2OD5A

Crystal structure of a putative nucleic acid binding protein (jcvi_pep_1096688149193) from uncultured marine organism at 1.79 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
ETESMKTVRIREKIKKFLGDRPRNTAEILEHINSTMRHGTTSQQLGNVLSKDKDIVKVGYIKRSGILSGGYDICEWATRNWVAEHCPEWTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of hypothetical protein (JCVI_PEP_1096688149193) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 1.79 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Dna binding protein
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2od5A00
3BOQA 1P4XA 4KFCA 4U7DA 2VBZA 3HSEA 1B9MA 2E7XA 4WX9A 2B0LA 1STZA 3FZVA 4AIHA 3QP6A 1KYZA 3I71A 3BP8A 4LJZF 1ULYA 1XSVA 4EJUA 5FLXZ 1LDJA 2QENA 2FA5A 5ICGA 5DDGA 5E1XA 2QQ9A 1R00A 3HSRA 4I7HA 2HQNA 1IF1A 1Q1HA 3R60A 5JR3A 4S04A 2DPDA 1G3SA 2RC4A 4GYIA 3RJPA 3CUQA 1W7PA 2HYGD 4XSZF 2CG4A 5F6FA 3SZTA 5E20A 4QWQA 1HW1A 2JT1A 1U3EM 1R7JA 2DW4A 4Q4ZF 1TBXA 1ZGJA 1CF7A 2PQ8A 2L02A 1NHAA 3KLOA 1UHMA 2O03A 1T2KA 1LB2A 1BC7C 3L09A 2KIUA 2X0LA 4G6DA 1G3TA 3DKWA 1HW2A 3E6DA 3R61A 5FD6A 4EJWA 2PBIA 3WTSC 4B09A 1WQ2A 4L0YB 2KRFA 2XKPA 5LHGA 2A6HF 2L4AA 1T38A 1CF7B 2OAZA 4KA4A 1W5TA 4PCQA 1F5TA 3M7GA 4EVIA 3CTAA 4G8XA 2FE3A 2CO5A 3VOEA 2QQAA 3E97A 3TDZC 3ZP5A 2EV6A 2XAJA 1I6XA 1OYWA 4ESFA 5K5OA 3BZ6A 1J2XA 5CLSA 3IRRA 4OIRF 3HIFA 4ENJA 1FP2A 4KUMA 2HQRA 1XCBA 2EFNA 5LEJA 3G3ZA 2F5EA 1O3QA 2UXXA 4U88A 3V4GA 3F8FA 1XMAA 1DPUA 3ULQB 2IRFG 4P5OA 3GFLA 4HX8A 5HDKA 5D6FA 3HRSA 3RPQA 2M8EA 2RNJA 3IRQA 2EFOA 1L3LA 4G7ZF 1XSDA 2VE8A 3FWEA 4HQMA 1YO5C 2LKPA 3E3VA 1FBUA 2CW0F 1ZN2A 3RKWA 1TNTA 1U78A 5L3DA 4HX7A 2DQRA 4ENMA 5DV5A 3L9FA 3IL2A 4EQQA 2G9WA 2CSOA 1I5ZA 2O3FA 2L54A 5D8KB 1USSA 2HWVA 3ZMTA 5LGTA 3EQLF 3W6JB 3SHFA 2GIVA 4BAYA 3TOAA 2E1NA 2XAFA 1MD0A 2CYYA 3BJOA 1P92A 1JXSA 4OIOF 5DCMA 3BPXA 4KN4X 3F8NA 1KQ8A 1PDNC 3ERED 3Q5FA 2K7LA 5E8GA 2EK5A 2QUFA 3HHGA 1JE8A 3HUGA 4G7OF 4HLYA 4AVPA 1RNLA 3I5UA 3MCZA 4LK0F 4UV8A 3TKYA 4UVCA 2F5CA 1U5TC 5LHIA 1W7PD 5BOXA 4FX0A 3F6OA 5DCMB 5CVIA 1CGPA 3MEXA 1EH8A 5ILSA 1FLIA 2GXGA 4Q5SF 1D3YA 4AIKA 4CZZA 3F22A 4HOBA 2FEZA 4A0XA 2DK8A 2R7FA 2Z5UA 1SFEA 1OR7A 1GXQA 3T1BA 3K1MA 1MGTA 2J5PA 2L01A 1HBXG 4ENNA 5BS6A 3RPUA 1FX7A 1WSUA 4LLGF 1R1TA 2XHKA 2VONA 1I1SA 4HLXA 2A5YB 2BGCA 1J75A 4M72A 3CDHA 2PFBA 1Y0UA 2ESNA 4Y15A 3J80K 1D5VA 4U0WA 3K1PA 3R0JA 5DEQA 4RGXA 1ZH5A 2G7UA 6PAXA 4NHJA 4RS8A 3WU0A 1HW5A 5ILUA 3E6MA 5HLGA 3KE2A 2QZ8A 4CGZA 3BWGA 4HX4A 3OV8A 5A2QK 2KIFA 3T5XA 2XROA 1RIOH 2K02A 1FC3A 4G7HF 1OYIA 1O3TA 5D5WB 3FX3A 1HSTA 4B8XA 3EYIA 3ZMSA 4UNOA 3ZMZA 3SFZA 2YPRA 2DT5A 1FBQA 1YTYA 1BN5A 3OOPA 2K86A 3JSOA 5E18F 2M1BA 5LLQA 2ISZA 3RYRA 3V7SA 2ZMEB 2L4MA 5J8CA 3T8RA 3DQVC 2K27A 2OD5A 2XIGA 5L3GA 2O61A 2P8TA 5LGUA 3MFKA 1BOAA 1USTA 1ZYRF 2XRNA 1K78A 2EA4A 4BNCA 1IW7F 5ICCA 1JHFA 1L0OC 3FF5A 3NRVA 5D8LB 4EGYA 3KP2A 1MDMA 4WK8F 4M9ZA 1ONVA 3FM3A 5FLXK 2VT2A 1FYLA 4XBFA 2GAUA 1K78B 3WTXC 3V8LA 2A6EF 1R1VA 5CYVA 4Y13A 3ZMDA 5BMZA 3LSTA 3KCCA 1MDMB 4EJVA 3HTSB 1O57A 4XLPF 4GCVA 3FMRA 3DF8A 3LA3A 5K5RA 5F1RA 1O3RA 4MQ9F 4A12A 5HS7A 1QGPA 1KU2A 2OQRA 2RN7A 3RDIA 5ERIA 1ZRFA 3IKTA 1XCVA 1B6AA 3WG9A 2ZNYA 2DBBA 2JTVA 3K69A 2P6TA 2EFPA 2XGXA 1ZREA 4G6QA 1PP7U 1ZG5A 4M74A 3WTVC 5ILVA 2R7DA 4HF0A 1B59A 5JHUA 2OQGA 5HLHA 1BM9A 2XASA 1P4WA 1YIOA 3ZQ7A 3GZ6A 4MEYF 3FHZA 3W6KB 1QO0D 2RKHA 5D4SA 1FZPB 3MZHA 2E1CA 1BIBA 3RIRA 4P9FA 2JSCA 3JTGA 1H9GA 3K9TA 1U5TA 4EV0A 1ZG3A 5KK1A 5J8FA 3RKXA 2JRTA 5L3EA 3VODA 4NB5A 3BDDA 3L7WA 2EB7A 1ON1A 1XN7A 4DNCA 3GZ5A 4ZZLA 1TLHB 2DTRA 2VOPA 4H0EA 3FXQA 1YLFA 3WTWC 2DO7A 2L3DA 2FMLA 4IPAA 1LVAA 1SFUA 4IHSA 3M8FA 5F64A 5DUIA 3LAPA 1ZLKA 3JTHA 3GF2A 2DAOA 1KQ9A 1S3JA 4DQ2A 5DYMA 3ECOA 1R5HA 3QAHA 2XKOA 2M87A 3EETA 1Z05A 4A5NA 3ZMVA 3HRUA 1TQPA 5CVJA 4L9VA 2EWNA 4M6XA 2OU2A 3K1NA 5IT9Z 1QNTA 1EV7A 1JGSA 1XGOA 4AD9A 2FBIA 4RB0A 3ZMUA 3O3KA 2A61A 2QWWA 2V1DA 1ZLJA 2W84A 5AONA 1E17A 2A07F 3CUQB 4LLLA 4ASNA 4M6YA 1W7PB 1IN8A 2RQPA 1I27A 1TW3A 1SMYF 2H6BA 3U1DA 2W25A 3I64A 2VT3A 1Z9CA 3RYPA 4IF4A 2MLGA 4EM0B 4RB2C 2IVMA 1VTNC 4R1HA 3TOBA 3KP4A 4HZFA 2IA0A 3DPTA 3WTZA 2HR3A 1LDKB 2XUBA 2STTA 4ZZDA 4HW0A 5H6RA 5D5VB 4LD5A 4XLNF 4I2OA 3GO5A 3PQJA 4WXDA 2KJBA 4I98B 5DCFA 5EEHA 2H6CA 1EH7A 5FO5A 1HKSA 4HV5A 4OOIA 2DK5A 3I54A 4HAMA 4EJOA 2QQBA 4KMFA 2QBYA 1O7LA 2W85A 2XAHA 5EEGA 3CUOA 2VBWA 3H3UA 2CWEA 1B9NA 2IW5A 3HYIA 4N9IA 5HDGA 1H0MA 4KICA 2Q2EA 3WU1B 4BXUA 1XGMA 2ADUA 4OMZA 4D0PA 1H9TA 2VE9A 4M71A 3ML6A 1K6OA 2K4BA 3WTTC 1IXCA 2XV4S 1MJAA 1IRFA 4WCGA 4A5MA 1SD7A 1QBJA 5K1YA 