2OD4A

Crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096665735785) from uncultured marine organism at 1.70 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
GMFAGSIPMYIRVVSITAQSKLQFDMTVTYFENVWSPKVISLGAISAEFVQSNENSGMYIIHYPDKQTAISVFDKIKPEVDEVRTQNRIQITEGKRLFRVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (JCVI_PEP_1096665735785) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 1.70 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Unknown function
molecule keywords hypothetical protein
total genus 27
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2od4A01
4EFAC 2QIFA 1Q53A 2BJDA 5F0WA 2IYIA 3DXSX 1YG0A 3BGUA 4YEAA 3VTIA 4A47A 1K0VA 1V3ZA 2LQBA 4OJ3A 5B08A 1SI9A 1Q8LA 3K7RA 3KKFA 2VH7A 3WDOA 4U9RA 2AJ1A 2N4DA 3TOQA 2KT2A 1VQSA 2RMLA 1SB6A 2ROGA 2BYCA 3HFKA 5B09A 4YDXA 5B0GA 1TZ0A 4HI1A 5KAKA 2BJEA 3QGPA 1Q4RA 1OPZA 4NPOA 1W2IA 5K9FA 1N5TA 1YJRA 4OJHA 1FVSA 2OKQA 3BF4A 1TL5A 1X7VA 3I9ZA 3LGNA 3MCSA 2OP5A 3HHLD 2KKHA 3TNVA 4F67A 3F44A 2N4CA 2W4DA 2FIUA 2ASYA 4NL5A 1Y3KA 3UDCA 4A46A 1RJJA 1CC7A 4FNHA 1SQEA 2HLUA 3MZIA 1OSDA 2N7YA 2LXFA 4FNIA 1GXTA 5B0FA 1JWWA 2K7KA 2PGCA 2VV5A 1XBWA 1WD6A 1YJVA 2GO8A 2GFFA 2XMVA 2FHMA 2AJ0A 3KG0A 4Y2IA 3TRGA 3HX9A 5A6PA 3HDSA 2CRLA 1S6OA 1FEEA 3E8OA 1LQ9A 2HQIA 2XMWA 3DCAA 3GZ7A 1N5QA 3BM7A 1AW0A 4HH0A 2OFHX 5B0DA 1APSA 2W4PA 1MWZA 1FD8A 1OQ3A 2OMOA 2W4CA 1N5SA 2BUNA 3LGMA 1URRA 4DN9A 3HF5A 4QOTA 1GXUA 1VQYA 4Q2LA 3QMQA 2QLWA 2L3MA 1Y0HA 2XMUA 5B0BA 4HH1A 2RU9A 4Y2KA 4DPOA 2EW9A 1KQKA 2HIQA 2QLXA 2IYGA 4HI2A 1OQ6A 2K7JA 2OAUA 1ULRA 2ACYA 2AP6A 5B0CA 4DL0C 2KT3A 1R6YA 2XMTA 2FTRA 3KNGA 1S6UA 1AFIA 1Y9OA 2K1RA 2K1RB 2ZDPA 2ZDOA 1TL4A 4A48A 3FRYA 2XMMA 3FMBA 2ROPA 3BDEA 4HL9A 3FGVA 2LDIA 2GV1A 2PD1A 3BR8A 2OD4A 2ROEA 2OFGX 2RSQA 5B0EA 5B0AA 1Y3JA 2AW0A 2GCFA 4ZOSA 2HFOA 1AFJA 2G9OA 2K2PA 4Q2MA 1TR0A 1TUVA 2HFNA 2RILA 5IXUA 2OD6A 3HHLC 3KG1A 1YRXA 1U7LA 2IFXA 1P8GA 1IUJA 1YJTA 4Y2MA 2HLTA 4OJGA 5T7LB 5T7LA 3LO3A 3T9NA 4A4JA 1JK9B 1FVQA 2XMKA 3IWLA 1KVIA 5A6WA 5F0UA 4OIXA 1N5VA 1FE0A 2BBEA 2Q3PA 2XMJA 3CJKA 1QUPA 3CJKB 1FE4A 3BB5A 1X8DA 2GGPB 2GGPA 1YJUA 2QYCA 1X0PA 3HHLA 1MWYA 1Q8BA 2JDJA 3HHLB 1CPZA 1CC8A 4OJ1A 2KYZA 4ZA1A 1KVJA 1P6TA 2FB0A 3BN7A 1FESA 2GA7A 2LQ9A 3IWXA
chains in the Genus database with same CATH superfamily
2FJVA 3J80Y 5F8JA 2D3ZA 2NXUA 4RBTA 2BANA 3I96A 3D5MA 3N4WA 3R5JB 4OYBA 5B08A 1VQ8S 3C3LA 4GKKJ 1Q8LA 1UJ4A 2H5JB 2VH7A 3MM8B 3T6JA 1RGVA 2NXEA 1RU2A 4TU8A 4X4UA 2HZAA 5JJBA 4K4TA 3CD6S 2AGPA 2MLZA 5LXRA 1R3NA 1K47A 3B8HA 1E6YB 2F4FA 4USUA 2J6SA 2V9KA 1NH7A 1R0AA 1WTBA 2MB0B 4LFBJ 1J5OB 2EKNA 1Y5LB 2CQ0A 4QIGA 3TA2A 3AOAA 4HT5A 2M9KA 2PIIA 2WBRA 4EZ9A 3JTPA 2BKOA 1VFJA 2Z30B 3NGUA 5EDWA 3LAMA 1HYSA 3A8JA 4F0HA 3MFIA 1RWPB 1B7YB 2FZCB 5K8MA 1OPIA 1RAOA 3A3PB 3KLIB 3B6BA 1VHFA 5FD1A 4A46A 5D8HB 3VAKA 1V5IB 3GONA 4B3RF 2MYFA 3IRWP 4DFKA 2LQJA 4GC7A 3RW6A 4FDFA 1U6BA 2KRRA 1FX4A 1RWWB 2X7IA 4I0WA 3W3SA 2CPJA 3BJYA 2ZZTA 3T19A 3R5AA 3BKFA 3L95X 4UF4A 5DS7A 4BC9A 4YMEA 1CJKA 3LWLA 4DV7J 1VQ9S 3IR5B 4ELUA 1PGZA 3NL0A 2KB2A 2NZ4A 4CWBA 3DYAA 3L7UA 2MXYA 5E3RA 1FCAA 2XMWA 4C8MA 3TUJC 1BQNA 4USVA 3NMAA 1GH8A 3DNCA 4LVNP 4I6WA 5EHHA 3M2VB 4G65A 4KO0A 1NSQA 5M2UA 2I0XA 2WK4A 2UVWA 1NK4A 2JEGA 2E1PA 4UZBA 2NR0A 3ENVA 3KOAA 2BJ3A 2B51A 2EPIA 4F3QA 2GX8A 1M5KC 1MMNA 3KDNA 2ZKTA 4DN9A 2HBYB 3HF5A 2VQFF 3BGRA 2DY9A 4KPYA 3MEKA 3CMES 1SKUB 3MECA 3NEKA 2Y9HA 4RPFA 3FFIB 9ATCB 2M2BA 2YNFB 2ZH6A 4M5GA 3CCES 3W2VB 3CCLS 4BS2A 2HVIA 1ZAXA 1LWCB 2B4UA 4AE5A 1HARA 2IYGA 2ZHOA 4J9LA 3CC2S 3RB4A 2CNNB 3M8PB 2AKWB 3IWNC 3THTA 3IR6B 4WU2A 3F0NA 2X1AA 1WG4A 3RW7A 4ZIWA 1U26A 1UPPA 3AFGA 3PACA 2RAQA 3QNWB 3WQPA 2GQ2A 1O6XA 2ADCA 3MEEB 1MMDA 2MKCA 4IFYB 4PYAA 1NJWA 4EBEA 1FJGF 1M5PC 3ILJA 1SQFA 4AQYJ 4DSLA 1SC3B 2WONA 2ILYA 2LMIA 3B54A 1M5OC 1Y3JA 4B9MA 4BDPA 2HQFA 4NXNJ 2AT1B 3HCXA 2B5JA 3OTOF 4C8LA 2GQCA 2VG6B 3MPYA 2DHHA 1M5VC 4WP9A 3SQOP 5KT6A 3PR4A 3W8GA 4WFNQ 3AY0A 1H2VZ 4P52A 3OD2A 2QA1A 2ZBPA 3OT9A 5T7LA 4NLXA 3FSIA 4DR3F 2W9BA 3PW7A 2J9DE 3P5TL 4FPIA 2RVJA 4PCQA 5F0UA 4DPTA 1PO6A 4HKQA 3PTWA 3H42A 4LIRA 4RR5A 3M8RA 3ISZA 4C98A 4XO0A 1WEYA 1R27B 2XZTB 4GVBB 3VHQA 1SV5A 3QZ7A 1RE1B 4QYZK 4ES1A 2ZFHA 3DOMB 1WKJA 2B4VA 3MPDA 4PAAA 5KFCA 2WVDA 2XZDB 4ZA1A 4OZJA 2WW8A 3QGIA 2NZCA 2BACA 3FBEA 4B3SF 3BGLA 2V2ZA 2KXHA 3I0SB 3DXBA 3CF5Q 1VJQA 5ADZA 3D0GE 2KHCA 4LBIA 5G0RB 3FCVA 1EIYB 1UVNA 3G9CA 1XNRJ 4DSFA 2WVEA 4ETXA 2XQCA 3UN2A 1MMLA 3MM8A 3D6FB 3UN3A 5FDLA 4L3NA 4EEYA 2DR9A 5IT9U 1DFDA 5KG0A 2CQHA 3HZEA 4IDKA 4DR4F 4TQSA 4M63A 1SJ1A 3CD7A 3FBFA 2ATCB 2W2OP 5F3TA 1R0AB 3QJPA 1N8RT 1CJVB 5I3PA 2X3GA 4DPWA 4DUYJ 1WDTA 1K9MT 4NEYA 2WOMA 3QIPB 3MCSA 2WSEC 5A0YB 5KFOA 2AGOA 1WG5A 2W9AA 3QT7A 1DAXA 3MEDB 3W5ZA 1TK8A 3KLGB 4C97A 2W2PP 2FHJD 3BEGB 3KLIA 1WF2A 3MD1A 4QIWD 2VJVA 1RZMA 2JEIA 3D1HA 1PJ5A 3O5TB 4WFYA 3UNYA 3MZIA 3FBBA 3BSOA 2JZ5A 3I4HX 1NB7A 1JLFA 4LFAF 1VQNS 2DGSA 1NHVA 5J2PB 3NRBA 4QWDA 1WD6A 4NMXA 2A18A 4F0KA 4WK3A 4C0OC 4ECZA 2AJ0A 2CPFA 4M5DA 4U8VA 3WBZA 3ZC4A 1RABB 1X5PA 3K8VA 1RHQB 2BJ8A 