2OCCH

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2occH00
3ASOH 3WG7H 5IY5H 2ZXWH 3AG4H 1V54H 2DYRH 2EIJH 3AG3H 2OCCH 1OCOH 1V55H 1OCRH 3ASNH 3AG1H 5B1BH 5B1AH 3X2QH 2EINH 3ABLH 3AG2H 1OCZH 3ABKH 2EIKH 5B3SH 2EIMH 2DYSH 2Y69H 2EILH 1OCCH 3ABMH
chains in the Genus database with same CATH superfamily
1QPMA 3EYYA 2E7WA 4XICA 1ZELA 5ICEA 4QLCU 2BZTA 2GM4A 1U78A 3M8FA 2RVCA 2EA4A 4PSWA 4BXFA 2A61A 3R60A 2BXYA 2LFBA 4NC6A 1U9NA 1IRGA 1FEXA 2COBA 4BQOA 4CCKA 2XHKA 4XN3A 3CCYA 1BN5A 2LLKA 1YS6A 3HM5A 5AONA 2V1XA 2K7LA 1FBSA 3Q0WA 5J47A 2KZVA 4JBAA 1SD7A 3BCAA 3T8TA 5AIPA 2WBMA 2JT1A 1FYKA 1O3RA 5TRDA 1VNDA 5K5RA 4I09A 4GRIA 4HYEA 4ZZDA 4B3AA 4BE0A 1X1CA 3PM1A 1O7FA 2G7UA 2R7DA 3GLXA 1XN7A 4S05A 4IHYA 3TMOA 2A6TA 2Q8KA 2DBBA 2IGMA 3H3ZA 2HDDA 1BR2A 3AAFA 3K4JA 4EJTA 1KU2A 4DYRA 1XDSA 3K4LA 2ZCWA 4XLPF 1BL0A 1TWAJ 3BR5A 1OPCA 4A6EA 3FIWA 3ASNH 3MKLA 3A01B 5C3EJ 2PMZA 2E2JJ 1I3AA 4UHTA 5IYCJ 2L3DA 3ZN1A 5AIQA 2GBYA 5B3SH 2GIVA 3CESA 4YFNF 4IOAF 2ZFWA 3O8GA 2HGCA 5EYRA 3ZMTA 3TEDA 1T39A 2OF7A 1X3ZB 2DK8A 4GGGA 1Z3XA 4U0VA 2JZYA 2HOEA 4A12A 1GUUA 1IV8A 3MKZA 2BW3B 1LDDA 3GXOA 2ME6A 1ZGWA 4FASD 3F8MA 3V7RA 2VLAA 3QOPA 3ZMVA 3EUHA 3VSKA 1K83J 2OZUA 1Y6IA 3F9KA 4LG3A 4EJWA 3AG2H 4CCMA 2JN6A 5FKKA 3KPHA 3ABKH 5HS9A 5LGNA 3J7YJ 3L1PA 4G8XA 4XLNF 2O8KA 3OYGA 3OR1C 4M3BA 2B7EA 1Z21A 2VJ5A 2XUBA 5J8FA 3L2CA 2V79A 2A69F 3Q3SA 3W6KB 2F4MB 2FRHA 2VOPA 4D7NA 1PVEA 5F64A 4MIMA 3GTPJ 1YRNB 3WGHA 2L01A 5DCFA 2E1CA 1Z6TA 4Z2YA 3AG3H 2L7MP 2ETHA 4P1WA 2V1DA 1WJ5A 5CVRA 4FT8A 3GZ6A 1WJEA 2CUFA 1ODDA 1U5TA 1P4XA 3QWLA 1POGA 4A3KJ 2LKXA 4JK1X 4I02A 4PFPA 3CTAA 3F6OA 3JAMZ 2X9DA 4D1QA 5DYMA 3IWFA 1MH3A 3COAC 4BQNA 4ABZA 1JT6A 3J7ZI 3R4KA 3KEQA 4M74A 3JRAA 3PSIA 3J81Z 2W4SA 3BTLA 5FD6A 3CCRI 4NHJA 3GTMJ 2K85A 4M73A 2W7NA 1FOWA 1HKQA 3JTGA 4E70A 4PDKA 5J4VA 3ONQA 3JSPA 4LB6B 4A5MA 3CCQI 3PNTA 3W6VA 2DU9A 3AL0C 3U9GA 1HCRA 2NS7A 2CMPA 3FBNB 2WAEA 3CUOA 2KDOA 3OOUA 1R22A 1GV2A 2DFHA 1SFUA 3HOWJ 4IEJA 1WRJA 3QAHA 3WE2A 5M5XJ 2BV6A 4M6XA 2VQCA 3O2PE 3GTOJ 3GZ5A 4L0ZB 2EZIA 3WTUC 3T5XA 1R49A 2PLYA 4II2A 4DYCA 4M3GA 3S1RJ 2MFZA 2XF7A 2JPCA 3V8LA 3DXJF 3HRMA 3VSLA 4UUVA 5LGTA 3F22A 3CJTB 1ZGJA 3HUGA 2DT5A 3PSFA 3E97A 5FKNA 4DBQA 1MZBA 1T0FA 2M45A 1E3HA 2OCEA 4XKCA 1O3QA 2R7SA 3LSKA 1IXSB 2V7FA 3MZHA 2JMWA 5BS6A 4KA4A 1XGOA 5CLSA 5FB2A 1IUYA 4B44A 2KISA 5IYBJ 4A3DJ 2ISZA 3V42A 3ULQB 4ZYDA 4HLYA 3HTSB 4O5VA 3WTSC 4BBSJ 3K6GA 1HA8A 3K2AA 3ZQCA 2RQQA 2YX4A 2M1BA 2ESNA 3K2ZA 3PQKA 2BYVE 4LITA 5GPCA 1FSEA 4MEXF 2XSJC 4UV9A 1APLC 4DZJA 4GDFA 5ICFA 2GA2A 2NVTJ 2FQ3A 4LIVA 1TBXA 1Q1HA 4HG2A 2RGVA 3WG7H 1W0UA 4J19A 3NARA 5IT3A 5K7FA 1MBHA 4KIGA 2LR8A 2BY1A 4XQFA 1XSDA 2IS4A 1R9TJ 2R93J 4FQGA 4B47A 1WJCA 1FOYA 2PFBA 1I6XA 2EBIA 2JA6J 2ZJQF 1NK2P 1UAAA 5F27A 1MDMA 1MMNA 1HDPA 4MNUA 5FD5A 3DLAA 3HSRA 5D4RA 3OS1A 1O4XA 3JRGA 2HEOA 2DA4A 5B66C 2XAHA 2EPFA 2K40A 3G6EI 3S2DJ 1OYWA 3JW4A 4II3A 3TDUC 3DBHB 4N0BA 2XGDA 2TDXA 1D3YA 1KGSA 2CU7A 3LSTA 2LVSA 4ANJA 4E7LA 5IP9J 4ESBA 4IPAA 3I71A 2XAGA 4F55A 5B1AH 1E3PA 3IKTA 4ZTFA 3C18A 1MBKA 3TP3A 2PEXA 1WJDA 4XLHA 4BQQA 2MA3A 2NRAC 2KIMA 3H92A 2ECCA 3LSPA 4UVAA 5LLQA 2QQAA 2WTEA 4AD9A 3P5JA 1OCCH 1ZREA 1J9IA 2LYCA 3BWGA 1PUFB 1EF4A 3HUGB 3V4GA 1ZRFA 3I0TA 1WH5A 3LSGA 5JR3A 1NH3A 4I0BA 3TO6A 2R7QA 1MD0A 2MD5A 4LK1F 4IKFA 3KCCA 3KP2A 5EG0B 1B8IA 4ESJA 4R1HA 4M72A 4HX4A 4RGXA 1TQIA 1I27A 4UVBA 3LSRA 1T56A 1ETQA 5DTDA 1QHHD 3E3VA 2EA2A 1UHWA 1S72I 1XTAA 2E2IJ 1USTA 2PMZN 4LGWA 2LF8A 2CGPA 4B1RA 5FRMA 2GOMA 3AG1H 5K7HA 5J6XA 3JTHA 3BROA 4CH7A 5KVRA 2M30A 4EVIA 4IRGA 3GW2A 4AU7A 2FOWA 4IHXA 2CH0A 3L2RA 3H36A 1GHCA 1Z05A 3H0GJ 1K6OA 3QPLA 4IF4A 1D5VA 4A93J 3JRIA 3S1QJ 4JYKA 3BR1A 2ADUA 2EZHA 4WK8F 3VODA 2DO7A 4PSXA 4CUGA 3Q0VA 4PGGA 3PIPF 5H2FC 2L7KA 4M3DA 1EJ9A 2WV0A 2DDAA 1FIAA 1LB2A 1IRXA 4HAMA 5LEKA 4G9YA 4N4OB 1FJLA 4IHSA 3T8RA 2W1OA 4JX5A 1RKWA 2NNYA 3KE2A 4OMZA 1K79A 2DTZA 2R5YA 2H8WA 4Y15A 4DZPA 2VC1A 5ILVA 4XOTA 3FHNA 3FWEA 3IP4B 3OYLA 2G9WA 3VEPA 1A35A 1XDUA 1SVLA 1RESA 3E6MA 1KU9A 1F1ZA 3I3LA 5HS7A 1LFBA 4KMUX 1BOAA 4FCYA 3RQ4A 2BHYA 4B3XA 1A31A 3LAJA 1ETVA 4XONA 2DMPA 2DOFA 1G6NA 2CUZA 2PMHA 3KP5A 3UNGC 1R1VA 1R6RA 2K02A 3IH3A 2ID6A 1U0JA 3K4KA 1WPKA 1KONA 2WA0A 1WZ2A 5CQGA 4OINF 1GT0C 1RR7A 2BY3A 4B48A 1I39A 2XF5A 1GXPA 1K78B 4ZYHA 3BG9A 3RZOJ 1K4TA 4KNYA 2XRNA 2I5UA 4X6AJ 2EV6A 5EZHA 4ZH4F 2QQ9A 2Z16A 2FNPA 4RB2C 4UB6C 5IOYA 3RKYA 4DIQA 1XG1A 2OCCH 5H6RA 1LDJA 1P92A 3AKZA 1IXRC 1ZG1A 4E4HA 2CRGA 2JSCA 3JREA 1QZZA 3BC8A 5LHGA 2DW4A 2BE5F 1UHMA 2STWA 3QOEA 2RNGA 4S0HB 2Y0SA 2VKHA 3VPRA 2VBYA 3A0HC 2R7XA 2M4GA 4IXAA 2Q2EB 1Z1DA 2MYSA 2IPQX 5JLXA 1VQPI 2Y31A 3K1NA 1BW5A 3L7WA 1X3UA 1Z7UA 3ZQIA 4BBRJ 1Z9CA 1YJNI 3EUKL 1HW1A 4IRIA 1AWCA 4IHVA 2PN6A 2FX0A 3MD2A 1TLHB 3WTXC 1VQLI 1V55H 2LRDA 4I7HA 4MQVA 4U7BA 4E7HA 1IJWC 1ZR4A 1XB4A 2DDBA 1LE8B 1K7AA 3V7SA 3FF5A 2QZ8A 3MFKA 5GPAA 2FUG2 1DU0A 3BZKA 1IN7A 1X2NA 4ZYAA 5HDGA 3HYIA 3DV8A 1T8IA 2CWEA 3RI4A 2VN2A 4NQWB 3ZGKA 4B09A 3KP3A 1W1WE 1ZTRA 4I0AA 4Y17A 2JA8J 1OJLA 3OSFA 2FBKA 2OBPA 3M1CA 2XF6A 2TRTA 2YX7A 2EQRA 2V26A 3GTJJ 1LEBA 1QU3A 3S17J 3MKYB 2R5YB 2NVYJ 4YIFA 1JXSA 4RLFA 3QYBA 1KU3A 1UB9A 2H1KA 2D45A 4XNFA 4XORA 3EETA 5BOXA 4E7IA 1IF1A 2E71A 2R4GA 3ESWB 1LUJB 2DQRA 3DLLF 4R8HA 4L9NA 4E7JA 3TOBA 1MMDA 4B43A 2ZO4A 1K61A 3AL0B 3H3VK 2M34A 4QPOA 3M3YJ 3GFJA 1ON2A 2Y75A 3BR6A 3BG3A 3S32A 3OWTA 4RMNA 3WHBA 1MNMC 1D8KA 2STTA 1KQ9A 2UXXA 4NB5A 2LP0A 3RSNA 2EIKH 1VQ8I 3G71I 5D5XB 3SJMA 2MH2A 4HSTA 2YU3A 4RB0A 4U0WA 4HRIA 4BL0B 4KT6A 3WTWC 4IQJA 4I6ZA 1O57A 3QQAA 1W5SA 1JKOC 4DW6A 4BDZA 2TCTA 2FSWA 4UXNA 3ELKA 3QPTA 4EMSA 1F36A 2LDUA 1AU7A 1MBGA 3G1OA 1HF0A 1L3LA 2X1DA 2MC4A 1H9GA 2F2EA 3ZQHA 3EDPA 3BTCA 1OR7C 2G0EA 3FXMA 3EYIA 1W7PA 2H94A 5E8GA 3SQNA 1FTZA 3KX2A 3ABTA 3HGGA 2XC7A 2CW7A 5E18F 4HLXA 3E0JB 4XRSG 1D0ZA 4YFKF 2HI3A 2E1MC 1T33A 1ZQ3P 5FLMJ 1G8XA 3P9IA 5LRRA 3TGNA 1ZRDA 3CD6I 2DMQA 2D1HA 3KZIC 1UG0A 5H6QA 2H1LA 4RAGA 1DPRA 4PK4A 1IN5A 1R5GA 4IHWA 1JGSA 5BPDA 1WQ2A 5E1WA 2HTSA 2ZJRF 2X6XA 2R92J 1D0XA 1BJAA 2Z99A 2DA1A 1YJWI 2QSHX 2NAZA 2F6CA 3HPGA 