 2E5ZA 2ZC2A 4YELA 1JI8A 2IGMA 5IOYA 1J59A 1QGPA 4M72A 4A6DA 3CF5F 3NRVA 2K9LA 3JTHA 3DBRB 2JUCA 4XLNF 2IPQX 2LH9A 3F8BA 3RYRA 2AS5F 3KEOA 3CCMI 4GRIA 3HIFA 3OL4A 2O3FA 3U2RA 4M3BA 3CTAA 2E60A 3KYDB 2F4IA 2LC2A 3S8PA 1TQMA 4B4CA 3LSGA 3LSMA 1GLNA 3DU5A 3J7YJ 2MLKA 1PUEE 2HYGD 4YG2F 1Z3XA 2PLYA 3GFIA 2ZJQF 3CCQI 1ENHA 1ETVA 1MH3A 2QLZA 4R8HA 4EMSA 2VONA 3ROUA 4YIRX 5FGMA 3BQZA 1I50J 2K5CA 2P5VA 3SZTA 1MBKA 2VBZA 3G1OA 3QPSA 5GTIC 2UXNA 3JSPA 1IXSB 2DMTA 2RAEA 3VODA 4CZZA 4A3FJ 4BQAA 3CCYA 2CV1A 2M30A 2H8WA 4RM3A 2L7ZA 4RM2A 5CPRB 5J8FA 2DMNA 5JHFA 2JPBA 3GF2A 3QU3A 4IX7A 4F91B 1BIBA 2N8GA 2V6CA 1DP3A 1T33A 5E3MA 2BXZA 2BV6A 3LQQA 1ETKA 3MVPA 4YFXF 1JGGA 2ZFWA 1A31A 3PQKA 3ZQIA 5FD6A 5HODA 3GO5A 2VUMJ 2ZSHB 3LA3A 4N4OB 1R7JA 3PUFA 1YHQI 1MSEC 2P5LC 4JBAA 2HZTA 3DU6A 1SMTA 2XB0X 3HG9A 4E7LA 3K7AJ 2X0LA 4P5OA 3R61A 1R58A 2DA4A 2BGCA 3TW6A 1YJNI 4L0YB 5D8LB 2P7VB 1KA8A 4WX9A 3NARA 4ZZLA 3GMEA 3S2WA 4B8XA 4ZZDA 3CO7C 1KONA 2DFIA 2L7KA 3HHHA 3PIPF 4HDVA 3LMMA 2VE8A 1D5YA 2F5EA 4RA2A 2F5FA 3FXOA 3KP5A 3LSJA 2M4KA 4A0ZA 1AU7A 3I9V2 1MBJA 2WB1N 4BGDA 2KDZA 4I7HA 2E5NA 5IY5H 3U1DA 3GTLJ 3MEXA 3T0YA 3TGNA 4QTRA 1E2XA 3SQNA 2DQLA 4CUGA 2OU2A 1OCRH 4GYIA 3QRFF 1HXDA 2MH2A 4LG0A 1JJ8C 1WPKA 2VJ4A 1FMWA 1LDJA 1TW3A 4W1UA 3I56I 4EEFG 4BY1J 3KEQA 1G3TA 4NB5A 4M9XA 2LFBA 3GYHX 1EKEA 2PMZA 2FRHA 5GTHC 2VL8A 3KZYA 1B8IA 1OYIA 5D8KB 2H8RA 1H88C 3Q3SA 3OYJA 4I76A 1DQUA 1I6XA 4NC7A 1Y0NA 1WJBA 4G6DA 4MHGA 2FF4A 3RZDJ 4DBRA 1HLVA 1D0YA 2ZFUA 1XCBA 2LOOA 2LVSA 2LK2A 3BOQA 3OSFA 1ZREA 3MD2A 5BQTA 4HF1A 1QHGA 1FBQA 1FOWA 2A68F 5LHHA 3M9AA 4A3BJ 1Z67A 3PIOF 3H9GA 3H0DA 3FXJA 2R5YB 2DFFA 3RYPA 1FBSA 5EG0B 2EA2A 1Z05A 2R7XA 2ACJA 4AVPA 3K4NA 2DA6A 2HOTA 4JX6A 4AVZA 3IH2A 1PJRA 1WJFA 4HF0A 1G6NA 1XB4A 1WH5A 2EZIA 4LGWA 2K7LA 2X51A 2IS4A 4M6VA 2A69F 2IGNA 4M6YA 4OAZA 1ZN2A 4IRHA 3FBNB 1R6RA 4PJMA 2P7CB 3GTJJ 1KZHA 4BH9A 5LBQA 2LDUA 1UFMA 2VB6A 4B47A 5D4RA 4WCGA 2ELHA 3ERMA 3MWMA 4PDKA 4KN4X 4KT6A 4IO9F 1FC3A 5CVVA 2DDAA 4J00A 1DP7P 1OKRA 2CMPA 2EH3A 4EJVA 1T6SA 4Y15A 3HSRA 2LF7A 5IYDJ 3DBHB 2M5WA 2E1NA 2B63J 2GA2A 2XF7A 4BKXA 2CFXA 2WY7Q 3FM3A 3JRCA 2Y48A 4N0BA 1UB9A 4UUSB 1ZGJA 2O7OA 1YJ9I 3F8CA 4RB2C 1I1SA 5IYBJ 2K4JA 2KZVA 2ZB9A 3CMMA 3E1SA 3H5NA 2HOAA 3K1NA 1HCRA 2PJRA 4JK1X 4E7IA 4G7ZF 5BS6A 1ZRDA 4DYQA 5B1BH 3F23A 3ERED 4IHXA 2HGCA 4HQEA 1LDDA 2DMUA 2YS9A 3NWTA 4U7BA 2OTJI 1Y0UA 3DQVC 1HC8A 1H0MA 1Z77A 4XRSA 2I8DA 2XGEA 1R1TA 1XN7A 4DIQA 2JQ7A 2Y31A 4Y17A 4J19A 3E7LA 1WGXA 3CZ6A 2DPDA 3ZP5A 4X6AJ 2XV4S 5LHIA 1ZRCA 2FQ3A 1WKMA 1XGOA 4XRFA 3S1NJ 1UJ8A 5JHUA 5D6EA 1U6GA 2VKHA 2CJJA 3WTUC 2PBIA 4HSTA 1LKXA 2Q2EA 2EINH 3VYTB 1O57A 4OMZA 2DQRA 2R7SA 4I01A 1X1PA 2L4AA 2NVYJ 1G4DA 2DMQA 1A36A 3A03A 5HDGA 5IP9J 1IF1A 4L9NA 2QWWA 1EJ9A 2XROA 2RREA 5FKMA 2VXDA 3I4NJ 4BJ5C 4EJTA 1XGNA 2JA2A 4PSWA 5KVRA 1D1CA 4OMYA 3FXRA 5DDGA 3IP4B 1JUMA 1YO5C 3Q0UA 3CCLI 1FMVA 1O3SA 4XLCA 4A3CJ 2AXLA 1IO2A 1FIAA 2HFHA 3HRMA 4D0PA 1B72B 3SFIA 2MABA 1V5EA 2Z3YA 1WJ5A 1QNTA 2BY1A 3MZYA 4AWXB 3N97A 1REPC 2R0QC 4IEJA 3ABLH 3M1CA 2LMDA 3ONQA 2L9VA 2VPRA 2QQBA 2CWEA 1XDUA 1SD5A 4GDFA 3HSEA 1U5TB 3O2PE 3LNQA 1V5FA 4I2OA 5E79C 4PJLA 1DPRA 3CCVI 1Y1WJ 2P6TA 4DBQA 1FX7A 2YPRA 5C4JJ 1LUJB 1ON2A 4FT8A 5GAHJ 2COMA 1WFXA 1YOVB 2K4BA 3LFKA 1EA3A 2VIXA 2LP0A 3ZMUA 2YUSA 3BG5A 2B7EA 2R7RA 2YR2A 3RPUA 1RPWA 3BZCA 1XSDA 1GVDA 2DA3A 2OA4A 4NHJA 1Z21A 4EGYA 1SMYF 4ZTFA 4L5EA 2LSOA 1O3TA 1AA7A 2V1DA 1M1EB 5JFRA 4X0GA 1TT5B 1OCPA 2JMWA 1IUFA 4ENJA 4XQFA 2NVXJ 4NQWA 2STTA 2PI0A 5F1RA 4XLAA 4P55A 2JTVA 4DJAA 2RQQA 2OUMA 5AONA 4IHWA 5LEKA 5BMZA 1TWFJ 1T56A 4CYCA 5TJJA 3CESA 1U8BA 5BPDA 4RGUA 4N9IA 4BXFA 3C18A 2QUFA 1E3PA 1TT0A 3L7WA 1SFEA 4NDLA 3HOWJ 2XAHA 3I4PA 2DDBA 1HW5A 2EIMH 2YX4A 3LSTA 3NEUA 1K78B 2STWA 4JOMA 2HI3A 2A3SA 2Y75A 3TW7A 1OISA 3TDUC 4BY7J 3JCUC 3K9TA 1MDMB 1B6AA 5L3CA 2UZKA 2EFOA 5K7HA 3NWSA 3K10A 5ILVA 3HZJA 3KX2A 2CQKA 3ABUA 3HYIA 1JGSA 1OQYA 1ZKGA 4LOCA 3KLOA 2DPUA 3L2CA 1FSHA 1WRJA 2WV1A 5J40A 5LGTA 4FTHA 3FX3A 1HSTA 3O3KA 3W6KB 2KIQA 3MN2A 3DPLC 1DUXC 4A0XA 3M8EA 4P96A 5HS8A 4OINF 4ZTJA 1BBYA 4BNCA 3MZ8A 2ZMEB 2TDXA 4XOTA 1CF7A 3FF5A 5CQEA 2MSYA 3T8RA 2IS1A 4YEJA 1MNMC 4ENKA 3QPHA 1SVMA 2YX7A 1WCMJ 2VT3A 5HLTA 5FKKA 4PJJA 2HQAA 3FMQA 5A2QK 1S9HA 3C2GA 1D3YA 4IVNA 1DU6A 4P1WA 2PMUA 2Z16A 2NVUB 4ENMA 1MJBA 4C2UA 3HRSA 5D5WB 2QA4I 2LREA 1KQ9A 1RUOA 2ICWG 3ELKA 2L9RA 1YW9A 2K9QA 4MLOA 3WGIA 1ZHFA 2VPLA 4KMUX 1A6QA 1Z6RA 1FYLA 2L02A 5H20A 3HUGB 4G6QA 4UVBA 4OIQF 2KLOA 3BR1A 4BDYA 1TL8A 1O4XA 2RDPA 3M7GA 3TP3A 1GDTA 3AG4H 4KICA 4B48A 5EYRA 1R4NB 3HGGA 4YRVA 3NQOA 1O7FA 3VYUB 5IP6A 4H0EA 3CDIA 4XN0A 4HAMA 3MKLA 3Q9VA 2JVGA 1TWAJ 4XLEA 4CZCA 2QSGX 4Z2YA 2F5CA 4E6KG 4JYKA 2XAFA 2EZLA 5F6FA 4I98B 1DDNA 2H94A 4U0YA 3I4MJ 2M7BA 5FLXZ 1XS9A 1YG2A 1FIPA 2HYFA 2O8XA 2RV8A 2W24A 1BI2A 3CUOA 1KU3A 3GEZA 4LK0F 4M3FA 1CQTA 1U5TC 4DYRA 2KDOA 4PK4A 3F6OA 1XSXA 2EK5A 2FD5A 4XKBA 3SDBA 2AO9A 1XD7A 2XAUA 1FP2A 3W3CA 1G3YA 3HOXJ 1WJDA 1Q1VA 2EZKA 3H5AA 3GTMJ 3OYKA 1KU9A 1Z3YA 2R3SA 4E7ZA 2R7DA 4KN7X 1LNWA 2JT1A 3L2QA 3OY9A 2HR3A 4Y7NJ 3OR2C 4BEHA 4KITB 3DP7A 4ESJA 4R1HA 1R22A 3F8FA 3QU6A 5FLMJ 2OCEA 4XSZF 3QQAA 2OQGA 2E7WA 4LIUA 5FFZA 4IHSA 1Y6IA 3IKTA 3DTKA 2JRMA 4A3DJ 4Z6YA 