2J0SD 2RQMA 3A1YG 3WIVA 3DYAB 2DGQA 2HGMA 1Z2ZA 3H2LA 4NLPA 1WOSA 3CCUS 2BA9A 3PEJA 4USJC 1T11A 2ZD1A 1OQ3A 1CQMA 4CO1A 2W9CB 3OXLA 2CQPA 2MLXA 3J81Y 5J1EB 1BQMA 1BXNA 4K2JA 4C3LA 3DOLA 1QSYA 3T1HJ 3H2UB 2A6MA 1U0SA 4KBIA 3KHRA 1RYRA 2E5LJ 2HMIA 3PO4A 3RBXA 1VQYA 2LA4A 1S1UB 3QT6A 3NOCA 4GKJF 3MOJB 4PWWA 2YNFA 1SBRA 1QAIA 3QATA 1LWCA 1I94J 3DN9A 4C8KA 4CLWA 2ALZA 2AYMA 2K7JA 5B0CA 3C6TB 3C6UB 2JWNA 3HD2A 3KNAA 3B82A 3PM9A 2F8EX 3IAS9 1S1WA 1ZM4A 4EO8A 2HWHA 4OYXA 3CCVS 4A8XA 1U1LA 1IR2A 2VDHA 3AH6A 1NKEA 2ZDOA 4JI4F 1Q8KA 2G1HA 4OI3A 4N8OA 4MTPA 4K50A 2HHUA 1N34J 3M8WA 3DU6A 4Z2XA 3A3NB 5HP1B 3FGVA 1B99A 4DR5F 1VQLS 4C7QA 4B02A 1TQLA 4AL7A 2KM8C 1SKSA 1IKWA 4FYDA 3ELHA 2E9ZA 4X66J 2GCFA 4UOFA 2EFPA 2R2SA 5HJYA 4PWDB 3SXLA 4O3QA 4DCPB 3RRGA 4ZVPB 5DQHA 5K20B 2MQOA 4CQ1A 2VQEJ 1H7WA 3RZAA 4F4ZA 2HPUA 4URGA 2XO7A 1KFDA 1RQ0A 5ETTA 3U02A 4B08A 4HTIA 4WTOB 3KHHA 3LO3A 2UV8A 3HSZA 1S7IA 2HW3A 2F5GA 3J7ZT 4NCGA 1VRTA 3DFEA 2VUGA 4ZPTR 5KFGA 1VC6A 4IFVA 3RRHA 4CNZA 4JI8J 3KDOA 5EUHA 4YY3J 3TYTA 4DR4J 4IOAQ 1AT1B 5GADU 1N0UA 2XYGB 2UVUA 1U1RA 3OR1B 1PBUA 3G86A 3ISNC 5A8RB 3PX4A 3HHDA 3OL6A 4JV5F 4LR9A 4OJ1A 2KYZA 2KRBA 1JNZB 2AYEA 4YB7A 5KFLA 2H65B 4DLEA 2Y0SD 1WKKA 1U45A 2Z56B 3M6WA 4IO9Q 4AXIA 4MYUA 3I0SA 2BJDA 3HPOA 3MOZA 4YEAA 3V6HA 4QJVA 1F3FA 1FTRA 4I2QB 4LRFA 2RQCA 2JHEA 4FZVA 3VAIA 1JJCB 3JYTB 3AODA 2J76E 2EC2A 1SJQA 2IVYA 1HPZB 3H5UA 3EE3A 3M8QA 2AEFA 4ECWA 4ED2A 2MEWA 1UVLA 1S57A 1S97A 1K73T 5HO4A 3R5CA 3BV8A 1L3SA 2HFUA 4YDDB 2YKNA 3OUYB 3RRKA 3D7SB 4N8NA 4C9DA 4TKTA 1PYSB 1RT6B 2UUWA 4IG3B 1UW4A 4OI6A 3W2WA 4LSNB 4HHJA 2VICA 1UWBB 1YBTA 3VWSA 1X7VA 2CZ9A 3Q23A 2LLZA 1I6JA 2KKHA 2HHVA 5AXLA 1JLGA 2IM1A 1S1TA 3KLGA 4XAKA 2YH1A 1A6LA 2M4MA 4NCAA 2OEMA 2HQ3A 3EX7B 1U6ZA 2APOA 2IM2A 4CIOA 1HR0F 1GXTA 3PX0A 2VV5A 2RT3A 3MTJA 1V3RA 4ANDA 1YJVA 2BMBA 4D3GA 1U1PA 1XNQF 4RZRA 4M5DB 2NS1B 3UI3A 1IBCB 3CDAA 1NLKL 2ATLA 1GT8A 3SIPB 5D4OA 4B3OB 2CZVC 2IDEA 3OFGA 4M94A 2HNDB 2EVZA 3BPDA 1DRZA 3FVYA 4JI5F 4H4KA 1BWVA 4LRAA 4IH5A 3H59A 3BSAA 1MWZA 2ZD1B 4Y65A 3G4SS 1KLNA 4PQUA 5J1EA 3I31A 3H4BA 1NDLA 3GG0A 4XIUA 2IRUA 3BH6B 4MKAA 2RJZA 2Z2LA 2HMIB 2DIUA 4OX9F 3OL9A 5CCLA 5F8NA 2OMLA 1XMOJ 3KUHA 2GMHA 5EWFA 1HNXF 2VZ9A 4CLLA 4CYUB 3QBCA 2XMUA 4YS2A 1F3VA 2XI2A 2YXLA 1NXIA 1TKTA 2JFKA 2YKOA 3CIZA 4TY9A 2ZNYA 2JVRA 3ZTPA 2ALYB 3DLBA 5CH7B 1ULRA 3DRSA 1MU2A 2QG9B 5IOLA 3GLJA 1FDAA 2DGUA 4DXLA 3M32A 4DG1B 2YQ3A 2ZOFA 4XPCA 3Q24A 3FJ2A 3FMBA 1KDNA 2F40A 3MWBA 3V4MA 2CQ2A 4UTGA 2P5VA 4HL9A 4P74A 3A3OB 4RWXA 3LALA 3PYGA 3U7JA 1JNRB 3UDLA 3R7BB 1FRHA 1K1QA 1S99A 3HHKA 3THPA 4KH1B 4MYTA 2E1MC 3GJSB 4MK8A 2V69A 1TR0A 3AB4B 2E1CA 5F9LA 4NCBA 4L73A 4NA3A 2ZH7A 1WHWA 4DX7A 2KFYA 2D9PA 4LREA 4Y2MA 1D09B 2W7OA 1TL7A 2PI4A 3GFYA 3IG1B 5IM0A 2H4YB 5KT5A 3V6DB 3EGZA 3ZZZA 1JLEB 3JAMY 2ZBCA 3O2IA 4IH7A 2LFVA 3TVKA 5DETA 4LF7J 2PT0A 5J2NA 4IFVB 4OMFG 3JB9k 1X4FA 4KHPJ 2DHGA 4KGXB 1TV6A 5C24A 2A0FB 5IWAF 2RQKA 2MKSA 3OR1A 4H4MB 4QW9A 1CPZA 4C8ZA 4RKUC 1M1GA 2OEKA 3R9LA 2MQPA 1H72C 5A2QU 1S76D 1KBRA 4OHZA 5CYQB 2VQEF 3TZWA 2QIFA 4OYZA 2D7SA 3VTIA 4DFMA 3OHAA 4DV3F 4IG0A 2E5JA 2LQBA 5A2QY 3G87A 2XY5A 1XR7A 3ICLA 3IS9B 4LSLB 3NNHA 1SQGA 1XERA 3WDOA 3TVZA 3M9OB 3JYTA 1XN9A 2MSTA 4DR5J 3HFVA 2RNEA 2HHSA 2R7XA 2XGQA 1YVFA 2HNZA 3ADAC 1H0HB 4QU7A 2K3IA 3AD9C 3MURP 1NCLA 5GMEA 2UXDF 2IIHA 3AXMA 4DQRA 4U7UD 3M2RB 1T9YA 3QPIA 4CO0A 4IH6A 1N5TA 4B3TF 1PJ7A 1VLYA 2MY7A 3AXKA 1LFWA 1X4AA 4I1TA 4I4BA 4R25A 2W01A 3F44A 4FPRA 1I94F 4U7CA 4LF9F 2XWXA 4JYAF 1KFSA 2BVZA 3HJVA 2V2QA 4ZVFA 4CRJA 4P7TA 3T1AA 1JB0C 1RJJA 5A8WB 1X4HA 4FNHA 2FVPA 1RTZA 2LKZA 1RU1A 4DDFA 4EK2A 2DRAA 1VCTA 2D1CA 2BE2A 2I5JA 2LA6A 4WFZA 1LXJA 4WE1B 3MMBB 1UA0A 2BOPA 5HROB 2VF3A 2YKMB 4W92B 2Y0BB 3VV2B 1IN0A 4L74A 3SCJE 4YUDA 2IAJB 5DDPC 3OHBA 1QE1B 1S9GA 2M5YA 5I3QA 4P9SA 4B3MF 1IBMF 2HVZA 3NWGA 3NGSA 4KGMA 1RAFB 4NZ0A 3GYXB 2NUHA 3CCQS 2BW7A 1N5QA 3BM7A 3MPWA 4ZCLA 1FWPA 4HH0A 3W9JA 5KFDA 2VPWB 2VBYA 3M2VA 1U0HB 1FD8A 4KO0B 1RAEB 3TJ9A 2HEKA 4ILRA 5GADI 1HNWJ 2PFDA 2GW8A 5J1NA 3KMSA 3LW5C 1GK8A 3D6HB 3D3BJ 1U1KA 1C4AA 3VAJA 1ZZFA 2CNKB 2IC3A 4CCHA 2MQ8A 1RT2B 4OYWA 2DXEA 4TNOA 1FXDA 4ZJOA 3MUTP 2U2FA 3UR0A 2OPPA 1JLBB 1FK9A 3P96A 4ZVRB 2AZ1A 3DLJA 3VGVA 3ISND 2BX6A 1S6QB 2HNYA 3CDEA 3VZIA 3TO8A 4Y2KA 4WP3A 1U25A 2ZUAA 1EKRA 3DRSB 3GIMA 2CJKA 3ZXWA 1RBOB 4ECQA 1G7CB 4Q45A 4FYYB 2OGUA 2UUCF 3MXHP 2OPQA 3TQ1A 5I3UA 1SJ3P 3HT0A 1KNZA 2HQCA 4B9NA 3GR1A 5JXSA 1Q5YA 4DR7J 3DRRA 2MKIA 1HR0J 4D3HA 3GTYX 4IFYA 4NX9A 3PFEA 2MHEA 1OMSA 3D28A 1KTVA 1RTIB 1F9EB 3M9MB 4DQQA 1I5OB 3CE8A 4K4XA 4ED6A 1T03A 5FJ4A 2F1FA 4RW9A 5KFVA 1CSJA 1AXQA 1YKWA 3BO2A 3P4UB 3MMAA 1LWFB 4Q2MA 2V34A 1LW0A 1TUVA 1I51B 2VG6A 3A8KA 4X84A 3JSRA 3GE9A 3V2UC 2DPJA 1WC5A 2YWEA 1BC6A 4N41A 1JXEA 1N0VC 3MM5A 4ZP9A 5ETMA 2B9EA 1VRUA 1D8ZA 4Y6IA 4AL5A 2PE8A 2XMKA 2O67A 4ICLB 1VMBA 1HQ2A 2DD8S 3Q8UA 2QGFB 1BMQB 4K8RA 1RT3A 5BXIA 5DG8A 4F50A 2UUAJ 4UY8T 3P49B 1OYDA 2E44A 1FXRA 1P9YA 2XMJA 2YWHA 1CJUA 3IGNA 1TV6B 5HI7A 1SV5B 1F60B 2RRNA 1F9HA 4HDHA 4WFXA 5KFEA 4DLGA 1U49A 