4BH9A 1B6AA 2E5NA 3A01A 4RS8A 2M5WA 3RKXA 4Y3OA 4XRSA 3WTYC 1MMAA 4HA8A 3KEOA 3KIOA 1NK3P 3BR3A 3PNVA 2QA4I 3KETA 3OOPA 3BJOA 3BTJA 5FKLA 4BXUA 2XAUA 2DLLA 3X2QH 4CCJA 1W4MA 4AYBA 3CCMI 5E8IA 4HF2A 1ZLJA 2D1VA 2VKVA 1RRJA 2J5OA 2DT6A 2Q1ZB 2GWRA 1GLNA 3DQVC 3PL8A 4NC7A 1ERDA 3SEQA 3KLOA 3V8JA 1JUSA 2OQGA 3OR2C 3ZP5A 1Y39A 2IS2A 3U1KA 1P7IA 4D9JA 1YE9A 4EEFG 4KFCA 3SZGA 1V4RA 3CF2A 2DOEA 4QSHA 3WU1B 4Y7NJ 1TP4A 5F1JA 2X4HA 3FKJA 2Y48A 3LQRA 4ZJZA 4CICA 3S3NA 3I54A 5D5WB 1SD5A 2VQLA 2QKLB 4AIHA 1YFHA 1YRNA 3HPHA 3F23A 2ZXIA 2A6EF 3OYFA 2IRFG 1T95A 4P9UA 1YG2A 4U0YA 1RKTA 1FYMA 5HVQC 1SD6A 2XKOA 4L5EA 2WWYA 4HZFA 1SVOA 1JJ6C 1K4SA 2DTRA 2HYJA 1W7PB 2GAUA 3CCLI 2PX9A 1MJBA 1YIJI 4BJTA 2R0QC 4PJMA 5HLIA 2CFOA 2LY2A 1WJAA 1XSVA 2Y9ZA 1GV5A 3V7CA 3IWZA 1BC8C 1WI9A 4J00A 3T0YA 1R4NB 3OYJA 4IX7A 1X1BA 3PNYA 4BY7J 1WFXA 3KFWX 1Z67A 3H35A 1JJ8C 3SDBA 4CCLA 3PUFA 1HW2A 2HU9A 3BJ6A 1V5FA 1OISA 2M0CA 2VKEA 3GFMA 1R1UA 2IBDA 2V1NA 2V9PA 4A3EJ 2JTVA 2Y0SN 3U21A 1TWFJ 2IS1A 3KYDB 2AQFA 3CCEI 2JUCA 3W2WA 2VBZA 2LK2A 3GX4X 1RZ4A 4FTHA 4I76A 1TNTA 4AVPA 3CCUI 2HWVA 2K9LA 2ZBKA 1B9NA 4LLNA 2M8GX 2WV1A 2EJRA 3CUQB 2LH9A 1P4AA 1OMIA 5IYDJ 1JI8A 5F08A 1UZCA 2Z9OA 3R6SA 1WVRA 1CQTA 2GA1A 1X4OA 3E6BA 5KCMA 3IL2A 1LVAA 2DA3A 4BEHB 1X1DA 3AFHA 4B8XA 3GWZA 4PGHA 1FOXA 3I55I 3RQIA 2XPUA 5H20A 2ZMEC 5LHHA 5HLGA 2CSOA 1OCPA 1WWXA 1JHFA 3BT9A 4X0GA 2LC2A 2ZFUA 1RUNA 2VT3A 4BJ6C 3VB2A 3JAMK 5HNHA 2DODA 2K9MA 4ZDLA 1EKEA 1BW6A 2KRCA 3KP7A 3J81K 1DUXC 1E0EA 1LDKB 2DYRH 1O3TA 5DDGA 3L9FA 2JSPA 3HGYA 2OTJI 3JSOA 1DGRM 1FMWA 3MN2A 3IRRA 1A5JA 3H0DA 5HLTA 5ICGA 1ZGAA 4WXCA 4BS9A 4HX8A 3S3OA 3CC2I 2XB5A 3HB9A 2P0WA 4M9SA 1GVJA 1JHHA 2K5CA 1W36C 4Y52J 4NNJA 2E1NA 4CDGA 2HPMA 5FKMA 1HSJA 2XGXA 3TDZC 3F8BA 2CW0F 3WGIA 4EM2A 2MLKA 1XD7A 1T2KA 4L0YB 4O3MA 5CVVA 2IAIA 2JRTA 2JJ7A 1R71A 4U7DA 4L9VA 1TT0A 2IGKA 1ZG3A 3ZQQA 2PJRB 1X2MA 1OR7A 1W5TA 2HQRA 4MTDA 1ZN2A 4JP0A 3CDLA 4CSWA 4IRHA 4W97A 1FBUA 4YEJA 5D4SA 5A2QZ 4X1EA 3TBIA 2BBYA 2Z5UA 2LREA 3MKWB 2WB1A 2A5YB 2V9VA 3B6CA 1FP1D 4XBFA 5IP7J 3GTKJ 1S7EA 1IRFA 1BM9A 4ENNA 2X1CA 3FZVA 3A4CA 4KYWA 2KP6A 2R7FA 5GAGJ 1ZLKA 5L3GA 4FE7A 2P7VB 2AO9A 1BI3A 1PUFA 2O3FA 4AWXB 3O3KA 3L2QA 2XPVA 1HSTA 5M3FJ 5E1ZB 2FD5A 2CUEA 1YITI 3CC7I 2W00A 1O3SA 1TL8A 2HYFA 1TWHJ 4M3FA 4JX6A 3ZOBA 3DU6A 4GO1A 3FXLA 2A05A 3DF8A 3HJEA 2LY1A 2M8EA 1HDDC 4L18B 5EG0A 2IGOA 3AG4H 4EV0A 2ELKA 5CVIA 1EV7A 2JA5J 3BY6A 5D5VB 2X6YA 4HQMA 4G6DA 2LKSA 4R79A 3OL4A 3TOAA 5E3MA 1R5ID 1TZLA 2F5EA 1DP3A 1SFXA 2BXZA 1O7LA 3RDIA 2D5VA 4KT5C 4AUXA 4AIDA 5EF6A 5F0FA 2LKPA 1AA7A 4L9TA 2NXNB 3DKYA 2EFPA 1KA8A 3QPSA 5J1YA 1Z7LA 2QENA 3LSHA 4PCQA 4F91B 2OZ6A 2R7TA 3OIOA 4XL9A 4M3EA 4AYBN 1PP7U 2H27A 2BEOA 4BHCA 3U1DA 1UCRA 1VTNC 2GLOA 2DJNA 1TQPA 2VJIA 4Q47A 5GP9A 4A3BJ 4D5CA 2QM3A 2YR2A 3G2BA 2P6SA 1QZEA 4RAFA 4CHUA 5K7ZA 4RB3C 2CS3A 5IT9K 2CQXA 4HDVA 3R61A 2WADA 2MABA 1ZARA 4QIWN 3DEEA 5JVTA 2BHZA 4IOCF 1PP8F 4OWRB 3GF2A 3H1CA 3Q0UA 2V6EA 3L2VA 2KRHA 2HFHA 2M4KA 3FXKA 1Z91A 2W82A 1Y8RB 1XCVA 1BR1A 1Z0XA 1P9QC 2DN0A 1OCTC 4BJ5C 2Q0OA 1FC3A 1I6HJ 2E1MB 2CUJA 1Y8QB 4DJAA 2IP2A 3W2AA 5IT9Z 3O6BB 2ZJ2A 2ACJA 5J1RA 3S3MA 1ZR2A 3K1MA 6PAXA 5EEHA 1ULYA 1QPIA 3DTKA 1PUEE 4NBQA 3OS0A 1QRYA 3QODA 3R0JA 2KQRA 1DDNA 3WTZA 2RKHA 2QUFA 2VPRA 2KMUA 2E2HJ 3W6JB 1LQ1A 2E19A 1D1CA 1K78A 1HBXG 2E7XA 2V4JC 1B4AA 2IW5A 2M2EA 3CMYA 4RLQA 2VXDA 1J2XA 1Y56A 4XLFA 4HEA2 2VPLA 3FXUA 5FFZA 4HF0A 1HLVA 1ON1A 2P7CB 5FLXK 1MW7A 2VB6A 5FGMA 4EJUA 2F4IA 1S9HA 4C2MJ 3JCUC 3VDXA 2N8GA 4Z6YA 3GTQJ 3C2HA 4IL6C 4TV7A 4CYCB 1OFCX 1KQ0A 3D5LA 1D0YA 1V54H 2JVHA 2BY0A 4FHTA 1NHAA 2AXLA 4OAYA 4ZC3A 5TGTA 2DMNA 2QYOA 3FMRA 2KFDA 3OYDA 4P96A 3G73A 2Q2EA 4XRMA 1LNWA 1JUMA 3ISPA 4KITB 2XRLA 2MSYA 2EV0A 5LBQA 5FLXZ 5BNGA 2ZMEA 2JQ7A 3OY9A 2FBHA 2L4AA 2VOOA 2EFQA 2XIGA 1WGXA 2LY9A 3ZCOA 5DM7F 3QP6A 3L2WA 5KNLA 1VZ0A 3G1MA 1FIPA 2KLOA 3E5UA 1U6GA 5E3OA 3HXLA 1LE8A 1F9NA 3CMAI 3KLNA 3TW6A 1U9OA 4CCOA 3ZXSA 2ICWG 3HHHA 4GXOA 5FJ8J 5J3LA 3I9V2 1SEUA 1DGWY 4RM3A 5CJ9A 4NQWA 3RIRA 1SVMA 3FXJA 3CUQC 4A3FJ 3FMQA 1W7PD 1P6RA 2QSGX 1U3EM 1SAUA 2DFIA 5HDKA 4M6YA 2LD5A 4IHTA 1ZK8A 3CMMA 3OYNA 1WI3A 3HDDA 1DU6A 3CLOA 2Y9YA 2E35A 2L9NA 3GTLJ 1YX3A 3PUBA 3B73A 3RTRA 2K9QA 3CP2A 3HOZJ 4N9HA 1E2XA 2HS5A 3MZYA 2EZLA 2DJIA 1IDZA 4HOBA 4LJZF 4MGRA 3PO2J 2MW8A 3N05A 4MO7A 2E36A 2DA6A 3DPLC 4A69C 5HLHA 1PDNC 4DNCA 5J1UA 1DPUA 4MTEA 1T08B 4GYGA 1FT9A 2LMDA 2JA7J 1MNEA 5E79C 2ZXJA 2HQAA 4HW0A 2XPWA 3BG7A 4XKBA 3HRTA 3I4PA 5EJCA 1QBJA 3RKQA 2ECBA 3BP8A 3ECHA 3QPHA 4EM1A 4V2FA 4Q5SF 1MBFA 5L3CA 1N75A 4A3IJ 3FM3A 1OCZH 2UUZA 2VXZA 2X6WA 2Z2SB 4KJZA 1OYYA 2A5WA 2CQ7A 3P7NA 3ZMUA 5GTHC 2JUGA 1JE8A 2WB1N 5D8LB 2W48A 2O9LA 2R7VA 4O6JA 3TQNA 5IY5H 1YW8A 3BCBA 3GLLA 2M0MA 1AOYA 1JKRC 1FWZA 2RAEA 4HV6A 2OU2A 3BTIA 5EEGA 4XIDA 5LD2C 3SFIA 2ZMEB 3KP4A 4WXDA 2R7UA 2HPIA 4KIBA 1Z77A 2PMUA 2UXNA 1ETYA 3CDHA 1T6SA 3J7AO 2O7OA 3K4CA 2W24A 3GTGJ 1X19A 2ZC2A 1VQ4I 3S8PA 1TC3C 4CGZA 3VYRB 4IJAA 2FXAA 4H4KC 1XMAA 1S8NA 3ZR8X 4FISA 5M5YJ 2KIFA 4ENKA 3A02A 2FMYA 4LLGF 4WF2A 1T98A 3E1SA 3OYMA 4EJVA 1LEAA 1S29A 4XMYA 2RREA 1VQKI 1IW7F 2K3PA 3DTEA 5D6FA 2X1EA 5K1YA 4DGWB 3ZPLA 1REPC 1G3WA 5DM6F 3CJNA 3MQ0A 2XROA 2LSOA 4MFEA 1TNSA 2P81A 1U8RA 2XKPA 1GVDA 2M7BA 3DU5A 2CFXA 3FX3A 4HNVA 3CMEI 1VQMI 4F92B 1RR8C 1FP2A 3F0CA 4EGYA 3ASOH 5BQTA 2ZXWH 5C44J 3BJAA 2B0LA 4EM0B 1ZHFA 4JQFA 5DS9A 2ISYA 3CO6C 1FPQA 3PFYA 2Z3YA 5FFXA 4W1UA 2VE9A 4OIQF 1FLIA 5CYVA 1ONVA 4FE4A 4WX9A 5LGUA 4AIJA 2A6HF 3ABLH 1E3OC 3S16J 1L0OC 4HNTA 4OMYA 3K70C 3DKWA 3Q9VA 3HOTA 3IAM2 2DXIA 1BI1A 2DYSH 2GXBA 2NOJB 2R3SA 4N4NB 1WHUA 1RC9A 3FXOA 2AS5F 4A6DA 2XAFA 1BOBA 4CZZA 3ZRGA 3I59B 1HKSA 4KMFA 2VL8A 4A3GJ 3WU2C 4WWCA 2WAQA 1B72B 3NEUA 2WAFA 3EUAA 2KT0A 1FTTA 3I5UA 4LG0A 4A2UA 4Q48A 4EJOA 5JHUA 1QQIA 4XRFA 4A3MJ 2XAQA 3ERED 2FE3A 4DYQA 4NDLA 4OU0A 2K9SA 4BGDA 3H3UA 2V9KA 5CVJA 2BOLA 1Y1VJ 5J40A 3ROUA 4BYYA 2PBIA 2EV5A 1ZRCA 1FX7A 1J0RA 1XGSA 1BJZA 4PUSA 2HQNA 3L00A 3TL4X 3ZMDA 3JR9A 1HC8A 1J09A 3DP7A 3BQZA 2R7OA 4BQAA 3DKXA 3VYSB 1OCOH 3D5RC 3NQOA 2CV0A 1BA5A 3RYPA 3S2HJ 5IP6A 