4A3MJ 3WE2A 5IT9K 2OCCH 3I59B 1RUNA 1LDKB 2CQNA 2BW3A 2LKPA 3Q0VA 1MBGA 1BI0A 4L9JA 5KNLA 4MO7A 3L1PA 5CLSA 1VQPI 3W2AA 4Y52J 2WY8Q 2DYRH 5M3MJ 3BCBA 1USSA 3RQIA 3TKYA 2PX9A 1P6RA 5DYMA 2F4OB 2CQ7A 5JVGF 2DJIA 1RKWA 1IJWC 2QEXI 3H0GJ 2X1CA 3ZCOA 4D7MA 2V1UA 1K7AA 4HW0A 4C30A 2A6EF 2MGQA 2XGCA 2NXNB 2V7FA 1HQCA 4EATA 4AC0A 3CMYA 1T2KA 3N05A 3K70D 2Y0SA 5F08A 4UB6C 2R92J 3AL0B 5E1WA 3A2KA 3IAS2 4AUXA 3RI4A 2M8GX 3SZGA 4RBOA 3EETA 2DT6A 4U0WA 1V5GA 3SZPA 4IPAA 3RSNA 3C1DA 4FASD 3JSOA 4EM2A 4HNTA 1RR8C 1P4AA 4C2TA 1YIJI 1T98A 1X2NA 2A6TA 4XKWA 2IEKA 1QPMA 4AIHA 1RRJA 5K7FA 4EGZA 1ZR4A 1W36D 1FYMA 4CCJA 2FE3A 2KIFA 2TCTA 3G71I 3RKXA 1PUFB 5AIQA 5J4VA 2B0LA 3AG3H 2CU7A 3DEEA 3CUQA 3GFLA 2IRFG 5TGTA 4KYWA 4Q5SF 3HTSB 3K0LA 1V4RA 1XTAA 3D0SA 2HTSA 2LNBA 3AAFA 1MMAA 3GZ5A 3V4GA 2WV0A 1MBFA 3KYCB 3KP7A 2MFZA 1VQ4I 2DOEA 3SEZA 5TRDA 1POGA 4MTDA 3H35A 3RJPA 1ERDA 2ME0A 2NVTJ 5HS9A 4LLGF 3BZ6A 2JPCA 3ZMDA 4ASNA 3QPLA 3A01A 3CCSI 4JX4A 2PMZN 4ZYHA 1YFHA 1MBEA 2E35A 3P7NA 4BE2A 2VOOA 2X6XA 3BPVA 4B3AA 1TWGJ 1USTA 3IWFA 4L18B 3L2UA 1ZARA 2X48A 4RAGA 2EZHA 2JSPA 3DCFA 4XR6A 2H1LA 3TO6A 4IJAA 4I0AA 4MQ9F 3GTGJ 1W5CC 4YIIA 4PJ0C 1K79A 1ZRFA 5L3EA 1ZGAA 4MTEA 3WTTC 1ZGWA 2HVRA 2ZJRF 1I1GA 5ILUA 3RIRA 1YQAA 1TBXA 2UUZA 3OYAA 4LLNA 4AYBA 4QLCU 1MSFC 3LA7A 2XKPA 4C3HJ 5EGOA 2E36A 1JHFA 3FMRA 1Z6TA 4S0HB 3G2BA 2VJIA 3DWLE 3W2WA 4KA4A 5LEJA 2M87A 2ESHA 1IN5A 3RPUD 1VF9A 1BJAA 2MH9A 1LVAA 1K4TA 3QP5A 4ESFA 3G1LA 2A05A 4FETA 4S05A 1P4XA 2PN6A 2NAZA 2BZTA 2W25A 1LB2A 2DYSH 1SD4A 4CSWA 4U0VA 2EV5A 2R7QA 2JRTA 3FKJA 4HLYA 3HBLA 3C2BA 1V3FA 5CQGA 5FRMA 3CP8A 2FMLA 1OCOH 4XIDA 2KHMA 2Z99A 2A07F 2F5VA 2NS0A 3MMYB 3LQRA 2QBYB 4S04A 2KT0A 2LTPA 1JUSA 3KFWX 1S7AA 2XIGA 2P6SA 1MH4A 4A3EJ 3V8LA 5HLHA 1PYVA 1A35A 5L3GA 1GV2A 2VT2A 4GGGA 1VQ7I 1SEUA 3WHBA 2RKHA 4FHTA 1LFPA 2DW4A 2ID3A 2DBBA 1NTCA 3GTOJ 3KYLA 1JTXA 1P2FA 5E8GA 2ETHA 1OJLA 2FMYA 3WG9A 1BOBA 1W5SA 1R4MB 2VQCA 2FX0A 1WZ2A 1VQKI 1RESA 2IJLA 4E7SA 3F22A 2AHQA 5DCMB 2Z2SB 3K69A 3A0BC 2ID6A 2FOWA 3BJOA 3S32A 3AL0C 4WF2A 4KIBA 1IRXA 2DOAA 4C3JJ 2LKXA 2ZBKA 4OAYA 1FYKA 5JLWA 1YS6A 3ZN1A 3WG7H 2NNYA 2Z9OA 1UG0A 2L7MP 3K4MA 1LPQA 4A3GJ 1R5HA 2WBMA 4HV6A 4V19K 4AD9A 4PFPA 4XLFA 1K83J 3Q5FA 1IRZA 1AOYA 3WTSC 3P9CA 1R00A 2DCEA 4ZDLA 3L2VA 2E7XA 3BTCA 4L5IA 1GUUA 4WXDA 4GYGA 1AKHB 1X4PA 3GTPJ 2R7ZJ 5GAGJ 4UVAA 5M5YJ 4KT5C 1U9OA 5EF6A 2XPWA 3ESWB 3WTYC 4AIKA 1W0UA 1YJWI 3QODA 3ZQHA 1YTYA 3ASOH 2NRAC 4P9FA 1MMGA 4LG3A 1S7EA 1LQ1A 2HKXA 3WTXC 2XVCA 1VQNI 3ZMZA 1O3QA 1JJ6C 1JT0A 4ZYGA 2O61A 2MBFA 3ZQQA 4B44A 5ICGA 4IXAA 3ZQGA 5KAFC 2JSCA 5E8IA 3LSPA 5EJCA 4G7OF 3PNTA 4RGRA 4IOCF 3UKGA 2JA6J 3VYSB 1QQIA 4I0BA 4QPOA 1FP1D 4C3IJ 5LHGA 1R5GA 1A6IA 1WJAA 3FHNA 2D2WA 4BL0B 2MC4A 1HOMA 1X2MA 2F6CA 4MGRA 2MD0A 1BW6A 1SD7A 3SEQA 1IN6A 1ETYA 1R1VA 3S93A 1D0ZA 3RKQA 1MMNA 1N75A 1YITI 2F48A 3R6SA 2V6EA 2QCOA 5HLIA 2XAQA 1RKTA 2QENA 2XKOA 5L3BA 3TL4X 1IN8A 4ITVA 4FX0A 3VSLA 1SFXA 2FEZA 5CVUA 1OPCA 3F8MA 3HOYJ 4EJUA 2WAQA 3QOEA 2ZXWH 4HEA2 5J1YA 3HC7A 1MBHA 1B9NA 2X1DA 1QRYA 5HDKA 5DM6F 1BI1A 3NAUA 4XN3A 1X3WB 2HXOA 2VC1A 5HDNA 2ELKA 3QP6A 2CG4A 2IGOA 2I5UA 2KJBA 2MA3A 1SAUA 4RGSA 4N9HA 4XSXF 1QU3A 3B73A 5HOOA 1L3LA 4XKVA 3JAMK 5B3SH 3IAM2 2BE5F 3TO7A 2EWNA 4A6EA 1XMXA 1W7PA 4KUMA 1ITYA 5M5XJ 1BOAA 1K78A 4HYEA 2M45A 2HYJA 3M8FA 1S6LA 1XX5A 2AQEA 2R7WA 3GCMA 1X1BA 3EDPA 3FZVA 2DFEA 5J4YA 1MDMA 4Y13A 4GO1A 4UVCA 1RIOH 3BJ6A 2D5VA 1XMKA 5EEGA 5CYVA 2BYVE 4HQMA 4P9UA 2E2JJ 2QKLB 4BE0A 5FKLA 1F4KA 4WXHA 1OYYA 5GP9A 2VQLA 3BWGA 3KZIC 1U3EM 1VZ0A 5J1RA 1WI3A 4UXNA 2H27A 3UR3C 4BS9A 3J81K 4GFBA 2YU3A 2BY0A 3EQLF 4II2A 5IOZA 2CUZA 5FJ8J 2BBYA 4MQVA 3LFUA 1OMIA 3VYRB 4BBRJ 5J8CA 4OU0A 4YFKF 3OYEA 2VODA 4ZDOA 1ORKA 2ECBA 5KHDA 3OYHA 1TZLA 2LRDA 2B9SA 3DLAA 2FSWA 1IUYA 2DN0A 2R93J 1Z91A 2HVSA 3HJEA 4MFEA 4M3DA 5E3OA 4LFUA 4LG0B 2RN7A 3PQJA 2BHYA 2VXZA 2OTLI 3CLOA 2KISA 2Y2ZA 1QZEA 3I5UA 3CO6C 4UUTA 3EUKL 4CCKA 1XGSA 1D8JA 1B8IB 3BTJA 5ILSA 3DKXA 2DA5A 1RETA 2LBFB 5ED4A 1XPXA 4KNYA 3T1BA 3OOUA 2WAEA 1LE8B 3S2HJ 3VPRA 1EH8A 3MZHA 3S15J 1YE9A 1EH7A 3RKYA 4ZDPA 1O3RA 4IHYA 4UV8A 5FKNA 3HXLA 1FWZA 1V54H 1VQMI 1BI3A 2HOEA 4IZZA 2XSJC 3BZKA 1Y39A 3GLXA 1SC7A 4FX4A 2LD5A 2CUFA 3A4CA 2ECCA 2R5ZA 1MKMA 1EV7A 1VNDA 2EV0A 3PO2J 2VBXA 1F5TA 3ZQCA 1FPQA 3PNYA 1EF4A 2GIVA 4XKCA 2E34A 5H6QA 2X6WA 1GV5A 3P9IA 2P4WA 1D0XA 1MMDA 3BR6A 2KRCA 3OYCA 3J7AY 1TNSA 5A2QZ 1IW7F 1Y8QB 2KQRA 4PZJA 2GBYA 5D6FA 1KYWA 1K6YA 4ZH4F 5DUIA 3GFMA 3ECHA 2H09A 1S5LC 2K85A 2LY9A 1FZPB 2ZSIB 1MGTA 1IAWA 3CJTB 1EH6A 5HLGA 1P92A 3EUHC 1B4AA 2VN2A 1W4MA 2LY2A 2ZXHA 3R4KA 2HOSA 3BTIA 4M9SA 2IXSA 1QHHD 2QQAA 5C44J 1SFOJ 5KK1A 3WU0A 5IYCJ 2L9SA 3F6VA 1VQ5I 4NC8A 5J6XA 1UHMA 5CKTA 2QZ8A 3DPUA 4GCVA 4RLFA 2JN6A 1LFUP 4A93J 1RNLA 1E3OC 2IW5A 2HWVA 4HX7A 1SFKA 4BAYA 2IS2A 1IDZA 5K1YA 4CHUA 2BVLA 2KIUA 2LR8A 2OC6A 1ZQ3P 2ZXJA 2H6CA 4N4NB 3S1RJ 2FBIA 5CJ9A 4D1QA 4HNVA 3H36A 3B6AA 2G7UA 2QQ9A 1TW2A 3BR2A 3GZNB 3JRHA 3OYBA 3LSHA 3R60A 3TQNA 1X3ZB 2JWTA 1H8AC 2PJRB 2UWMA 1R23A 3PFYA 4XONA 2OV7A 2O5RA 3BP8A 2YU9J 3B02A 2CV2A 3I53A 4BDZA 2XPUA 3JRBA 4KISA 3E3VA 1JKQC 2PFBA 2Y0SN 3F72A 2DU9A 3CC7I 4BXXJ 3IL2A 3OYIA 3G6EI 5GPAA 2JK3A 3MCZA 2LYCA 5LRSA 1LEBA 3ZQ7A 4RGXA 1JKPC 