3Q9VA 2QBYB 1JHHA 2JPCA 1KU9A 1I1GA 2ZNZA 2CGPA 4XSXF 1F9NA 4QLCU 4AIJA 3WODF 3QPTA 4CO8A 2FSWA 5TRDA 4EM1A 3R0AA 1V3FA 4MNUA 4ENKA 1WRJA 2HKXA 2HYFA 1YG2A 5JI6A 1BI2A 5D5XB 1ZRCA 1J59A 1IRGA 1IZ1A 3F6VA 2ZJ2A 4FHTA 4LFUA 5BPIA 3KEOA 3SQNA 4LGWA 1KQ0A 4I02A 4U0YA 5HVQC 2KJCA 4MGRA 3WGIA 2UWMA 2FRHA 3C1DA 1G4DA 3LA7A 2LF8A 2STWA 2QLZA 5K5QA 1P4AA 4Y17A 4E70A 4YIFA 2FU4A 3R6SA 1DP7P 1IXRC 3EYYA 4FT8A 2M5WA 1YYVA 4HF2A 2ZKZA 4ZYHA 1KYWA 4P9UA 3DV8A 4A2UA 3HHHA 3CJNA 3JW4A 2FXAA 2NNNA 4MEXF 5CVVA 5FFZA 5BQTA 3AAFA 5HLIA 1B1BA 1HKQA 1T98A 5LRRA 2MD5A 1YS7A 3MQ0A 3KFWX 5FD5A 3E6CC 3Q9SA 5TJJA 4OINF 3K2ZA 2Z9OA 1OPCA 3GEZA 1ZAOA 2HFHA 1TTYA 3DPLC 3N4MA 1V4RA 3LWFA 3P7NA 5BPDA 3J7AO 3IWFA 2K4JA 4HA8A 4KT5C 4EGZA 2M45A 1RZ4A 4LMYA 1WI9A 1FOKA 1UCRA 2DLLA 2HTJA 1TQMA 1HSJA 2FNPA 2LF7A 4HQEA 1FYMA 2P7CB 3BJ6A 2TDXA 3V7RA 4HBLA 4HYEA 3IHUA 2MH9A 1C0WA 1IAWA 2HZTA 3TO9A 3JSPA 3V8JA 1LQ1A 5KVRA 1PP8F 3KETA 3K0LA 2NNYA 2V1XA 2FBKA 4HV6A 3ZN0A 3E6BA 5LRSA 5DUKA 1WWXA 3G73A 2NRAC 3I53A 4PZJA 1TQIA 2IT0A 1A04A 2OZUA 3WE3A 3SXYA 1KGSA 5LEKA 4PDKA 1HKTA 3EUHA 3LQRA 1K7AA 5CJ9A 3FXRA 2IA2A 1S7AA 2E7WA 5IT3A 4CXFA 1G3YA 1LJ9A 2VC0A 3HSFA 1LEBA 3I4PA 1R36A 5FB2A 2MC3A 3C3WA 4KIBA 2NYXA 1FPQA 1YQAA 3LQQA 1OKRA 5JFRA 2PMHA 3IC7A 3H3ZA 2A3SA 3HOSA 4A6EA 2D45A 1BJAA 1J9IA 4L9TA 3L00A 2MH2A 4GYGA 3J81Z 3VB2A 4KYWA 1Z91A 2CFXA 1UFMA 3LAJA 3DP7A 2D2WA 4HDUA 1FYKA 2HGCA 5JVTA 2Z99A 1AWCA 2AXLA 4O5VA 1TNSA 1ODDA 3TGNA 1T0FA 2GA1A 4MQVA 2P5LC 2P6SA 4ZH4F 1GHCA 3T0YA 4I0AA 2COMA 4ETSA 2RGVA 5LGNA 1LNWA 4Q47A 3FMSA 2XVCA 1SAXA 1XSXA 4AWXB 2O8XA 4IRGA 3N97A 1G3WA 2ZO4A 4IRIA 1Z1DA 3F8BA 4BYYA 3GWZA 2F2EA 3CO7C 3COAC 4LG0A 2Z33A 2YR2A 5IT9K 1MJ9A 2FQ3A 5ICEA 4U7BA 2EA2A 3I58A 1FBSA 4N0BA 3ECHA 2RDPA 4ZYDA 1U2WA 2HEOA 3QU6A 1F1ZA 4MHGA 4ON0A 3GFMA 3FXUA 4LG0B 3ABTA 1EH6A 1Z7UA 2LDUA 1P2FA 4I0BA 4P55A 3E5XA 2X4HA 3M1EA 3I59A 1Z6TA 2LNBA 3ROUA 2WC2A 2PLYA 3DXJF 3IWZA 1R1UA 2XAGA 1LEAA 4FX4A 2W57A 3MWMA 4G9YA 3GUDA 5AIPA 4UUVA 1YW9A 4NQWA 2PMUA 2HOEA 2A69F 2HDCA 4RAYA 4IXAA 3KZZA 3F23A 1U5TB 4RGRA 2EV5A 4N9HA 2GWRA 4YIIA 1YW8A 1R23A 1GXPA 2QYOA 2DQLA 3JAMZ 3RI4A 4G94A 4IJAA 2V9VA 2VBXA 2NAZA 2IP2A 4CYDA 1FSEA 3GX4X 4OIPF 2FOKA 2GQQA 3O2PE 5E17F 5LHHA 3SZPA 3ELKA 2OZ6A 2QVOA 1W5SA 3V8KA 4KMUX 1HXDA 1P6RA 5ICFA 4UXNA 2QM3A 3RKYA 5HDNA 1RI7A 1D8KA 1GVJA 3C7JA 2PI0A 4L5JA 4YG2F 1XB4A 1ON2A 2A68F 2GXBA 3VFZA 3GW2A 4HDVA 4A0YA 2DI3A 3GVAA 4I09A 1BBYA 3ISPA 4YFKF 5AIQA 4BHCA 4JBAA 2WWYA 3GLXA 2D1VA 3BJAA 1FY7A 2WV0A 3EDPA 4EJTA 2RV8A 1IN6A 2IJLA 1S6LA 3WGGA 1UB9A 3LA2A 2VODA 2PJPA 1OMIA 4RGSA 4UHTA 1BC8C 3WGHA 1ZHFA 3M8EA 2C6YA 1QQIA 2P5VA 5HOOA 3MAJA 4CHUA 4UV9A 3WTUC 5E8IA 4LLNA 1UHWA 2BYVE 3T8TA 2DFIA 1J7KA 4YFNF 4OIQF 1ZRDA 2ESHA 4P96A 1BI3A 3CLOA 5D5UB 1XDUA 5H20A 1IN4A 3NQOA 2HTSA 4KN7X 1OYYA 4O6JA 4M73A 1PUEE 3CO6C 3F3XA 1SD4A 3KP7A 5L3FA 1XGSA 4TV7A 1U6GA 4RB1A 2Y48A 4LB5A 2FNAA 1RUOA 1T39A 1BI1A 1MZBA 4K2EA 3ZPLA 1QPMA 5CVUA 1KU7A 4ESJA 2YX7A 4HF1A 1ZGAA 4R8HA 4Z2YA 2Y0MA 1TW2A 2M30A 1F4KA 2YSRA 1U8RA 2EFWA 3KLNA 1DUXC 1FP1D 3ABUA 4KNYA 2Y75A 3GXOA 2KIMA 4A0ZA 4U0VA 4JQFA 2EFQA 5L3BA 3M9AA 3LFKA 3KP5A 2V1UA 3D0SA 1G6NA 2H27A 3QPHA 2ETHA 5LBQA 2F5DA 3F8MA 2V6CA 3R4KA 2J5OA 4L0ZB 2ZCWA 3L2CA 4S05A 2VC1A 4XRFA 2JZYA 1IUYA 2RVCA 2IA1A 3TDUC 1T6SA 2WTEA 3WTYC 3QRFF 3PQKA 4ESBA 4RB3C 1J5YA 1J0RA 4EMSA 4CICA 4WF2A 4BQAA 3J81K 2EJRA 3F72A 3HRTA 4RAZA 2BBYA 4L5IA 1S29A 4Q48A 2MBFA 2DU9A 1MKMA 2UXNA 1XDSA 4A6DA 3P9CA 3GYHX 1B4AA 3TO7A 2LSOA 4YFXF 4ZYEA 3HTUA 1IN7A 3O6BB 4BH9A 1SD6A 3HRMA 1ZARA 2MA3A 4GGGA 4KIGA 4UVBA 4RGUA 4M9XA 1FT9A 3TO6A 1XD7A 4WXHA 4ZYGA 3F21A 1O7FA 2O0YA 3B02A 1S8NA 1BIAA 3CUQC 2VXZA 3KZYA 1KA8A 4BHBA 1HQCA 2H09A 2F5FA 2GA2A 2DPUA 1R22A 3F8CA 5CVRA 2FBHA 2OA4A 2AS5F 2YX4A 2PG4A 5J6XA 2YU3A 1R5GA 5L3CA 4JK1X 3U9GA 4GXOA 5DD8A 3RTRA 1D8JA 2W24A 3WE2A 2HS5A 2Q0OA 2CQKA 1YFHA 4KDPA 1SFXA 1IN5A 4WXCA 2ZMEA 2G7HA 3C18A 4F7ZA 1IXSB 3TQNA 1Z6RA 2R3SA 1K79A 2H94A 3KEQA 1E2XA 4MTDA 3QP5A 1AOYA 4R79A 1RUNA 2OBPA 4L9JA 5ED4A 1XGNA 1R58A 3KP6A 2HKOA 3BROA 4LK1F 1KU3A 1QZYA 1DPRA 3IKVA 4LB6B 2V79A 4BHPA 5HS8A 3BPVA 5FGMA 4EM2A 2FF4A 1S7OA 1FSHA 1YS6A 4PGGA 2P5KA 3V7CA 2PN6A 3BY6A 2Z3YA 4MTEA 3JAMK 4L18B 2ZFWA 3DFGA 3NEUA 2O6GE 1BI0A 4UVAA 3MZYA 5H6QA 5E1WA 3ZN1A 2VBYA 1DDNA 1SD5A 4IVNA 3U2RA 1ZG1A 5D6EA 3I0TA 3P9KA 2ELHA 3S2WA 1SMTA 2XAQA 1MJBA 5E1ZB 3J80Z 1X3UA 3GFJA 4I01A 4OU0A 2VOOA 2ZBKA 2P7VB 2PEXA 4IHTA 3QOPA 3E5QA 1FWZA 3DEUA 2ZXJA 1YW7A 3B73A 3KP3A 5FFXA 1XMKA 5A2QZ 3VEPA 2JPBA 2D1HA 4O3MA 2UZKA 2IPQX 4WWCA 3P9IA 2Q8KA 5HS9A 5DD4A 3HOTA 2FMYA 2BEOA 4IRHA 2ISYA 1O3SA 1REPC 3FM5A 3H92A 4L9NA 1QZZA 2GZWA 3E5UA 2EV0A 4PGHA 3D5LA 3GFIA 5D4RA 1W4MA 4CDGA 3QU3A 2ACJA 2BE5F 2KKOA 3I59B 1WKMA 2NS0A 2MLKA 4OMYA 4M9SA 3FMQA 4GO1A 1LDDA 3PFIA 2VN2A 1FNNA 2BV6A 2P4WA 3REOA 4KIFA