1B9MA 3K7AJ 2HVSA 4P5OA 5L3BA 4Q4ZF 2K9NA 3GUDA 2PQ8A 5K5QA 2KJBA 4RDUA 2DQLA 5B5EC 4WCGA 4YIIA 3TKYA 2L9SA 3Q9SA 3C3WA 2V6CA 1XMKA 4ETSA 2CV1A 4A3CJ 3IV5A 1OKRA 1ZKGA 2O5RA 5EDNA 3IH2A 3OYHA 3BPVA 3NAUA 3WG9A 3ERMA 2IGNA 1IAWA 5F1RA 1EA3A 3FXRA 1D1BA 1RETA 2UV1A 2VI6A 5IPAA 2DA7A 4XR6A 9ANTA 3IC7A 4DOZA 1UELB 2FBIA 1T0FC 4FX0A 2W84A 3CUQA 4RAZA 1VQ7I 2LNBA 1LJ9A 2CJJA 3M8EA 2VT2A 3QYFA 2OC6A 1TWCJ 2YS9A 4B4CA 1TW2A 1TQMA 4BEHA 2VBWA 4BHPA 3BQYA 3VOEA 3HZJA 2L0KA 3IHUA 3K4BA 5JHFA 4UV8A 2ME0A 2Z33A 1MJAA 2FOKA 1YW9A 4BU2A 2R5ZB 3N97A 3LFUA 4KISA 3S93A 4OIOF 1KYWA 2W25A 4YELA 2DCEA 3RYRA 5DEQA 1S3JA 3CCSI 4PZJA 3F8CA 1XMXA 4RGUA 1GDTA 2YPRA 5GADJ 4BE1A 3OIPA 3LA7A 3CQZJ 1BC7C 2HXOA 1G3YA 2H6CA 1VFCA 1N77A 3RPUA 2RQPA 1EH8A 3QP5A 3BG5A 4U87A 4CA0A 2COMA 4QPQA 1BBYA 4LG0B 4F7ZA 3OV8A 4I99C 4C3IJ 1D1AA 3C1DA 2HZTA 5LHIA 1FYLA 2RDPA 2O8XA 1AHDP 4ZDOA 3BDDA 5L3DA 2EFOA 3UKGA 2BY2A 4PFOA 1G4DA 4NUBA 4MHGA 5KK1A 5ICCA 3JRDA 1VI0A 1Y0UA 2XV4S 2VQGA 3CJQB 1H88C 1SAXA 1XSXA 3M9AA 3F8NA 3T1BA 3WTTC 4PJJA 4ASNA 1S5LC 2F5FA 2LBFA 5HS8A 1SANA 2O6GE 3K9TA 3Q5FA 1UG2A 3CCJI 3LQQA 2JA2A 4G6QA 3DPUA 4D0PA 1D5YA 1W5CC 1X3WB 1XGNA 3DTIA 3HIFA 2QKMB 4HV5A 4JX4A 4MQ9F 4D7MA 2D2WA 2RC4A 4OOIA 4BHBA 5LFAA 2PJRA 2F5CA 1VQOI 2XGCA 3H5NA 3SEZA 1SFOJ 5FROA 4GCVA 3HTUA 3GFIA 4M6VA 2QBYA 2ELHA 3VWBA 1H9TA 2FQ4A 2KKOA 4G7OF 3RJPA 4RB1A 2L7FP 4F3QA 2P5KA 2FEZA 3RPQA 2MG4A 1QA6A 1UJ8A 1MBEA 1Y0NA 1LVKA 1R5HA 3ABMH 4C9YA 1JTYA 4M9XA 1G3TA 2FA5A 3QYEA 4I01A 1VF9A 1V3FA 2O0YA 1HOMA 3FKIJ 3FK7A 3F3XA 4YFXF 2JRMA 3K1PA 3GVAA 2WY7Q 3W3CA 2VQHA 1ORKA 3SDGA 3GMEA 2MGQA 3DBRB 2VE8A 1R58A 2DA5A 2DA2A 4XLAA 5D5UB 3HOVJ 2ZJPF 3I4NJ 3L2UA 2F5VA 3M7GA 3EPZA 5KHDA 1U8BA 1I1SA 5E20A 2FF4A 4EQQA 3DWLE 3E6DA 4JOMA 2X85A 2HOSA 2I10A 4QWQA 3E6CC 1JUPA 1X58A 2JPBA 2HKOA 4RAYA 1H89C 1JKPC 2VBXA 1A6QA 2ZKZA 4KICA 3IUOA 3KEYA 2EK5A 3NWTA 3C7JA 1H8AC 1QVUA 3LSJA 2DFFA 5ILSA 2RNJA 1I1GA 2AQEA 2KJCA 3HSFA 2NVUB 3TO7A 2GQQA 2H09A 2KHMA 4XK4A 2DT7B 3G1LA 4V2GA 2DK5A 2L9VA 5A2QK 4MLOA 4ZYGA 2HXIA 5JFRA 2LBFB 3ZQGA 3FBIB 1I3QJ 2AXTC 3HKZA 1HW5A 2HQ5A 4XSZF 4XN0A 5F0HA 5E17F 1OYIA 3E7LA 4EGZA 3SZPA 4NC8A 4A0YA 2EWNA 2ZSIB 4BE2A 1E17A 5IOZA 4YG2F 4KDPA 1FSHA 4UVCA 2OJED 2F5DA 2WC2A 2VODA 4BDYA 2WAQN 5E1XA 2QBYB 3PIOF 1S6LA 3RCOA 2YUSA 3MAJA 2HTJA 2R7RA 1YHQI 4A3JJ 3FISA 4C3JJ 2EFWA 4LD5A 3W2VA 3OSGA 1OCRH 1NG6A 2M7AA 4G94A 1BI2A 3QU3A 2PG4A 3OYEA 3MCZA 3K0LA 4Y33A 2NOGA 2UWMA 3HEFA 5M3MJ 3OYCA 1PYVA 2CQKA 1HXDA 4PJLA 5F04A 3KYLA 2F4OB 5F6FA 1F43A 4CXFA 1W36D 1J5YA 2IEKA 2HR3A 3N4MA 1FZPB 3CF5F 1X1PA 2OV7A 4AM3A 3H9JA 3F6VA 2E1OA 5DD8A 2M3AA 2GOXB 1S7AA 3CJRB 3S14J 2EIJH 4Y4RA 4PJNA 1IN8A 5DD4A 3JRHA 2Y30A 2I8DA 1MNDA 2L54A 4G7ZF 3H5RA 3BZCA 4XKVA 4CYCA 1IUFA 3ZMZA 2F48A 2K4BA 5JVGF 5JI6A 2R7ZJ 2ID3A 1TWGJ 3S2WA 3IAS2 4G7HF 2QQ8A 2XGEA 2W85A 1OQYA 4BUPA 5ED4A 4RBOA 1IN4A 3HRSA 3OL3A 1H0MA 3K69A 2G7HA 3I58A 4CYDA 1WCMJ 4XLCA 4CCNA 2M9HA 3GCMA 3OYBA 5B1BH 1BIAA 1XC5A 2ZXHA 1T38A 2HDWA 4QTRA 1MSEC 5K5OA 3LA2A 2CG4A 2NVXJ 1LFUP 3ZQLA 1HQCA 2Y0MA 1MGTA 2MC3A 2K27A 1OLTA 1VQ5I 2JWTA 2XDVA 1HKTA 2IJLA 3UR3C 2CQNA 1U5TB 2NS8A 1DP7P 3M4OJ 4GYIA 3L09A 5EZGA 5TISC 2XASA 3VYUB 4E6KG 3HOSA 3WU0A 2IT0A 1U2WA 2DOAA 2CW8A 1SMYF 3OIQA 2Z1DA 4L5IA 5KAFC 1F4KA 3MVPA 2IS6A 2ZNYA 2XB0X 3PQJA 3KP6A 1MBJA 4ZZLA 3GZNB 5CQEA 4ZTJA 1AKHA 4LK0F 4FX4A 4HX7A 3LFKA 2DPDA 1G3SA 2E60A 2OTLI 1IN6A 3TW7A 4E7ZA 1X1AA 2HKXA 2QVOA 1FBQA 3H9GA 5C4XJ 3MWMA 3FM5A 2A07F 2JVGA 1CGPA 1FOKA 1Z3YA 5J8CA 2Y69H 1BI0A 5DUIA 2C6YA 2IA1A 2ZNZA 2DI3A 3EQLF 1QGPA 4RGSA 1G59A 1IV6A 3K10A 2NNNA 2FNAA 2KDZA 3J7AY 4BXXJ 3G3ZA 1P4WA 4LFUA 2AHQA 3P9KA 3FDYA 2XAJA 4N9IA 3IRQA 1ETKA 4FETA 1BR4A 3A03A 1JKQC 3SYTA 1MSFC 3CCVI 2DPUA 5L3FA 4D5FA 1IGNA 2OPTA 1J59A 2MH9A 1STZA 3I4MJ 4UUSA 5J4YA 5CVUA 1WKMA 2P5VA 3REOA 1FY7A 3TP0A 4C3HJ 3LNQA 1WH7A 3MZ8A 1VQ9I 5HOOA 3HOUJ 5GAHJ 1VQNI 3S1MJ 3JRBA 4WXHA 1ZH5A 4AVZA 1NTCA 4LIUA 1I50J 4BACA 2BGCA 3R0AA 1KU7A 2QLZA 1SMTA 2K4JA 4MEYF 3FK6A 4XM3A 5TJJA 1SFEA 1FMVA 1SFKA 4HF1A 4IZZA 2L4MA 1W0TA 2QSFX 3VYTB 1MKMA 2NS0A 2VUMJ 2NYXA 3D5SC 2B63J 3IH4A 3DEWA 1RIOH 2KRFA 3C2BA 4CZCA 2K3FA 3HRUA 2WY8Q 4ZDPA 3ZMSA 1TTYA 2VONA 2A3SA 1R23A 2OUMA 3LOCA 4UUTA 1YI2I 3LL7A 1QZYA 4DBRA 4PJ0C 3QRFF 4GFBA 1VQ6I 5LEJA 1WSUA 1MMSA 1S7OA 1MMGA 3BR2A 2LG4A 2DMTA 5E3LA 2A68F 3HOXJ 2H8RA 1IRZA 1EH7A 1SD4A 2P8TA 1AKHB 4BNCA 2LOOA 4BKXA 3E5QA 4ENMA 1MDMB 4G6TB 2LTPA 4YRVA 2L9RA 2KPMA 1JTXA 1R36A 1USSA 3J80K 4HQEA 2P6TA 3BR0A 1A36A 3ECOA 3P9CA 3HSEA 2XSDC 1ETWA 1YTYA 3M07A 2BVMA 3BLYA 3WE3A 1Q1VA 4OIRF 3KYCB 2J5PA 2W57A 1YLFA 5HDNA 3DBLB 1XX5A 1UFMA 3ABUA 1M1EB 4A0XA 4C2TA 2L2OA 3C2GA 3S15J 3PJRA 1JT0A 1RI7A 2QEXI 3JRFA 3PO3J 4HDUA 5L3EA 3CC4I 1YQAA 3O8HA 3HKZN 5GTIC 2JK3A 1EH6A 2OA4A 3J80Z 1ETXA 4XOPA 1XGMA 4UUSB 3RZDJ 1G2HA 3NWSA 5CKTA 3KZZA 3CLQA 3I59A 3BPXA 3U2RA 4CO8A 1DQUA 2EFNA 1B72A 2EIMH 3TO9A 2K86A 1KZHA 3F21A 2QCOA 3I64A 3ZQFA 1RPWA 4UB8C 3DCFA 2O03A 2OAZA 4YIRX 5FRNA 1X4PA 5C4JJ 1IC8A 1XS9A 1B8IB 3DEUA 3OYIA 1NG7A 4XLEA 1LFPA 1P2FA 5F0CA 4C2UA 2HOAA 3BG6A 1ZYRF 2QWWA 5ILUA 2HVQA 1YS7A 2OQRA 2EB7A 3A0BC 4I98B 1YJ9I 4L5JA 3MEXA 3DFGA 2L7ZA 1TW3A 3M8JA 4HSRA 1IG7A 1ETOA 3IKVA 4M9ZA 5CPRB 4UNOA 1N78A 4V19K 1P7JA 1ZAOA 3RPUD 4XKWA 4AIKA 2UZKA 1F5TA 3I56I 2HOTA 3FXQA 2X51A 1V5GA 3WGGA 2X6OA 2CV2A 4L9JA 2X48A 1J7KA 1GXQA 3DPTA 2MBFA 2MLGA 4RGRA 1Y1WJ 5DUKA 4LLLA 3ML6A 4Y13A 1A04A 4HBLA 4EATA 3LAPA 5BMZA 4IQ4A 5GAEJ 4UY8I 1UMQA 3JRCA 2HVRA 2VC0A 3HG9A 3PFIA 2CQQA 4P9FA 5M5WJ 1R4MB 2IXSA 5DCMA 4E7SA 2L02A 2EILH 2ZB9A 3G4SI 1N25A 1R7JA 1R00A 2IA0A 3GO5A 4OAZA 3WHCA 3CP8A 4ITVA 1YYVA 3S1NJ 1KYZA 3GEZA 1PJRA 3EUHC 3FMSA 1UHSA 3LWFA 3VFZA 3B6AA 2HZDA 2E5ZA 1ENHA 3CO7C 2CO5A 1YX5A 4I2OA 4A5NA 3ZN0A 1K6YA 2KIUA 2R5ZA 3F72A 5ERIA 2PJPA 2CYYA 4ON0A 5HNFA 1ACIA 5E3NA 4ENJA 2YSRA 5EGOA 2MD0A 1LPQA 1FNNA 1QHGA 3K4NA 1MJ9A 3OYKA 3A1YA 3NRVA 3LMMA 1CF7A 1YOVB 3SXYA 2GXAA 3H9QA 2M87A 5FKOA 5HODA 4ESFA 3E5XA 2O61A 2GZWA 1JGGA 1U5TC 3OYAA 4H0EA 3FHZA 2FMLA 1KQ8A 4RA2A 4OIPF 2EZKA 4LOCA 2P4WA 1LKXA 2HYGD 5DV5A 2P5LC 1C0WA 2DMUA 