1T39A 2JUGA 3JRFA 3HHGA 5E20A 3ZR8X 5K7ZA 2DODA 2CUEA 1J5YA 3I0TA 4HNUA 2RGVA 3RDIA 3HPHA 3CCUI 1V55H 3V7RA 3BPXA 3PJRA 2VOPA 3LAPA 1YIOA 3MKYB 4BACA 2E1MB 2NOGA 1K6OA 4CICA 4J01A 5KAIC 1VFCA 2J5PA 4EM1A 2L7FP 5B66C 5EZHA 5BPIA 5IP7J 1F1ZA 1HSJA 2I10A 3GWZA 3ISPA 5FFXA 2FU4A 4ON0A 1WQ2A 4L0ZB 3HL2A 2PJPA 1GXPA 3OV8A 3LWFA 2R4GA 2XRLA 3OWTA 4BUPA 5E18F 1UG2A 2QM3A 4ZYAA 3KP3A 1P7IA 1BJZA 4XBFA 3MKWB 2G9WA 4ZYDA 3D5RC 2DFHA 5H2FC 4PCQA 2ZXIA 3WGGA 2HPMA 1LEAA 2L9NA 3OYDA 2CW0F 3PM1A 3D5SC 1WSUA 2GXAA 2WWYA 2IT0A 2DI3A 1APLC 3X2QH 3J80K 2EFPA 2HTJA 2QGUA 1I39A 1QZYA 1MIJA 3HSFA 3CMAI 1HW1A 3CJRB 3GVAA 3GXOA 2PMHA 4CGZA 2QKMB 4RDUA 1HKSA 3KZZA 3JRAA 3UNGC 1DGRM 2X85A 1H9GA 2HDWA 3JRIA 2GXGA 5GAEJ 3CQZJ 4CCNA 3CC2I 2COBA 4RAFA 3M8JA 1T8IA 2BXYA 4RAYA 3H3VK 2CQXA 2E71A 4OIOF 3QWLA 4LK1F 4NQWB 2M0CA 4KMFA 1Z1DA 4AYBN 3EPZA 1IRGA 3V7CA 1R9TJ 1X1AA 2Y9YA 5F0FA 1S3JA 4EVIA 3ZMSA 3ZGKA 1QA6A 2CFOA 2VJ5A 4CYCB 3OIPA 2HZDA 2GA1A 3PO3J 2A5WA 1MJ9A 1Z7UA 4M3GA 5M3FJ 1RR7A 2L54A 4G7HF 3SHFA 5HNFA 1FTZA 4HBLA 2FQ4A 2GOMA 2FUG2 2RQPA 1HKQA 1ZK8A 2M9HA 2FOKA 4QSHA 5LFAA 1ETQA 3VFZA 2RC4A 1JKRC 1E17A 1GXQA 4BYYA 2VBWA 1H89C 5GPCA 2FA5A 2KZGA 1JT6A 1P9QC 3V7SA 4HX8A 4HRIA 3GUDA 3Q9SA 2DA7A 3SXYA 1W5TA 1UZCA 2QVOA 1SANA 5D5XB 3K70C 1KQ0A 1NK2P 2Y69H 3WHCA 1SFUA 2CH0A 2FNAA 1F9NA 3L09A 2DT7B 3O6BB 1XDSA 2E2HJ 4XM3A 4X1EA 2WC2A 1W7PD 2ADUA 3BG9A 2EILH 1H9TA 2MYSA 2P5KA 3IUOA 2M0MA 5K5OA 4LD5A 4ESBA 2D45A 4OIRF 3CD6I 3MAJA 2CSOA 3DBLB 4O3MA 1JUPA 3WODF 5K5RA 4DW6A 2QYOA 5FLXK 1TC3C 2DTRA 4CH7A 1LFBA 4CXFA 4YIFA 2XGDA 2AQFA 2ZMEC 3GTQJ 5E1XA 2D1VA 1XSVA 2DLLA 1MD0A 3TDZC 4C2MJ 1WI9A 3TBIA 2XSDC 3HGYA 5CVRA 3W6JB 5HNHA 4OOIA 3FK7A 1IZ1A 1X58A 2EQRA 4BJ6C 1KYZA 1IXCA 1AWCA 4XOPA 2CGPA 3H9JA 1ZLKA 3MQ0A 2KKOA 1ZG1A 4XRSG 5CVJA 5L3FA 1OCTC 1VQ8I 4HV5A 4NC6A 4ZJZA 3KETA 3JTGA 2RVCA 2E1MC 3IH4A 1Y8RB 3E5UA 2R7UA 2MG4A 1YS7A 3IH3A 2L3DA 2H1KA 4ANJA
chains in the Genus database with same CATH topology
2EINH 3ABLH 3X2QH 1OCRH 3ABMH 2EILH 2EIJH 3AG4H 2EIMH 5B3SH 1OCOH 1V55H 3ABKH 2EIKH 2ZXWH 5B1AH 1OCZH 3ASNH 3AG2H 3AG3H 1V54H 2OCCH 1OCCH 3ASOH 5IY5H 3AG1H 2DYSH 2Y69H 3WG7H 2DYRH 5B1BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN H;  3ABL H;  3X2Q H;  1OCR H;  3ABM H;  2EIL H;  2EIJ H;  3AG4 H;  2EIM H;  5B3S H;  1OCO H;  1V55 H;  3ABK H;  2EIK H;  2ZXW H;  5B1A H;  1OCZ H;  3ASN H;  3AG2 H;  3AG3 H;  1V54 H;  2OCC H;  1OCC H;  3ASO H;  5IY5 H;  3AG1 H;  2DYS H;  2Y69 H;  3WG7 H;  2DYR H;  5B1B H; 
#chains in the Genus database with same CATH topology
 2WAF A;  3ZQL A;  3GFJ A;  2DJN A;  1VQO I;  4KIF A;  3HOU J;  3K4L A;  1U2W A;  3LL7 A;  2FXA A;  3E5X A;  3OL3 A;  3FHZ A;  1E0E A;  2DTZ A;  1YRN B;  3N4M A;  2V1X A;  5ERI A;  3S3O A;  2BVM A;  4RMN A;  4B3X A;  2O9L A;  3CC4 I;  3LSI A;  2K9N A;  1FBU A;  2K02 A;  5FKO A;  4LMY A;  2ISY A;  1UAA A;  2HXI A;  2Y30 A;  2CQQ A;  5F27 A;  1QBJ A;  3QAH A;  3CJN A;  2H6B A;  1I3A A;  2R5Y A;  3U9G A;  5EG0 A;  3EUH A;  3ABM H;  3KCC A;  3TOA A;  3L2R A;  2EIJ H;  2HDC A;  4HPQ A;  3EYI A;  1R71 A;  1I27 A;  1ZAO A;  1BC8 C;  2EV6 A;  1SAX A;  3ABK H;  2GAU A;  4MEY F;  2F5D A;  4BQN A;  4DOZ A;  5IT3 A;  2MC3 A;  4BEH B;  2WAQ N;  3TO9 A;  2JVH A;  2Z1D A;  3CJQ B;  2GOX B;  2MW8 A;  4F93 B;  2ZJP F;  1ZR2 A;  3DTE A;  2BEO A;  3F3X A;  3DLL F;  4I02 A;  2XAJ A;  5BNG A;  2BOL A;  3RKW A;  1STZ A;  2W85 A;  3BG7 A;  3IC7 A;  4CCM A;  4MEX F;  1D5V A;  3T8T A;  4GXO A;  2BW3 B;  3GW2 A;  1MNE A;  1RC9 A;  2PEX A;  4D5F A;  1OCZ H;  4BQO A;  3KP4 A;  2XC7 A;  2EFN A;  2W82 A;  3U1K A;  4UUS A;  2HQ5 A;  2R7T A;  3GX4 X;  4XNF A;  3V42 A;  5E3L A;  2GXB A;  4Y33 A;  3GBG A;  2K9M A;  1YLF A;  2KL4 A;  3BLY A;  2AXT C;  1D1A A;  2O0Y A;  2V4J C;  1PVE A;  3E6M A;  5BOX A;  1NK3 P;  4O6J A;  4XMY A;  4HZF A;  2IGK A;  5F64 A;  2NS8 A;  5J3L A;  4Q4Z F;  3VWB A;  1S29 A;  3K6G A;  5F0C A;  4H4K C;  2E1C A;  4M9Z A;  3QYF A;  5C3E J;  2VC0 A;  2HU9 A;  2VAS A;  4LB6 B;  2CV0 A;  1IXR C;  3ZPL A;  3W6V A;  2XF5 A;  2EB7 A;  4O5V A;  1ZG5 A;  4IQJ A;  4DYC A;  3ZOB A;  3H3U A;  2IA1 A;  3OS2 A;  3ZXS A;  3I64 A;  3S17 J;  4G94 A;  1GT0 C;  1QVT A;  2VE9 A;  1SVL A;  3F0C A;  4HOB A;  1KU7 A;  2NYX A;  3PL8 A;  5FO5 A;  3I54 A;  2WTE A;  3SDG A;  3OIO A;  3CUQ B;  1OR7 C;  1Z0X A;  4OIP F;  4I09 A;  1X3U A;  2F2E A;  3TP0 A;  3WTZ A;  3ZRG A;  4AM3 A;  4JP0 A;  4B43 A;  4BHB A;  3BR5 A;  2FJ1 A;  3PSF A;  4V2G A;  1F43 A;  4LIT A;  4IOA F;  3JAM Z;  1DPU A;  1J2X A;  3RPQ A;  4AIJ A;  3S3M A;  1IG7 A;  1O7L A;  3D1N I;  3DKW A;  1FNN A;  1BR2 A;  3G1M A;  1U78 A;  2W1O A;  3CDL A;  3HEF A;  3HTU A;  3DEU A;  3FIS A;  2PQ8 A;  2HPI A;  4Q48 A;  3OIQ A;  4ZC3 A;  4A12 A;  2K3P A;  3C3W A;  3A01 B;  3HKZ A;  1B72 A;  3P9K A;  4EV0 A;  2LKS A;  1FTT A;  3WU1 B;  5FLV A;  2Y9Z A;  2O03 A;  3CF2 A;  3M4O J;  1ETX A;  2V9K A;  4BHC A;  2QSF X;  4TV7 A;  2LBF A;  3ULQ B;  1J0R A;  2VKD A;  2L01 A;  5LRR A;  1U5T A;  2TRT A;  3FBI B;  5JR3 A;  5LD2 C;  1LE8 A;  1C0W A;  2V9V A;  3SJM A;  2C6Y A;  1XG1 A;  1J7K A;  4C9Y A;  5E1Z B;  3VB2 A;  2YSR A;  3FM5 A;  1B59 A;  4DNC A;  2XHK A;  5GAD J;  