chains in the Genus database with same CATH superfamily
3BOQA 1W0UA 1P4XA 2HOAA 2OPTA 4KFCA 4HNUA 4U7DA 5CQGA 2VBZA 5FRMA 3CLQA 3HSEA 1B9MA 2E7XA 5GADJ 4WX9A 2B0LA 2OTJI 3OYKA 2A6TA 1STZA 2M0MA 3FZVA 4AIHA 2BOLA 1LVKA 3QP6A 3TMOA 1KYZA 3FBNB 1R5ID 3I71A 3BP8A 4LJZF 1ULYA 1XSVA 4EJUA 5FLXZ 1LDJA 2OV7A 2QENA 3DU5A 5FRNA 2FA5A 5ICGA 4C2UA 4CCKA 5DDGA 2L7FP 1Q1VA 2QQ9A 5E1XA 5M5WJ 1IDYA 1R00A 3HSRA 1DU6A 4I7HA 2HQNA 1IF1A 2H8RA 1Q1HA 5GAHJ 3R60A 2JMWA 4V19K 4NC7A 5JR3A 3ESWB 4S04A 2DPDA 4JX5A 1U9OA 2L7MP 4CZCA 3LSHA 2X9DA 1G3SA 1I39A 2RC4A 1WFXA 2HDDA 4GYIA 2KLOA 3RJPA 2JVGA 1MH4A 3CUQA 1W7PA 5B66C 4BY7J 3K4NA 2HYGD 1SVLA 4XSZF 2CG4A 3GCMA 5F6FA 2XRLA 3SZTA 5KNLA 1N77A 3OL4A 5E20A 4QWQA 3OY9A 3OYFA 3LSJA 3CCMI 1HW1A 2YUSA 2YS9A 3E0JB 2XAUA 2CV0A 1MMSA 2JT1A 1R6RA 2PMZA 1R7JA 2DW4A 4Q4ZF 1U3EM 4C2TA 1TBXA 1ZGJA 1CF7A 5KCMA 3J7ZI 1IUFA 2PX9A 2ME0A 2PQ8A 3QYFA 4HEA2 5B1BH 2L02A 1NHAA 3KLOA 1UHMA 2O03A 1T2KA 1LB2A 3S1QJ 1BC7C 5K7FA 3L09A 2KIUA 2VPRA 2OC6A 1NK3P 2X0LA 1A6QA 4G6DA 1G3TA 1D0XA 2EBIA 2X1DA 3DKWA 1HW2A 3E6DA 3R61A 1MNDA 3EUHC 5FD6A 4EJWA 2PBIA 3WTSC 1QHHD 4B09A 4XKBA 1WQ2A 3W3CA 3OS0A 4L0YB 3PO2J 2M9HA 1ERDA 2KRFA 2M4GA 2EZIA 3ZRGA 2XKPA 5LHGA 3F0CA 2JRMA 2A6HF 2L4AA 1T38A 3ZQFA 2EINH 1CF7B 2OAZA 4KA4A 1W5TA 4PCQA 1F5TA 2DCEA 3M7GA 1UG2A 4EVIA 3G71I 3CTAA 1AU7A 2P0WA 4G8XA 2B63J 2DN0A 4IKFA 3H9JA 2F4MB 2FE3A 3OL3A 4KT6A 1SANA 1Z3YA 2CO5A 4W97A 3VOEA 2QQAA 4E7KA 3E97A 3TDZC 3HGGA 3ZP5A 2M4KA 2KHMA 4CUGA 3ZCOA 2EV6A 2BY3A 2XAJA 1QVTA 4RM2A 1I6XA 1OYWA 1WH7A 3ERMA 3MKWB 3H5NA 2KP6A 4ESFA 1Y1WJ 4XK4A 2WV1A 3BZ6A 5K5OA 1J2XA 5CLSA 3IRRA 4OIRF 3HIFA 4J01A 4ENJA 1WJFA 3S3MA 1FP2A 4KUMA 2HQRA 1XCBA 2EFNA 5LEJA 2JUCA 3G3ZA 3QYEA 2OUMA 2F5EA 3OS2A 3CCQI 1O3QA 1WJAA 4ABZA 1D1AA 3JRGA 1B72A 1WJCA 2UXXA 4U88A 4OWRB 3V4GA 4DBRA 3F8FA 1XMAA 1RR7A 1DPUA 4ZDOA 3ULQB 2IRFG 1BR4A 1G8XA 4P5OA 5F1JA 1E3HA 1DQUA 3GFLA 4HX8A 5HDKA 3A01A 2OCEA 5D6FA 3HRSA 4Y52J 3RPQA 2ZXHA 1W5CC 2M8EA 3BT9A 2RNJA 3IRQA 2EFOA 1L3LA 4G7ZF 1MBJA 3LNQA 4W1UA 5E3OA 1XSDA 4UB6C 2XPVA 5M3FJ 2VE8A 3FWEA 4HQMA 2NOJB 3JREA 1YO5C 1B72B 2LKPA 3E3VA 2MSYA 1FMWA 1FBUA 2CW0F 1ZN2A 3HJEA 3RKWA 4AVZA 3RSNA 3GTPJ 1TNTA 3J7YJ 4FASD 4E7LA 1U78A 2FD5A 5L3DA 4NBQA 1OFCX 1XG1A 4HX7A 2HU9A 2HXOA 3S3NA 4IHVA 2DQRA 4ENMA 4XKVA 5EDNA 5DV5A 2E1OA 3L9FA 3IL2A 2ME6A 3OSGA 2NVQJ 4EQQA 2G9WA 3L2QA 2K3FA 5GTHC 2CSOA 4D7MA 1I5ZA 2O3FA 2L54A 5D8KB 1USSA 2HWVA 2KL4A 2WA0A 4CH7A 3ZMTA 2DA4A 2JVHA 3W2VA 5LGTA 3RZOJ 3SJMA 3EQLF 3RKQA 2XSJC 3C2GA 3W6JB 3SHFA 4BGDA 5IOYA 2O5RA 5IP6A 2GIVA 2R7TA 4BAYA 2IAIA 1T33A 3TOAA 2E1NA 2X6YA 2XAFA 1MD0A 2CYYA 3BQZA 2CJJA 3O8GA 3BJOA 2K9NA 2LG4A 1P92A 1JXSA 4OIOF 3W2WA 1VQ9I 5DCMA 3BPXA 4KN4X 3K7AJ 2L9NA 3F8NA 1KQ8A 1PDNC 2WADA 4DBQA 3ERED 3CC7I 1YX5A 2GBYA 3Q5FA 2K7LA 5E8GA 1BA5A 1TWCJ 2EK5A 2QUFA 3HHGA 1JE8A 3HUGA 4G7OF 2DDAA 4XLHA 4HLYA 4AVPA 1RNLA 3L2RA 3I5UA 5DTDA 1A6IA 1QU3A 3MCZA 4LK0F 4UV8A 3TKYA 4UVCA 2F5CA 1WH5A 2R7QA 1V5FA 1M1EB 1U5TC 4OAZA 5LHIA 1W7PD 3W2AA 5BOXA 4FX0A 3TEDA 1X19A 3QYBA 2HI3A 4B44A 1ORKA 3F6OA 4YEJA 5DCMB 4DZJA 4Z6YA 5B3SH 5CVIA 1CGPA 3MEXA 3OSFA 1EH8A 5ILSA 3ZXSA 3GTJJ 4Y4RA 1FLIA 2GXGA 4Q5SF 3KIOA 2WAFA 1D3YA 4AIKA 3HUGB 4CZZA 2DMQA 4JX6A 1MMAA 3F22A 3S1NJ 3DTIA 4BJ5C 4HOBA 2FEZA 4A0XA 3CCLI 2DMNA 2DK8A 2R7FA 2Z5UA 4A3MJ 3OIOA 2VIXA 1D1CA 4BUPA 1IRXA 1A31A 1SFEA 1OR7A 2AXTC 5F04A 4XNFA 1GXQA 3T1BA 4E7JA 1AKHA 4BQQA 1MH3A 2DMUA 3K1MA 1MGTA 2J5PA 2L01A 2VL8A 5JVGF 4ENNA 1HBXG 5BS6A 3DPUA 3RPUA 1FX7A 1H8AC 2HXIA 1RR8C 2VUMJ 1WSUA 4LLGF 1FMVA 1R1TA 3ZOBA 2XHKA 2RNGA 2WB1A 2P81A 3DTEA 2VONA 1IJWC 3L2UA 1I1SA 4HLXA 1WPKA 2A5YB 1TWFJ 2BGCA 3OYGA 1J75A 4NC8A 4M72A 3CDHA 1YOVB 2PFBA 1OCRH 3KYLA 1Y0UA 2ESNA 4Y15A 3J80K 3FHNA 1D5VA 3GMEA 1JT6A 4U0WA 3PJRA 1G59A 4IZZA 3K1PA 3DCFA 3R0JA 5DEQA 4RGXA 1ZH5A 1AKHB 2JA7J 2G7UA 2HOSA 2CH0A 2JSPA 1APLC 6PAXA 4M3DA 4ZJZA 4NHJA 3HBLA 4RS8A 3WU0A 1HW5A 5ILUA 3E6MA 2DJNA 4CCMA 3DEWA 3HOVJ 5HLGA 3KE2A 4H4KC 2Y31A 2QZ8A 5J3LA 3PFYA 3EUKL 2QCOA 4CGZA 3H3VK 2L7ZA 2UUZA 1R4MB 3BWGA 2GXAA 4HX4A 3OV8A 5A2QK 4HSRA 2KIFA 3T5XA 2XROA 2QQ8A 1RIOH 2K02A 1R9TJ 5EG0A 1BW6A 4MLOA 1FC3A 4G7HF 1R71A 4IHXA 1OYIA 1O3TA 2OCCH 4CCNA 2XPWA 2HYJA 5D5WB 3DU6A 2CU7A 3PO3J 3OYIA 3FX3A 4F92B 1HSTA 3HPHA 