1FD2A 1NUEA 2KT5A 1Q8BA 2L08A 5T14A 1RTDB 2DXDA 3ENAA 4I2PA 2RU3A 3VGTA 2MSSA 3IBFB 4CM2A 4I6AA 1YSJA 5DM7Q 4E0DA 4M95A 4H4OB 2EK6A 2PMZD 1EETB 1M90T 2PI5A 5G0RA 4H54A 2LXUA 4IG0B 3QYYA 1V3ZA 4RBUA 4OJ3A 3W1YC 5SZTA 2MPUA 1N33J 3MHYA 2KXFA 5KT3A 1Q81T 4U9RA 1K1SA 4DZ6A 4DUZJ 3BS9A 2B8PA 3AD8C 1YTYA 4TN2A 4L72B 1SB6A 2DGVA 4ZPAA 5BR8F 2DYAA 4NLUA 2VOPA 3AJ2A 4ID5B 3VVTA 5M2PA 1F1BB 1Q4RA 4M1KA 4I7FB 2N3LA 3ENWA 1H38A 3TEGA 1TL5A 4F67A 1WEZA 2OP5A 3EXYA 4X66F 3LWMA 2R7WA 1T94A 3UN5A 5H1SV 2FIUA 1H98A 3DLGB 3FBCA 4UQGA 3GIJA 4LF8J 3TA1A 1W26A 2PA3A 2M7SA 2N7YA 2EFVA 2V0NA 2I5JB 1N34F 1JLQA 4FVCA 2F9JA 2LP4A 4WTYA 2GO8A 2F3JA 2H48B 2FHMA 2X1FA 1FRKA 4X64J 4G3IA 2KJVA 3D54A 3S8SA 5A6PA 4NZ7A 1LXNA 3CTRA 1FEEA 1LNQA 5DG7A 2VBZA 3O3LA 5KG7A 4DQIA 1PG5B 3HVTB 4CO3A 2JOQA 2KXNB 2MTLA 4WK1A 4DSKA 2WVCA 4NRUA 4DV7F 4PYDA 1X5SA 4LF1A 4QWBA 3SSQA 1J5EJ 3NS6A 3LF0A 2DGWA 2DR8A 3SEOA 3H25A 5LM7E 2HBZB 3TVYA 5ETVA 4YHHF 2OHDA 1ZTWA 1RT2A 1JXVA 1HNIB 3QIDA 5CQGA 3JTOA 4Q2LA 2FY1A 1VIOA 2H4WB 3CJTA 1JX4A 4W98A 2XM3A 3MCMA 2KI2A 2OPRA 4HH1A 4ZVUB 4A8YA 4LR7A 5LXYA 1KQKA 4CO4A 5AXMA 2UXBJ 5DJBA 3C6TA 4U8YA 4DL0C 1RCOB 2OEJA 5IV4A 1C1CB 3M30A 1S1WB 2DT9A 3X3UA 2C42A 1WHVA 3O6QA 1QY7A 3IXQA 4G1QB 3Q8SB 1Q5VA 5CD4H 1H7XA 5K14B 4CLTA 1BUXA 1FF2A 4JI1F 3LH2S 1TFWA 4WFBQ 2IJNA 2YPZA 2GV1A 3Q2TC 3G8TA 2LEPA 5CZXA 2E5HA 2OD4A 5GMKa 2J9EA 2LVWA 3BBFA 3KWMA 2HAIA 4OQJA 4RW9B 5KFKA 1T05B 1VQ4S 1RAJA 1HD1A 1MROB 3US5A 1N5YA 4G1IA 1HBUB 2CIMA 2ZJRQ 2ZC4A 5IXUA 2IPOB 1OY6A 4KSEB 4DUYF 3PW5A 3OFFA 5HMYA 2V4RA 2FVSA 3KG1A 3HK2A 1VLOA 1DZ5A 5HMXA 5KFFA 1YJTA 1AYEA 4A4JA 2FGOA 1DTQB 3MUMP 1NHUA 4Q5VA 2QFIA 4J5OA 3OLBA 1RT7A 5A6WA 5CCMA 2JSXA 2O66A 1HNZF 2HRTA 3UNGC 1Q82T 1HNWF 1RHKB 3EZUA 1K44A 4QIVA 4N7TA 5H9FK 1LWEB 1IM4A 3MAHA 5JVHQ 4NLTA 3EUNA 4CLPA 1ZYQA 1X8DA 1VDHA 1XK8A 4IRCA 1N54B 1RK8A 2OELA 5CYMB 4OZ2A 4WYWA 2E29A 2GNKA 5E2QA 3J7YI 4JI0J 1EJ7L 3BPSP 4KIAA 4ZN3A 3NG8A 3TANA 3CW2C 4B3MJ 2A10A 4G6VB 2ZVSA 2AWZA 2A2DA 4H4OA 4O4GB 1GTEA 2CJXB 4RW6B 3PIPQ 4P7VA 1UEUA 1YX2A 4LRBA 1VJWA 2HIYA 1R8CA 5KFPA 1DLOA 1RACB 2CPIA 3N6MA 3KLHA 4C4WA 2C28A 3UFCX 4UQTA 2OUGA 2PEBA 3PW0A 4CM0A 5RUBA 1SKRA 4F36A 3BN4A 3EDRB 4NYZA 4ATNA 3CC4S 4FBUA 1URNA 4F3MA 8AT1B 4DR1F 2MLYA 1VBKA 2ZH5A 1TKXB 2YX7A 3M8QB 4ZCKA 2E7WA 4EWTA 1HBNA 4Y3CA 4RUBA 1YITS 2QEXS 1FTCA 1WHXA 4LF8F 3UD3P 4ANCA 4F4YA 3V4IB 1DHMA 1SH3A 4J9OA 2ZE2B 4LF9J 1NAQA 4RL1A 2B0GA 4Z7YA 2IVFB 1HYSB 1ZAWA 1S12A 4JI2F 5DDOC 3VGSA 4JI6F 2CWKA 3DLGA 2DRDA 5DGBA 4AQYF 1D8YA 1DARA 1TTHB 2W7PA 3UDCA 1NB2A 3Q8YA 2UXDJ 2V50A 3NAHA 3DDIA 2E5GA 4DBQA 3K89A 4A8SA 3SYZA 4X65J 1RTHA 2BJ1A 4CLYA 2W2QP 2AD9A 3V81A 3AAWB 4X2BA 3FMWA 2DH7A 1RA6A 4FYWB 1S0OA 1RDRA 3GSDA 4KYZA 4OZ3A 2UVRA 5FLXY 3GG1A 1X4GA 2C1EB 3M8ZA 4CTAA 1SUQB 4UOGA 3K5LA 3PG9A 1WEXA 3ONQA 3AA8A 4DU8A 5F9NA 1IBKF 3C15A 4KB7A 1R7IA 5FLXU 4ZPWR 1TAUA 1XC9A 4IKAA 1LW2B 1FHTA 1HWKA 1UL3A 2VQFJ 4HYKA 2ZH1A 1RWMB 2VFSA 4UOCA 1IJEB 4NASA 3HHEA 4O44B 5L9NA 5LSLA 1KHVA 1S1VA 1FNXH 4X4PA 4ZVGA 5HSPA 1GXUA 4KHPF 2H1YA 1X9WA 3H7HB 1CULA 2GAHC 4NA1A 4PPZA 2QL5B 3C14B 4TYAA 1V3SA 2WZ1A 2NYHA 3FFIA 4HACB 5E3PA 4ZVSB 5B0BA 3EDQB 4USMA 2WCXA 2K8GA 3HD1A 3CD5A 2AF6A 3TAMA 4PEOA 4KAIA 1U02A 3KHGA 2IHR1 1S1XB 4OV1A 4PABA 5DRKA 4R5PA 1GMUA 4K0KF 1QTMA 2MZRA 4H4KC 1FEHA 3LA0A 1WUUA 2V6AA 3J7Z5 4J9MA 2FPHX 1EARA 5K14A 2XO6A 4B3RJ 3KUGA 1Y11A 1RP5A 2ZBRA 3ZTRA 3T1YF 4YHHJ 1AUSL 3OJUA 2PEHA 1RHUB 1RAHB 3DM2B 1IKXA 3FNNA 2OFGX 3W64A 1EHWA 4M8LA 2DEJA 2HBRB 2JC1A 2V4QA 3EPGA 4QCLA 3SFUA 4KFBB 3GCXP 1MROA 2B5JB 2LQ5A 2K2PA 6FDRA 4DL6A 3C2PA 2HHTA 1NZAA 2C3PA 3E2EA 2HSEB 5EWEA 3QZ8A 1NM2A 3TJAA 2HVDA 4YQWA 1CJTB 2IA6A 3C46A 2BRLA 2E9RX 1O51A 3NGRA 3IG1A 2CDRB 2W9BB 3UCZP 1JLEA 2FGCA 1RT7B 4DCOB 2DEIA 1Q95G 1AZSB 3VCDA 1N5VA 3CB4A 4A8OA 1GMWD 3MR3A 3V4IA 3D4JA 3E01A 4ZP8A 2D3UA 3AD7C 5SUHA 3OVSA 4R0JA 4JI1J 2E7VA 1XNRF 2NQPA 4DQSA 4YOEA 2NXJA 4FF2A 3RR8A 3OTEA 3IP0A 1VGYA 1EQMA 1KQGB 1RT4B 4B3SJ 4IYQA 4JUZA 3MR7A 1R8HA 4YN3B 2QLJB 1V9OA 3FCWA 3M6UA 3R3TA 1TK5A 1T9XA 2C22A 2ZWOA 3JQKA 3E3XA 3UCUP 4JI5J 2QJ3A 5HL7Q 2ZM6J 3IA0A 3KLEA 3KLHB 1K0VA 4P2FA 4Y2AA 3GV5B 2A6OA 1U1QA 5KFIA 1HA1A 4Q8FA 2IDLA 3KKFA 5A8KA 4WF9Q 2AHOB 4O0IA 1HNXJ 4HT7A 2FJDB 1Z1ZA 2RUSA 5DLGA 4PPDA 2MGZA 4M5IA 2H5EA 5DZ6A 1HBNB 3SV4A 3M6VA 1SL1A 4IR1A 3JSMA 1L3VA 4NLRA 3ZO7A 2G13A 4IOBA 5ETRA 3AOBA 3PXGa 1YJRA 2WOMB 4WPAA 3HHNB 4NLSA 3MEGB 4JI7J 3W8PA 3I6PA 2DGTA 3I0RA 3SBMA 4DF8A 4X4QA 2VFVA 3RBZA 1X4DA 1U6FA 1Q1KA 3W5XA 2GHVC 1L3UA 2RDJA 1JLFB 2I8EA 2RUGA 4OZNA 8RUCA 3FKBA 4CI0B 3CUNA 2YKMA 2HVHA 2VFTA 2HFZA 2VG7A 4NYPA 3N01A 2IAJA 1IR0A 2HHHJ 1AROP 1S9GB 2VG5A 3HX9A 3SSSA 4LRCA 3PV8A 2KG0A 4C8NA 4CTAB 3CJQA 3DCAA 3MPUB 4K4SA 2BRKA 1F5AA 1XQIA 1KLMB 2ZWPA 4EMDA 1D3WA 2ZH8A 4JI8F 3PR5B 1IVZA 3ETOA 2RKIB 3MCNA 2OSQA 1LW2A 4QR1A 2FYXA 5JVGQ 2CDQA 1WOOA 3WC0A 1CBKA 3CJ5A 2VODA 4Q0BB 3G6ES 1S10A 2IC3B 2ZZNA 1JKHA 2HQGA 3BBCA 4MKYA 4NMLA 3DRXA 1S5ZA 1CULB 2L9DA 2R3VA 4I69A 4U95A 3ZZPA 4HDGA 2AU0A 2BDPA 4HACA 1CEZA 1HD0A 4TY8A 3EMTA 5E3CA 1VQ5S 3TAMB 