3KE2 A;  2MLG A;  3B6C A;  4NUB A;  4DZP A;  5DM7 F;  4XLP F;  5D5V B;  4PUS A;  3SFZ A;  1BW5 A;  3J81 Z;  3LOC A;  2K40 A;  1P4W A;  4UY8 I;  3A0H C;  2EA4 A;  3QYE A;  1ZEL A;  4II3 A;  1J9I A;  2JZY A;  3G73 A;  1UMQ A;  1BL0 A;  2XPV A;  3IWZ A;  3E5Q A;  3HPG A;  1HDD C;  5EGO B;  1WWX A;  5DTD A;  2ZJ2 A;  1ON1 A;  5JLX A;  3AG1 H;  2CW7 A;  1G2H A;  1MMS A;  4EJW A;  4A3I J;  3M1E A;  2W7N A;  3K2A A;  2CUJ A;  2A61 A;  3LSK A;  2BY2 A;  3BRO A;  1LJ9 A;  1ZG3 A;  1PP8 F;  1CGP A;  1VQL I;  2K3F A;  3K4J A;  2JA5 J;  4CA0 A;  1ETW A;  1GHC A;  3KEY A;  4RAZ A;  1W0T A;  2CYY A;  2HDD A;  3K4C A;  3OMY A;  2VKE A;  4D7N A;  2ZNZ A;  3OYF A;  2XDV A;  1ZLJ A;  1R49 A;  1I5Z A;  1X1D A;  3GLL A;  4OWR B;  2M4G A;  2XUB A;  2OZ6 A;  1N77 A;  2QSH X;  1MZB A;  1MJA A;  2XB5 A;  1R5I D;  2RNJ A;  4FQG A;  1K4S A;  3AFH A;  2G7H A;  2OF7 A;  2V26 A;  2HS5 A;  3EYY A;  2DO7 A;  2W57 A;  3DEW A;  1VQ6 I;  3G3Z A;  3T5X A;  1TNT A;  4F52 A;  4WK8 F;  4XRM A;  3H1C A;  2LY1 A;  3CCE I;  3ZMT A;  2D1H A;  2VQH A;  3HOV J;  1ONV A;  1D8K A;  4U88 A;  5LGN A;  2VKV A;  1WHU A;  3HDD A;  3R0A A;  4WXC A;  3MFK A;  4ETS A;  5ICE A;  1LVK A;  4HG2 A;  4R79 A;  2BHZ A;  3FWE A;  3KP2 A;  1UCR A;  2ELJ A;  4PGG A;  3CCJ I;  2DK5 A;  4LIV A;  1UEL B;  2ZME A;  3PFI A;  1FOK A;  2ZKZ A;  3LSR A;  2W00 A;  3S3N A;  3GTK J;  1YX5 A;  3BC8 A;  1NH3 A;  1L0O C;  1Q1H A;  3OYG A;  1ACI A;  2M34 A;  3S2D J;  4ENN A;  1DU0 A;  4CCO A;  1JKO C;  4PSX A;  3RZO J;  4RB3 C;  3LAJ A;  1T0F C;  2WB1 A;  5ICC A;  1BIA A;  1VI0 A;  1TWH J;  1T95 A;  1YW8 A;  2JJ7 A;  2OPT A;  5E3N A;  1HW2 A;  3DPT A;  4FE7 A;  1FOX A;  4IQ4 A;  5L3D A;  1MND A;  3BG3 A;  2KFD A;  2OJE D;  3TED A;  3I55 I;  1NG6 A;  3FXK A;  5DUK A;  2K86 A;  4A2U A;  1G3W A;  2IVM A;  6PAX A;  3J7A O;  3WTW C;  1U0J A;  2Q0O A;  1XGM A;  2WAD A;  1VTN C;  3COA C;  3HUG A;  3F8N A;  2A5Y B;  2OAZ A;  3HRT A;  3HOT A;  4YFN F;  3CUQ C;  3DKY A;  1ETO A;  4WWC A;  2L5Q A;  4E7K A;  1PDN C;  2EFQ A;  1FOY A;  4IF4 A;  2GZW A;  3K2Z A;  1OCC H;  4MNU A;  2E1O A;  4UV9 A;  4QIW N;  3GZ6 A;  4F3Q A;  9ANT A;  2X6O A;  3OYN A;  4HDU A;  5JI6 A;  1X1C A;  4RB1 A;  5EEH A;  1FT9 A;  3KP6 A;  3DF8 A;  3ZN0 A;  2XRN A;  2OD5 A;  4UHT A;  3K4B A;  3FMS A;  2O8K A;  2UV1 A;  5J1U A;  2VI6 A;  2FBH A;  4XK4 A;  2VQG A;  3S1Q J;  1ZYR F;  3PSI A;  2DOF A;  1B1B A;  3O8H A;  3CDH A;  3VEP A;  4E7J A;  1FY7 A;  3ABT A;  2L2O A;  1J09 A;  1TLH B;  4M74 A;  3TMO A;  2JA7 J;  3HOZ J;  4PGH A;  4IHT A;  1SD6 A;  2W84 A;  3BR0 A;  3W2V A;  2HQN A;  3WTV C;  2IAI A;  2ZNY A;  1QZZ A;  2R7F A;  3RCO A;  1K61 A;  3K1P A;  5FB2 A;  2FNP A;  2P81 A;  4UNO A;  3FXQ A;  3D5L A;  1RZ4 A;  2M1B A;  5LLQ A;  4XLH A;  5IPA A;  1HKT A;  3OS0 A;  2K9S A;  4RLQ A;  2M2E A;  4I6Z A;  4BXU A;  3F9K A;  1BN5 A;  3I58 A;  5J47 A;  3BDD A;  1TWC J;  4I99 C;  3TOB A;  4RS8 A;  3U21 A;  2EBI A;  3JW4 A;  2KRH A;  2L4M A;  2KRF A;  1F36 A;  5ICF A;  1T38 A;  3S1M J;  1S7O A;  3G4S I;  3V8K A;  1W7P B;  2O6G E;  3A1Y A;  2G0E A;  3I59 A;  4L9V A;  5FRN A;  4B09 A;  1IN7 A;  1Z9C A;  1WVR A;  2KPM A;  3WGH A;  1D1B A;  2CW8 A;  2V79 A;  4IRI A;  1HA8 A;  1X4O A;  3J80 Z;  3ECO A;  1MW7 A;  4HA8 A;  3I71 A;  1A5J A;  4Y4R A;  2Q8K A;  2IS6 A;  3C7J A;  3I3L A;  3ZQF A;  3ASN H;  2LG4 A;  4F7Z A;  3V8J A;  1I3Q J;  3KPH A;  4HX4 A;  1TQP A;  1I6H J;  1B9M A;  4KDP A;  1BM9 A;  2LF8 A;  4A69 C;  3J7Z I;  2Q1Z B;  3MKZ A;  4BBS J;  3SYT A;  2MD5 A;  3RQ4 A;  2HKO A;  4IL6 C;  1BR1 A;  1R36 A;  4BE1 A;  4FCY A;  2P0W A;  1U9N A;  3IRR A;  2VJJ A;  1SVO A;  2A6H F;  3BT9 A;  4XIC A;  1HDP A;  4FE4 A;  3QOP A;  4E70 A;  1G59 A;  4BHP A;  2Q2E B;  1OR7 A;  3H9Q A;  5CVI A;  1GVJ A;  1TTY A;  4CO8 A;  1BR4 A;  3BCA A;  3L00 A;  2R7V A;  4EM0 B;  3QYB A;  1OLT A;  4BJT A;  4L5J A;  2DA2 A;  1JHH A;  4HSR A;  1JTY A;  3C2H A;  1S72 I;  1PUF A;  2KP6 A;  3E6C C;  2IA0 A;  4A5M A;  3BG6 A;  1KGS A;  2KMU A;  5IT9 Z;  2L0K A;  1YYV A;  2HNH A;  5DCF A;  2V9P A;  1W1W E;  4U87 A;  2CRG A;  3FXM A;  2VLA A;  4CYD A;  2XAS A;  2QQ8 A;  4AID A;  1N78 A;  1UHW A;  2NNN A;  1BA5 A;  3CME I;  2PG4 A;  1A04 A;  2GLO A;  4DZJ A;  1QPI A;  4M3E A;  1OFC X;  3JR9 A;  4F55 A;  3O8G A;  1VQ9 I;  2HEO A;  4A5N A;  1XC5 A;  3WE3 A;  4IKF A;  5DS9 A;  3PUB A;  4E4H A;  3M3Y J;  1TP4 A;  3HB9 A;  5KCM A;  3S16 J;  1P7J A;  3JRG A;  3L2W A;  1UHS A;  2GQQ A;  2EIK H;  5JVT A;  2F4M B;  2R5Z B;  4JQF A;  2OQR A;  3LA2 A;  3BY6 A;  5AIP A;  1YRN A;  3DFG A;  2ZO4 A;  3HRU A;  2DMP A;  1Y56 A;  3KIO A;  2E19 A;  4HLX A;  4PJN A;  1HBX G;  4HF2 A;  2P8T A;  2GM4 A;  3P5J A;  4IHV A;  2UXX A;  4LJZ F;  2XAG A;  4G9Y A;  5TIS C;  2OBP A;  4JX5 A;  2X4H A;  4Q47 A;  2NS7 A;  5HVQ C;  1IC8 A;  2XGX A;  5DEQ A;  2J5O A;  4G8X A;  3E6D A;  1TQI A;  3BQY A;  3PNV A;  1N25 A;  2EPF A;  2M3A A;  3FDY A;  3IRQ A;  2EJR A;  4M73 A;  3H5R A;  2DAO A;  3DTI A;  1JXS A;  3CLQ A;  2Z33 A;  3BTL A;  4NNJ A;  3VOE A;  2K27 A;  1J75 A;  5C4X J;  3HOS A;  4W97 A;  1JE8 A;  2DXI A;  4MIM A;  1FJL A;  4B1R A;  2QF7 A;  5D5U B;  2Y0M A;  1G3S A;  1ZTR A;  2DK8 