4B8XA 3ZMSA 4LG3A 3EYIA 1SC7A 4UNOA 1QVUA 3ZMZA 1U8BA 3SFZA 2YPRA 4F55A 2DT5A 3DBHB 1FBQA 1QZEA 1YTYA 2M7BA 3KYDB 3JR9A 3FISA 1BJZA 1BN5A 3H1CA 2OJED 3OOPA 2K86A 3BCBA 3JSOA 5E18F 4M3FA 2XPUA 2M1BA 5EG0B 2LOOA 5LLQA 3TW6A 3DKXA 2ISZA 2IGOA 3CQZJ 3RYRA 2ZMEB 3V7SA 2L4MA 1AHDP 3GTLJ 4BE2A 5J8CA 3H9QA 3T8RA 3DQVC 3FDYA 2ZJQF 2V7FA 3HEFA 2K27A 2OD5A 2XIGA 5L3GA 1IV6A 2D5VA 2O61A 1IO2A 2IGNA 3G1MA 2ZXIA 2P8TA 5LGUA 3MFKA 1BOAA 1USTA 1ZYRF 4KITB 1NG7A 2DA7A 2DOFA 2XRNA 5KHDA 4GFBA 1ACIA 1K78A 2A05A 2EA4A 3FK6A 4C9YA 1KZHA 4BNCA 1IW7F 1AA7A 1X4OA 5JLWA 5ICCA 4BS9A 3A0HC 1JHFA 4A3BJ 1NG6A 1L0OC 3FF5A 2L5QA 3IAS2 3NRVA 3CP2A 4QSHA 4X1EA 4DJAA 2LKSA 5FJ8J 5D8LB 4EGYA 3KP2A 1UAAA 2CW7A 1XX5A 3BTJA 1MDMA 4FQGA 4WK8F 3PIPF 2QEXI 3GBGA 1ONVA 4M9ZA 3FM3A 1ITYA 1PUFA 3PNTA 5FLXK 2VT2A 1VQMI 3K70D 1FYLA 3OYJA 4XBFA 2GAUA 3BR1A 2IBDA 1K4TA 3DBRB 1JKOC 1K78B 3WTXC 3V8LA 2DOEA 2A6EF 1DP3A 3VYUB 1R4NB 3GLLA 4II2A 2XF5A 1R1VA 4HSTA 5CYVA 2KQRA 5GP9A 3S15J 2I10A 3ZMDA 4Y13A 1LFPA 4ZTFA 5BMZA 3LSTA 2DMTA 3KCCA 1K6YA 4JP0A 2AQFA 1MDMB 2JK3A 4EJVA 3UKGA 3HTSB 1O57A 4XLPF 1GT0C 4GCVA 3FMRA 1PUFB 3DF8A 3LA3A 5K5RA 3HGYA 5F1RA 1BR1A 2XF6A 2BW3A 2CUJA 3PSFA 1Z3XA 2KIQA 2HZDA 1VFCA 1O3RA 2JUGA 1Z77A 4MQ9F 4A12A 5HS7A 1QGPA 1KU2A 4N4NB 2OQRA 2RN7A 3RDIA 5ERIA 1ZRFA 3PL8A 3IKTA 5EEAA 1XCVA 3CMEI 1B6AA 2NVXJ 2K9SA 1OCPA 2CV2A 5E3NA 3WG9A 5JLXA 3AG4H 2ZNYA 1SAUA 2DBBA 3CJQB 2JTVA 3FIWA 4RMNA 3K69A 2R93J 1P9QC 4XQFA 2IGKA 1UG0A 2P6TA 2EFPA 5TGTA 2XGXA 4AYBA 1VQ4I 2E71A 3DBLB 1CQTA 1ZREA 1IG7A 4G6QA 1PP7U 1ZG5A 1MNEA 2M3AA 4M74A 2BW3B 3WTVC 5ILVA 2R7DA 4HF0A 1B59A 2ID6A 1I50J 5JHUA 2OQGA 5HLHA 2XASA 1BM9A 2O9LA 1P4WA 1YIOA 3E7LA 3ZQ7A 5EF6A 3GZ6A 2NS7A 4MEYF 3FHZA 3W6KB 1YIJI 3BR5A 1JJ8C 1QO0D 2RKHA 2TCTA 5D4SA 3KZIC 1FZPB 3MZHA 2E1CA 2CRGA 1BIBA 4RDUA 3RIRA 2MYSA 2VKEA 2JSCA 4P9FA 3JTGA 3A1YA 4ZTJA 1H9GA 2MW8A 2WAQN 1U5TA 3K9TA 2KDZA 3CCEI 4EV0A 2HNHA 1ZG3A 2XC7A 3FK7A 4QPQA 1JI8A 5KK1A 3VYTB 2X6WA 4ZC3A 3C2HA 4E7IA 1Z7LA 5J8FA 3RKXA 2JRTA 5EZGA 5L3EA 3BC8A 3VODA 2W82A 4HNTA 2W48A 4NB5A 3BDDA 3ZQQA 3L7WA 2EB7A 2NOGA 4GRIA 1ON1A 1Z0XA 2GIZA 3LSKA 2EH3A 1XN7A 3O8HA 2MFZA 2F4OB 4DNCA 3RZDJ 1FJLA 2XB5A 4CYCA 3GZ5A 4ZZLA 1TLHB 2DTRA 2VOPA 4H0EA 5IP7J 5TISC 3FXQA 4S0HB 1YLFA 4DW6A 5M5XJ 2HVSA 2DO7A 2L3DA 3WTWC 2FMLA 2W00A 3HOYJ 4IPAA 4XLAA 1YJ9I 2KRCA 1LVAA 1SFUA 2IS1A 3ZQLA 1JUSA 4IHSA 3ASOH 3JRHA 3M8FA 5F64A 1X1DA 3BG7A 5E3LA 1P7JA 2LFBA 5DUIA 4X0GA 1SFKA 3LAPA 2R7VA 1T56A 1ZLKA 4IX7A 3JTHA 3GF2A 3GTOJ 2IXSA 3B6CA 4FETA 5H2FC 2DAOA 1V5EA 1KQ9A 1S3JA 2DA2A 4DQ2A 3I3LA 2O8KA 1HLVA 5DYMA 3JRDA 3ECOA 4B4CA 4CYCB 3RCOA 2VQHA 1R5HA 3QAHA 2XKOA 2M87A 2KZGA 3EETA 3HOWJ 2BXZA 4C2MJ 1Z05A 4A5NA 2DT7B 1JJ6C 3ZMVA 3HRUA 4UB8C 1VZ0A 1E3OC 2VKVA 1TQPA 5CVJA 2JA2A 4HG2A 2BY1A 1XTAA 3BQYA 4XLEA 4L9VA 1TL8A 2EWNA 1GV5A 3SEQA 2ZXWH 3S93A 4M6XA 2OU2A 1SEUA 1X1PA 2QGUA 1E0EA 3K1NA 2E5NA 2JA5J 3TL4X 4RAFA 5LFAA 3CCYA 5IT9Z 1QNTA 4CCOA 1EV7A 1JGSA 1XGOA 4AD9A 2FBIA 4B3XA 1MMNA 4RB0A 3ZMUA 2W1OA 3O3KA 1OLTA 2A61A 2M8GX 2QWWA 3CF2A 2B9SA 1ZTRA 4X6AJ 2V1DA 1ZLJA 2W84A 5AONA 1E17A 2A07F 3CUQB 2NVYJ 4LLLA 4M6YA 1GLNA 3K4LA 4PFOA 1W7PB 1IN8A 4ASNA 2RQPA 3PUFA 1I27A 1TW3A 1SMYF 2BHYA 3M07A 2H6BA 3OYMA 2DFFA 3U1DA 2V9PA 1DGWY 2W25A 5IPAA 3I64A 2VT3A 2KRHA 2LP0A 1Z9CA 3RYPA 2L7KA 4IF4A 2VPLA 4XN3A 2EILH 2MLGA 4EM0B 4YELA 2PJRA 1WI3A 4MFEA 3HKZA 4RB2C 2IS6A 1HA8A 3BG3A 2IVMA 1VTNC 1OQYA 5DM6F 4BY1J 4R1HA 2X85A 3TOBA 1WJBA 2UV1A 3NWSA 1JUPA 3KP4A 1ZK8A 4HZFA 4LOCA 1T8IA 2IA0A 5IY5H 2IEKA 4A3EJ 4XLCA 3DPTA 3WTZA 4ANJA 2HR3A 1LDKB 2XUBA 3H9GA 2STTA 4ZZDA 4HW0A 5H6RA 3E1SA 4B3AA 5D5VB 4M3GA 3GZNB 5J40A 3CMYA 4LD5A 4XLNF 4I2OA 3GO5A 3PQJA 4WXDA 2KJBA 4BQOA 4I98B 3IH4A 2DDBA 5DCFA 5C4XJ 5EEHA 2H6CA 3U1KA 2DA1A 1EH7A 1ETYA 1HKSA 5FO5A 4B48A 4HV5A 3FXKA 4OOIA 2DK5A 3I54A 1D0YA 4HAMA 4EJOA 3CMMA 2QQBA 4KMFA 3L1PA 2QBYA 1O7LA 2HQ5A 2W85A 2XAHA 5EEGA 1RETA 3CUOA 3FKJA 2VBWA 1ETVA 3F9KA 3H3UA 3CP8A 2CWEA 4MO7A 2M34A 3HDDA 2L9SA 3LSGA 4DYRA 1B9NA 2CMPA 4HPQA 2IW5A 3FKIJ 3HYIA 4BEHA 4N9IA 5HDGA 2R7WA 2PMZN 1H0MA 4KICA 2Q2EA 9ANTA 2ZC2A 3WU1B 2W4SA 4BXUA 1XGMA 2VJJA 2ADUA 4OMZA 4D0PA 4DYQA 1H9TA 2VE9A 4M71A 3ML6A 1K6OA 2X6OA 2K4BA 3MKYB 3WTTC 4PUSA 1IXCA 1WGXA 2XV4S 1MJAA 3IP4B 3MD2A 1T0FC 1IRFA 2LTPA 2NVUB 1S5LC 3S8PA 4WCGA 4A5MA 1SD7A 3OOUA 3BG5A 3NARA 1QBJA 3K2AA 5K1YA 3Q9VA 2QBYB 3BZCA 1JHHA 2JPCA 1HF0A 5FKNA 1OCOH 3JCUC 1BW5A 1VF9A 1KU9A 1YX3A 4BEHB 1I1GA 2ZNZA 4HNVA 2CGPA 2V1NA 5B5EC 2Q2EB 4XSXF 2XF7A 1F9NA 5M3MJ 4QLCU 4AIJA 4NNJA 3WODF 3QPTA 