1H6KX 5E3AA 4ELVA 1DBDA 2ACYA 3T41A 2B8QA 3LOUA 2C2OB 3DOKB 2Y1LB 4R5PB 2AX0A 3QWUA 1HWIA 3MUVP 2K1RB 5BYQA 1RLDA 3TX0A 2ZJPQ 2MHNA 3PIOQ 1F0XA 1UTAA 4ETZA 3QGGA 1KP6A 1LOUA 5BR8J 1MSWD 3PY8A 4K7QA 2BZ2A 4J90A 3CD0A 4MIWA 1KOHA 3DM2A 4RUCA 4ED8A 1LEOA 2NREA 1BY9A 3U27A 2I9SA 4LSZB 4JI7F 2R8IA 3MMAB 1L5UA 1Y00A 2XULA 4ZVEA 3W61A 2VPZB 1SC4B 2CQGA 4DV0F 3BBBA 5HATA 2QZ8A 1CJTA 4DL5A 1HKAA 1IUJA 1P8GA 2CKWA 1VRUB 3CDBA 3FDSA 5DG9A 3T5JA 4PXBA 4YP3A 1FRLA 3CO9A 1TKZA 1AZSA 2Z4PA 4EBCA 3P45B 3DLLQ 3HVWA 3M1VA 3E01B 3N28A 3TUIC 2YQ0A 1CJUB 5KG4A 1OS5A 1RLCL 1GMVA 2G0IA 3FEZA 1IKVB 2AZ3A 4J37A 5ETKA 2GVZA 4RBVA 2ZNZA 2L41A 2XS2A 4DFJA 3TX8A 1RTDA 2UUCJ 1RT4A 5IFMA 3QO9A 3DHXA 2M52A 4CO5A 4I2PB 4ZHRB 1X0FA 2POKA 2V5HG 2YWKA 1W2BR 1LV5A 2FLLA 2IMOA 3D6MB 2G2ZA 5D3GA 2P2CB 2GIQA 2MKYA 3HVAA 3ULHA 4OX6A 5GAHU 2YX1A 1YG0A 2FQQB 1U2CA 2BANB 2KN4A 4FS1A 3GIRA 1WNEA 4DV2F 2MKKA 4YB6A 1SPBP 3I32A 5D15A 3VVUA 1PJ6A 1SXLA 4AYBD 3GIIA 1HFEL 3PFOA 2N4DA 1RYSA 1VQSA 1RT1A 2RMLA 3CJ4A 3ZTOA 1D9AA 1C2PA 1E6YA 3F41A 5E3QA 2EG1A 5B09A 3GSIA 1TMJA 1S0VA 3OUYA 3MPVA 1EAYC 3M2UB 1OPZA 3DKDA 3L9ZA 3PJ9A 4O3SA 1T02A 3SZ2A 1FVSA 2D41A 3CWJA 3LGNA 4F2RA 4BC7A 2DPIA 5C42B 1U8SA 5K8NA 3PO5A 5DO2A 1JLGB 3KG4A 5K5MA 1WSRA 2Z2ZA 4OZ1A 1DQ9A 4LQ9A 3X1LB 4F7VA 3DLKB 3H20A 1B4SA 3M7VA 1RISA 4XDDA 1WACA 2CADA 5D77A 4ZN1A 3G8SA 4NLVA 2IJFA 1WC1A 2BW2A 4ENOA 2J6UA 2UUBJ 3ILLA 1REGX 2CJAA 4TLRA 2VG7B 1B64A 2ADBA 1OYEA 1HMVB 1HNVA 2DGXA 3Q2SC 4ANEA 2V9WA 1X60A 5LMUF 1YZ6A 2Y3YA 2CG8A 2V2VA 3EXCX 3FEYB 2XCAA 4B3OA 2UXBF 4N77A 4WIQA 4C8OA 4N56A 2KVIA 2HNDA 2C3YA 5HAOA 4WFAQ 1RWOB 1WC3A 1BQNB 2MJUA 2YKAA 4NOHA 1U1MA 1AW0A 2XEXA 3J7YU 1KLMA 4K4UA 2OI2A 2CQDA 3I9V9 1S0NA 2YWWA 3QAEA 5T41A 2D3O1 1KR4A 2FY8A 2WB4A 5M2RA 5KFRA 3TQEA 4PG6A 1PAUB 5IV3A 1WF1A 5E0OA 4F0MA 3QRQA 3W65A 1FFGB 2R2TA 1MN9A 3SCIE 1VK8A 4MIBA 2KM8B 2DXFA 4AFFA 4BHQA 2QMWA 5GAEU 5D4NA 3GFZA 4GVLA 1YGYA 2U1AA 3GJTB 1NRKA 3ILIA 4TY8B 3LP2A 5HBMA 2YVSA 1U8WA 5L1IA 1DURA 4RO0A 1IBKJ 2Q79A 2DITA 3EPIA 2W24A 2CPEA 2ZDPA 1J27A 5F8MA 3M32B 4LVOP 4DG1A 4Z37A 4OI4A 5F8LA 4UY85 2XB2D 2R7VA 4RX6A 4IRDA 1ZETA 2Y8WA 2PMHA 4M5LA 1DQAA 2HWIA 4P10A 3W9HA 3PW4A 2DBBA 4JI6J 1VQOS 4CP5A 4X65F 3JTNA 4N76A 3BR8A 1B3TA 5JUMA 2VFUA 5LOQA 3KJNB 5AJ3J 3UWTA 1DQ8A 2NUUG 3UPFA 1N5YB 3H4DA 1NKBA 5J2MA 1RWNB 3SFGA 2XSJA 4ZPDA 2IRYA 2RS8A 3HHLC 1RKJA 2LXIA 1JLAA 1ZH5A 2IFXA 1R8BA 1X4BA 3R5DA 3W66A 3HM9A 2OPSB 2FVQA 3TW0A 5D0GA 5H9EJ 3ZZTA 3CJ8A 1ZM3A 3NY0A 3UVJA 4DUZF 1S59A 1NMEB 3D66A 1FKOB 4Q43A 1TFYA 2CNOB 4ZCMA 2J0WA 1FRJA 1O5JA 4NA2A 2QN6B 4RU9A 3CMQA 2Y1JA 1IKVA 1U1NA 1FE4A 1RKIA 2GGPA 1G6BA 1ZS6A 1YJUA 1XR5A 3R7NB 5KFHA 4X4TA 3D2WA 4QU6A 2IM3A 2NXCA 4CT9A 1FDBA 1RI7A 3KYLA 4EBDA 3EJMA 3TAQA 4FF1A 1WDDA 1IKYB 1UP1A 1HWLA 1RCXB 4JI0F 1P1LA 3VR1A 3JSBA 5MAOA 3CO0P 3QWPA 4V1Ak 2BV3A 4ZCIA 2HAFA 3CCRS 1HI0P 1FRXA 5CZVA 4OYOA 1WJ9A 3GR0A 3AA9A 5AXKA 3QSYB 2EBEA 2JFDA 3LPEA 4LSLA 3H8YA 3KJQB 4CT8A 3K7RA 2XLJA 3KUEA 3T5LA 3G82A 3KJVB 1XMQF 4RU2A 4OX9J 3K5PA 2J9CA 5FDLB 3S01A 5EN1A 3QLHA 1ELOA 3TOQA 2V4JB 4DX6A 4RUHA 2DISA 2HGNA 3IGVA 3KHLA 4GRSA 3IFEA 2OTLS 2M88A 5LL6d 1TZ0A 1UFLA 3LUYA 2K06A 3QGPA 4ZJLA 3AB2B 3CCZA 2RHSB 2GJIA 1X4EA 2XBPA 5GMDA 1LK5A 4B9SA 1UZDA 3ET6A 2N4CA 4ED0A 2E66A 4ZVQB 1BLUA 3MEDA 4MT1A 4Q44A 1UVIA 3ZNJ1 1PCAA 4O3RA 1R6VA 2B4PA 2HQDA 2YNHA 3WIUA 1Y3KA 3R1HA 4I67A 4TXSA 2FLOA 2CQ4A 2FC9A 2HRUA 3ITHA 1OSDA 2DJWA 2WTFA 4DR7F 1NDCA 4MFBA 3MMBA 4WE1A 1JLCB 1TVRB 4QYZJ 2Z8QA 1S48A 3OQ2A 4DL2A 1TK0A 2RF2B 4PUOB 2B4OA 2QA4S 4PG8A 5F3ZA 2P9GA 3Q83A 4KR0B 4AD6A 3NBPA 1VBYA 3GFHA 1U2FA 2V8HA 1WSVA 2Q6CA 3W63A 4KJIA 2YWGA 1OY9A 1OIAA 1WORA 2HQIA 4DS5A 4OZ0A 3GZ7A 1UZHA 2O5DA 2W4PA 5KOWA 3GIKA 2BQ3A 4GMKA 2XLIA 4MK9A 2GC8A 1BQMB 3DI6B 5D6GA 1KONA 5BYRA 3DOLB 3CXCR 1S1VB 2EFNA 4IR9A 3PYFA 5L46A 1K0TA 2ZITA 4ZLPA 2FD2A 3ILOA 4C2MA 1JLBA 1I3OB 4ED7A 2PN6A 4C48A 2R42A 1PC4A 1RBAA 2GHWA 1LFPA 3PRDA 3ZNUA 5KOXA 1FJCA 4L75A 2HK2A 1IBMJ 4P75A 4E98A 2J7UA 4KC5A 4CZCA 4M5HA 2DK2A 1S6UA 4V19J 1T9WA 2WVFA 1BQXA 2KFNA 3FQLA 4F4WA 1ZA2B 1TKDA 2ROPA 2AJ4A 4RNOA 2GJFA 1N32F 2YPYA 5HLFA 2LU2A 1PSDA 1IKXB 2FJBB 3T1YJ 3R97A 1UMJA 5B0EA 4K4ZA 1QSLA 4KFBA 3NNAA 4DR6J 1FKPB 1WHYA 2UV8G 4LT6A 5KFZA 4K4WA 2FUG9 2HFNA 3RTVA 1H73A 4B3TJ 4CDIA 1M1KT 1VOMA 3O8WA 3MM7B 2XSJB 4GO7X 4DX8H 2VD3A 1IJFB 2OD6A 4J9VA 3ZZOA 1JLAB 2X3DA 3MM5B 5THWA 4TU7A 4R8UB 1FJ7A 2HYIB 2D74B 1KVKA 4ICLA 2B43A 2VC1A 5BJRA 4NCGB 1RT3B 5DQGA 5CD4A 2BBEA 5LMNF 4KHRA 5KG6A 2YNIA 2CFXA 5KT4A 2LDYA 4NYOA 1VISA 1WKLA 2QFJA 1R8PA 3RBDA 1TL1A 1Q7LB 1S6PA 1X5TA 5ETPA 4F4XA 1N52B 4A8FA 1H3DA 2V67A 1F5BA 1MWYA 1N6QB 2GAGC 3R1LA 1FDDA 2JLGA 4P2SA 4O3PA 3QAUA 3MDFA 2OH2A 3QJJA 1NZ8A 5GAHI 1EETA 8ATCB 2WRMA 2IYIA 2FJWA 3DXSX 4WU3A 2J0QD 3MF5A 1CS4B 1M0SA 2ZKUA 4DEZA 2EK1A 5IT4A 4WKRA 1UJ5A 3PYDA 3H5XA 1TAQA 1XMBA 4RNMA 2UUAF 3GU0A 1HPZA 4RW7A 3RB6A 3UQSA 4DR6F 4F2SA 3JAMU 2MGZB 3VQSA 1T9UA 3MR6A 5KFUA 2C3MA 3SCKE 4WZQA 2D69A 3R6GB 3HFKA 1UFWA 5B0GA 1S79A 4B9VA 5DM6Q 4DJBA 1J5OA 1S4EA 4I7FA 2XS5A 5K9FA 4ED3A 