A;  2Z5U A;  4M71 A;  1XCV A;  2M8E A;  3JRE A;  3F21 A;  4Y3O A;  1PP7 U;  3FKI J;  3EUA A;  1E3H A;  1KQ8 A;  2W48 A;  4E7H A;  4BU2 A;  1IGN A;  1WJE A;  1ULY A;  5EZG A;  1X19 A;  5EEA A;  3BJA A;  3E97 A;  1IRF A;  2JA8 J;  5EDN A;  3L9F A;  3E6B A;  4KJZ A;  5H6R A;  4ZYE A;  4RB0 A;  2E2I J;  3OSG A;  1T08 B;  5E17 F;  3E0J B;  3CCR I;  5F04 A;  2X9D A;  1YX3 A;  3FIW A;  4XOR A;  1BC7 C;  2QBY A;  1FSE A;  1IN4 A;  2DT5 A;  2W4S A;  4XL9 A;  2ISZ A;  1DGW Y;  2BY3 A;  1U8R A;  2RNG A;  2HVQ A;  4F92 B;  2R7O A;  3WU2 C;  4UB8 C;  4LLL A;  3JRD A;  1CF7 B;  1QO0 D;  4A3J J;  2IBD A;  5FD5 A;  1FEX A;  2IA2 A;  4KFC A;  4U7D A;  3REO A;  4L9T A;  4A3K J;  1W36 C;  3KLN A;  1XMA A;  4UUV A;  2ME6 A;  1T0F A;  3FXU A;  5DD4 A;  2OZU A;  5F0H A;  3IV5 A;  1Y1V J;  3ML6 A;  2ESN A;  5K5Q A;  5LGU A;  3H92 A;  5M5W J;  1RI7 A;  5FRO A;  4EQQ A;  2CO5 A;  2VBY A;  5DCM A;  4A0Y A;  1IV8 A;  3DV8 A;  3H3Z A;  4KIG A;  4BQQ A;  5B5E C;  3K1M A;  4NBQ A;  3OS1 A;  1HF0 A;  3VSK A;  4PFO A;  2M7A A;  3OOP A;  3OYL A;  3OYM A;  1WJC A;  4DQ2 A;  2ZCW A;  5HS7 A;  4FIS A;  1IV6 A;  1OYW A;  1YW7 A;  2KIM A;  3ZMV A;  4D9J A;  1AKH A;  2DA1 A;  1NHA A;  4IRG A;  2NVQ J;  5D4S A;  2KJC A;  2CS3 A;  1NG7 A;  1ODD A;  1KU2 A;  3RTR A;  2FBK A;  3IKV A;  3K4K A;  4G6T B;  4QPQ A;  3CP2 A;  1ZH5 A;  3BR3 A;  3R0J A;  1YI2 I;  4K2E A;  3IHU A;  2WA0 A;  4CCL A;  4EJO A;  1Z7L A;  1IDY A;  1WH7 A;  2NOJ B;  5F1J A;  3S14 J;  3FXL A;  2GIZ A;  4CDG A;  1S8N A;  5DV5 A;  2EFW A;  1FLI A;  2X6Y A;  4D5C A;  3DXJ F;  3Q0W A;  3HKZ N;  1QVU A;  5B1A H;  2XF6 A;  2IP2 A;  5DD8 A;  4QWQ A;  3A02 A;  3AG2 H;  3OR1 C;  2LLK A;  1G8X A;  2V1N A;  4A3L J;  3QPT A;  3HM5 A;  2X1E A;  4M6X A;  4LB5 A;  2HQR A;  3FK6 A;  2GWR A;  4G12 A;  3AKZ A;  4V2F A;  4ABZ A;  3VDX A;  4DGW B;  4MFD A;  3M07 A;  1AHD P;  4AU7 A;  1R1U A;  2E5Z A;  2ZC2 A;  4YEL A;  1JI8 A;  2IGM A;  5IOY A;  1J59 A;  1QGP A;  4M72 A;  4A6D A;  3CF5 F;  3NRV A;  2K9L A;  3JTH A;  3DBR B;  2JUC A;  4XLN F;  2IPQ X;  2LH9 A;  3F8B A;  3RYR A;  2AS5 F;  3KEO A;  3CCM I;  4GRI A;  3HIF A;  3OL4 A;  2O3F A;  3U2R A;  4M3B A;  3CTA A;  2E60 A;  3KYD B;  2F4I A;  2LC2 A;  3S8P A;  1TQM A;  4B4C A;  3LSG A;  3LSM A;  1GLN A;  3DU5 A;  3J7Y J;  2MLK A;  1PUE E;  2HYG D;  4YG2 F;  1Z3X A;  2PLY A;  3GFI A;  2ZJQ F;  3CCQ I;  1ENH A;  1ETV A;  1MH3 A;  2QLZ A;  4R8H A;  4EMS A;  2VON A;  3ROU A;  4YIR X;  5FGM A;  3BQZ A;  1I50 J;  2K5C A;  2P5V A;  3SZT A;  1MBK A;  2VBZ A;  3G1O A;  3QPS A;  5GTI C;  2UXN A;  3JSP A;  1IXS B;  2DMT A;  2RAE A;  3VOD A;  4CZZ A;  4A3F J;  4BQA A;  3CCY A;  2CV1 A;  2M30 A;  2H8W A;  4RM3 A;  2L7Z A;  4RM2 A;  5CPR B;  5J8F A;  2DMN A;  5JHF A;  2JPB A;  3GF2 A;  3QU3 A;  4IX7 A;  4F91 B;  1BIB A;  2N8G A;  2V6C A;  1DP3 A;  1T33 A;  5E3M A;  2BXZ A;  2BV6 A;  3LQQ A;  1ETK A;  3MVP A;  4YFX F;  1JGG A;  2ZFW A;  1A31 A;  3PQK A;  3ZQI A;  5FD6 A;  5HOD A;  3GO5 A;  2VUM J;  2ZSH B;  3LA3 A;  4N4O B;  1R7J A;  3PUF A;  1YHQ I;  1MSE C;  2P5L C;  4JBA A;  2HZT A;  3DU6 A;  1SMT A;  2XB0 X;  3HG9 A;  4E7L A;  3K7A J;  2X0L A;  4P5O A;  3R61 A;  1R58 A;  2DA4 A;  2BGC A;  3TW6 A;  1YJN I;  4L0Y B;  5D8L B;  2P7V B;  1KA8 A;  4WX9 A;  3NAR A;  4ZZL A;  3GME A;  3S2W A;  4B8X A;  4ZZD A;  3CO7 C;  1KON A;  2DFI A;  2L7K A;  3HHH A;  3PIP F;  4HDV A;  3LMM A;  2VE8 A;  1D5Y A;  2F5E A;  4RA2 A;  2F5F A;  3FXO A;  3KP5 A;  3LSJ A;  2M4K A;  4A0Z A;  1AU7 A;  3I9V 2;  1MBJ A;  2WB1 N;  4BGD A;  2KDZ A;  4I7H A;  2E5N A;  5IY5 H;  3U1D A;  3GTL J;  3MEX A;  3T0Y A;  3TGN A;  4QTR A;  1E2X A;  3SQN A;  2DQL A;  4CUG A;  2OU2 A;  1OCR H;  4GYI A;  3QRF F;  1HXD A;  2MH2 A;  4LG0 A;  1JJ8 C;  1WPK A;  2VJ4 A;  1FMW A;  1LDJ A;  1TW3 A;  4W1U A;  3I56 I;  4EEF G;  4BY1 J;  3KEQ A;  1G3T A;  4NB5 A;  4M9X A;  2LFB A;  3GYH X;  1EKE A;  2PMZ A;  2FRH A;  5GTH C;  2VL8 A;  3KZY A;  1B8I A;  1OYI A;  5D8K B;  2H8R A;  1H88 C;  3Q3S A;  3OYJ A;  4I76 A;  1DQU A;  1I6X A;  4NC7 A;  1Y0N A;  1WJB A;  4G6D A;  4MHG A;  2FF4 A;  3RZD J;  4DBR A;  1HLV A;  1D0Y A;  2ZFU A;  1XCB A;  2LOO A;  2LVS A;  2LK2 A;  3BOQ A;  3OSF A;  1ZRE A;  3MD2 A;  5BQT A;  4HF1 A;  1QHG A;  1FBQ A;  1FOW A;  2A68 F;  5LHH A;  3M9A A;  4A3B J;  1Z67 A;  3PIO F;  3H9G A;  3H0D A;  3FXJ A;  2R5Y B;  2DFF A;  3RYP A;  1FBS A;  5EG0 B;  2EA2 A;  1Z05 A;  2R7X A;  2ACJ A;  4AVP A;  3K4N A;  2DA6 A;  2HOT A;  4JX6 A;  4AVZ A;  3IH2 A;  1PJR A;  1WJF A;  4HF0 A;  1G6N A;  1XB4 A;  1WH5 A;  2EZI A;  4LGW A;  2K7L A;  2X51 A;  2IS4 A;  4M6V A;  2A69 F;  2IGN A;  4M6Y A;  4OAZ A;  1ZN2 A;  4IRH A;  3FBN B;  1R6R A;  4PJM A;  2P7C B;  3GTJ J;  1KZH A;  4BH9 A;  5LBQ A;  2LDU A;  1UFM A;  2VB6 A;  4B47 A;  5D4R A;  4WCG A;  2ELH A;  3ERM A;  3MWM A;  4PDK A;  4KN4 X;  4KT6 A;  4IO9 F;  1FC3 A;  5CVV A;  2DDA A;  4J00 A;  1DP7 P;  1OKR A;  2CMP A;  2EH3 A;  4EJV A;  1T6S A;  4Y15 A;  3HSR A;  2LF7 A;  5IYD J;  3DBH B;  2M5W A;  2E1N A;  2B63 J;  2GA2 A;  2XF7 A;  4BKX A;  2CFX A;  2WY7 Q;  3FM3 A;  3JRC A;  2Y48 A;  4N0B A;  1UB9 A;  4UUS B;  1ZGJ A;  2O7O A;  1YJ9 I;  3F8C A;  4RB2 