4CO8A 2FSWA 5TRDA 4EM1A 3R0AA 1V3FA 4MNUA 3A01B 4ENKA 4XOTA 2LKXA 3UNGC 2FJ1A 3M1CA 3X2QH 1WRJA 2DA3A 2E60A 4XRMA 2F48A 3ZQHA 2HKXA 2HYFA 2WY8Q 3CCJI 2H1KA 2NXNB 1YG2A 2E1MB 2K5CA 3GTMJ 5JI6A 1BI2A 3TP3A 3K4JA 5D5XB 4PSWA 1ZRCA 1J59A 1WJDA 4LITA 1IRGA 1IZ1A 3F6VA 2ZJ2A 1SVMA 4FHTA 4LFUA 3D5RC 5BPIA 3KEOA 3SQNA 4LGWA 3S2HJ 1KQ0A 3I56I 1DU0A 2V6EA 4I02A 4U0YA 2K40A 4A3LJ 5HVQC 2KJCA 4MGRA 3WGIA 2UWMA 2FRHA 1S7EA 3C1DA 3ONQA 1G4DA 1ETKA 3LA7A 4IHYA 3QQAA 2LF8A 2VJ4A 2STWA 3HPGA 2QLZA 2Y0SA 5K5QA 2R0QC 2WBMA 1P4AA 4Y17A 4E70A 4YIFA 3TP0A 5CKTA 2FU4A 4FE7A 3R6SA 2Y69H 2AQEA 1DP7P 1IXRC 1A36A 3OR2C 4A3KJ 3EYYA 1D0ZA 1IRZA 5IP9J 3W6VA 4FT8A 3S16J 2M5WA 1YYVA 2NS8A 1N78A 4HF2A 3AL0B 5EGOA 3A4CA 2ZKZA 4ZYHA 3C2BA 4FTHA 1KYWA 4P9UA 3DV8A 5J4YA 1VQ5I 3SFIA 1DGRM 2CQQA 3BTCA 4A2UA 5C4JJ 3L2WA 3HHHA 3CJNA 3JW4A 2XDVA 2XSDC 4FCYA 1NH3A 1H88C 4D5CA 4L5EA 2FXAA 2NNNA 4MEXF 5CVVA 4IL6C 5FFZA 5BQTA 3AAFA 5HLIA 1VQPI 1B1BA 1HKQA 1T98A 5LRRA 2MD5A 1YS7A 1JUMA 3MQ0A 3CCVI 3KFWX 5FD5A 1XPXA 3E6CC 1ZELA 3Q9SA 2LY9A 5EGOB 3GTKJ 5TJJA 4AUXA 4OINF 4A93J 1Y8RB 3G1OA 2N8GA 3K2ZA 4AM3A 1R49A 1RKWA 3ZQCA 1YI2I 2Z9OA 1OPCA 3GEZA 1D1BA 1ZAOA 2R5YA 2HFHA 1TTYA 3DPLC 3N4MA 1V4RA 3LWFA 3P7NA 5BPDA 3J7AO 3IWFA 2K4JA 4HA8A 3LSMA 2CV1A 2H8WA 2VQGA 4KT5C 2LBFA 4EGZA 2M45A 2WAEA 1RZ4A 4LMYA 5HNFA 3S2DJ 1WI9A 1FOKA 1UCRA 2DLLA 1FOWA 4RLQA 2HTJA 1LUJB 1LFBA 1TQMA 1HSJA 2HPMA 3Q3SA 2FNPA 2LF7A 4I99C 2DFHA 2F6CA 3Q0VA 4HQEA 1FYMA 1EKEA 2P7CB 3BJ6A 2TDXA 3CCRI 3V7RA 4HBLA 4HYEA 3IHUA 2MH9A 4C3IJ 2ECBA 1C0WA 1VNDA 1ZR2A 4C3JJ 2R5YB 4JYKA 1IAWA 2MD0A 4BDYA 4BJ6C 2HDWA 2HZTA 3TO9A 2E2HJ 1TWHJ 3BTLA 3SDBA 3FXMA 3JSPA 2E35A 2KISA 3V8JA 1LQ1A 5KVRA 2F4IA 1PP8F 1KONA 2OF7A 3KETA 3K0LA 2NNYA 2V1XA 1BL0A 2FBKA 4EATA 2LH9A 4HV6A 3ZN0A 3E6BA 5LRSA 3BCAA 4XKCA 4RM3A 5DUKA 3I4MJ 1WWXA 5JHFA 1X2NA 1JTXA 3G73A 2NRAC 3I53A 4PZJA 1QPIA 1TQIA 2IT0A 2EZLA 1A04A 4BE1A 2OZUA 3WE3A 3SXYA 1KGSA 5LEKA 4PDKA 1HKTA 1JT0A 3EUHA 4BQNA 3LQRA 1K7AA 2FQ4A 3QWLA 5CJ9A 1VQ8I 3FXRA 2JWTA 2IA2A 1S7AA 2E7WA 4II3A 5IT3A 2DYRH 4CXFA 1G3YA 1LJ9A 2VC0A 3HSFA 1LEBA 3I4PA 1R36A 3H0DA 5FB2A 2HVQA 3OYEA 2MC3A 3C3WA 4KIBA 3AKZA 2Y2ZA 4BXFA 4D5FA 2LR8A 2HOTA 2NYXA 1GVDA 5LD2C 1FPQA 3G2BA 4BXXJ 1YQAA 3HXLA 2CUEA 3S1RJ 2KMUA 3H0GJ 4XL9A 1A35A 3LQQA 1OKRA 2KT0A 2WB1N 1WZ2A 5JFRA 2PMHA 3IC7A 5F0FA 3H3ZA 2BVMA 3CCUI 2A3SA 2KPMA 5IOZA 4A6EA 3HOSA 4XRSG 2EIKH 2X1CA 2D45A 1K61A 1BJAA 1J9IA 4L9TA 2DOAA 3L00A 2DODA 2MH2A 4GYGA 1BR2A 3J81Z 5E3MA 3IV5A 4FISA 3VB2A 4KYWA 3BTIA 1Z91A 2CFXA 1B8IA 1ZKGA 2JN6A 1UFMA 3FBIB 4A3IJ 3LOCA 3LAJA 3DP7A 2D2WA 4A3GJ 4BBRJ 1SFOJ 4HDUA 3SEZA 3VWBA 1FYKA 2HGCA 5JVTA 2Z99A 1AWCA 2AXLA 4NUBA 1XS9A 2LYCA 1U9NA 1XC5A 4O5VA 1TNSA 1ODDA 3TGNA 2MGQA 1T0FA 2GA1A 1W36C 4Y33A 4MQVA 3LSPA 1Y39A 1OCTC 2P5LC 1O4XA 2LD5A 3AG2H 2P6SA 4ZH4F 1WJEA 1GHCA 3DWLE 4I0AA 2COMA 3T0YA 4ETSA 3CDLA 2RGVA 5LGNA 2GM4A 3M3YJ 1B8IB 1LNWA 4Q47A 3PIOF 1RESA 3FMSA 2XVCA 1SAXA 1LFUP 2R7RA 1OISA 1VQLI 1XSXA 1UELB 4ZDPA 4AWXB 2H1LA 3S1MJ 1ETQA 1X3WB 2L2OA 2O8XA 4N4OB 1IV8A 4DIQA 2CQNA 4IQ4A 4IRGA 3OYBA 3N97A 3ABLH 1G3WA 2ZO4A 2KZVA 4IRIA 1Z1DA 3F8BA 4BYYA 4F93B 3JRAA 3GWZA 2F2EA 4AIDA 3CO7C 3COAC 2QF7A 4U87A 1D5YA 4LG0A 3CC4I 2R7UA 1OJLA 3FXLA 2Z33A 2YR2A 5IT9K 3PSIA 1MJ9A 2VJIA 2FQ3A 3H5AA 3PUBA 1I3QJ 4DGWB 3K4MA 5ICEA 4UUSA 2AHQA 2X1EA 4U7BA 5CQEA 3Q0UA 2ZFUA 2EA2A 4CA0A 3JRBA 3I58A 1FBSA 4N0BA 2K9QA 3ECHA 2RDPA 1WCMJ 4ZYDA 1U2WA 1QHGA 4RAGA 1MBGA 3BG9A 4MIMA 2HEOA 3QU6A 1F1ZA 2ECCA 4MHGA 3JRFA 2F5VA 2X48A 4PJ0C 4F3QA 4QTRA 4ON0A 3GFMA 3FXUA 4LG0B 3ABTA 1J09A 2X6XA 1EH6A 2ZSIB 1Z7UA 2LDUA 4UUSB 1P2FA 4I0BA 4M3BA 1JGGA 4P55A 3E5XA 2X4HA 4ITVA 3M1EA 3I59A 3MKLA 3K70C 1Z6TA 2LNBA 3ROUA 3MVPA 3K4CA 2WC2A 2PLYA 3DEEA 1A5JA 3DXJF 3IWZA 4PSXA 1R1UA 2Y9YA 1S9HA 3D5SC 1VQNI 1E3PA 5J1RA 2R5ZA 3EUAA 2XAGA 1LEAA 4FX4A 1TWGJ 2W57A 1T08B 1FTZA 5J1YA 3IH2A 4PK4A 3MWMA 3MKZA 4DYCA 1FOYA 2TRTA 3KX2A 3Q0WA 4G9YA 1Z67A 4PFPA 3GUDA 5AIPA 4UUVA 1YW9A 4XONA 3AG1H 4NQWA 2VXDA 3FXJA 2PMUA 2DJIA 2HOEA 2A69F 2HDCA 1Y0NA 2EZHA 1X1BA 2ELJA 4NC6A 2E2IJ 4RAYA 4IXAA 1MIJA 2Z2SB 3KZZA 3F23A 3HC7A 3CZ6A 5IYBJ 1U5TB 4D9JA 4RGRA 2R5ZB 1W0TA 2EV5A 4N9HA 2GWRA 4YIIA 1VQOI 1YW8A 1R23A 3ZQGA 1GXPA 1YHQI 2ZJRF 2X51A 2QYOA 2V4JC 5F27A 4BDZA 2DQLA 4HRIA 3JAMZ 3RI4A 2E5ZA 4G94A 2CUFA 4IJAA 2V9VA 2VBXA 4NQWB 3A03A 2NAZA 1OCZH 2IP2A 2LY2A 2JJ7A 1OR7C 4CYDA 4AYBN 2EIMH 2DYSH 1FSEA 5HLTA 3GX4X 4OIPF 2EQRA 2FOKA 2GQQA 1ZGWA 4I76A 1VQ6I 5C44J 3O2PE 1MSEC 5E17F 3GTGJ 5LHHA 3SZPA 3IUOA 4G12A 3ELKA 2OZ6A 2QVOA 1W5SA 