3I82A 1RAIB 4LSNA 3BQ0A 4Y28C 2A1BA 1VQ7S 3BF4A 3MEGA 1CLFA 3R6LB 2RRAA 3CIMA 1U4BA 4OI1A 2E5IA 4EYIB 2QA2A 4WKYA 2L9WA 2C2DA 4Y2CA 4ED4A 1RWVB 2F9DA 3OL7A 3GJRB 2GVDB 3CCSS 5CXTA 3TP2A 2VDIA 1P9QC 1B0VA 4UUXA 1WC0A 3CULA 4WXOA 1GX5A 3FRZA 2QRRA 4B9UA 1JLQB 1SIZA 2CQ1A 3CT9A 5IS2A 2FJEB 2GFFA 4TLQA 2EFQA 2RF2A 3EWGA 2VG5B 1T9TA 1NSKL 4FF3A 4AUKA 4EUVA 2ZHAA 2LEBA 1F6TA 5HQ8A 2W8KA 2C2RA 2DY1A 1GQEA 1PC5A 1SVDA 2FJXA 4ID8A 1Q0NA 4RW4A 2CPHA 2CUYA 3SDEA 2R9LA 2OMOA 4PQUB 1CG2A 2GMJA 4I68A 1ZTTA 4Q0BA 2GS8A 1KRPA 1KSPA 4YR3A 5L38A 1HNIA 2AMCB 4MAKA 2R7SA 4BBYA 2N3OA 1FRMA 2HFSA 2QMUB 2BM1A 4OI2A 4U96A 6AT1B 2V68A 1YRTA 4MH8A 5B7WA 5C7PA 2HURA 3W2VA 4DF4A 4KGVB 1V6HA 1YWXA 2XYHB 5LSRA 3DGPA 2DHAA 2AJ2A 3QT8A 4CH0S 4FS2A 2KT3A 1NSAA 1R6YA 2J5AA 1MU2B 3DOKA 5D4PA 3G6XA 2QA4G 1UCNA 3AT1B 3FK4A 1F5CA 1XNQJ 1KQSR 1REVA 2QSFA 1SKWA 1TL4A 1QJHA 4Q7AA 5CHCB 1JJ4A 5EWGA 1UETA 4OHYA 5KFSA 2QX0A 2QO3A 2JRSA 3N6NA 2LU1A 4GC6A 5KFWA 2PD1A 3IR7B 2Y1IA 2WBMA 1A7GE 3QSIA 3LTOA 2ROEA 1S9EB 1HI1A 1RSCA 4U7UK 5LSOA 3EGVA 3R2CJ 1HW9A 2IRXA 5KFMA 5EGYA 4WYLA 1HHQA 4PXDA 4U67Q 3J80U 2RILA 4JV1A 4NLQA 4ILMA 2XWYA 1NK0A 4C8YA 4JYAJ 1QDUB 1RA7A 1T9VA 1G2EA 1YRXA 1TP7A 2F8MA 2PO4A 5LMNJ 4LF2A 5T7LB 1SH0A 1TL7B 2J8SA 3JQMA 1DTQA 3Q89A 4DV1J 1SJFA 2H3EB 1KVIA 4E2FB 1TKZB 2QLFB 4IO1A 3GMGA 4USWA 3TEHB 4DWIA 3M1VB 2DRBA 1ZZNA 2F7VA 3CJKB 4DV5F 2ZOMA 3GPAA 4J9PA 3DLHA 1VQMS 3OVBA 1ITPA 2WVBA 3PNIA 3OLAA 2GVZB 2P9CA 3HT3A 1S6PB 5HANA 4Y34A 4C0BA 3TAPA 3DOMA 3P6YC 2HG4A 2IMWP 1N6QA 3TR5A 5ETNA 2KHDA 3GP9A 2IY5B 4ZP7A 2KFZA 1P6TA 2JH3A 5GVQA 4ZITA 3IWXA 1HWUA 1R89A 3WHIA 3MMJA 2WHOA 4P71A 2QT7A 1DLOB 4DPYA 4DL3A 3C16B 4NXNF 1M1HA 2DNNA 4M5MA 4CLKA 4FKXA 3M8SA 3U1MA 2AGQA 2H51B 2PA8D 5HQMA 2RD5C 2P6TA 1QM9A 3SQGA 3T5KA 2VBXA 2DNLA 5K8PA 2E7XA 3L4BC 3TWZA 4IDKB 1RT1B 3DU5A 4KQZA 5IWAJ 9RUBA 3CMAS 2N82B 2I2YA 4ECSA 3PZPA 4ILLA 3CCTA 4RNFA 2ZZMA 1FXLA 3M2UA 2BXJA 3D6TB 2B9XA 3O44A 4NEZA 4UUWA 4ZPCA 3DDNA 2KVQE 3T5HA 2ASDA 4OYIA 2OKQA 5ETOA 1NK5A 3QIPA 5A0YA 1N36J 3H90A 3HHLD 3TNVA 1Y5IB 3POTB 3OW2R 3J7AN 3BH7B 2R8JA 3CCMS 2AEJA 2ASYA 1DTTB 3MM6B 2VOOA 4KY3A 3D1OA 1RHJB 2YWFA 3DLKA 3QRRA 2NPFA 2ASJA 3QQCD 4ZPBA 1EZZB 3ZZUA 3SV3A 2G2OA 2HLUA 1Q7YT 4I56A 2O3DA 1VBZA 4BCAA 1RWKB 2BE2B 2CZ4A 2PGCA 3PEHA 5J2PA 4DR1J 4YR0A 2AJQA 5HROA 2WSCC 3H5YA 4JI4J 2H54B 1QSSA 3CVKA 1N32J 3ZFVA 1HMVA 1HNVB 3EGNA 1QE1A 2YTCA 3FUYA 3N5BA 2VFRA 1MLAA 4FP9A 4O23A 5IC4B 3J81j 3EZ5A 3A12A 2WSFC 3TUZC 1Z4UA 5HJXA 1RTJA 2FZGB 4FKYA 2CQCA 3KK1A 1MG7A 4M5JA 2SXLA 3B78A 2XI3A 4RW4B 3C15B 4EZ6A 2MMYA 4ZLJA 4MMOA 3CNQP 4F3OA 3G2XA 4X4SA 5KFTA 1N56A 2E5LF 3OXGA 4IRKA 2R7UA 2CJYB 3ZZYA 3MM9A 1SC1B 4ZPVR 2LQ8A 3LGMA 2VKZG 2ZH2A 2R7TA 5I42A 2RQ4A 4LMZA 3AQPA 4NLYA 1S1UA 2I6WA 3JXOA 3MR5A 4CH7A 1WI6A 5L1JA 4PWUA 1NNDA 3F73A 2CVEA 4CLUA 2ASLA 2EW9A 3K58A 4Z7CA 3HLUA 2PMWA 1WOPA 1L3KA 2KDOA 3BZQA 3C6UA 1SL2A 1TL3B 4QWEA 1S1XA 2XMTA 2F4VF 1UVJA 3HULA 4USHA 5DLFA 4QZVB 4RJVA 2MQNA 5I3UB 1REVB 3OVAA 4KGZB 2XMMA 3THVA 3IRXA 3M4XA 4MKBA 1XIQA 2BE9B 3DMJB 3WX4A 2DCUB 3D9BA 3NCRA 1DY3A 2DNOA 1U47A 1QAJA 1RTIA 2XLKA 2I1RA 1SH2A 5D0RA 2ACMA 1SJRA 4JP8A 1HLWA 5DGAA 3R8YA 3DC2A 3OL8A 2RSQA 4URQU 4USTA 4DSIA 4C6AA 3N6LA 3IBCB 4CO2A 2BQRA 3BKTA 2HFOA 3ENQA 1NPKA 2G9OA 4Q8EA 1RT5A 1LW0B 1IQTA 5F41A 2DR7A 5J2MB 2E9TA 1EQ0A 4QW8A 4F4AA 5E41A 4KT0C 4DU7A 1MW7A 3BSNA 1ZAVA 5C2CA 4WP8A 2OPSA 1U48A 2ZHBA 3PHTA 1UJ6A 3A4TA 3D67A 4BWMA 2CYYA 4HR2A 1OWXA 3R2DJ 3OFHA 4KRWA 2VONA 2CQ3A 5KG3A 1KTQA 3BB5A 4QYRA 2GGPB 4NWBA 1F2HA 4DCJB 1H2TZ 1NDPA 1Y5NB 5A8RA 4DMZA 2VJUA 3PYEA 2VA2A 5KFBA 1OO0B 4MIAA 3PCOB 3NAIA 3S7RA 4X4OA 2C2KB 1IKYA 3UR3C 4EGLA 3CCWA 3EVWA 3T9ZA 2DH9A 3LPYA 3Q22A 5F0WA 3GB0A 1QVGR 4M5KA 4A47A 5J1PA 3F56A 4I2QA 4YY3F 1FNOA 7FDRA 2RS2A 2AYBA 4DL7A 2B7CB 4FXWA 1GXLA 1SI9A 2XCPA 3IBWA 1GNKA 2AEMA 4FYXB 3DLEA 1PYOB 1FFSB 3SQGB 2C3UA 3QGHA 2V4JA 2RH3A 4WBFA 4WCEQ 3HO1A 4JB8B 1VQKS 4DR3J 2W2NP 2E1AA 3BQ2A 1V5VA 2CPDA 1B0TA 1FERA 1N88A 1GMWA 5CAAA 3OR2A 2YKNB 2BJEA 3JSMB 4JI3J 4OX7A 5C25B 1RT6A 1UWAA 2LEAA 4IG3A 5AE3A 4DOZA 5D0HA 1UWBA 3HVRA 5KFJA 3ET6B 2JVOA 3POTA 2DB1A 2O1PA 2W4DA 3IMQJ 1U09A 5CABA 3PRVA 2L48A 3HP6A 3AQOA 3BR9A 4LQ3A 1H2UX 3CEDA 3SSRA 3ZZ0A 2EWHA 1VK3A 3ITHB 1FWLA 1VC0A 3HFZB 3NCQA 3Q8RB 2UU9J 1JQGA 3CGIA 3LQVA 4KE5A 3GYGA 4RWWA 2MZ1A 1KC8T 2OLWA 5E5NA 5AE1A 3PHEA 4I64A 2KYXA 1B0PA 1T0TV 4QBUA 5L8RC 4O0NA 2M3DA 4JI2J 4DPUA 4PUOA 2CRLA 3NBPB 1S6OA 2B3TB 2J7KA 4JV2A 2DNZA 1J2VA 2YY3A 1LQ9A 3E8OA 1UVKA 3MFHA 2CA9A 1FNMA 3HSDA 4EYHB 1NSPA 4CH1A 3KK1B 1SL0A 3FSYA 3V6JA 3UO0A 1IM6A 1SC6A 4LBPA 3CJ3A 4ECXA 2MZJA 3G6YA 3DI6A 1HBMB 1R43A 2JC0A 3BYRA 3UDVA 4DS4A 5D78A 3GQCA 4UW2A 1JKHB 3NGTA 1KWMA 1XEZA 3KMQA 5IQQA 1VC5A 4QOTA 2M8DB 3PKMA 1IBLJ 4NZ6A 1HQEB 1ZBTA 2YKPA 2QLWA 4ZJQA 2IM0A 4PG4A 4F26A 5GAGI 1Y0HA 3CCJS 2UP1A 1BHNA 2JLFA 4QWAA 2RU9A 3JQJA 1VI7A 5HVHA 2HS0A 5E33A 1H74A 4NLOA 2DHXA 3WZ0A 1PYTA 2GJ2A 2ABYA 1C1CA 3M30B 3U1LA 1KD1T 2FVRA 1GTHA 1Y9OA 1C1BB 2K1RA 2VASA 1KOOA 2WB1D 3CJSA 2O01C 4G1QA 4P6QA 4IQMA 2XNQA 5IC6B 4A48A 