C;  1I1S A;  5IYB J;  2K4J A;  2KZV A;  2ZB9 A;  3CMM A;  3E1S A;  3H5N A;  2HOA A;  3K1N A;  1HCR A;  2PJR A;  4JK1 X;  4E7I A;  4G7Z F;  5BS6 A;  1ZRD A;  4DYQ A;  5B1B H;  3F23 A;  3ERE D;  4IHX A;  2HGC A;  4HQE A;  1LDD A;  2DMU A;  2YS9 A;  3NWT A;  4U7B A;  2OTJ I;  1Y0U A;  3DQV C;  1HC8 A;  1H0M A;  1Z77 A;  4XRS A;  2I8D A;  2XGE A;  1R1T A;  1XN7 A;  4DIQ A;  2JQ7 A;  2Y31 A;  4Y17 A;  4J19 A;  3E7L A;  1WGX A;  3CZ6 A;  2DPD A;  3ZP5 A;  4X6A J;  2XV4 S;  5LHI A;  1ZRC A;  2FQ3 A;  1WKM A;  1XGO A;  4XRF A;  3S1N J;  1UJ8 A;  5JHU A;  5D6E A;  1U6G A;  2VKH A;  2CJJ A;  3WTU C;  2PBI A;  4HST A;  1LKX A;  2Q2E A;  2EIN H;  3VYT B;  1O57 A;  4OMZ A;  2DQR A;  2R7S A;  4I01 A;  1X1P A;  2L4A A;  2NVY J;  1G4D A;  2DMQ A;  1A36 A;  3A03 A;  5HDG A;  5IP9 J;  1IF1 A;  4L9N A;  2QWW A;  1EJ9 A;  2XRO A;  2RRE A;  5FKM A;  2VXD A;  3I4N J;  4BJ5 C;  4EJT A;  1XGN A;  2JA2 A;  4PSW A;  5KVR A;  1D1C A;  4OMY A;  3FXR A;  5DDG A;  3IP4 B;  1JUM A;  1YO5 C;  3Q0U A;  3CCL I;  1FMV A;  1O3S A;  4XLC A;  4A3C J;  2AXL A;  1IO2 A;  1FIA A;  2HFH A;  3HRM A;  4D0P A;  1B72 B;  3SFI A;  2MAB A;  1V5E A;  2Z3Y A;  1WJ5 A;  1QNT A;  2BY1 A;  3MZY A;  4AWX B;  3N97 A;  1REP C;  2R0Q C;  4IEJ A;  3ABL H;  3M1C A;  2LMD A;  3ONQ A;  2L9V A;  2VPR A;  2QQB A;  2CWE A;  1XDU A;  1SD5 A;  4GDF A;  3HSE A;  1U5T B;  3O2P E;  3LNQ A;  1V5F A;  4I2O A;  5E79 C;  4PJL A;  1DPR A;  3CCV I;  1Y1W J;  2P6T A;  4DBQ A;  1FX7 A;  2YPR A;  5C4J J;  1LUJ B;  1ON2 A;  4FT8 A;  5GAH J;  2COM A;  1WFX A;  1YOV B;  2K4B A;  3LFK A;  1EA3 A;  2VIX A;  2LP0 A;  3ZMU A;  2YUS A;  3BG5 A;  2B7E A;  2R7R A;  2YR2 A;  3RPU A;  1RPW A;  3BZC A;  1XSD A;  1GVD A;  2DA3 A;  2OA4 A;  4NHJ A;  1Z21 A;  4EGY A;  1SMY F;  4ZTF A;  4L5E A;  2LSO A;  1O3T A;  1AA7 A;  2V1D A;  1M1E B;  5JFR A;  4X0G A;  1TT5 B;  1OCP A;  2JMW A;  1IUF A;  4ENJ A;  4XQF A;  2NVX J;  4NQW A;  2STT A;  2PI0 A;  5F1R A;  4XLA A;  4P55 A;  2JTV A;  4DJA A;  2RQQ A;  2OUM A;  5AON A;  4IHW A;  5LEK A;  5BMZ A;  1TWF J;  1T56 A;  4CYC A;  5TJJ A;  3CES A;  1U8B A;  5BPD A;  4RGU A;  4N9I A;  4BXF A;  3C18 A;  2QUF A;  1E3P A;  1TT0 A;  3L7W A;  1SFE A;  4NDL A;  3HOW J;  2XAH A;  3I4P A;  2DDB A;  1HW5 A;  2EIM H;  2YX4 A;  3LST A;  3NEU A;  1K78 B;  2STW A;  4JOM A;  2HI3 A;  2A3S A;  2Y75 A;  3TW7 A;  1OIS A;  3TDU C;  4BY7 J;  3JCU C;  3K9T A;  1MDM B;  1B6A A;  5L3C A;  2UZK A;  2EFO A;  5K7H A;  3NWS A;  3K10 A;  5ILV A;  3HZJ A;  3KX2 A;  2CQK A;  3ABU A;  3HYI A;  1JGS A;  1OQY A;  1ZKG A;  4LOC A;  3KLO A;  2DPU A;  3L2C A;  1FSH A;  1WRJ A;  2WV1 A;  5J40 A;  5LGT A;  4FTH A;  3FX3 A;  1HST A;  3O3K A;  3W6K B;  2KIQ A;  3MN2 A;  3DPL C;  1DUX C;  4A0X A;  3M8E A;  4P96 A;  5HS8 A;  4OIN F;  4ZTJ A;  1BBY A;  4BNC A;  3MZ8 A;  2ZME B;  2TDX A;  4XOT A;  1CF7 A;  3FF5 A;  5CQE A;  2MSY A;  3T8R A;  2IS1 A;  4YEJ A;  1MNM C;  4ENK A;  3QPH A;  1SVM A;  2YX7 A;  1WCM J;  2VT3 A;  5HLT A;  5FKK A;  4PJJ A;  2HQA A;  3FMQ A;  5A2Q K;  1S9H A;  3C2G A;  1D3Y A;  4IVN A;  1DU6 A;  4P1W A;  2PMU A;  2Z16 A;  2NVU B;  4ENM A;  1MJB A;  4C2U A;  3HRS A;  5D5W B;  2QA4 I;  2LRE A;  1KQ9 A;  1RUO A;  2ICW G;  3ELK A;  2L9R A;  1YW9 A;  2K9Q A;  4MLO A;  3WGI A;  1ZHF A;  2VPL A;  4KMU X;  1A6Q A;  1Z6R A;  1FYL A;  2L02 A;  5H20 A;  3HUG B;  4G6Q A;  4UVB A;  4OIQ F;  2KLO A;  3BR1 A;  4BDY A;  1TL8 A;  1O4X A;  2RDP A;  3M7G A;  3TP3 A;  1GDT A;  3AG4 H;  4KIC A;  4B48 A;  5EYR A;  1R4N B;  3HGG A;  4YRV A;  3NQO A;  1O7F A;  3VYU B;  5IP6 A;  4H0E A;  3CDI A;  4XN0 A;  4HAM A;  3MKL A;  3Q9V A;  2JVG A;  1TWA J;  4XLE A;  4CZC A;  2QSG X;  4Z2Y A;  2F5C A;  4E6K G;  4JYK A;  2XAF A;  2EZL A;  5F6F A;  4I98 B;  1DDN A;  2H94 A;  4U0Y A;  3I4M J;  2M7B A;  5FLX Z;  1XS9 A;  1YG2 A;  1FIP A;  2HYF A;  2O8X A;  2RV8 A;  2W24 A;  1BI2 A;  3CUO A;  1KU3 A;  3GEZ A;  4LK0 F;  4M3F A;  1CQT A;  1U5T C;  4DYR A;  2KDO A;  4PK4 A;  3F6O A;  1XSX A;  2EK5 A;  2FD5 A;  4XKB A;  3SDB A;  2AO9 A;  1XD7 A;  2XAU A;  1FP2 A;  3W3C A;  1G3Y A;  3HOX J;  1WJD A;  1Q1V A;  2EZK A;  3H5A A;  3GTM J;  3OYK A;  1KU9 A;  1Z3Y A;  2R3S A;  4E7Z A;  2R7D A;  4KN7 X;  1LNW A;  2JT1 A;  3L2Q A;  3OY9 A;  2HR3 A;  4Y7N J;  3OR2 C;  4BEH A;  4KIT B;  3DP7 A;  4ESJ A;  4R1H A;  1R22 A;  3F8F A;  3QU6 A;  5FLM J;  2OCE A;  4XSZ F;  3QQA A;  2OQG A;  2E7W A;  4LIU A;  5FFZ A;  4IHS A;  1Y6I A;  3IKT A;  3DTK A;  2JRM A;  4A3D J;  4Z6Y A;  4A3M J;  3WE2 A;  5IT9 K;  2OCC H;  3I59 B;  1RUN A;  1LDK B;  2CQN A;  2BW3 A;  2LKP A;  3Q0V A;  1MBG A;  1BI0 A;  4L9J A;  5KNL A;  4MO7 A;  3L1P A;  5CLS A;  1VQP I;  3W2A A;  4Y52 J;  2WY8 Q;  2DYR H;  5M3M J;  3BCB A;  1USS A;  3RQI A;  3TKY A;  2PX9 A;  1P6R A;  5DYM A;  2F4O B;  2CQ7 A;  5JVG F;  2DJI A;  1RKW A;  1IJW C;  2QEX I;  3H0G J;  2X1C A;  3ZCO A;  4D7M A;  2V1U A;  1K7A A;  4HW0 A;  4C30 A;  2A6E F;  2MGQ A;  2XGC A;  2NXN B;  2V7F A;  1HQC A;  4EAT A;  4AC0 A;  3CMY A;  1T2K A;  3N05 A;  3K70 D;  2Y0S A;  5F08 A;  4UB6 C;  2R92 J;  3AL0 B;  5E1W A;  3A2K A;  3IAS 2;  4AUX A;  3RI4 A;  2M8G X;  3SZG A;  4RBO A;  3EET A;  2DT6 A;  4U0W A;  