3V8KA 5EEAA 3D1NI 4M71A 5FLVA 2X0LA 4C30A 2IVMA 1RNLA 1V5EA 3K4MA 2KZGA 1MH4A 4ZYEA 3GFLA 3GYHX 4A0ZA 2VJ4A 2GXGA 2LF7A 1YO5C 3LSMA 2IA2A 4XSXF 3WTVC 5FO5A 4BAYA 3GBGA 4HNUA 1A6IA 2YU9J 1IXCA 2EINH 1D8JA 2QGUA 3OMYA 2VASA 2XVCA 3HHGA 3I53A 4KUMA 3HC7A 2FU4A 4LMYA 3K70D 2ESHA 4DQ2A 4BY1J 1B1BA 3SHFA 2H6BA 5D8KB 3SZTA 2DFEA 2V1UA 1J75A 3ZQ7A 2KL4A 2VIXA 4U88A 3HL2A 1BIBA 3BOQA 3LA3A 2RV8A 2DAOA 3M1EA 4MFDA 4P55A 5DCMB 3CZ6A 4F93B 1IZ1A 4RM2A 3OS2A 2VJJA 3D0SA 3H5AA 1XCBA 5KAIC 3HOYJ 1SC7A 3B02A 4G12A 2VKDA 2GIZA 2NVQJ 3BZ6A 2KIQA 4F52A 5JLWA 1WJBA 1B59A 4LB5A 1MIJA 2OD5A 3MMYB 1QO0D 2HNHA 1IDYA 4KIFA 3CDIA 3RKWA 1QNTA 1TT5B 4HPQA 5D6EA 3F8FA 3HBLA 3KZYA 3WODF 1XPXA 4KN7X 2L5QA 4S04A 3QU6A 1YIOA 4J01A 2EH3A 2QQBA 2BVLA 2ELJA 2QF7A 2Y2ZA 5LRSA 4KN4X 2ZSHB 1I5ZA 4IO9F 5BPIA 4K2EA 5EGOB 4A3LJ 3LSIA 1RUOA 1YW7A 1ZG5A 2E34A 3SFZA 2R7WA 2BW3A 2B9SA 4IVNA 1CF7B 1R1TA 1ITYA 2RN7A 2FJ1A 1Z6RA 1IO2A 4E7KA 2HDCA 1WJFA 2PI0A 1QVTA 4AC0A 3A2KA
chains in the Genus database with same CATH topology
3ASOH 3WG7H 5IY5H 2ZXWH 3AG4H 1V54H 2DYRH 2EIJH 3AG3H 2OCCH 1OCOH 1V55H 1OCRH 3ASNH 3AG1H 5B1BH 5B1AH 3X2QH 2EINH 3ABLH 3AG2H 1OCZH 3ABKH 2EIKH 5B3SH 2EIMH 2DYSH 2Y69H 2EILH 1OCCH 3ABMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO H;  3WG7 H;  5IY5 H;  2ZXW H;  3AG4 H;  1V54 H;  2DYR H;  2EIJ H;  3AG3 H;  2OCC H;  1OCO H;  1V55 H;  1OCR H;  3ASN H;  3AG1 H;  5B1B H;  5B1A H;  3X2Q H;  2EIN H;  3ABL H;  3AG2 H;  1OCZ H;  3ABK H;  2EIK H;  5B3S H;  2EIM H;  2DYS H;  2Y69 H;  2EIL H;  1OCC H;  3ABM H; 
#chains in the Genus database with same CATH topology
 1QPM A;  3EYY A;  2E7W A;  4XIC A;  1ZEL A;  5ICE A;  4QLC U;  2BZT A;  2GM4 A;  1U78 A;  3M8F A;  2RVC A;  2EA4 A;  4PSW A;  4BXF A;  2A61 A;  3R60 A;  2BXY A;  2LFB A;  4NC6 A;  1U9N A;  1IRG A;  1FEX A;  2COB A;  4BQO A;  4CCK A;  2XHK A;  4XN3 A;  3CCY A;  1BN5 A;  2LLK A;  1YS6 A;  3HM5 A;  5AON A;  2V1X A;  2K7L A;  1FBS A;  3Q0W A;  5J47 A;  2KZV A;  4JBA A;  1SD7 A;  3BCA A;  3T8T A;  5AIP A;  2WBM A;  2JT1 A;  1FYK A;  1O3R A;  5TRD A;  1VND A;  5K5R A;  4I09 A;  4GRI A;  4HYE A;  4ZZD A;  4B3A A;  4BE0 A;  1X1C A;  3PM1 A;  1O7F A;  2G7U A;  2R7D A;  3GLX A;  1XN7 A;  4S05 A;  4IHY A;  3TMO A;  2A6T A;  2Q8K A;  2DBB A;  2IGM A;  3H3Z A;  2HDD A;  1BR2 A;  3AAF A;  3K4J A;  4EJT A;  1KU2 A;  4DYR A;  1XDS A;  3K4L A;  2ZCW A;  4XLP F;  1BL0 A;  1TWA J;  3BR5 A;  1OPC A;  4A6E A;  3FIW A;  3ASN H;  3MKL A;  3A01 B;  5C3E J;  2PMZ A;  2E2J J;  1I3A A;  4UHT A;  5IYC J;  2L3D A;  3ZN1 A;  5AIQ A;  2GBY A;  5B3S H;  2GIV A;  3CES A;  4YFN F;  4IOA F;  2ZFW A;  3O8G A;  2HGC A;  5EYR A;  3ZMT A;  3TED A;  1T39 A;  2OF7 A;  1X3Z B;  2DK8 A;  4GGG A;  1Z3X A;  4U0V A;  2JZY A;  2HOE A;  4A12 A;  1GUU A;  1IV8 A;  3MKZ A;  2BW3 B;  1LDD A;  3GXO A;  2ME6 A;  1ZGW A;  4FAS D;  3F8M A;  3V7R A;  2VLA A;  3QOP A;  3ZMV A;  3EUH A;  3VSK A;  1K83 J;  2OZU A;  1Y6I A;  3F9K A;  4LG3 A;  4EJW A;  3AG2 H;  4CCM A;  2JN6 A;  5FKK A;  3KPH A;  3ABK H;  5HS9 A;  5LGN A;  3J7Y J;  3L1P A;  4G8X A;  4XLN F;  2O8K A;  3OYG A;  3OR1 C;  4M3B A;  2B7E A;  1Z21 A;  2VJ5 A;  2XUB A;  5J8F A;  3L2C A;  2V79 A;  2A69 F;  3Q3S A;  3W6K B;  2F4M B;  2FRH A;  2VOP A;  4D7N A;  1PVE A;  5F64 A;  4MIM A;  3GTP J;  1YRN B;  3WGH A;  2L01 A;  5DCF A;  2E1C A;  1Z6T A;  4Z2Y A;  3AG3 H;  2L7M P;  2ETH A;  4P1W A;  2V1D A;  1WJ5 A;  5CVR A;  4FT8 A;  3GZ6 A;  1WJE A;  2CUF A;  1ODD A;  1U5T A;  1P4X A;  3QWL A;  1POG A;  4A3K J;  2LKX A;  4JK1 X;  4I02 A;  4PFP A;  3CTA A;  3F6O A;  3JAM Z;  2X9D A;  4D1Q A;  5DYM A;  3IWF A;  1MH3 A;  3COA C;  4BQN A;  4ABZ A;  1JT6 A;  3J7Z I;  3R4K A;  3KEQ A;  4M74 A;  3JRA A;  3PSI A;  3J81 Z;  2W4S A;  3BTL A;  5FD6 A;  3CCR I;  4NHJ A;  3GTM J;  2K85 A;  4M73 A;  2W7N A;  1FOW A;  1HKQ A;  3JTG A;  4E70 A;  4PDK A;  5J4V A;  3ONQ A;  3JSP A;  4LB6 B;  4A5M A;  3CCQ I;  3PNT A;  3W6V A;  2DU9 A;  3AL0 C;  3U9G A;  1HCR A;  2NS7 A;  2CMP A;  3FBN B;  2WAE A;  3CUO A;  2KDO A;  3OOU A;  1R22 A;  1GV2 A;  2DFH A;  1SFU A;  3HOW J;  4IEJ A;  1WRJ A;  3QAH A;  3WE2 A;  5M5X J;  2BV6 A;  4M6X A;  2VQC A;  3O2P E;  3GTO J;  3GZ5 A;  4L0Z B;  2EZI A;  3WTU C;  3T5X A;  1R49 A;  2PLY A;  4II2 A;  4DYC A;  4M3G A;  3S1R J;  2MFZ A;  2XF7 A;  2JPC A;  3V8L A;  3DXJ F;  3HRM A;  3VSL A;  4UUV A;  5LGT A;  3F22 A;  3CJT B;  1ZGJ A;  3HUG A;  2DT5 A;  3PSF A;  3E97 A;  5FKN A;  4DBQ A;  1MZB A;  1T0F A;  2M45 A;  1E3H A;  2OCE A;  4XKC A;  1O3Q A;  2R7S A;  3LSK A;  1IXS B;  2V7F A;  3MZH A;  2JMW A;  5BS6 A;  4KA4 A;  1XGO A;  5CLS A;  5FB2 A;  1IUY A;  4B44 A;  2KIS A;  5IYB J;  4A3D J;  2ISZ A;  3V42 A;  3ULQ B;  4ZYD A;  4HLY A;  3HTS B;  4O5V A;  3WTS C;  4BBS J;  3K6G A;  1HA8 A;  3K2A A;  3ZQC A;  2RQQ A;  2YX4 A;  2M1B A;  2ESN A;  3K2Z A;  3PQK A;  2BYV E;  4LIT A;  5GPC A;  1FSE A;  4MEX F;  2XSJ C;  4UV9 A;  1APL C;  4DZJ A;  4GDF A;  5ICF A;  2GA2 A;  2NVT J;  2FQ3 A;  4LIV A;  1TBX A;  1Q1H A;  4HG2 A;  2RGV A;  3WG7 H;  1W0U A;  4J19 A;  3NAR A;  5IT3 A;  5K7F A;  1MBH A;  4KIG A;  2LR8 A;  2BY1 A;  4XQF A;  1XSD A;  2IS4 A;  1R9T J;  2R93 J;  4FQG A;  4B47 A;  1WJC A;  1FOY A;  2PFB A;  1I6X A;  2EBI A;  2JA6 J;  2ZJQ F;  1NK2 P;  1UAA A;  5F27 A;  1MDM A;  1MMN A;  1HDP A;  4MNU A;  5FD5 A;  3DLA A;  3HSR A;  5D4R A;  3OS1 A;  1O4X A;  3JRG A;  2HEO A;  2DA4 A;  5B66 C;  2XAH A;  2EPF A;  2K40 A;  3G6E I;  3S2D J;  1OYW A;  3JW4 A;  4II3 A;  3TDU C;  3DBH B;  4N0B A;  2XGD A;  2TDX A;  1D3Y A;  1KGS A;  2CU7 A;  3LST A;  2LVS A;  4ANJ A;  4E7L A;  5IP9 J;  4ESB A;  4IPA A;  3I71 A;  2XAG A;  4F55 A;  5B1A H;  1E3P A;  3IKT A;  4ZTF A;  3C18 A;  1MBK A;  3TP3 A;  2PEX A;  1WJD A;  4XLH A;  4BQQ A;  2MA3 A;  2NRA C;  2KIM A;  3H92 A;  2ECC A;  3LSP A;  4UVA A;  5LLQ A;  2QQA A;  2WTE A;  4AD9 A;  3P5J A;  1OCC H;  1ZRE A;  1J9I A;  2LYC A;  3BWG A;  1PUF B;  1EF4 A;  3HUG B;  3V4G A;  1ZRF A;  3I0T A;  1WH5 A;  3LSG A;  5JR3 A;  1NH3 A;  4I0B A;  