4J9SA 1T95A 5LMUJ 4KTQA 2Z2YB 2UVVA 3BDEA 4LJMA 3RAXA 4UOHA 2HVEA 3S6EA 4PXCA 1HHSA 4KKOA 3RB3A 3CC7S 4LFAJ 4F04B 1PIEA 2CJ9A 1S49A 1G1XA 1M5HA 2HHWA 2BJ9A 2HZVA 2QSWA 2DGOA 1AA1B 4LF6J 1P27B 3CDUA 4PZVA 3MM7A 2CPYA 4E8UA 3BREA 2HS3A 1RXOB 2L9NA 3GJQB 4QQBA 4J7CA 3T9NA 4R8UA 1HBOB 1NBEB 2DO4A 1T3OA 3VAGA 1YQHA 1SIWB 1FVQA 5IM0B 1IWAA 4DV6F 1VS3A 2E1RA 4ECUA 3DRPA 2ILZA 3MCOA 4OIXA 1NK7A 4NLGA 3N0VA 5J2NB 3AHPA 2EI5A 1NPRA 2DNYA 1LWEA 3GCWP 1JIHA 1PAEX 2GHPA 3FZBA 4GVBA 1B7FA 1Q78A 3TJ8A 1M5SA 4NE9C 3BGOP 3QO9B 4QIFA 4ZHRA 1Q8IA 3BQ1A 4DV2J 4OV6A 4EI2A 4A8QA 1VQPS 3W5YA 3NS7B 5D3GB 4LRDA 3TZYA 3R5GA 4OL8A 4RW6A 2P6SA 4ZVTB 2HS4A 1UPMB 2JJ4D 5LJ3Y 4X62F 1CS4A 3A13A 4IQXA 1UKUA 1NO8A 2GZOA 2ZBIA 2AX1A 4NLDA 4XTTA 2BOAA 2MZTA 5LT5A 3DLEB 4JV5J 2Q66A 4RW7B 5LJ5Y 2AJ1A 2ZH3A 2KT2A 2FC8A 1TKXA 2Q1LA 4LFCJ 4PKDB 1EP4A 5HMZA 1KKHA 1OJ4A 1J5EF 5ETQA 5ITHA 4YDXA 1PKUA 4HI1A 1JJHA 2MQMA 3OR2B 3R7SB 5HQLA 4TYBA 1IQZA 5KAKA 5C25A 4NPOA 2V8PA 1HI8A 2EEYA 2GIRA 2ZE2A 3DDKA 2HKEA 5I4MA 3I9ZA 1VBXA 5D4LA 2W1BA 3VF0B 4TQRA 3Q8PB 2QYGA 3G6VA 3GWCA 3NS5A 4W90B 1Y10A 4OHXA 2WW4A 2LYVA 2ZEJA 1IXKA 4NL5A 3BO3A 4ZS6A 5L1KA 5A8WA 2VIHA 1VHIA 4QR0A 2DH8A 2KJWA 3MAAA 3IM9A 4F02A 4XK8C 1NK6A 2K7KA 3H2VE 1JWWA 5EX0A 4A8MP 1XBWA 3OTDA 2M0GB 2ZM6F 3LP1B 3NP5A 3I55S 2R4FA 5CA5A 3V81B 3IC1A 1FJGJ 3KG0A 4Y2IA 3G96A 1YBUA 2R2UA 1UA1A 4DQPA 2DHSA 1ICEB 3HDSA 5AE2A 2HHXA 4DV4F 2YX4A 3OFEA 5EX3A 2P8IA 3MD3A 1XWLA 5DDQC 2XSFA 4X4VA 1SUQA 1WC4A 4AXJA 4F25A 2OFHX 1APSA 3AJDA 3RAQA 1U0HA 3VALA 4UZCA 2W9CA 3ZZRA 3K57A 1TMMA 2AIRB 4PG7A 2AQ4A 2VBWA 1S4FA 5DZ7A 3RYLA 4C0HA 2CQBA 2DNMA 3DRYA 4O44A 2DNGA 5F8IA 4USIA 4OX8A 4K4YA 2G2YA 1ZA1B 2HRYA 2OPPB 2UZAA 3NLCA 4AL6A 4XPEA 2C2NA 3OTBA 2BABA 4WZMA 4FF4A 1G4CA 5AT1B 3LP2B 4HVZA 3DGPB 3H40A 1VIXA 2HHQA 3MI7X 1XR6A 2UXCJ 2QTWA 2RE1A 3CPWR 1N4LA 1RAGB 3D68A 3KNGA 2W25A 4LF6F 3VZHA 3PW2A 1C1BA 1WC6A 3NOGA 2HWTA 3ETMA 2B56A 3DRRB 1FRIA 3FC9A 2ZBQA 3NXZA 2RDIA 4RW8A 1YI2S 1EB0A 4P2MA 5HP1A 5HVFA 1BD6A 1W7WA 2VB6A 3CDWA 4CLFA 3I5CA 1HWJA 4K0KJ 1XMQJ 2X51A 2MKHA 3K5OA 4LR8A 1KQFB 5B0AA 1IKWB 3R5BA 1T03B 3M8YA 3HJFA 4ERDA 2AW0A 4PXEA 4RNHA 4ZOSA 5KG5A 3K59A 1LWFA 1RHMB 3B4DA 1N36F 4PWDA 3HI9A 2OTJS 2W8LA 1YIJS 4KHMA 3J81U 4XDCA 4CLZA 1JXLA 4LFBF 5IZHA 4X4NA 2G1DA 2LECA 1U7LA 1C0UA 4BWJA 2KTQA 2HLTA 3P8BB 2KL8A 1OSCA 4HLBA 2Q6BA 5FIIA 1JK9B 4OLOA 2EBGA 3IWLA 2MQQA 3NGKA 4CNYA 4ZLNA 2Q3PA 4A8WA 4ER8A 4KGKA 5ETLA 1XMOF 4GKJJ 4C11A 2BKNA 1IBLF 1WI8A 3I4PA 4K5RA 4K4VA 4DZDA 2QYCA 3HHLB 4CLSA 2DNRA 3KLFA 4LF7F 3VQTA 1UFKA 1HIYA 4LF5J 3PX6A 2J6TA 3QFHA 4DL4A 3UDEA 3PJWA 1Q53A 5BYSA 2UU9F 4DV4J 1A0OB 3C16A 1ZPWX 3FCHA 1O0PA 1NJZA 2GMLA 1RUSA 2QL9B 3D0IE 3G82B 3KJVA 4JBCA 2DCLA 2PDAA 4YB1P 2DTJA 2VHGA 4ECTA 2C2EA 3BDPA 2YKQA 4C3MA 2DIVA 1YJ7A 3FEXB 4HTJA 3VAHA 1UVMA 1QVFR 4ID5A 1MNEA 4FXDA 1BWEA 3Q86A 3W2WB 4FXVA 4URSA 2PC6A 3L7OA 3FSXA 2A3JA 3HSJA 3OV7A 1C4CA 2CVIA 3V6KA 4DSJA 7AT1B 1CQNA 2CAJA 4KV8B 4C3KA 4OYAA 5KTQA 5C5JA 4TVAB 3UD4P 1RBLA 1S7HA 2YNHB 5E7OB 1NJXA 3VAFA 1Y4ZB 4ZDNA 3RG6A 4P72A 1HQUA 1YLXA 3M9NB 2DNPA 2UUTA 4JI3F 1O8BA 3MAAB 1TU0B 4FNIA 2JX2A 2VPYB 1Q79A 2MKJA 4OYMA 5H9FJ 4MFBB 3MMCA 2XZWA 2BKPA 2XMVA 3LP1A 2ZOGA 3OSNA 1TUWA 3TRGA 2VU5A 1I1GA 2V8DA 1OY8A 2RIJA 1GAOA 2XG8A 5KFXA 4DSEA 1S0MA 4NXMJ 4I6YA 4OHVA 3D3CJ 2C3OA 3EM1A 1ACMB 3I87A 4PQAA 2XYPB 3MAQA 3GYNA 3FZ2A 1NJIT 5KFNA 2RKIA 1QUVA 2KO1A 4O4RA 3P3DA 4MJKA 3C8YA 1NKCA 3MM9B 5IT0A 2DNKA 2ERRA 2UUBF 3JS9A 4DUTA 2ZC3A 4EU0A 3I56S 3BGRB 3I5BA 4L6V3 1W25A 4ZKAA 3J7A1 2KU7A 3MECB 2QV6A 2M70A 2L3MA 4CYUA 3TZXA 3SCLE 2ZUGA 3UW1A 4J9KA 1WELA 3DGVA 5J2QB 4DPOA 3L09A 1WF0A 1HW8A 2DO0A 2Z58B 3W9IA 2XHWA 4LF5F 3N79A 1F9FA 5HK4A 3AJ1A 2YBVA 1TL3A 3M8PA 2IA0A 2FTRA 4K2XA 3RU0A 4V19X 5MLCV 4F4KA 1RAAB 1C0TB 4OHWA 5KT2A 4USKA 1FT8A 2X1GA 3QFWA 2MQLA 1UEKA 4PG5A 3FRYA 4S0MA 2P9EA 3RBEA 3DMJA 2QMXA 3MEEA 4KH0B 2CXEA 1ZOTA 3D1QA 2CWXA 4RW8B 2I38A 2XS7A 3DHWC 2BJ7A 1A9NB 5AXNA 1E6VA 4ES2A 2F4VJ 3NCPA 2FVCA 1P1TA 1T05A 2B9WA 2VKRA 4B9TA 3A8EA 5H9EK 4U6PA 2IBKA 4HEA9 1FKPA 2NYIA 1RT5B 4NRTA 4PRFA 3C19A 2R8HA 3A8IA 3O1LA 3C66A 3PRBA 4ELTA 5JMNA 1YJ9S 2F63A 4L3KA 5GAGU 1B70B 2G0JA 1JMTA 5GAEI 3V6DA 3W7BA 3RB0A 5ETSA 2V8VA 2EG2A 4RLEA 1FE0A 2CQIA 2QLBB 1AB8A 3N9UC 2YNIB 4OZLA 2HK3A 1X31C 1GX6A 1QUPA 3PJXA 4DHVA 3CJ2A 3K17A 4ED5A 3GFXA 1YDLA 1TL1B 3KK2B 2ZH4A 2ZJQQ 4H4MA 2JDJA 4GO5X 3KXDA 1CC8A 3KLFB 2JNJA 5HVGA 2FDNA 3LGHA 2R8KA 1KVJA 2KG1A 1L3TA 2UXCF 3RR7A 2HHPA 2GA7A 5CYQA 4EFAC 2JEJA 1YJWS 2J8AA 1G3OA 2V2KA 5U47A 3QRPA 3BGUA 3BKUA 4N47A 4ZVHA 2Y1RI 1RWUA 2Q43A 1Y7PA 4MKVA 3IS9A 5F8GA 3EGWB 3VAMA 3K0JA 2KZMA 4OI0A 1WG1A 5HMWA 1VQ6S 2V63A 4DFPA 3P5BP 4NI2B 3EICA 2HNZB 4PR6A 3M05A 1UAWA 2PFFB 2ROGA 2BYCA 1WWHA 2H9ZA 2R7RA 1CJVA 2D3OR 4DR2F 3M2RA 1W2IA 1VR6A 2EFGA 1T3NA 3LANA 4FVMA 2YH0A 2J7WA 5AJ3F 5K8OA 1IR1A 4L76A 3CJRA 3D0HE 3BYPA 4KV8A 5C42A 5A76A 5KFQA 4YFUA 1X9MA 2R8GA 2QC3A 4HHHA 2IJRA 5KFAA 4LFCF 1TELA 3HZGA 1PBAA 2GVDA 1MN7A 2B6AB 1XJWB 2NCKL 2RB7A 3H98A 1HQUB 1BE4A 1CC7A 3ZTSA 5HN0A 1NPPA 1SQEA 5KG2A 