3V8KA 3WHBA 4XOPA 4KMUX 1HXDA 4B43A 3WU2C 1P6RA 5ICFA 4UXNA 2VQCA 1TT0A 2QM3A 3RKYA 5HDNA 4RA2A 1MBKA 2V9KA 4G6TB 4PJNA 2M0CA 2BY2A 3DLLF 1RI7A 3ZGKA 2M7AA 1D8KA 1HCRA 3OYCA 1GVJA 1QA6A 1Z21A 2VB6A 3SYTA 3C7JA 1EA3A 3DLAA 2PI0A 4L5JA 4YG2F 1XB4A 2VKHA 1ON2A 2A68F 2GXBA 3VFZA 3VPRA 5GTIC 3GW2A 4HDVA 4E7ZA 4A0YA 3CCSI 2DI3A 3S32A 3GVAA 5GAEJ 4I09A 1BBYA 1BOBA 3ISPA 4YFKF 2R7ZJ 5AIQA 2VI6A 2BHZA 4BHCA 1ZR4A 3P5JA 2XB0X 4JBAA 2WWYA 3GLXA 2D1VA 3BJAA 2K85A 1FY7A 2WV0A 4E4HA 3TW7A 3EDPA 4EJTA 3VDXA 2ZMEC 3GTQJ 1X2MA 2RV8A 3QPLA 4JOMA 1IN6A 2IJLA 1S6LA 3WGGA 1MMGA 3WHCA 1UB9A 1K83J 3LA2A 2VODA 2PJPA 1H89C 1OMIA 2HVRA 4RGSA 4UHTA 1BC8C 3WGHA 1TP4A 1VQ7I 1ZHFA 1UHSA 2PJRB 3M8EA 4CSWA 1N75A 2B7EA 3OR1C 2C6YA 1QQIA 2P5VA 5HOOA 3MAJA 3H35A 4CHUA 1SVOA 4XICA 4UV9A 1EF4A 3WTUC 5E8IA 4LLNA 4XRSA 1UHWA 2BYVE 3T8TA 4A69C 4C3HJ 3IAM2 1RKTA 2DA6A 3J7AY 3PNYA 1J7KA 2DFIA 1X1AA 1F43A 4IOCF 4YFNF 4IHWA 4CCJA 4OIQF 3U21A 2E36A 3K4KA 1ZRDA 4V2FA 2R7SA 2ESHA 3S3OA 1ETXA 5EJCA 2LRDA 4P96A 4XM3A 2CUZA 1BI3A 1F36A 2ELKA 3CLOA 3A0BC 4LIUA 1VQKI 2KFDA 5D5UB 1XDUA 5H20A 1IN4A 3NQOA 2HTSA 4KN7X 5FKKA 2Z1DA 1OYYA 5K7HA 4O6JA 4M73A 3BR3A 4ZYAA 3CO6C 2HQAA 3F3XA 1PUEE 1SD4A 3A02A 3KP7A 1GV2A 5CPRB 1WHUA 3HKZN 3LSRA 3OYHA 4E7SA 3MMYB 5L3FA 3CJRB 1XGSA 4TV7A 1U6GA 4RB1A 2Y48A 4LB5A 4B47A 2FNAA 5J1UA 1ENHA 1QRYA 5BNGA 1RUOA 5F0CA 3HB9A 1T39A 1BI1A 1MZBA 4K2EA 3ZPLA 1QPMA 5CVUA 5FROA 1KU7A 2EPFA 3TBIA 3SZGA 1I3AA 1JTYA 4ESJA 2YX7A 4HF1A 1ZGAA 1MW7A 4R8HA 4Z2YA 2Y0MA 4CCLA 1TC3C 1Y8QB 4F91B 1TW2A 4ZDLA 2M30A 1F4KA 2YSRA 1FOXA 1U8RA 2EFWA 3KLNA 1JKPC 2DTZA 1DUXC 2XGCA 5HODA 2EZKA 4IO9F 1FP1D 3ABUA 4KNYA 2DA5A 2A5WA 5KAIC 2Q1ZB 2Y75A 1G2HA 2FUG2 2KIMA 3GXOA 1XMXA 4A0ZA 5FLMJ 4U0VA 4JQFA 1TWAJ 2EFQA 5L3BA 3PM1A 4P1WA 5EZHA 3N05A 3M9AA 3LFKA 3KP5A 2V1UA 3D0SA 2QKMB 3M4OJ 1EJ9A 1G6NA 1N25A 3LMMA 1TT5B 2H27A 3QPHA 4BBSJ 2BY0A 2ETHA 5LBQA 2F5DA 3F8MA 2V6CA 1FIPA 3R4KA 3HOUJ 3PNVA 4KJZA 2J5OA 4L0ZB 2R92J 2ZCWA 2LLKA 3L2CA 4S05A 2VC1A 2IGMA 4XRFA 3BLYA 2JZYA 1IUYA 2DMPA 2RVCA 2IA1A 3TDUC 3G4SI 3LFUA 2LY1A 2CW8A 2WY7Q 4Y7NJ 2G0EA 1T6SA 2WTEA 3WTYC 1S72I 2V26A 3QRFF 1K4SA 2E19A 1PJRA 3PQKA 5J4VA 2E2JJ 2QKLB 4ESBA 1FEXA 2R4GA 1MNMC 4RB3C 1J5YA 2LVSA 3AFHA 5DS9A 1J0RA 4EMSA 3QODA 1Y56A 3OIQA 4CICA 4WF2A 3OYDA 4BQAA 4DOZA 1HOMA 4C30A 4D1QA 3J81K 2EIJH 3V42A 3AG3H 3ZQIA 2EJRA 2RAEA 3K10A 1NTCA 4E6KG 1JKRC 4QIWN 3F72A 3HRTA 3HZJA 4RAZA 2BBYA 1FIAA 4L5IA 1S29A 4Q48A 2MBFA 4M6VA 2DU9A 4BJTA 5DM7F 2GLOA 1MKMA 3B6AA 2UXNA 5GPAA 1XDSA 4A6DA 3P9CA 4XLFA 2QSGX 2LK2A 3GYHX 1B4AA 1V5GA 3M8JA 3TO7A 3OWTA 2LSOA 4YFXF 3OIPA 4ZYEA 3RQ4A 3HTUA 4BU2A 1ETOA 1IN7A 3O6BB 3CF5F 2JA8J 4BH9A 3H5RA 2MABA 1SD6A 3SDGA 4J00A 3HRMA 2VLAA 1ZARA 2MA3A 4GGGA 3OYAA 4RLFA 4KIGA 4BE0A 4UVBA 3KEYA 1OCCH 3VSLA 4RGUA 4M9XA 2Y0SN 2LMDA 1FT9A 3TO6A 2L0KA 5J47A 5F0HA 1XD7A 1IGNA 4WXHA 4ZYGA 2CFOA 2LBFB 3F21A 1O7FA 2O0YA 1V54H 1ETWA 3B02A 1IDZA 3BG6A 2BXYA 4UY8I 1S8NA 1BIAA 3CUQC 2NVTJ 1HDPA 1POGA 4F52A 2VXZA 3KZYA 1I6HJ 1KA8A 4BHBA 4J19A 1HQCA 4MFDA 2H09A 2F5FA 2GA2A 1LPQA 1X3ZB 4FE4A 2DPUA 1R22A 3F8CA 4NDLA 1UMQA 5CVRA 3ABKH 2CQ7A 3LL7A 1P7IA 2FBHA 2OA4A 2Y30A 3HOZJ 2AS5F 2YX4A 4E7HA 2PG4A 2M2EA 3BR6A 5J6XA 2MG4A 2K9LA 2YU3A 1R5GA 5L3CA 4PJMA 4JK1X 3U9GA 3HL2A 4GXOA 5DD8A 3RTRA 1D8JA 3S17J 2GOMA 2W24A 2O7OA 3WE2A 3WG7H 2HS5A 2Q0OA 2CQKA 3I9V2 1YFHA 4KDPA 3DKYA 2MC4A 1PVEA 1SFXA 3CDIA 3MZ8A 4UUTA 1IN5A 1HDDC 4WXCA 2ZMEA 4RBOA 2G7HA 1W36D 1JKQC 3C18A 4F7ZA 1IXSB 3TQNA 2YU9J 1Z6RA 2DT6A 2R3SA 1K79A 2H94A 2ICWG 3KEQA 4A3FJ 4BKXA 1E2XA 2E34A 1MBFA 1NK2P 5FLVA 1W1WE 2RREA 3ZR8X 2R7OA 4MTDA 3QP5A 3S14J 1AOYA 4R79A 1RRJA 3KPHA 1RUNA 1IC8A 2COBA 2OBPA 4KISA 4L9JA 5ED4A 3OS1A 1FTTA 3LSIA 1XGNA 1R58A 1GUUA 3K4BA 3KP6A 4OAYA 2HKOA 1LKXA 3CD6I 3G6EI 3K6GA 3CMAI 3BROA 4LK1F 3I55I 1KU3A 2FOWA 3OMYA 1QZYA 3BR0A 3EPZA 3ABMH 1DPRA 3IKVA 2W7NA 3QPSA 2XGEA 1MMDA 4LB6B 2V79A 5E79C 4BHPA 5HS8A 4GDFA 3BPVA 3IH3A 1GDTA 5FGMA 2ZJPF 4EM2A 4IQJA 2FF4A 1S7OA 1FSHA 1YE9A 1YS6A 1TZLA 4XR6A 1UJ8A 2QSFX 4AU7A 3NAUA 4PGGA 2GOXB 4M3EA 1RPWA 2ZB9A 2P5KA 3V7CA 1T95A 2CQXA 2PN6A 4YIRX 2K9MA 4A3DJ 3BY6A 2K3PA 2Z3YA 4MTEA 2I8DA 3OYNA 3QOEA 3JAMK 1YRNA 4L18B 2ZFWA 3DFGA 4DZPA 1Y6IA 3NEUA 2LREA 3BZKA 2O6GE 1BI0A 3VSKA 3HM5A 4XORA 4UVAA 3HG9A 3CC2I 3MZYA 2Y9ZA 5H6QA 5E1WA 3ZN1A 4XIDA 3H36A 5C3EJ 2AO9A 2VBYA 1DDNA 1SD5A 4IVNA 3U2RA 1VI0A 1ZG1A 1X4PA 5D6EA 1X58A 3HOXJ 1LE8A 3JRIA 2I5UA 3I0TA 2E1MC 2WAQA 3P9KA 2ELHA 3S2WA 1SMTA 5F08A 2XAQA 1RC9A 2ZSHB 4V2GA 4QPOA 1YRNB 3OYLA 1MJBA 3ASNH 5E1ZB 3J80Z 