3TO6 A;  2R7Q A;  1MD0 A;  2MD5 A;  4LK1 F;  4IKF A;  3KCC A;  3KP2 A;  5EG0 B;  1B8I A;  4ESJ A;  4R1H A;  4M72 A;  4HX4 A;  4RGX A;  1TQI A;  1I27 A;  4UVB A;  3LSR A;  1T56 A;  1ETQ A;  5DTD A;  1QHH D;  3E3V A;  2EA2 A;  1UHW A;  1S72 I;  1XTA A;  2E2I J;  1UST A;  2PMZ N;  4LGW A;  2LF8 A;  2CGP A;  4B1R A;  5FRM A;  2GOM A;  3AG1 H;  5K7H A;  5J6X A;  3JTH A;  3BRO A;  4CH7 A;  5KVR A;  2M30 A;  4EVI A;  4IRG A;  3GW2 A;  4AU7 A;  2FOW A;  4IHX A;  2CH0 A;  3L2R A;  3H36 A;  1GHC A;  1Z05 A;  3H0G J;  1K6O A;  3QPL A;  4IF4 A;  1D5V A;  4A93 J;  3JRI A;  3S1Q J;  4JYK A;  3BR1 A;  2ADU A;  2EZH A;  4WK8 F;  3VOD A;  2DO7 A;  4PSX A;  4CUG A;  3Q0V A;  4PGG A;  3PIP F;  5H2F C;  2L7K A;  4M3D A;  1EJ9 A;  2WV0 A;  2DDA A;  1FIA A;  1LB2 A;  1IRX A;  4HAM A;  5LEK A;  4G9Y A;  4N4O B;  1FJL A;  4IHS A;  3T8R A;  2W1O A;  4JX5 A;  1RKW A;  2NNY A;  3KE2 A;  4OMZ A;  1K79 A;  2DTZ A;  2R5Y A;  2H8W A;  4Y15 A;  4DZP A;  2VC1 A;  5ILV A;  4XOT A;  3FHN A;  3FWE A;  3IP4 B;  3OYL A;  2G9W A;  3VEP A;  1A35 A;  1XDU A;  1SVL A;  1RES A;  3E6M A;  1KU9 A;  1F1Z A;  3I3L A;  5HS7 A;  1LFB A;  4KMU X;  1BOA A;  4FCY A;  3RQ4 A;  2BHY A;  4B3X A;  1A31 A;  3LAJ A;  1ETV A;  4XON A;  2DMP A;  2DOF A;  1G6N A;  2CUZ A;  2PMH A;  3KP5 A;  3UNG C;  1R1V A;  1R6R A;  2K02 A;  3IH3 A;  2ID6 A;  1U0J A;  3K4K A;  1WPK A;  1KON A;  2WA0 A;  1WZ2 A;  5CQG A;  4OIN F;  1GT0 C;  1RR7 A;  2BY3 A;  4B48 A;  1I39 A;  2XF5 A;  1GXP A;  1K78 B;  4ZYH A;  3BG9 A;  3RZO J;  1K4T A;  4KNY A;  2XRN A;  2I5U A;  4X6A J;  2EV6 A;  5EZH A;  4ZH4 F;  2QQ9 A;  2Z16 A;  2FNP A;  4RB2 C;  4UB6 C;  5IOY A;  3RKY A;  4DIQ A;  1XG1 A;  2OCC H;  5H6R A;  1LDJ A;  1P92 A;  3AKZ A;  1IXR C;  1ZG1 A;  4E4H A;  2CRG A;  2JSC A;  3JRE A;  1QZZ A;  3BC8 A;  5LHG A;  2DW4 A;  2BE5 F;  1UHM A;  2STW A;  3QOE A;  2RNG A;  4S0H B;  2Y0S A;  2VKH A;  3VPR A;  2VBY A;  3A0H C;  2R7X A;  2M4G A;  4IXA A;  2Q2E B;  1Z1D A;  2MYS A;  2IPQ X;  5JLX A;  1VQP I;  2Y31 A;  3K1N A;  1BW5 A;  3L7W A;  1X3U A;  1Z7U A;  3ZQI A;  4BBR J;  1Z9C A;  1YJN I;  3EUK L;  1HW1 A;  4IRI A;  1AWC A;  4IHV A;  2PN6 A;  2FX0 A;  3MD2 A;  1TLH B;  3WTX C;  1VQL I;  1V55 H;  2LRD A;  4I7H A;  4MQV A;  4U7B A;  4E7H A;  1IJW C;  1ZR4 A;  1XB4 A;  2DDB A;  1LE8 B;  1K7A A;  3V7S A;  3FF5 A;  2QZ8 A;  3MFK A;  5GPA A;  2FUG 2;  1DU0 A;  3BZK A;  1IN7 A;  1X2N A;  4ZYA A;  5HDG A;  3HYI A;  3DV8 A;  1T8I A;  2CWE A;  3RI4 A;  2VN2 A;  4NQW B;  3ZGK A;  4B09 A;  3KP3 A;  1W1W E;  1ZTR A;  4I0A A;  4Y17 A;  2JA8 J;  1OJL A;  3OSF A;  2FBK A;  2OBP A;  3M1C A;  2XF6 A;  2TRT A;  2YX7 A;  2EQR A;  2V26 A;  3GTJ J;  1LEB A;  1QU3 A;  3S17 J;  3MKY B;  2R5Y B;  2NVY J;  4YIF A;  1JXS A;  4RLF A;  3QYB A;  1KU3 A;  1UB9 A;  2H1K A;  2D45 A;  4XNF A;  4XOR A;  3EET A;  5BOX A;  4E7I A;  1IF1 A;  2E71 A;  2R4G A;  3ESW B;  1LUJ B;  2DQR A;  3DLL F;  4R8H A;  4L9N A;  4E7J A;  3TOB A;  1MMD A;  4B43 A;  2ZO4 A;  1K61 A;  3AL0 B;  3H3V K;  2M34 A;  4QPO A;  3M3Y J;  3GFJ A;  1ON2 A;  2Y75 A;  3BR6 A;  3BG3 A;  3S32 A;  3OWT A;  4RMN A;  3WHB A;  1MNM C;  1D8K A;  2STT A;  1KQ9 A;  2UXX A;  4NB5 A;  2LP0 A;  3RSN A;  2EIK H;  1VQ8 I;  3G71 I;  5D5X B;  3SJM A;  2MH2 A;  4HST A;  2YU3 A;  4RB0 A;  4U0W A;  4HRI A;  4BL0 B;  4KT6 A;  3WTW C;  4IQJ A;  4I6Z A;  1O57 A;  3QQA A;  1W5S A;  1JKO C;  4DW6 A;  4BDZ A;  2TCT A;  2FSW A;  4UXN A;  3ELK A;  3QPT A;  4EMS A;  1F36 A;  2LDU A;  1AU7 A;  1MBG A;  3G1O A;  1HF0 A;  1L3L A;  2X1D A;  2MC4 A;  1H9G A;  2F2E A;  3ZQH A;  3EDP A;  3BTC A;  1OR7 C;  2G0E A;  3FXM A;  3EYI A;  1W7P A;  2H94 A;  5E8G A;  3SQN A;  1FTZ A;  3KX2 A;  3ABT A;  3HGG A;  2XC7 A;  2CW7 A;  5E18 F;  4HLX A;  3E0J B;  4XRS G;  1D0Z A;  4YFK F;  2HI3 A;  2E1M C;  1T33 A;  1ZQ3 P;  5FLM J;  1G8X A;  3P9I A;  5LRR A;  3TGN A;  1ZRD A;  3CD6 I;  2DMQ A;  2D1H A;  3KZI C;  1UG0 A;  5H6Q A;  2H1L A;  4RAG A;  1DPR A;  4PK4 A;  1IN5 A;  1R5G A;  4IHW A;  1JGS A;  5BPD A;  1WQ2 A;  5E1W A;  2HTS A;  2ZJR F;  2X6X A;  2R92 J;  1D0X A;  1BJA A;  2Z99 A;  2DA1 A;  1YJW I;  2QSH X;  2NAZ A;  2F6C A;  3HPG A;  4BH9 A;  1B6A A;  2E5N A;  3A01 A;  4RS8 A;  2M5W A;  3RKX A;  4Y3O A;  4XRS A;  3WTY C;  1MMA A;  4HA8 A;  3KEO A;  3KIO A;  1NK3 P;  3BR3 A;  3PNV A;  2QA4 I;  3KET A;  3OOP A;  3BJO A;  3BTJ A;  5FKL A;  4BXU A;  2XAU A;  2DLL A;  3X2Q H;  4CCJ A;  1W4M A;  4AYB A;  3CCM I;  5E8I A;  4HF2 A;  1ZLJ A;  2D1V A;  2VKV A;  1RRJ A;  2J5O A;  2DT6 A;  2Q1Z B;  2GWR A;  1GLN A;  3DQV C;  3PL8 A;  4NC7 A;  1ERD A;  3SEQ A;  3KLO A;  3V8J A;  1JUS A;  2OQG A;  3OR2 C;  3ZP5 A;  1Y39 A;  2IS2 A;  3U1K A;  1P7I A;  4D9J A;  1YE9 A;  4EEF G;  4KFC A;  3SZG A;  1V4R A;  3CF2 A;  2DOE A;  4QSH A;  3WU1 B;  4Y7N J;  1TP4 A;  5F1J A;  2X4H A;  3FKJ A;  2Y48 A;  3LQR A;  4ZJZ A;  4CIC A;  3S3N A;  3I54 A;  5D5W B;  1SD5 A;  2VQL A;  2QKL B;  4AIH A;  1YFH A;  1YRN A;  3HPH A;  3F23 A;  2ZXI A;  2A6E F;  3OYF A;  2IRF G;  1T95 A;  4P9U A;  1YG2 A;  4U0Y A;  1RKT A;  1FYM A;  5HVQ C;  1SD6 A;  2XKO A;  4L5E A;  2WWY A;  4HZF A;  1SVO A;  1JJ6 C;  1K4S A;  2DTR A;  2HYJ A;  1W7P B;  2GAU A;  3CCL I;  2PX9 A;  1MJB A;  1YIJ I;  4BJT A;  2R0Q C;  4PJM A;  5HLI A;  2CFO A;  2LY2 A;  1WJA A;  1XSV A;  2Y9Z A;  1GV5 A;  3V7C A;  3IWZ A;  1BC8 C;  1WI9 A;  4J00 A;  3T0Y A;  1R4N B;  3OYJ A;  4IX7 A;  1X1B A;  3PNY A;  4BY7 J;  1WFX A;  3KFW X;  1Z67 A;  3H35 A;  1JJ8 C;  3SDB A;  4CCL A;  3PUF A;  1HW2 A;  2HU9 A;  3BJ6 A;  1V5F A;  1OIS A;  2M0C A;  2VKE A;  3GFM A;  1R1U A;  2IBD A;  2V1N A;  2V9P A;  4A3E J;  2JTV A;  2Y0S N;  3U21 A;  1TWF J;  2IS1 A;  3KYD B;  2AQF A;  3CCE I;  2JUC A;  3W2W A;  2VBZ A;  2LK2 A;  3GX4 X;  1RZ4 A;  4FTH A;  4I76 A;  1TNT A;  4AVP A;  3CCU I;  2HWV A;  2K9L A;  2ZBK A;  1B9N A;  4LLN A;  2M8G X;  2WV1 A;  2EJR A;  3CUQ B;  2LH9 A;  1P4A A;  1OMI A;  5IYD J;  1JI8 A;  5F08 A;  1UZC A;  2Z9O A;  3R6S A;  1WVR A;  1CQT A;  2GA1 A;  1X4O A;  3E6B A;  5KCM A;  3IL2 