2XGPA 4ED1A 3GILA 4J9NA 1AFIA 3B4MA 3NKYA 3MMCB 4RNNA 1EKSA 1RTHB 4OFZA 4WJBA 1ZM2A 2C2ZB 3OXFA 3Q8QB 1R31A 2G0CA 4FN5A 1ZPVA 2V94A 1SJ4P 2VA3A 2MJNA 4KPCA 2AV5A 3W62A 2G4BA 2W7AA 2DNHA 5IQ6A 3NNCA 5F8HA 5B0DA 4LUBA 3SDEB 2HHHF 2BR0A 4O3NA 3FQKA 2XNRA 1NK8A 5KT7A 2AJFE 1HBMA 3RAMA 3H5SA 3MGJA 4J9RA 1DJ0A 1NK9A 2BUNA 1JJ2R 2NPIA 1WTFA 4DV1F 1X4CA 2CNLB 4ZMMA 1URRA 1T8EA 4HHUA 3OJSA 1LK7A 2F8HA 2Z0GA 2F65A 4W4MA 3RJMB 2KH9A 1XTZA 1HQEA 3QMQA 4R0EA 1FK9B 4WXWA 3KK3A 2XTJP 3C14A 2A2CA 1VRQC 1LKZA 1S6QA 2HNYB 4MK7A 1S9FA 2LCWA 2VPXB 3JSYA 5J2QA 4FBTA 2DVIA 3TARA 2HIQA 1KEKA 5HBMB 4HI2A 4LBHA 2C2MB 2Z57B 3OPKA 2OAUA 3ZTQA 2XY6A 3IN5A 2AP6A 1X9SA 2FHJA 1D9FA 3K5NA 1C0TA 2OPQB 2QL7B 4OZ5A 1ZM9A 4DI6A 3OTOJ 2XC9A 2BQUA 3HKZD 2EFOA 2EKYA 3L7PA 4YB5A 4X64F 3KJFB 5DQIA 1R8AA 3IM8A 2LDIA 1E6VB 1U24A 4WIIA 2HFVA 4TU9A 2IVMA 2B9YA 1FX2A 2BEFA 1BGXT 4KKOB 1S9EA 3L3CA 2YNGA 1NDKA 4RUAA 4DV6J 1KS2A 1GEHA 1AFJA 4Y00A 3V5RA 3KLVA 2N7CA 2GQQA 1RB0A 4A8KA 3K2YA 3BGFA 3M6XA 5L9XA 4ALZA 4DR2J 3IO1A 2OO4A 1QAYA 1AUDA 4JOUA 1QLNA 3OBIA 1HBOA 2MY8A 3CSKA 4K59A 5IT9Y 2CJQA 4UT4A 1U1OA 4QR2A 2CPZA 1VRTB 3DRPB 3UVJB 3VGUA 3LP0A 3HMJG 1FKOA 3CJKA 1D0EA 4OYPA 1FI4A 3H0PA 2W2MP 3NMRA 2RHQB 3WX8A 3KK2A 1FJEB 1F2GA 1YHQS 3SMZA 1UW9A 1FWKA 1RADB 2GO9A 2RRBA 1GFWB 2HBQB 2XHCA 1N33F 3BN7A 4QWCA 1N48A 1MWQA 2WAQD 4ECRA 1D1UA 2K3KA 4ES3A 3GV8B 2DR5A 4BLGA 4P2XA 3KLEB 5DDRC 1PILA 7FD1A 1Z2LA 1Q16B 2DR6A 3I5AA 3R27A 1K8AT 5A8KB 2HGLA 1QTNB 2J9DA 2X1BA 3T6BA 1R0BG 3TZZA 1LWXA 3T1HF 4OLPA 3K8WA 3QLHB 4G1PA 4NI2A 4JV0A 3UE2A 3CJ0A 3SI8A 4J91A 5KG1A 1HHTP 2FJAB 2M8HA 1EP4B 4ZIVA 4ECVA 2OIHA 3LAKA 1YBAA 3OTCA 2VL1A 3PKYA 4DV0J 2XY7A 4F8RA 2FLNA 4OJHA 1R0CB 3HKWA 3OSPA 5CYJA 2NXNA 2RDDA 4ITSA 1ROFA 3I0RB 1T7PA 1S1TB 3UCGA 1DTTA 3MM6A 3S1TA 3TUPA 2PSZA 2B6AA 2HZCA 2BE7D 3T3FA 1UEVA 2XMAA 4QPTA 2DNQA 2LXFA 3U1NA 5B0FA 1Q86T 4M5NA 1JLCA 1NEEA 1TVRA 1QD1A 1RHRB 3AOCA 3MTKA 3BSCA 2GIFA 1KHWA 2JLEA 1HL6A 2R7QA 3KFWX 3NWRA 4FYVB 4B17A 3Q0AA 1CJKB 2JL9A 4GKKF 4LIWA 3MR2A 1FKAF 1SCJB 2JEFA 1RTJB 1EX8A 4LF4F 2D9OA 2Z2MA 2QE5A 3HVTA 3HXMA 2MZSA 1NHKL 5L1LA 2BM0A 4X4RA 2AYGA 3E51A 2NLWA 3EVOA 4WWSA 2CPXA 2W4CA 2DKOB 1N5SA 2H5IB 1NJYA 2Y8YA 1NU4A 4IUFA 1TUGB 1IWGA 5I42B 4J9UE 1FDNA 2ZVIA 4J9QA 4DV5J 4IOCQ 1S77D 3QJLA 1KN6A 3EVMA 2CG4A 2VC0A 3KK3B 2OPRB 2COLA 3Q8VA 2ZH9A 1YZ7A 2FHKA 1TKTB 3W60A 4DN0A 3K5MA 2QLXA 1FA0A 1OQ6A 1YJNS 3QT5A 4ECYA 4ZLLA 5C2GA 3EZOA 4YR2A 4ZVOB 3UD5A 3GV7B 2MDAA 2FHOB 4NXMF 2J0XA 3TA0A 3IRXB 2EC0A 5L39A 3HSGA 3IAM9 2R7OA 5HLFB 3PVXA 2YQ1A 1D9DA 4Y0FA 2R2RA 2WONB 3G71S 1U2RA 1RWXB 2YNGB 5D0EA 3RUBL 3NGDA 3RGIA 3PDNA 5KFYA 2FZKB 1YRUA 1HBUA 4QIEA 2IBOA 2NSCA 3G8QA 3N5FA 1VYAA 4EO6A 1NH8A 6FD1A 1C0UB 1YK9A 3TI0A 4OJGA 1QAXA 2FLPA 4QPXA 2KZZA 4B9LA 2OJ3A 2NSBA 4O3OA 4DPXA 2MZQA 4DX5A 3LP0B 2CJBA 4C11B 3BO4A 1FO1A 1X5OA 1S72S 4P73A 5C24B 2B7BB 1HNZJ 3KTQA 4NLWA 2OSRA 4ZP6A 4ZK7M 4X62J 3EYZA 5CYMA 4AT1B 4LF4J 1X0PA 3HHLA 5G4DA 1FFWB 4K5SA 3WC2A 1CVJA 2EXUA 2V8GA 4N5SA 2FB0A 1FESA 4O4GA 4DV3J 2LQ9A
chains in the Genus database with same CATH topology
2FJVA 3J80Y 5F8JA 2D3ZA 2NXUA 4RBTA 2BANA 3I96A 3D5MA 3N4WA 5B08A 1VQ8S 3C3LA 1Q8LA 1UJ4A 2VH7A 3MM8B 3T6JA 1RGVA 4TU8A 4X4UA 5JJBA 4K4TA 3CD6S 2AGPA 5LXRA 1R3NA 3B8HA 1E6YB 2J6SA 2V9KA 1NH7A 1R0AA 1WTBA 2MB0B 1J5OB 1Y5LB 2CQ0A 4QIGA 3TA2A 4HT5A 2M9KA 2PIIA 2WBRA 4EZ9A 3JTPA 1VFJA 5EDWA 3LAMA 1HYSA 3MFIA 5K8MA 1OPIA 3KLIB 1VHFA 5FD1A 4A46A 5D8HB 3VAKA 4B3RF 2MYFA 3IRWP 4DFKA 2LQJA 4GC7A 3RW6A 1U6BA 2KRRA 4I0WA 3W3SA 2CPJA 3BJYA 3T19A 3R5AA 5DS7A 3L95X 4YMEA 4BC9A 3LWLA 1VQ9S 3NL0A 4ELUA 1IQTA 3IR5B 1PGZA 2KB2A 2NZ4A 3DYAA 2MXYA 5E3RA 1FCAA 2XMWA 4C8MA 3TUJC 1BQNA 3NMAA 1GH8A 3DNCA 4LVNP 4I6WA 5EHHA 3M2VB 4KO0A 5M2UA 2I0XA 2WK4A 2UVWA 1NK4A 2JEGA 2NR0A 3ENVA 3KOAA 2EPIA 2B51A 4F3QA 2GX8A 1MMNA 2VQFF 2ZKTA 4DN9A 3HF5A 3BGRA 4KPYA 3MEKA 3CMES 3MECA 3V6KA 3FFIB 2ZH6A 2M2BA 2YNFB 4BS2A 2HVIA 3CCES 3W2VB 3CCLS 1ZAXA 1LWCB 2B4UA 4AE5A 1HARA 2IYGA 2ZHOA 4J9LA 3CC2S 3RB4A 3M8PB 3IWNC 3THTA 3IR6B 4WU2A 2X1AA 1WG4A 3RW7A 1U26A 3PACA 2GQ2A 2ADCA 3MEEB 1MMDA 2MKCA 4IFYB 4EBEA 1FJGF 1M5PC 4DSLA 2WONA 2ILYA 2LMIA 1M5OC 1Y3JA 4B9MA 4BDPA 2B5JA 3OTOF 4C8LA 2GQCA 2VG6B 3MPYA 1M5VC 3PR4A 4WFNQ 3AY0A 1H2VZ 5T7LA 3FSIA 2QA1A 4DR3F 4NLXA 2W9BA 3PW7A 2J9DE 3P5TL 2RVJA 4PCQA 5F0UA 1PO6A 4HKQA 4LIRA 3M8RA 3ISZA 4C98A 4XO0A 1WEYA 1R27B 1SV5A 3QZ7A 4ES1A 2ZFHA 5KFCA 2B4VA 4ZA1A 4OZJA 2WW8A 3QGIA 2BACA 4B3SF 3BGLA 2KXHA 3I0SB 3DXBA 3CF5Q 5ADZA 3D0GE 2KHCA 5G0RB 1UVNA 3G9CA 4DSFA 4ETXA 1MMLA 3MM8A 1DFDA 4EEYA 5FDLA 4L3NA 5KG0A 2CQHA 3HZEA 4IDKA 4DR4F 4TQSA 4M63A 1SJ1A 3CD7A 5F3TA 1R0AB 3QJPA 1N8RT 5I3PA 2X3GA 1K9MT 2WOMA 3QIPB 3MCSA 2WSEC 5A0YB 5KFOA 2AGOA 1WG5A 2W9AA 1DAXA 3MEDB 1TK8A 3KLGB 4C97A 2FHJD 3BEGB 3KLIA 1WF2A 3MD1A 4QIWD 2JEIA 3D1HA 3O5TB 4WFYA 3BSOA 1NB7A 3MZIA 1VQNS 2JZ5A 3I4HX 4LFAF 1JLFA 2DGSA 1NHVA 5J2PB 3NRBA 4QWDA 1WD6A 2A18A 4WK3A 4C0OC 4ECZA 2AJ0A 2CPFA 4M5DA 3WBZA 3ZC4A 3K8VA 1X5PA 2J0SD 2RQMA 3A1YG 3DYAB 2DGQA 2HGMA 1Z2ZA 3H2LA 4NLPA 3CCUS 2BA9A 