1V5G A;  3SZP A;  4IPA A;  3RSN A;  3C1D A;  4FAS D;  3JSO A;  4EM2 A;  4HNT A;  1RR8 C;  1P4A A;  4C2T A;  1YIJ I;  1T98 A;  1X2N A;  2A6T A;  4XKW A;  2IEK A;  1QPM A;  4AIH A;  1RRJ A;  5K7F A;  4EGZ A;  1ZR4 A;  1W36 D;  1FYM A;  4CCJ A;  2FE3 A;  2KIF A;  2TCT A;  3G71 I;  3RKX A;  1PUF B;  5AIQ A;  5J4V A;  2B0L A;  3AG3 H;  2CU7 A;  3DEE A;  3CUQ A;  3GFL A;  2IRF G;  5TGT A;  4KYW A;  4Q5S F;  3HTS B;  3K0L A;  1V4R A;  1XTA A;  3D0S A;  2HTS A;  2LNB A;  3AAF A;  1MMA A;  3GZ5 A;  3V4G A;  2WV0 A;  1MBF A;  3KYC B;  3KP7 A;  2MFZ A;  1VQ4 I;  2DOE A;  3SEZ A;  5TRD A;  1POG A;  4MTD A;  3H35 A;  3RJP A;  1ERD A;  2ME0 A;  2NVT J;  5HS9 A;  4LLG F;  3BZ6 A;  2JPC A;  3ZMD A;  4ASN A;  3QPL A;  3A01 A;  3CCS I;  4JX4 A;  2PMZ N;  4ZYH A;  1YFH A;  1MBE A;  2E35 A;  3P7N A;  4BE2 A;  2VOO A;  2X6X A;  3BPV A;  4B3A A;  1TWG J;  1UST A;  3IWF A;  4L18 B;  3L2U A;  1ZAR A;  2X48 A;  4RAG A;  2EZH A;  2JSP A;  3DCF A;  4XR6 A;  2H1L A;  3TO6 A;  4IJA A;  4I0A A;  4MQ9 F;  3GTG J;  1W5C C;  4YII A;  4PJ0 C;  1K79 A;  1ZRF A;  5L3E A;  1ZGA A;  4MTE A;  3WTT C;  1ZGW A;  2HVR A;  2ZJR F;  1I1G A;  5ILU A;  3RIR A;  1YQA A;  1TBX A;  2UUZ A;  3OYA A;  4LLN A;  4AYB A;  4QLC U;  1MSF C;  3LA7 A;  2XKP A;  4C3H J;  5EGO A;  2E36 A;  1JHF A;  3FMR A;  1Z6T A;  4S0H B;  3G2B A;  2VJI A;  3DWL E;  3W2W A;  4KA4 A;  5LEJ A;  2M87 A;  2ESH A;  1IN5 A;  3RPU D;  1VF9 A;  1BJA A;  2MH9 A;  1LVA A;  1K4T A;  3QP5 A;  4ESF A;  3G1L A;  2A05 A;  4FET A;  4S05 A;  1P4X A;  2PN6 A;  2NAZ A;  2BZT A;  2W25 A;  1LB2 A;  2DYS H;  1SD4 A;  4CSW A;  4U0V A;  2EV5 A;  2R7Q A;  2JRT A;  3FKJ A;  4HLY A;  3HBL A;  3C2B A;  1V3F A;  5CQG A;  5FRM A;  3CP8 A;  2FML A;  1OCO H;  4XID A;  2KHM A;  2Z99 A;  2A07 F;  2F5V A;  2NS0 A;  3MMY B;  3LQR A;  2QBY B;  4S04 A;  2KT0 A;  2LTP A;  1JUS A;  3KFW X;  1S7A A;  2XIG A;  2P6S A;  1MH4 A;  4A3E J;  3V8L A;  5HLH A;  1PYV A;  1A35 A;  5L3G A;  1GV2 A;  2VT2 A;  4GGG A;  1VQ7 I;  1SEU A;  3WHB A;  2RKH A;  4FHT A;  1LFP A;  2DW4 A;  2ID3 A;  2DBB A;  1NTC A;  3GTO J;  3KYL A;  1JTX A;  1P2F A;  5E8G A;  2ETH A;  1OJL A;  2FMY A;  3WG9 A;  1BOB A;  1W5S A;  1R4M B;  2VQC A;  2FX0 A;  1WZ2 A;  1VQK I;  1RES A;  2IJL A;  4E7S A;  3F22 A;  2AHQ A;  5DCM B;  2Z2S B;  3K69 A;  3A0B C;  2ID6 A;  2FOW A;  3BJO A;  3S32 A;  3AL0 C;  4WF2 A;  4KIB A;  1IRX A;  2DOA A;  4C3J J;  2LKX A;  2ZBK A;  4OAY A;  1FYK A;  5JLW A;  1YS6 A;  3ZN1 A;  3WG7 H;  2NNY A;  2Z9O A;  1UG0 A;  2L7M P;  3K4M A;  1LPQ A;  4A3G J;  1R5H A;  2WBM A;  4HV6 A;  4V19 K;  4AD9 A;  4PFP A;  4XLF A;  1K83 J;  3Q5F A;  1IRZ A;  1AOY A;  3WTS C;  3P9C A;  1R00 A;  2DCE A;  4ZDL A;  3L2V A;  2E7X A;  3BTC A;  4L5I A;  1GUU A;  4WXD A;  4GYG A;  1AKH B;  1X4P A;  3GTP J;  2R7Z J;  5GAG J;  4UVA A;  5M5Y J;  4KT5 C;  1U9O A;  5EF6 A;  2XPW A;  3ESW B;  3WTY C;  4AIK A;  1W0U A;  1YJW I;  3QOD A;  3ZQH A;  1YTY A;  3ASO H;  2NRA C;  4P9F A;  1MMG A;  4LG3 A;  1S7E A;  1LQ1 A;  2HKX A;  3WTX C;  2XVC A;  1VQN I;  3ZMZ A;  1O3Q A;  1JJ6 C;  1JT0 A;  4ZYG A;  2O61 A;  2MBF A;  3ZQQ A;  4B44 A;  5ICG A;  4IXA A;  3ZQG A;  5KAF C;  2JSC A;  5E8I A;  3LSP A;  5EJC A;  4G7O F;  3PNT A;  4RGR A;  4IOC F;  3UKG A;  2JA6 J;  3VYS B;  1QQI A;  4I0B A;  4QPO A;  1FP1 D;  4C3I J;  5LHG A;  1R5G A;  1A6I A;  1WJA A;  3FHN A;  2D2W A;  4BL0 B;  2MC4 A;  1HOM A;  1X2M A;  2F6C A;  4MGR A;  2MD0 A;  1BW6 A;  1SD7 A;  3SEQ A;  1IN6 A;  1ETY A;  1R1V A;  3S93 A;  1D0Z A;  3RKQ A;  1MMN A;  1N75 A;  1YIT I;  2F48 A;  3R6S A;  2V6E A;  2QCO A;  5HLI A;  2XAQ A;  1RKT A;  2QEN A;  2XKO A;  5L3B A;  3TL4 X;  1IN8 A;  4ITV A;  4FX0 A;  3VSL A;  1SFX A;  2FEZ A;  5CVU A;  1OPC A;  3F8M A;  3HOY J;  4EJU A;  2WAQ A;  3QOE A;  2ZXW H;  4HEA 2;  5J1Y A;  3HC7 A;  1MBH A;  1B9N A;  2X1D A;  1QRY A;  5HDK A;  5DM6 F;  1BI1 A;  3NAU A;  4XN3 A;  1X3W B;  2HXO A;  2VC1 A;  5HDN A;  2ELK A;  3QP6 A;  2CG4 A;  2IGO A;  2I5U A;  2KJB A;  2MA3 A;  1SAU A;  4RGS A;  4N9H A;  4XSX F;  1QU3 A;  3B73 A;  5HOO A;  1L3L A;  4XKV A;  3JAM K;  5B3S H;  3IAM 2;  2BE5 F;  3TO7 A;  2EWN A;  4A6E A;  1XMX A;  1W7P A;  4KUM A;  1ITY A;  5M5X J;  1BOA A;  1K78 A;  4HYE A;  2M45 A;  2HYJ A;  3M8F A;  1S6L A;  1XX5 A;  2AQE A;  2R7W A;  3GCM A;  1X1B A;  3EDP A;  3FZV A;  2DFE A;  5J4Y A;  1MDM A;  4Y13 A;  4GO1 A;  4UVC A;  1RIO H;  3BJ6 A;  2D5V A;  1XMK A;  5EEG A;  5CYV A;  2BYV E;  4HQM A;  4P9U A;  2E2J J;  2QKL B;  4BE0 A;  5FKL A;  1F4K A;  4WXH A;  1OYY A;  5GP9 A;  2VQL A;  3BWG A;  3KZI C;  1U3E M;  1VZ0 A;  5J1R A;  1WI3 A;  4UXN A;  2H27 A;  3UR3 C;  4BS9 A;  3J81 K;  4GFB A;  2YU3 A;  2BY0 A;  3EQL F;  4II2 A;  5IOZ A;  2CUZ A;  5FJ8 J;  2BBY A;  4MQV A;  3LFU A;  1OMI A;  3VYR B;  4BBR J;  5J8C A;  4OU0 A;  4YFK F;  3OYE A;  2VOD A;  4ZDO A;  1ORK A;  2ECB A;  5KHD A;  3OYH A;  1TZL A;  2LRD A;  2B9S A;  3DLA A;  2FSW A;  1IUY A;  2DN0 A;  2R93 J;  1Z91 A;  2HVS A;  3HJE A;  4MFE A;  4M3D A;  5E3O A;  4LFU A;  4LG0 B;  2RN7 A;  3PQJ A;  2BHY A;  2VXZ A;  2OTL I;  3CLO A;  2KIS A;  2Y2Z A;  1QZE A;  3I5U A;  3CO6 C;  4UUT A;  3EUK L;  4CCK A;  1XGS A;  1D8J