A;  1LVA A;  2DA3 A;  4BEH B;  1X1D A;  3AFH A;  4B8X A;  3GWZ A;  4PGH A;  1FOX A;  3I55 I;  3RQI A;  2XPU A;  5H20 A;  2ZME C;  5LHH A;  5HLG A;  2CSO A;  1OCP A;  1WWX A;  1JHF A;  3BT9 A;  4X0G A;  2LC2 A;  2ZFU A;  1RUN A;  2VT3 A;  4BJ6 C;  3VB2 A;  3JAM K;  5HNH A;  2DOD A;  2K9M A;  4ZDL A;  1EKE A;  1BW6 A;  2KRC A;  3KP7 A;  3J81 K;  1DUX C;  1E0E A;  1LDK B;  2DYR H;  1O3T A;  5DDG A;  3L9F A;  2JSP A;  3HGY A;  2OTJ I;  3JSO A;  1DGR M;  1FMW A;  3MN2 A;  3IRR A;  1A5J A;  3H0D A;  5HLT A;  5ICG A;  1ZGA A;  4WXC A;  4BS9 A;  4HX8 A;  3S3O A;  3CC2 I;  2XB5 A;  3HB9 A;  2P0W A;  4M9S A;  1GVJ A;  1JHH A;  2K5C A;  1W36 C;  4Y52 J;  4NNJ A;  2E1N A;  4CDG A;  2HPM A;  5FKM A;  1HSJ A;  2XGX A;  3TDZ C;  3F8B A;  2CW0 F;  3WGI A;  4EM2 A;  2MLK A;  1XD7 A;  1T2K A;  4L0Y B;  4O3M A;  5CVV A;  2IAI A;  2JRT A;  2JJ7 A;  1R71 A;  4U7D A;  4L9V A;  1TT0 A;  2IGK A;  1ZG3 A;  3ZQQ A;  2PJR B;  1X2M A;  1OR7 A;  1W5T A;  2HQR A;  4MTD A;  1ZN2 A;  4JP0 A;  3CDL A;  4CSW A;  4IRH A;  4W97 A;  1FBU A;  4YEJ A;  5D4S A;  5A2Q Z;  4X1E A;  3TBI A;  2BBY A;  2Z5U A;  2LRE A;  3MKW B;  2WB1 A;  2A5Y B;  2V9V A;  3B6C A;  1FP1 D;  4XBF A;  5IP7 J;  3GTK J;  1S7E A;  1IRF A;  1BM9 A;  4ENN A;  2X1C A;  3FZV A;  3A4C A;  4KYW A;  2KP6 A;  2R7F A;  5GAG J;  1ZLK A;  5L3G A;  4FE7 A;  2P7V B;  2AO9 A;  1BI3 A;  1PUF A;  2O3F A;  4AWX B;  3O3K A;  3L2Q A;  2XPV A;  1HST A;  5M3F J;  5E1Z B;  2FD5 A;  2CUE A;  1YIT I;  3CC7 I;  2W00 A;  1O3S A;  1TL8 A;  2HYF A;  1TWH J;  4M3F A;  4JX6 A;  3ZOB A;  3DU6 A;  4GO1 A;  3FXL A;  2A05 A;  3DF8 A;  3HJE A;  2LY1 A;  2M8E A;  1HDD C;  4L18 B;  5EG0 A;  2IGO A;  3AG4 H;  4EV0 A;  2ELK A;  5CVI A;  1EV7 A;  2JA5 J;  3BY6 A;  5D5V B;  2X6Y A;  4HQM A;  4G6D A;  2LKS A;  4R79 A;  3OL4 A;  3TOA A;  5E3M A;  1R5I D;  1TZL A;  2F5E A;  1DP3 A;  1SFX A;  2BXZ A;  1O7L A;  3RDI A;  2D5V A;  4KT5 C;  4AUX A;  4AID A;  5EF6 A;  5F0F A;  2LKP A;  1AA7 A;  4L9T A;  2NXN B;  3DKY A;  2EFP A;  1KA8 A;  3QPS A;  5J1Y A;  1Z7L A;  2QEN A;  3LSH A;  4PCQ A;  4F91 B;  2OZ6 A;  2R7T A;  3OIO A;  4XL9 A;  4M3E A;  4AYB N;  1PP7 U;  2H27 A;  2BEO A;  4BHC A;  3U1D A;  1UCR A;  1VTN C;  2GLO A;  2DJN A;  1TQP A;  2VJI A;  4Q47 A;  5GP9 A;  4A3B J;  4D5C A;  2QM3 A;  2YR2 A;  3G2B A;  2P6S A;  1QZE A;  4RAF A;  4CHU A;  5K7Z A;  4RB3 C;  2CS3 A;  5IT9 K;  2CQX A;  4HDV A;  3R61 A;  2WAD A;  2MAB A;  1ZAR A;  4QIW N;  3DEE A;  5JVT A;  2BHZ A;  4IOC F;  1PP8 F;  4OWR B;  3GF2 A;  3H1C A;  3Q0U A;  2V6E A;  3L2V A;  2KRH A;  2HFH A;  2M4K A;  3FXK A;  1Z91 A;  2W82 A;  1Y8R B;  1XCV A;  1BR1 A;  1Z0X A;  1P9Q C;  2DN0 A;  1OCT C;  4BJ5 C;  2Q0O A;  1FC3 A;  1I6H J;  2E1M B;  2CUJ A;  1Y8Q B;  4DJA A;  2IP2 A;  3W2A A;  5IT9 Z;  3O6B B;  2ZJ2 A;  2ACJ A;  5J1R A;  3S3M A;  1ZR2 A;  3K1M A;  6PAX A;  5EEH A;  1ULY A;  1QPI A;  3DTK A;  1PUE E;  4NBQ A;  3OS0 A;  1QRY A;  3QOD A;  3R0J A;  2KQR A;  1DDN A;  3WTZ A;  2RKH A;  2QUF A;  2VPR A;  2KMU A;  2E2H J;  3W6J B;  1LQ1 A;  2E19 A;  1D1C A;  1K78 A;  1HBX G;  2E7X A;  2V4J C;  1B4A A;  2IW5 A;  2M2E A;  3CMY A;  4RLQ A;  2VXD A;  1J2X A;  1Y56 A;  4XLF A;  4HEA 2;  2VPL A;  3FXU A;  5FFZ A;  4HF0 A;  1HLV A;  1ON1 A;  2P7C B;  5FLX K;  1MW7 A;  2VB6 A;  5FGM A;  4EJU A;  2F4I A;  1S9H A;  4C2M J;  3JCU C;  3VDX A;  2N8G A;  4Z6Y A;  3GTQ J;  3C2H A;  4IL6 C;  4TV7 A;  4CYC B;  1OFC X;  1KQ0 A;  3D5L A;  1D0Y A;  1V54 H;  2JVH A;  2BY0 A;  4FHT A;  1NHA A;  2AXL A;  4OAY A;  4ZC3 A;  5TGT A;  2DMN A;  2QYO A;  3FMR A;  2KFD A;  3OYD A;  4P96 A;  3G73 A;  2Q2E A;  4XRM A;  1LNW A;  1JUM A;  3ISP A;  4KIT B;  2XRL A;  2MSY A;  2EV0 A;  5LBQ A;  5FLX Z;  5BNG A;  2ZME A;  2JQ7 A;  3OY9 A;  2FBH A;  2L4A A;  2VOO A;  2EFQ A;  2XIG A;  1WGX A;  2LY9 A;  3ZCO A;  5DM7 F;  3QP6 A;  3L2W A;  5KNL A;  1VZ0 A;  3G1M A;  1FIP A;  2KLO A;  3E5U A;  1U6G A;  5E3O A;  3HXL A;  1LE8 A;  1F9N A;  3CMA I;  3KLN A;  3TW6 A;  1U9O A;  4CCO A;  3ZXS A;  2ICW G;  3HHH A;  4GXO A;  5FJ8 J;  5J3L A;  3I9V 2;  1SEU A;  1DGW Y;  4RM3 A;  5CJ9 A;  4NQW A;  3RIR A;  1SVM A;  3FXJ A;  3CUQ C;  4A3F J;  3FMQ A;  1W7P D;  1P6R A;  2QSG X;  1U3E M;  1SAU A;  2DFI A;  5HDK A;  4M6Y A;  2LD5 A;  4IHT A;  1ZK8 A;  3CMM A;  3OYN A;  1WI3 A;  3HDD A;  1DU6 A;  3CLO A;  2Y9Y A;  2E35 A;  2L9N A;  3GTL J;  1YX3 A;  3PUB A;  3B73 A;  3RTR A;  2K9Q A;  3CP2 A;  3HOZ J;  4N9H A;  1E2X A;  2HS5 A;  3MZY A;  2EZL A;  2DJI A;  1IDZ A;  4HOB A;  4LJZ F;  4MGR A;  3PO2 J;  2MW8 A;  3N05 A;  4MO7 A;  2E36 A;  2DA6 A;  3DPL C;  4A69 C;  5HLH A;  1PDN C;  4DNC A;  5J1U A;  1DPU A;  4MTE A;  1T08 B;  4GYG A;  1FT9 A;  2LMD A;  2JA7 J;  1MNE A;  5E79 C;  2ZXJ A;  2HQA A;  4HW0 A;  2XPW A;  3BG7 A;  4XKB A;  3HRT A;  3I4P A;  5EJC A;  1QBJ A;  3RKQ A;  2ECB A;  3BP8 A;  3ECH A;  3QPH A;  4EM1 A;  4V2F A;  4Q5S F;  1MBF A;  5L3C A;  1N75 A;  4A3I J;  3FM3 A;  1OCZ H;  2UUZ A;  2VXZ A;  2X6W A;  2Z2S B;  4KJZ A;  1OYY A;  2A5W A;  2CQ7 A;  3P7N A;  3ZMU A;  5GTH C;  2JUG A;  1JE8 A;  2WB1 N;  5D8L B;  2W48 A;  2O9L A;  2R7V A;  4O6J A;  3TQN A;  5IY5 H;  1YW8 A;  3BCB A;  3GLL A;  2M0M A;  1AOY A;  1JKR C;  1FWZ A;  2RAE A;  4HV6 A;  2OU2 A;  3BTI A;  5EEG A;  4XID A;  5LD2 C;  3SFI A;  2ZME B;  3KP4 A;  4WXD A;  2R7U A;  2HPI A;  4KIB A;  1Z77 A;  2PMU A;  2UXN A;  1ETY A;  3CDH A;  1T6S A;  3J7A O;  2O7O A;  3K4C A;  2W24 A;  3GTG J;  1X19 A;  2ZC2 A;  1VQ4 I;  3S8P A;  1TC3 C;  4CGZ A;  3VYR B;  4IJA A;  2FXA A;  4H4K C;  1XMA A;  1S8N A;  3ZR8 X;  4FIS A;  5M5Y J;  2KIF A;  4ENK A;  3A02 A;  2FMY A;  4LLG F;  4WF2 A;  1T98 A;  3E1S A;  3OYM A;  4EJV A;  1LEA A;  1S29 A;  4XMY A;  2RRE A;  1VQK I;  1IW7 F;  2K3P A;  3DTE A;  5D6F A;  2X1E A;  5K1Y A;  4DGW B;  3ZPL A;  1REP C;  1G3W A;  5DM6 F;  3CJN A;  3MQ0 A;  2XRO A;  2LSO A;  4MFE A;  1TNS A;  2P81 A;  1U8R A;  2XKP A;  1GVD A;  2M7B A;  3DU5 A;  2CFX A;  3FX3 A;  4HNV A;  3CME I;  1VQM I;  4F92 B;  1RR8 C;  1FP2 A;  3F0C A;  4EGY