1UZCA 1YITI 1X3UA 3GFJA 4I01A 4OU0A 3RQIA 2VOOA 1V55H 5GAGJ 2ZBKA 2IS4A 2P7VB 1U0JA 2PEXA 2VASA 4IHTA 3QOPA 3NWTA 3E5QA 4BL0B 1FWZA 2VQLA 3G1LA 5IYDJ 3DEUA 2VKDA 3CESA 3UR3C 4B1RA 4I6ZA 2ZXJA 1YW7A 3B73A 2RQQA 3KP3A 5FFXA 3VYRB 1LE8B 1XMKA 5A2QZ 3VEPA 1ZQ3P 2JPBA 2XGDA 2D1HA 2IS2A 4IOAF 4JX4A 5FKMA 3L2VA 3JRCA 1MBHA 4O3MA 4XKWA 4Y3OA 5KAFC 5B1AH 2UZKA 1WJ5A 2IPQX 1MBEA 4WWCA 3AL0C 2VJ5A 3P9IA 3KYCB 2Q8KA 5HS9A 3DTKA 2BVLA 5M5YJ 4YRVA 1X1CA 2DXIA 5DD4A 3HOTA 2BZTA 2FMYA 2BEOA 4IRHA 2ISYA 1O3SA 1REPC 4A3CJ 3FM5A 3H92A 3CJTB 4L9NA 1QZZA 2R7XA 2GZWA 4XN0A 3E5UA 2EV0A 2KDOA 4BACA 4PGHA 3D5LA 3GFIA 3RPUD 2HPIA 4XMYA 3BR2A 5D4RA 3A2KA 4AC0A 1Y1VJ 2CS3A 1W4MA 2L9RA 4CDGA 2JQ7A 4EEFG 3QU3A 5K7ZA 2L9VA 1YJNI 5FKOA 2ACJA 4PJLA 2ID3A 5IYCJ 3FXOA 5GPCA 2QA4I 1MSFC 2BE5F 3I4NJ 2KKOA 3I59B 4A3JJ 4LIVA 3D1NI 2OTLI 1WKMA 1YJWI 1WVRA 2DFEA 2NS0A 2MLKA 2FX0A 2QSHX 1PYVA 4OMYA 4M9SA 3FMQA 4GO1A 4D7NA 1LDDA 3MN2A 2Z16A 3VYSB 4IEJA 5EYRA 5HNHA 2LC2A 2JA6J 5FKLA 3PFIA 1HC8A 2VN2A 4PJJA 1FNNA 2BV6A 2P4WA 3REOA 4KIFA
chains in the Genus database with same CATH topology
3BOQA 1P4XA 4KFCA 4U7DA 2VBZA 3HSEA 1B9MA 2E7XA 4WX9A 2B0LA 1STZA 3FZVA 4AIHA 3QP6A 1KYZA 3I71A 3BP8A 4LJZF 1ULYA 1XSVA 4EJUA 5FLXZ 1LDJA 2QENA 2FA5A 5ICGA 5DDGA 5E1XA 2QQ9A 1R00A 3HSRA 4I7HA 2HQNA 1IF1A 1Q1HA 3R60A 5JR3A 4S04A 2DPDA 1G3SA 2RC4A 4GYIA 3RJPA 3CUQA 1W7PA 2HYGD 4XSZF 2CG4A 5F6FA 3SZTA 5E20A 4QWQA 1HW1A 2JT1A 1U3EM 1R7JA 2DW4A 4Q4ZF 1TBXA 1ZGJA 1CF7A 2PQ8A 2L02A 1NHAA 3KLOA 1UHMA 2O03A 1T2KA 1LB2A 1BC7C 3L09A 2KIUA 2X0LA 4G6DA 1G3TA 3DKWA 1HW2A 3E6DA 3R61A 5FD6A 4EJWA 2PBIA 3WTSC 4B09A 1WQ2A 4L0YB 2KRFA 2XKPA 5LHGA 2A6HF 2L4AA 1T38A 1CF7B 2OAZA 4KA4A 1W5TA 4PCQA 1F5TA 3M7GA 4EVIA 3CTAA 4G8XA 2FE3A 2CO5A 3VOEA 2QQAA 3E97A 3TDZC 3ZP5A 2EV6A 2XAJA 1I6XA 1OYWA 4ESFA 5K5OA 3BZ6A 1J2XA 5CLSA 3IRRA 4OIRF 3HIFA 4ENJA 1FP2A 4KUMA 2HQRA 1XCBA 2EFNA 5LEJA 3G3ZA 2F5EA 1O3QA 2UXXA 4U88A 3V4GA 3F8FA 1XMAA 1DPUA 3ULQB 2IRFG 4P5OA 3GFLA 4HX8A 5HDKA 5D6FA 3HRSA 3RPQA 2M8EA 2RNJA 3IRQA 2EFOA 1L3LA 4G7ZF 1XSDA 2VE8A 3FWEA 4HQMA 1YO5C 2LKPA 3E3VA 1FBUA 2CW0F 1ZN2A 3RKWA 1TNTA 1U78A 5L3DA 4HX7A 2DQRA 4ENMA 5DV5A 3L9FA 3IL2A 4EQQA 2G9WA 2CSOA 1I5ZA 2O3FA 2L54A 5D8KB 1USSA 2HWVA 3ZMTA 5LGTA 3EQLF 3W6JB 3SHFA 2GIVA 4BAYA 3TOAA 2E1NA 2XAFA 1MD0A 2CYYA 3BJOA 1P92A 1JXSA 4OIOF 5DCMA 3BPXA 4KN4X 3F8NA 1KQ8A 1PDNC 3ERED 3Q5FA 2K7LA 5E8GA 2EK5A 2QUFA 3HHGA 1JE8A 3HUGA 4G7OF 4HLYA 4AVPA 1RNLA 3I5UA 3MCZA 4LK0F 4UV8A 3TKYA 4UVCA 2F5CA 1U5TC 5LHIA 1W7PD 5BOXA 4FX0A 3F6OA 5DCMB 5CVIA 1CGPA 3MEXA 1EH8A 5ILSA 1FLIA 2GXGA 4Q5SF 1D3YA 4AIKA 4CZZA 3F22A 4HOBA 2FEZA 4A0XA 2DK8A 2R7FA 2Z5UA 1SFEA 1OR7A 1GXQA 3T1BA 3K1MA 1MGTA 2J5PA 2L01A 1HBXG 4ENNA 5BS6A 3RPUA 1FX7A 1WSUA 4LLGF 1R1TA 2XHKA 2VONA 1I1SA 4HLXA 2A5YB 2BGCA 1J75A 4M72A 3CDHA 2PFBA 1Y0UA 2ESNA 4Y15A 3J80K 1D5VA 4U0WA 3K1PA 3R0JA 5DEQA 4RGXA 1ZH5A 2G7UA 6PAXA 4NHJA 4RS8A 3WU0A 1HW5A 5ILUA 3E6MA 5HLGA 3KE2A 2QZ8A 4CGZA 3BWGA 4HX4A 3OV8A 5A2QK 2KIFA 3T5XA 2XROA 1RIOH 2K02A 1FC3A 4G7HF 1OYIA 1O3TA 5D5WB 3FX3A 1HSTA 4B8XA 3EYIA 3ZMSA 4UNOA 3ZMZA 3SFZA 2YPRA 2DT5A 1FBQA 1YTYA 1BN5A 3OOPA 2K86A 3JSOA 5E18F 2M1BA 5LLQA 2ISZA 3RYRA 3V7SA 2ZMEB 2L4MA 5J8CA 3T8RA 3DQVC 2K27A 2OD5A 2XIGA 5L3GA 2O61A 2P8TA 5LGUA 3MFKA 1BOAA 1USTA 1ZYRF 2XRNA 1K78A 2EA4A 4BNCA 1IW7F 5ICCA 1JHFA 1L0OC 3FF5A 3NRVA 5D8LB 4EGYA 3KP2A 1MDMA 4WK8F 4M9ZA 1ONVA 3FM3A 5FLXK 2VT2A 1FYLA 4XBFA 2GAUA 1K78B 3WTXC 3V8LA 2A6EF 1R1VA 5CYVA 4Y13A 3ZMDA 5BMZA 3LSTA 3KCCA 1MDMB 4EJVA 3HTSB 1O57A 4XLPF 4GCVA 3FMRA 3DF8A 3LA3A 5K5RA 5F1RA 1O3RA 4MQ9F 4A12A 5HS7A 1QGPA 1KU2A 2OQRA 2RN7A 3RDIA 5ERIA 1ZRFA 3IKTA 1XCVA 1B6AA 3WG9A 2ZNYA 2DBBA 2JTVA 3K69A 2P6TA 2EFPA 2XGXA 1ZREA 4G6QA 1PP7U 1ZG5A 4M74A 3WTVC 5ILVA 2R7DA 4HF0A 1B59A 5JHUA 2OQGA 5HLHA 1BM9A 2XASA 1P4WA 1YIOA 3ZQ7A 3GZ6A 4MEYF 3FHZA 3W6KB 1QO0D 2RKHA 5D4SA 1FZPB 3MZHA 2E1CA 1BIBA 3RIRA 4P9FA 2JSCA 3JTGA 1H9GA 3K9TA 1U5TA 4EV0A 1ZG3A 5KK1A 5J8FA 3RKXA 2JRTA 5L3EA 3VODA 4NB5A 3BDDA 3L7WA 2EB7A 1ON1A 1XN7A 4DNCA 3GZ5A 4ZZLA 1TLHB 2DTRA 2VOPA 4H0EA 3FXQA 1YLFA 3WTWC 2DO7A 2L3DA 2FMLA 4IPAA 1LVAA 1SFUA 4IHSA 3M8FA 5F64A 5DUIA 3LAPA 1ZLKA 3JTHA 3GF2A 2DAOA 1KQ9A 1S3JA 4DQ2A 5DYMA 3ECOA 1R5HA 3QAHA 2XKOA 2M87A 3EETA 1Z05A 4A5NA 3ZMVA 3HRUA 1TQPA 5CVJA 4L9VA 2EWNA 4M6XA 2OU2A 3K1NA 5IT9Z 1QNTA 1EV7A 1JGSA 1XGOA 4AD9A 2FBIA 4RB0A 3ZMUA 3O3KA 2A61A 2QWWA 2V1DA 1ZLJA 2W84A 5AONA 1E17A 2A07F 3CUQB 4LLLA 4ASNA 4M6YA 1W7PB 1IN8A 2RQPA 1I27A 1TW3A 1SMYF 2H6BA 3U1DA 2W25A 3I64A 2VT3A 1Z9CA 3RYPA 4IF4A 