A;  1B8I B;  3BTJ A;  5ILS A;  3DKX A;  2DA5 A;  1RET A;  2LBF B;  5ED4 A;  1XPX A;  4KNY A;  3T1B A;  3OOU A;  2WAE A;  1LE8 B;  3S2H J;  3VPR A;  1EH8 A;  3MZH A;  3S15 J;  1YE9 A;  1EH7 A;  3RKY A;  4ZDP A;  1O3R A;  4IHY A;  4UV8 A;  5FKN A;  3HXL A;  1FWZ A;  1V54 H;  1VQM I;  1BI3 A;  2HOE A;  4IZZ A;  2XSJ C;  3BZK A;  1Y39 A;  3GLX A;  1SC7 A;  4FX4 A;  2LD5 A;  2CUF A;  3A4C A;  2ECC A;  2R5Z A;  1MKM A;  1EV7 A;  1VND A;  2EV0 A;  3PO2 J;  2VBX A;  1F5T A;  3ZQC A;  1FPQ A;  3PNY A;  1EF4 A;  2GIV A;  4XKC A;  2E34 A;  5H6Q A;  2X6W A;  1GV5 A;  3P9I A;  2P4W A;  1D0X A;  1MMD A;  3BR6 A;  2KRC A;  3OYC A;  3J7A Y;  1TNS A;  5A2Q Z;  1IW7 F;  1Y8Q B;  2KQR A;  4PZJ A;  2GBY A;  5D6F A;  1KYW A;  1K6Y A;  4ZH4 F;  5DUI A;  3GFM A;  3ECH A;  2H09 A;  1S5L C;  2K85 A;  2LY9 A;  1FZP B;  2ZSI B;  1MGT A;  1IAW A;  3CJT B;  1EH6 A;  5HLG A;  1P92 A;  3EUH C;  1B4A A;  2VN2 A;  1W4M A;  2LY2 A;  2ZXH A;  3R4K A;  2HOS A;  3BTI A;  4M9S A;  2IXS A;  1QHH D;  2QQA A;  5C44 J;  1SFO J;  5KK1 A;  3WU0 A;  5IYC J;  2L9S A;  3F6V A;  1VQ5 I;  4NC8 A;  5J6X A;  1UHM A;  5CKT A;  2QZ8 A;  3DPU A;  4GCV A;  4RLF A;  2JN6 A;  1LFU P;  4A93 J;  1RNL A;  1E3O C;  2IW5 A;  2HWV A;  4HX7 A;  1SFK A;  4BAY A;  2IS2 A;  1IDZ A;  5K1Y A;  4CHU A;  2BVL A;  2KIU A;  2LR8 A;  2OC6 A;  1ZQ3 P;  2ZXJ A;  2H6C A;  4N4N B;  3S1R J;  2FBI A;  5CJ9 A;  4D1Q A;  4HNV A;  3H36 A;  3B6A A;  2G7U A;  2QQ9 A;  1TW2 A;  3BR2 A;  3GZN B;  3JRH A;  3OYB A;  3LSH A;  3R60 A;  3TQN A;  1X3Z B;  2JWT A;  1H8A C;  2PJR B;  2UWM A;  1R23 A;  3PFY A;  4XON A;  2OV7 A;  2O5R A;  3BP8 A;  2YU9 J;  3B02 A;  2CV2 A;  3I53 A;  4BDZ A;  2XPU A;  3JRB A;  4KIS A;  3E3V A;  1JKQ C;  2PFB A;  2Y0S N;  3F72 A;  2DU9 A;  3CC7 I;  4BXX J;  3IL2 A;  3OYI A;  3G6E I;  5GPA A;  2JK3 A;  3MCZ A;  2LYC A;  5LRS A;  1LEB A;  3ZQ7 A;  4RGX A;  1JKP C;  1T39 A;  2JUG A;  3JRF A;  3HHG A;  5E20 A;  3ZR8 X;  5K7Z A;  2DOD A;  2CUE A;  1J5Y A;  3I0T A;  4HNU A;  2RGV A;  3RDI A;  3HPH A;  3CCU I;  1V55 H;  3V7R A;  3BPX A;  3PJR A;  2VOP A;  3LAP A;  1YIO A;  3MKY B;  4BAC A;  2E1M B;  2NOG A;  1K6O A;  4CIC A;  4J01 A;  5KAI C;  1VFC A;  2J5P A;  4EM1 A;  2L7F P;  5B66 C;  5EZH A;  5BPI A;  5IP7 J;  1F1Z A;  1HSJ A;  2I10 A;  3GWZ A;  3ISP A;  5FFX A;  2FU4 A;  4ON0 A;  1WQ2 A;  4L0Z B;  3HL2 A;  2PJP A;  1GXP A;  3OV8 A;  3LWF A;  2R4G A;  2XRL A;  3OWT A;  4BUP A;  5E18 F;  1UG2 A;  2QM3 A;  4ZYA A;  3KP3 A;  1P7I A;  1BJZ A;  4XBF A;  3MKW B;  2G9W A;  4ZYD A;  3D5R C;  2DFH A;  5H2F C;  4PCQ A;  2ZXI A;  3WGG A;  2HPM A;  1LEA A;  2L9N A;  3OYD A;  2CW0 F;  3PM1 A;  3D5S C;  1WSU A;  2GXA A;  2WWY A;  2IT0 A;  2DI3 A;  1APL C;  3X2Q H;  3J80 K;  2EFP A;  2HTJ A;  2QGU A;  1I39 A;  1QZY A;  1MIJ A;  3HSF A;  3CMA I;  1HW1 A;  3CJR B;  3GVA A;  3GXO A;  2PMH A;  4CGZ A;  2QKM B;  4RDU A;  1HKS A;  3KZZ A;  3JRA A;  3UNG C;  1DGR M;  2X85 A;  1H9G A;  2HDW A;  3JRI A;  2GXG A;  5GAE J;  3CQZ J;  4CCN A;  3CC2 I;  2COB A;  4RAF A;  3M8J A;  1T8I A;  2BXY A;  4RAY A;  3H3V K;  2CQX A;  2E71 A;  4OIO F;  3QWL A;  4LK1 F;  4NQW B;  2M0C A;  4KMF A;  1Z1D A;  4AYB N;  3EPZ A;  1IRG A;  3V7C A;  1R9T J;  1X1A A;  2Y9Y A;  5F0F A;  1S3J A;  4EVI A;  3ZMS A;  3ZGK A;  1QA6 A;  2CFO A;  2VJ5 A;  4CYC B;  3OIP A;  2HZD A;  2GA1 A;  3PO3 J;  2A5W A;  1MJ9 A;  1Z7U A;  4M3G A;  5M3F J;  1RR7 A;  2L54 A;  4G7H F;  3SHF A;  5HNF A;  1FTZ A;  4HBL A;  2FQ4 A;  2GOM A;  2FUG 2;  2RQP A;  1HKQ A;  1ZK8 A;  2M9H A;  2FOK A;  4QSH A;  5LFA A;  1ETQ A;  3VFZ A;  2RC4 A;  1JKR C;  1E17 A;  1GXQ A;  4BYY A;  2VBW A;  1H89 C;  5GPC A;  2FA5 A;  2KZG A;  1JT6 A;  1P9Q C;  3V7S A;  4HX8 A;  4HRI A;  3GUD A;  3Q9S A;  2DA7 A;  3SXY A;  1W5T A;  1UZC A;  2QVO A;  1SAN A;  5D5X B;  3K70 C;  1KQ0 A;  1NK2 P;  2Y69 H;  3WHC A;  1SFU A;  2CH0 A;  2FNA A;  1F9N A;  3L09 A;  2DT7 B;  3O6B B;  1XDS A;  2E2H J;  4XM3 A;  4X1E A;  2WC2 A;  1W7P D;  2ADU A;  3BG9 A;  2EIL H;  1H9T A;  2MYS A;  2P5K A;  3IUO A;  2M0M A;  5K5O A;  4LD5 A;  4ESB A;  2D45 A;  4OIR F;  3CD6 I;  3MAJ A;  2CSO A;  3DBL B;  4O3M A;  1JUP A;  3WOD F;  5K5R A;  4DW6 A;  2QYO A;  5FLX K;  1TC3 C;  2DTR A;  4CH7 A;  1LFB A;  4CXF A;  4YIF A;  2XGD A;  2AQF A;  2ZME C;  3GTQ J;  5E1X A;  2D1V A;  1XSV A;  2DLL A;  1MD0 A;  3TDZ C;  4C2M J;  1WI9 A;  3TBI A;  2XSD C;  3HGY A;  5CVR A;  3W6J B;  5HNH A;  4OOI A;  3FK7 A;  1IZ1 A;  1X58 A;  2EQR A;  4BJ6 C;  1KYZ A;  1IXC A;  1AWC A;  4XOP A;  2CGP A;  3H9J A;  1ZLK A;  3MQ0 A;  2KKO A;  1ZG1 A;  4XRS G;  5CVJ A;  5L3F A;  1OCT C;  1VQ8 I;  4HV5 A;  4NC6 A;  4ZJZ A;  3KET A;  3JTG A;  2RVC A;  2E1M C;  3IH4 A;  1Y8R B;  3E5U A;  2R7U A;  2MG4 A;  1YS7 A;  3IH3 A;  2L3D A;  2H1K A;  4ANJ A; 
#chains in the Genus database with same CATH homology
 2EIN H;  3ABL H;  3X2Q H;  1OCR H;  3ABM H;  2EIL H;  2EIJ H;  3AG4 H;  2EIM H;  5B3S H;  1OCO H;  1V55 H;  3ABK H;  2EIK H;  2ZXW H;  5B1A H;  1OCZ H;  3ASN H;  3AG2 H;  3AG3 H;  1V54 H;  2OCC H;  1OCC H;  3ASO H;  5IY5 H;  3AG1 H;  2DYS H;  2Y69 H;  3WG7 H;  2DYR H;  5B1B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...