A;  3ASO H;  5BQT A;  2ZXW H;  5C44 J;  3BJA A;  2B0L A;  4EM0 B;  1ZHF A;  4JQF A;  5DS9 A;  2ISY A;  3CO6 C;  1FPQ A;  3PFY A;  2Z3Y A;  5FFX A;  4W1U A;  2VE9 A;  4OIQ F;  1FLI A;  5CYV A;  1ONV A;  4FE4 A;  4WX9 A;  5LGU A;  4AIJ A;  2A6H F;  3ABL H;  1E3O C;  3S16 J;  1L0O C;  4HNT A;  4OMY A;  3K70 C;  3DKW A;  3Q9V A;  3HOT A;  3IAM 2;  2DXI A;  1BI1 A;  2DYS H;  2GXB A;  2NOJ B;  2R3S A;  4N4N B;  1WHU A;  1RC9 A;  3FXO A;  2AS5 F;  4A6D A;  2XAF A;  1BOB A;  4CZZ A;  3ZRG A;  3I59 B;  1HKS A;  4KMF A;  2VL8 A;  4A3G J;  3WU2 C;  4WWC A;  2WAQ A;  1B72 B;  3NEU A;  2WAF A;  3EUA A;  2KT0 A;  1FTT A;  3I5U A;  4LG0 A;  4A2U A;  4Q48 A;  4EJO A;  5JHU A;  1QQI A;  4XRF A;  4A3M J;  2XAQ A;  3ERE D;  2FE3 A;  4DYQ A;  4NDL A;  4OU0 A;  2K9S A;  4BGD A;  3H3U A;  2V9K A;  5CVJ A;  2BOL A;  1Y1V J;  5J40 A;  3ROU A;  4BYY A;  2PBI A;  2EV5 A;  1ZRC A;  1FX7 A;  1J0R A;  1XGS A;  1BJZ A;  4PUS A;  2HQN A;  3L00 A;  3TL4 X;  3ZMD A;  3JR9 A;  1HC8 A;  1J09 A;  3DP7 A;  3BQZ A;  2R7O A;  4BQA A;  3DKX A;  3VYS B;  1OCO H;  3D5R C;  3NQO A;  2CV0 A;  1BA5 A;  3RYP A;  3S2H J;  5IP6 A;  1B9M A;  3K7A J;  2HVS A;  4P5O A;  5L3B A;  4Q4Z F;  2K9N A;  3GUD A;  2PQ8 A;  5K5Q A;  2KJB A;  4RDU A;  2DQL A;  5B5E C;  4WCG A;  4YII A;  3TKY A;  2L9S A;  3Q9S A;  3C3W A;  2V6C A;  1XMK A;  4ETS A;  2CV1 A;  4A3C J;  3IV5 A;  1OKR A;  1ZKG A;  2O5R A;  5EDN A;  3IH2 A;  3OYH A;  3BPV A;  3NAU A;  3WG9 A;  3ERM A;  2IGN A;  1IAW A;  5F1R A;  1EA3 A;  3FXR A;  1D1B A;  1RET A;  2UV1 A;  2VI6 A;  5IPA A;  2DA7 A;  4XR6 A;  9ANT A;  3IC7 A;  4DOZ A;  1UEL B;  2FBI A;  1T0F C;  4FX0 A;  2W84 A;  3CUQ A;  4RAZ A;  1VQ7 I;  2LNB A;  1LJ9 A;  2CJJ A;  3M8E A;  2VT2 A;  3QYF A;  2OC6 A;  1TWC J;  2YS9 A;  4B4C A;  1TW2 A;  1TQM A;  4BEH A;  2VBW A;  4BHP A;  3BQY A;  3VOE A;  3HZJ A;  2L0K A;  3IHU A;  3K4B A;  5JHF A;  4UV8 A;  2ME0 A;  2Z33 A;  1MJA A;  2FOK A;  1YW9 A;  4BU2 A;  2R5Z B;  3N97 A;  3LFU A;  4KIS A;  3S93 A;  4OIO F;  1KYW A;  2W25 A;  4YEL A;  2DCE A;  3RYR A;  5DEQ A;  1S3J A;  3CCS I;  4PZJ A;  3F8C A;  1XMX A;  4RGU A;  1GDT A;  2YPR A;  5GAD J;  4BE1 A;  3OIP A;  3LA7 A;  3CQZ J;  1BC7 C;  2HXO A;  1G3Y A;  2H6C A;  1VFC A;  1N77 A;  3RPU A;  2RQP A;  1EH8 A;  3QP5 A;  3BG5 A;  4U87 A;  4CA0 A;  2COM A;  4QPQ A;  1BBY A;  4LG0 B;  4F7Z A;  3OV8 A;  4I99 C;  4C3I J;  1D1A A;  3C1D A;  2HZT A;  5LHI A;  1FYL A;  2RDP A;  2O8X A;  1AHD P;  4ZDO A;  3BDD A;  5L3D A;  2EFO A;  3UKG A;  2BY2 A;  4PFO A;  1G4D A;  4NUB A;  4MHG A;  5KK1 A;  5ICC A;  3JRD A;  1VI0 A;  1Y0U A;  2XV4 S;  2VQG A;  3CJQ B;  1H88 C;  1SAX A;  1XSX A;  3M9A A;  3F8N A;  3T1B A;  3WTT C;  4PJJ A;  4ASN A;  1S5L C;  2F5F A;  2LBF A;  5HS8 A;  1SAN A;  2O6G E;  3K9T A;  3Q5F A;  1UG2 A;  3CCJ I;  3LQQ A;  2JA2 A;  4G6Q A;  3DPU A;  4D0P A;  1D5Y A;  1W5C C;  1X3W B;  1XGN A;  3DTI A;  3HIF A;  2QKM B;  4HV5 A;  4JX4 A;  4MQ9 F;  4D7M A;  2D2W A;  2RC4 A;  4OOI A;  4BHB A;  5LFA A;  2PJR A;  2F5C A;  1VQO I;  2XGC A;  3H5N A;  3SEZ A;  1SFO J;  5FRO A;  4GCV A;  3HTU A;  3GFI A;  4M6V A;  2QBY A;  2ELH A;  3VWB A;  1H9T A;  2FQ4 A;  2KKO A;  4G7O F;  3RJP A;  4RB1 A;  2L7F P;  4F3Q A;  2P5K A;  2FEZ A;  3RPQ A;  2MG4 A;  1QA6 A;  1UJ8 A;  1MBE A;  1Y0N A;  1LVK A;  1R5H A;  3ABM H;  4C9Y A;  1JTY A;  4M9X A;  1G3T A;  2FA5 A;  3QYE A;  4I01 A;  1VF9 A;  1V3F A;  2O0Y A;  1HOM A;  3FKI J;  3FK7 A;  3F3X A;  4YFX F;  2JRM A;  3K1P A;  3GVA A;  2WY7 Q;  3W3C A;  2VQH A;  1ORK A;  3SDG A;  3GME A;  2MGQ A;  3DBR B;  2VE8 A;  1R58 A;  2DA5 A;  2DA2 A;  4XLA A;  5D5U B;  3HOV J;  2ZJP F;  3I4N J;  3L2U A;  2F5V A;  3M7G A;  3EPZ A;  5KHD A;  1U8B A;  1I1S A;  5E20 A;  2FF4 A;  4EQQ A;  3DWL E;  3E6D A;  4JOM A;  2X85 A;  2HOS A;  2I10 A;  4QWQ A;  3E6C C;  1JUP A;  1X58 A;  2JPB A;  2HKO A;  4RAY A;  1H89 C;  1JKP C;  2VBX A;  1A6Q A;  2ZKZ A;  4KIC A;  3IUO A;  3KEY A;  2EK5 A;  3NWT A;  3C7J A;  1H8A C;  1QVU A;  3LSJ A;  2DFF A;  5ILS A;  2RNJ A;  1I1G A;  2AQE A;  2KJC A;  3HSF A;  2NVU B;  3TO7 A;  2GQQ A;  2H09 A;  2KHM A;  4XK4 A;  2DT7 B;  3G1L A;  4V2G A;  2DK5 A;  2L9V A;  5A2Q K;  4MLO A;  4ZYG A;  2HXI A;  5JFR A;  2LBF B;  3ZQG A;  3FBI B;  1I3Q J;  2AXT C;  3HKZ A;  1HW5 A;  2HQ5 A;  4XSZ F;  4XN0 A;  5F0H A;  5E17 F;  1OYI A;  3E7L A;  4EGZ A;  3SZP A;  4NC8 A;  4A0Y A;  2EWN A;  2ZSI B;  4BE2 A;  1E17 A;  5IOZ A;  4YG2 F;  4KDP A;  1FSH A;  4UVC A;  2OJE D;  2F5D A;  2WC2 A;  2VOD A;  4BDY A;  2WAQ N;  5E1X A;  2QBY B;  3PIO F;  1S6L A;  3RCO A;  2YUS A;  3MAJ A;  2HTJ A;  2R7R A;  1YHQ I;  4A3J J;  3FIS A;  4C3J J;  2EFW A;  4LD5 A;  3W2V A;  3OSG A;  1OCR H;  1NG6 A;  2M7A A;  4G94 A;  1BI2 A;  3QU3 A;  2PG4 A;  3OYE A;  3MCZ A;  3K0L A;  4Y33 A;  2NOG A;  2UWM A;  3HEF A;  5M3M J;  3OYC A;  1PYV A;  2CQK A;  1HXD A;  4PJL A;  5F04 A;  3KYL A;  2F4O B;  5F6F A;  1F43 A;  4CXF A;  1W36 D;  1J5Y A;  2IEK A;  2HR3 A;  3N4M A;  1FZP B;  3CF5 F;  1X1P A;  2OV7 A;  4AM3 A;  3H9J A;  3F6V A;  2E1O A;  5DD8 A;  2M3A A;  2GOX B;  1S7A A;  3CJR B;  3S14 J;  2EIJ H;  4Y4R A;  4PJN A;  1IN8 A;  5DD4 A;  3JRH A;  2Y30 A;  2I8D A;  1MND A;  2L54 A;  4G7Z F;  3H5R A;  3BZC A;  4XKV A;  4CYC A;  1IUF A;  3ZMZ A;  2F48 A;  2K4B A;  5JVG F;  5JI6 A;  2R7Z J;  2ID3 A;  1TWG J;  3S2W A;  3IAS 2;  4G7H F;  2QQ8 A;  2XGE A;  2W85 A;  1OQY A;  4BUP A;  5ED4 A;  4RBO A;  1IN4 A;  3HRS A;  3OL3 A;  1H0M A;  3K69 A;  2G7H A;  3I58 A;  4CYD A;  1WCM J;  4XLC A;  4CCN A;  2M9H A;  3GCM A;  3OYB A;  5B1B H;  1BIA A;  1XC5 A;  2ZXH A;  1T38 A;  2HDW A;  4QTR A;  1MSE C;  5K5O A;  3LA2 A;  2CG4 A;  2NVX J;  1LFU P;  3ZQL A;  1HQC A;  2Y0M A;  1MGT A;  2MC3 A;  2K27 A;  1OLT A;  1VQ5 I;  2JWT A;  2XDV A;  1HKT A;  2IJL A;  3UR3 C;  2CQN A;  1U5T B;  2NS8 A;  1DP7 P;  3M4O J;  4GYI A;  3L09 A;  5EZG A;  5TIS C;  2XAS A;  3VYU B;  4E6K G;  3HOS A;  3WU0 A;  2IT0 A;  1U2W A;  2DOA A;  2CW8 A;  1SMY F;  3OIQ A;  2Z1D A;  4L5I A;  5KAF C;  1F4K A;  3MVP