3PEJA 4USJC 4CO1A 2ZD1A 1OQ3A 1CQMA 2W9CB 3OXLA 2CQPA 3J81Y 5J1EB 1BQMA 4C3LA 3DOLA 1QSYA 3H2UB 4KBIA 2HMIA 3KHRA 1RYRA 3PO4A 1VQYA 2LA4A 1S1UB 4GKJF 3MOJB 2YNFA 1SBRA 1QAIA 1LWCA 3DN9A 4C8KA 2ALZA 2AYMA 2K7JA 5B0CA 3C6TB 3C6UB 2JWNA 3KNAA 3B82A 3PM9A 2F8EX 3IAS9 1S1WA 1ZM4A 4EO8A 2HWHA 3CCVS 4A8XA 4JI4F 3AH6A 1AFIA 1NKEA 2ZDOA 2HHUA 4OI3A 4N8OA 4MTPA 4K50A 3DU6A 4Z2XA 5HP1B 3FGVA 4DR5F 1VQLS 4C7QA 4B02A 1TQLA 4AL7A 2KM8C 1SKSA 1IKWA 4FYDA 2E9ZA 2GCFA 2R2SA 2EFPA 4PWDB 3SXLA 4O3QA 3RRGA 5DQHA 2MQOA 4CQ1A 1H7WA 3RZAA 4F4ZA 2HPUA 4URGA 2XO7A 1KFDA 1RQ0A 3U02A 3KHHA 4B08A 4HTIA 3LO3A 2UV8A 2HW3A 3J7ZT 4NCGA 1VRTA 3DFEA 2VUGA 4ZPTR 5KFGA 1VC6A 4IFVA 3RRHA 4CNZA 5EUHA 3TYTA 4IOAQ 5GADU 1N0UA 2UVUA 1U1RA 3OR1B 3ISNC 3G86A 5A8RB 3PX4A 4JV5F 3HHDA 3OL6A 4OJ1A 2KYZA 2KRBA 1JNZB 2AYEA 4YB7A 5KFLA 4DLEA 2Y0SD 1U45A 3M6WA 4IO9Q 4AXIA 4MYUA 3I0SA 2BJDA 3HPOA 3MOZA 4YEAA 3V6HA 4QJVA 1FTRA 4I2QB 2RQCA 2JHEA 4FZVA 3VAIA 3JYTB 2J76E 1SJQA 2IVYA 1HPZB 3H5UA 3M8QA 4ECWA 1UVLA 1S97A 1K73T 5HO4A 3R5CA 1L3SA 4YDDB 2YKNA 3OUYB 3RRKA 4C9DA 4N8NA 4TKTA 3V4IA 1RT6B 2UUWA 4IG3B 1UW4A 4OI6A 3W2WA 4LSNB 4HHJA 1UWBB 3VWSA 1X7VA 3Q23A 2LLZA 1I6JA 2KKHA 2HHVA 5AXLA 1JLGA 2IM1A 1S1TA 3KLGA 4XAKA 2YH1A 1A6LA 2M4MA 4NCAA 2HQ3A 3EX7B 1U6ZA 2APOA 2IM2A 4CIOA 1HR0F 1GXTA 3PX0A 2VV5A 2RT3A 3MTJA 1V3RA 4D3GA 1YJVA 1U1PA 1XNQF 4RZRA 4M5DB 2NS1B 3UI3A 3CDAA 2ATLA 1GT8A 5D4OA 4B3OB 2CZVC 3OFGA 4M94A 2HNDB 2EVZA 1DRZA 4JI5F 3FVYA 4H4KA 4IH5A 3H59A 1MWZA 2ZD1B 4Y65A 3G4SS 1KLNA 4PQUA 5J1EA 3I31A 3H4BA 3GG0A 4XIUA 2IRUA 4MKAA 2HMIB 2RJZA 2Z2LA 3OL9A 2DIUA 4OX9F 5CCLA 5F8NA 2OMLA 5EWFA 2GMHA 2VZ9A 2XMUA 2XI2A 3CIZA 1TKTA 2YKOA 2JFKA 4TY9A 2ZNYA 2JVRA 3DLBA 5CH7B 1ULRA 3DRSA 1MU2A 1FDAA 2DGUA 3M32A 4DG1B 2YQ3A 2ZOFA 4XPCA 3Q24A 3FJ2A 3FMBA 2F40A 3MWBA 3V4MA 2CQ2A 2P5VA 4HL9A 4RWXA 3LALA 3U7JA 1JNRB 3UDLA 1FRHA 1K1QA 1S99A 3HHKA 3THPA 4MYTA 2E1MC 4MK8A 1TR0A 3AB4B 5F9LA 4NCBA 4NA3A 1WHWA 2KFYA 2D9PA 4Y2MA 2W7OA 2PI4A 3GFYA 3IG1B 5IM0A 5KT5A 3V6DB 3EGZA 3ZZZA 1JLEB 3JAMY 2ZBCA 3O2IA 4IH7A 3TVKA 5DETA 2PT0A 5J2NA 4IFVB 4OMFG 3JB9k 1X4FA 2DHGA 1TV6A 5C24A 5IWAF 2RQKA 2MKSA 3OR1A 4H4MB 4QW9A 1CPZA 4RKUC 2MQPA 1S76D 4OHZA 5CYQB 2VQEF 2QIFA 2D7SA 3VTIA 4DFMA 3OHAA 4DV3F 4IG0A 2E5JA 2LQBA 5A2QY 2XY5A 1XR7A 3ICLA 3IS9B 4LSLB 3NNHA 1XERA 3WDOA 3TVZA 3M9OB 3JYTA 1XN9A 2MSTA 2RNEA 2HHSA 2R7XA 2XGQA 1YVFA 2HNZA 4QU7A 1H0HB 2K3IA 3MURP 2UXDF 4DQRA 3M2RB 3QPIA 4CO0A 4IH6A 1N5TA 4B3TF 1VLYA 2MY7A 1LFWA 1X4AA 4I1TA 4I4BA 4R25A 3F44A 4FPRA 1I94F 4U7CA 4LF9F 2XWXA 4JYAF 1KFSA 2BVZA 4ZVFA 4P7TA 3T1AA 1JB0C 1RJJA 5A8WB 1X4HA 4FNHA 2FVPA 2LKZA 4DDFA 2DRAA 2D1CA 2I5JA 2BE2A 2LA6A 4WFZA 1UA0A 1LXJA 4WE1B 3MMBB 2BOPA 2DR9A 5HROB 4W92B 2YKMB 1IN0A 3SCJE 4YUDA 2IAJB 5DDPC 3OHBA 1QE1B 1S9GA 2M5YA 5I3QA 4B3MF 1IBMF 2HVZA 3NWGA 4KGMA 4NZ0A 3GYXB 2NUHA 3CCQS 2N82B 3BM7A 1N5QA 3MPWA 4ZCLA 5KFDA 4HH0A 4ED2A 1VQOS 2VPWB 2VBYA 3M2VA 4KO0B 1FD8A 5DGAA 4ILRA 5GADI 5J1NA 2GW8A 3KMSA 3LW5C 4CCHA 1U1KA 1C4AA 3VAJA 1ZZFA 2IC3A 1RT2B 4TNOA 1FXDA 3MUTP 2U2FA 3UR0A 2OPPA 1JLBB 1FK9A 3P96A 3DLJA 3ISND 2HNYA 1S6QB 3CDEA 3VZIA 3TO8A 4Y2KA 1U25A 3DRSB 3GIMA 2CJKA 4ECQA 1G7CB 4Q45A 2UUCF 3MXHP 2OPQA 3TQ1A 5I3UA 1SJ3P 1KNZA 4B9NA 3GR1A 5JXSA 3DRRA 2MKIA 4D3HA 4IFYA 4NX9A 3PFEA 2MHEA 3D28A 1KTVA 1RTIB 4DQQA 3M9MB 3CE8A 4K4XA 4ED6A 1T03A 5FJ4A 2F1FA 4RW9A 5KFVA 1CSJA 1AXQA 3BO2A 3MMAA 1LWFB 4Q2MA 4X84A 1LW0A 1TUVA 2VG6A 4C8ZA 3JSRA 3GE9A 3V2UC 2DPJA 2YWEA 4N41A 1JXEA 1N0VC 3MM5A 4ZP9A 4AL5A 1VRUA 1D8ZA 4Y6IA 2PE8A 2XMKA 2O67A 4ICLB 1VMBA 2DD8S 4F50A 4UY8T 5DG8A 1RT3A 3P49B 2E44A 1FXRA 2XMJA 2YWHA 3IGNA 1TV6B 5HI7A 1SV5B 2RRNA 1F60B 4HDHA 4WFXA 5KFEA 4DLGA 1U49A 1RTDB 1FD2A 2KT5A 5T14A 1Q8BA 2L08A 4I2PA 2RU3A 2MSSA 5DM7Q 4E0DA 4I6AA 1YSJA 4M95A 4H4OB 2EK6A 2PMZD 1EETB 1M90T 2PI5A 5G0RA 4H54A 2LXUA 4IG0B 3QYYA 1V3ZA 4RBUA 4OJ3A 5SZTA 2MPUA 3MHYA 2KXFA 5KT3A 1Q81T 4U9RA 1K1SA 3BS9A 1YTYA 4TN2A 4L72B 1SB6A 2DGVA 4ZPAA 5BR8F 4NLUA 2VOPA 3AJ2A 4ID5B 5M2PA 1Q4RA 4M1KA 4I7FB 2N3LA 3ENWA 1H38A 1TL5A 4F67A 1WEZA 2OP5A 3EXYA 4X66F 3LWMA 2R7WA 1T94A 5H1SV 2FIUA 1H98A 3DLGB 4UQGA 3GIJA 3TA1A 2PA3A 2M7SA 2N7YA 2EFVA 2V0NA 2I5JB 1N34F 1JLQA 4FVCA 2F9JA 4WTYA 2GO8A 2F3JA 2FHMA 2X1FA 1FRKA 4G3IA 2KJVA 3D54A 3S8SA 5A6PA 4NZ7A 1LXNA 3CTRA 1FEEA 5DG7A 2VBZA 3O3LA 5KG7A 4DQIA 3HVTB 4CO3A 2JOQA 2KXNB 4WK1A 4DSKA 4NRUA 4DV7F 1X5SA 4QWBA 3SSQA 3NS6A 3LF0A 2DGWA 2DR8A 3SEOA 3H25A 3TVYA 1ZTWA 1RT2A 1HNIB 3QIDA 5CQGA 3JTOA 4Q2LA 2FY1A 1VIOA 1JX4A 2KI2A 2OPRA 4HH1A 4A8YA 5LXYA 1KQKA 4CO4A 5AXMA 5DJBA 3C6TA 4DL0C 1C1CB 3M30A 1S1WB 2DT9A 3X3UA 2C42A 1WHVA 3O6QA 1QY7A 3IXQA 4G1QB 3Q8SB 5CD4H 1H7XA 5K14B 1FF2A 4JI1F 3LH2S 1TFWA 4WFBQ 2IJNA 2GV1A 3Q2TC 3G8TA 2LEPA 5CZXA 2E5HA 2OD4A 5GMKa 2J9EA 2LVWA 3KWMA 4OQJA 2HAIA 4RW9B 5KFKA 1T05B 1VQ4S 1RAJA 1HD1A 1MROB 3US5A 1N5YA 4G1IA 1HBUB 2CIMA 2ZJRQ 2ZC4A 5IXUA 3PW5A 4KSEB 4DUYF 2FVSA 3OFFA 5HMYA 2V4RA 3HK2A 3KG1A 1DZ5A 5HMXA 5KFFA 1YJTA 4A4JA 2FGOA 1DTQB 3MUMP 1NHUA 4Q5VA 4J5OA 3OLBA 1RT7A 5A6WA 5CCMA 2JSXA 2O66A 1HNZF 3UNGC 1Q82T