A;  2IS6 A;  2ZNY A;  2XB0 X;  3PQJ A;  3KP6 A;  1MBJ A;  4ZZL A;  3GZN B;  5CQE A;  4ZTJ A;  1AKH A;  4LK0 F;  4FX4 A;  4HX7 A;  3LFK A;  2DPD A;  1G3S A;  2E60 A;  2OTL I;  1IN6 A;  3TW7 A;  4E7Z A;  1X1A A;  2HKX A;  2QVO A;  1FBQ A;  3H9G A;  5C4X J;  3MWM A;  3FM5 A;  2A07 F;  2JVG A;  1CGP A;  1FOK A;  1Z3Y A;  5J8C A;  2Y69 H;  1BI0 A;  5DUI A;  2C6Y A;  2IA1 A;  2ZNZ A;  2DI3 A;  3EQL F;  1QGP A;  4RGS A;  1G59 A;  1IV6 A;  3K10 A;  2NNN A;  2FNA A;  2KDZ A;  3J7A Y;  4BXX J;  3G3Z A;  1P4W A;  4LFU A;  2AHQ A;  3P9K A;  3FDY A;  2XAJ A;  4N9I A;  3IRQ A;  1ETK A;  4FET A;  1BR4 A;  3A03 A;  1JKQ C;  3SYT A;  1MSF C;  3CCV I;  2DPU A;  5L3F A;  4D5F A;  1IGN A;  2OPT A;  1J59 A;  2MH9 A;  1STZ A;  3I4M J;  4UUS A;  5J4Y A;  5CVU A;  1WKM A;  2P5V A;  3REO A;  1FY7 A;  3TP0 A;  4C3H J;  3LNQ A;  1WH7 A;  3MZ8 A;  1VQ9 I;  5HOO A;  3HOU J;  5GAH J;  1VQN I;  3S1M J;  3JRB A;  4WXH A;  1ZH5 A;  4AVZ A;  1NTC A;  4LIU A;  1I50 J;  4BAC A;  2BGC A;  3R0A A;  1KU7 A;  2QLZ A;  1SMT A;  2K4J A;  4MEY F;  3FK6 A;  4XM3 A;  5TJJ A;  1SFE A;  1FMV A;  1SFK A;  4HF1 A;  4IZZ A;  2L4M A;  1W0T A;  2QSF X;  3VYT B;  1MKM A;  2NS0 A;  2VUM J;  2NYX A;  3D5S C;  2B63 J;  3IH4 A;  3DEW A;  1RIO H;  2KRF A;  3C2B A;  4CZC A;  2K3F A;  3HRU A;  2WY8 Q;  4ZDP A;  3ZMS A;  1TTY A;  2VON A;  2A3S A;  1R23 A;  2OUM A;  3LOC A;  4UUT A;  1YI2 I;  3LL7 A;  1QZY A;  4DBR A;  4PJ0 C;  3QRF F;  4GFB A;  1VQ6 I;  5LEJ A;  1WSU A;  1MMS A;  1S7O A;  1MMG A;  3BR2 A;  2LG4 A;  2DMT A;  5E3L A;  2A68 F;  3HOX J;  2H8R A;  1IRZ A;  1EH7 A;  1SD4 A;  2P8T A;  1AKH B;  4BNC A;  2LOO A;  4BKX A;  3E5Q A;  4ENM A;  1MDM B;  4G6T B;  2LTP A;  4YRV A;  2L9R A;  2KPM A;  1JTX A;  1R36 A;  1USS A;  3J80 K;  4HQE A;  2P6T A;  3BR0 A;  1A36 A;  3ECO A;  3P9C A;  3HSE A;  2XSD C;  1ETW A;  1YTY A;  3M07 A;  2BVM A;  3BLY A;  3WE3 A;  1Q1V A;  4OIR F;  3KYC B;  2J5P A;  2W57 A;  1YLF A;  5HDN A;  3DBL B;  1XX5 A;  1UFM A;  3ABU A;  1M1E B;  4A0X A;  4C2T A;  2L2O A;  3C2G A;  3S15 J;  3PJR A;  1JT0 A;  1RI7 A;  2QEX I;  3JRF A;  3PO3 J;  4HDU A;  5L3E A;  3CC4 I;  1YQA A;  3O8H A;  3HKZ N;  5GTI C;  2JK3 A;  1EH6 A;  2OA4 A;  3J80 Z;  1ETX A;  4XOP A;  1XGM A;  4UUS B;  3RZD J;  1G2H A;  3NWS A;  5CKT A;  3KZZ A;  3CLQ A;  3I59 A;  3BPX A;  3U2R A;  4CO8 A;  1DQU A;  2EFN A;  1B72 A;  2EIM H;  3TO9 A;  2K86 A;  1KZH A;  3F21 A;  2QCO A;  3I64 A;  3ZQF A;  1RPW A;  4UB8 C;  3DCF A;  2O03 A;  2OAZ A;  4YIR X;  5FRN A;  1X4P A;  5C4J J;  1IC8 A;  1XS9 A;  1B8I B;  3DEU A;  3OYI A;  1NG7 A;  4XLE A;  1LFP A;  1P2F A;  5F0C A;  4C2U A;  2HOA A;  3BG6 A;  1ZYR F;  2QWW A;  5ILU A;  2HVQ A;  1YS7 A;  2OQR A;  2EB7 A;  3A0B C;  4I98 B;  1YJ9 I;  4L5J A;  3MEX A;  3DFG A;  2L7Z A;  1TW3 A;  3M8J A;  4HSR A;  1IG7 A;  1ETO A;  3IKV A;  4M9Z A;  5CPR B;  4UNO A;  1N78 A;  4V19 K;  1P7J A;  1ZAO A;  3RPU D;  4XKW A;  4AIK A;  2UZK A;  1F5T A;  3I56 I;  2HOT A;  3FXQ A;  2X51 A;  1V5G A;  3WGG A;  2X6O A;  2CV2 A;  4L9J A;  2X48 A;  1J7K A;  1GXQ A;  3DPT A;  2MBF A;  2MLG A;  4RGR A;  1Y1W J;  5DUK A;  4LLL A;  3ML6 A;  4Y13 A;  1A04 A;  4HBL A;  4EAT A;  3LAP A;  5BMZ A;  4IQ4 A;  5GAE J;  4UY8 I;  1UMQ A;  3JRC A;  2HVR A;  2VC0 A;  3HG9 A;  3PFI A;  2CQQ A;  4P9F A;  5M5W J;  1R4M B;  2IXS A;  5DCM A;  4E7S A;  2L02 A;  2EIL H;  2ZB9 A;  3G4S I;  1N25 A;  1R7J A;  1R00 A;  2IA0 A;  3GO5 A;  4OAZ A;  3WHC A;  3CP8 A;  4ITV A;  1YYV A;  3S1N J;  1KYZ A;  3GEZ A;  1PJR A;  3EUH C;  3FMS A;  1UHS A;  3LWF A;  3VFZ A;  3B6A A;  2HZD A;  2E5Z A;  1ENH A;  3CO7 C;  2CO5 A;  1YX5 A;  4I2O A;  4A5N A;  3ZN0 A;  1K6Y A;  2KIU A;  2R5Z A;  3F72 A;  5ERI A;  2PJP A;  2CYY A;  4ON0 A;  5HNF A;  1ACI A;  5E3N A;  4ENJ A;  2YSR A;  5EGO A;  2MD0 A;  1LPQ A;  1FNN A;  1QHG A;  3K4N A;  1MJ9 A;  3OYK A;  3A1Y A;  3NRV A;  3LMM A;  1CF7 A;  1YOV B;  3SXY A;  2GXA A;  3H9Q A;  2M87 A;  5FKO A;  5HOD A;  4ESF A;  3E5X A;  2O61 A;  2GZW A;  1JGG A;  1U5T C;  3OYA A;  4H0E A;  3FHZ A;  2FML A;  1KQ8 A;  4RA2 A;  4OIP F;  2EZK A;  4LOC A;  2P4W A;  1LKX A;  2HYG D;  5DV5 A;  2P5L C;  1C0W A;  2DMU A;  3V8K A;  5EEA A;  3D1N I;  4M71 A;  5FLV A;  2X0L A;  4C30 A;  2IVM A;  1RNL A;  1V5E A;  3K4M A;  2KZG A;  1MH4 A;  4ZYE A;  3GFL A;  3GYH X;  4A0Z A;  2VJ4 A;  2GXG A;  2LF7 A;  1YO5 C;  3LSM A;  2IA2 A;  4XSX F;  3WTV C;  5FO5 A;  4BAY A;  3GBG A;  4HNU A;  1A6I A;  2YU9 J;  1IXC A;  2EIN H;  1D8J A;  2QGU A;  3OMY A;  2VAS A;  2XVC A;  3HHG A;  3I53 A;  4KUM A;  3HC7 A;  2FU4 A;  4LMY A;  3K70 D;  2ESH A;  4DQ2 A;  4BY1 J;  1B1B A;  3SHF A;  2H6B A;  5D8K B;  3SZT A;  2DFE A;  2V1U A;  1J75 A;  3ZQ7 A;  2KL4 A;  2VIX A;  4U88 A;  3HL2 A;  1BIB A;  3BOQ A;  3LA3 A;  2RV8 A;  2DAO A;  3M1E A;  4MFD A;  4P55 A;  5DCM B;  3CZ6 A;  4F93 B;  1IZ1 A;  4RM2 A;  3OS2 A;  2VJJ A;  3D0S A;  3H5A A;  1XCB A;  5KAI C;  3HOY J;  1SC7 A;  3B02 A;  4G12 A;  2VKD A;  2GIZ A;  2NVQ J;  3BZ6 A;  2KIQ A;  4F52 A;  5JLW A;  1WJB A;  1B59 A;  4LB5 A;  1MIJ A;  2OD5 A;  3MMY B;  1QO0 D;  2HNH A;  1IDY A;  4KIF A;  3CDI A;  3RKW A;  1QNT A;  1TT5 B;  4HPQ A;  5D6E A;  3F8F A;  3HBL A;  3KZY A;  3WOD F;  1XPX A;  4KN7 X;  2L5Q A;  4S04 A;  3QU6 A;  1YIO A;  4J01 A;  2EH3 A;  2QQB A;  2BVL A;  2ELJ A;  2QF7 A;  2Y2Z A;  5LRS A;  4KN4 X;  2ZSH B;  1I5Z A;  4IO9 F;  5BPI A;  4K2E A;  5EGO B;  4A3L J;  3LSI A;  1RUO A;  1YW7 A;  1ZG5 A;  2E34 A;  3SFZ A;  2R7W A;  2BW3 A;  2B9S A;  4IVN A;  1CF7 B;  1R1T A;  1ITY A;  2RN7 A;  2FJ1 A;  1Z6R A;  1IO2 A;  4E7K A;  2HDC A;  1WJF A;  2PI0 A;  1QVT A;  4AC0 A;  3A2K A; 
#chains in the Genus database with same CATH homology
 3ASO H;  3WG7 H;  5IY5 H;  2ZXW H;  3AG4 H;  1V54 H;  2DYR H;  2EIJ H;  3AG3 H;  2OCC H;  1OCO H;  1V55 H;  1OCR H;  3ASN H;  3AG1 H;  5B1B H;  5B1A H;  3X2Q H;  2EIN H;  3ABL H;  3AG2 H;  1OCZ H;  3ABK H;  2EIK H;  5B3S H;  2EIM H;  2DYS H;  2Y69 H;  2EIL H;  1OCC H;  3ABM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...