2MLGA 4EM0B 4RB2C 2IVMA 1VTNC 4R1HA 3TOBA 3KP4A 4HZFA 2IA0A 3DPTA 3WTZA 2HR3A 1LDKB 2XUBA 2STTA 4ZZDA 4HW0A 5H6RA 5D5VB 4LD5A 4XLNF 4I2OA 3GO5A 3PQJA 4WXDA 2KJBA 4I98B 5DCFA 5EEHA 2H6CA 1EH7A 5FO5A 1HKSA 4HV5A 4OOIA 2DK5A 3I54A 4HAMA 4EJOA 2QQBA 4KMFA 2QBYA 1O7LA 2W85A 2XAHA 5EEGA 3CUOA 2VBWA 3H3UA 2CWEA 1B9NA 2IW5A 3HYIA 4N9IA 5HDGA 1H0MA 4KICA 2Q2EA 3WU1B 4BXUA 1XGMA 2ADUA 4OMZA 4D0PA 1H9TA 2VE9A 4M71A 3ML6A 1K6OA 2K4BA 3WTTC 1IXCA 2XV4S 1MJAA 1IRFA 4WCGA 4A5MA 1SD7A 1QBJA 5K1YA 3Q9VA 2QBYB 1JHHA 2JPCA 1KU9A 1I1GA 2ZNZA 2CGPA 4XSXF 1F9NA 4QLCU 4AIJA 3WODF 3QPTA 4CO8A 2FSWA 5TRDA 4EM1A 3R0AA 1V3FA 4MNUA 4ENKA 1WRJA 2HKXA 2HYFA 1YG2A 5JI6A 1BI2A 5D5XB 1ZRCA 1J59A 1IRGA 1IZ1A 3F6VA 2ZJ2A 4FHTA 4LFUA 5BPIA 3KEOA 3SQNA 4LGWA 1KQ0A 4I02A 4U0YA 5HVQC 2KJCA 4MGRA 3WGIA 2UWMA 2FRHA 3C1DA 1G4DA 3LA7A 2LF8A 2STWA 2QLZA 5K5QA 1P4AA 4Y17A 4E70A 4YIFA 2FU4A 3R6SA 1DP7P 1IXRC 3EYYA 4FT8A 2M5WA 1YYVA 4HF2A 2ZKZA 4ZYHA 1KYWA 4P9UA 3DV8A 4A2UA 3HHHA 3CJNA 3JW4A 2FXAA 2NNNA 4MEXF 5CVVA 5FFZA 5BQTA 3AAFA 5HLIA 1B1BA 1HKQA 1T98A 5LRRA 2MD5A 1YS7A 3MQ0A 3KFWX 5FD5A 3E6CC 3Q9SA 5TJJA 4OINF 3K2ZA 2Z9OA 1OPCA 3GEZA 1ZAOA 2HFHA 1TTYA 3DPLC 3N4MA 1V4RA 3LWFA 3P7NA 5BPDA 3J7AO 3IWFA 2K4JA 4HA8A 4KT5C 4EGZA 2M45A 1RZ4A 4LMYA 1WI9A 1FOKA 1UCRA 2DLLA 2HTJA 1TQMA 1HSJA 2FNPA 2LF7A 4HQEA 1FYMA 2P7CB 3BJ6A 2TDXA 3V7RA 4HBLA 4HYEA 3IHUA 2MH9A 1C0WA 1IAWA 2HZTA 3TO9A 3JSPA 3V8JA 1LQ1A 5KVRA 1PP8F 3KETA 3K0LA 2NNYA 2V1XA 2FBKA 4HV6A 3ZN0A 3E6BA 5LRSA 5DUKA 1WWXA 3G73A 2NRAC 3I53A 4PZJA 1TQIA 2IT0A 1A04A 2OZUA 3WE3A 3SXYA 1KGSA 5LEKA 4PDKA 1HKTA 3EUHA 3LQRA 1K7AA 5CJ9A 3FXRA 2IA2A 1S7AA 2E7WA 5IT3A 4CXFA 1G3YA 1LJ9A 2VC0A 3HSFA 1LEBA 3I4PA 1R36A 5FB2A 2MC3A 3C3WA 4KIBA 2NYXA 1FPQA 1YQAA 3LQQA 1OKRA 5JFRA 2PMHA 3IC7A 3H3ZA 2A3SA 3HOSA 4A6EA 2D45A 1BJAA 1J9IA 4L9TA 3L00A 2MH2A 4GYGA 3J81Z 3VB2A 4KYWA 1Z91A 2CFXA 1UFMA 3LAJA 3DP7A 2D2WA 4HDUA 1FYKA 2HGCA 5JVTA 2Z99A 1AWCA 2AXLA 4O5VA 1TNSA 1ODDA 3TGNA 1T0FA 2GA1A 4MQVA 2P5LC 2P6SA 4ZH4F 1GHCA 3T0YA 4I0AA 2COMA 4ETSA 2RGVA 5LGNA 1LNWA 4Q47A 3FMSA 2XVCA 1SAXA 1XSXA 4AWXB 2O8XA 4IRGA 3N97A 1G3WA 2ZO4A 4IRIA 1Z1DA 3F8BA 4BYYA 3GWZA 2F2EA 3CO7C 3COAC 4LG0A 2Z33A 2YR2A 5IT9K 1MJ9A 2FQ3A 5ICEA 4U7BA 2EA2A 3I58A 1FBSA 4N0BA 3ECHA 2RDPA 4ZYDA 1U2WA 2HEOA 3QU6A 1F1ZA 4MHGA 4ON0A 3GFMA 3FXUA 4LG0B 3ABTA 1EH6A 1Z7UA 2LDUA 1P2FA 4I0BA 4P55A 3E5XA 2X4HA 3M1EA 3I59A 1Z6TA 2LNBA 3ROUA 2WC2A 2PLYA 3DXJF 3IWZA 1R1UA 2XAGA 1LEAA 4FX4A 2W57A 3MWMA 4G9YA 3GUDA 5AIPA 4UUVA 1YW9A 4NQWA 2PMUA 2HOEA 2A69F 2HDCA 4RAYA 4IXAA 3KZZA 3F23A 1U5TB 4RGRA 2EV5A 4N9HA 2GWRA 4YIIA 1YW8A 1R23A 1GXPA 2QYOA 2DQLA 3JAMZ 3RI4A 4G94A 4IJAA 2V9VA 2VBXA 2NAZA 2IP2A 4CYDA 1FSEA 3GX4X 4OIPF 2FOKA 2GQQA 3O2PE 5E17F 5LHHA 3SZPA 3ELKA 2OZ6A 2QVOA 1W5SA 3V8KA 4KMUX 1HXDA 1P6RA 5ICFA 4UXNA 2QM3A 3RKYA 5HDNA 1RI7A 1D8KA 1GVJA 3C7JA 2PI0A 4L5JA 4YG2F 1XB4A 1ON2A 2A68F 2GXBA 3VFZA 3GW2A 4HDVA 4A0YA 2DI3A 3GVAA 4I09A 1BBYA 3ISPA 4YFKF 5AIQA 4BHCA 4JBAA 2WWYA 3GLXA 2D1VA 3BJAA 1FY7A 2WV0A 3EDPA 4EJTA 2RV8A 1IN6A 2IJLA 1S6LA 3WGGA 1UB9A 3LA2A 2VODA 2PJPA 1OMIA 4RGSA 4UHTA 1BC8C 3WGHA 1ZHFA 3M8EA 2C6YA 1QQIA 2P5VA 5HOOA 3MAJA 4CHUA 4UV9A 3WTUC 5E8IA 4LLNA 1UHWA 2BYVE 3T8TA 2DFIA 1J7KA 4YFNF 4OIQF 1ZRDA 2ESHA 4P96A 1BI3A 3CLOA 5D5UB 1XDUA 5H20A 1IN4A 3NQOA 2HTSA 4KN7X 1OYYA 4O6JA 4M73A 1PUEE 3CO6C 3F3XA 1SD4A 3KP7A 5L3FA 1XGSA 4TV7A 1U6GA 4RB1A 2Y48A 4LB5A 2FNAA 1RUOA 1T39A 1BI1A 1MZBA 4K2EA 3ZPLA 1QPMA 5CVUA 1KU7A 4ESJA 2YX7A 4HF1A 1ZGAA 4R8HA 4Z2YA 2Y0MA 1TW2A 2M30A 1F4KA 2YSRA 1U8RA 2EFWA 3KLNA 1DUXC 1FP1D 3ABUA 4KNYA 2Y75A 3GXOA 2KIMA 4A0ZA 4U0VA 4JQFA 2EFQA 5L3BA 3M9AA 3LFKA 3KP5A 2V1UA 3D0SA 1G6NA 2H27A 3QPHA 2ETHA 5LBQA 2F5DA 3F8MA 2V6CA 3R4KA 2J5OA 4L0ZB 2ZCWA 3L2CA 4S05A 2VC1A 4XRFA 2JZYA 1IUYA 2RVCA 2IA1A 3TDUC 1T6SA 2WTEA 3WTYC 3QRFF 3PQKA 4ESBA 4RB3C 1J5YA 1J0RA 4EMSA 4CICA 4WF2A 4BQAA 3J81K 2EJRA 3F72A 3HRTA 4RAZA 2BBYA 4L5IA 1S29A 4Q48A 2MBFA 2DU9A 1MKMA 2UXNA 1XDSA 4A6DA 3P9CA 3GYHX 1B4AA 3TO7A 2LSOA 4YFXF 4ZYEA 3HTUA 1IN7A 3O6BB 4BH9A 1SD6A 3HRMA 1ZARA 2MA3A 4GGGA 4KIGA 4UVBA 4RGUA 4M9XA 1FT9A 3TO6A 1XD7A 4WXHA 4ZYGA 3F21A 1O7FA 2O0YA 3B02A 1S8NA 1BIAA 3CUQC 2VXZA 3KZYA 1KA8A 4BHBA 1HQCA 2H09A 2F5FA 2GA2A 2DPUA 1R22A 3F8CA 5CVRA 2FBHA 2OA4A 2AS5F 2YX4A 2PG4A 5J6XA 2YU3A 1R5GA 5L3CA 4JK1X 3U9GA 4GXOA 5DD8A 3RTRA 1D8JA 2W24A 3WE2A 2HS5A 2Q0OA 2CQKA 1YFHA 4KDPA 1SFXA 1IN5A 4WXCA 2ZMEA 2G7HA 3C18A 4F7ZA 1IXSB 3TQNA 1Z6RA 2R3SA 1K79A 2H94A 3KEQA 1E2XA 4MTDA 3QP5A 1AOYA 4R79A 1RUNA 2OBPA 4L9JA 5ED4A 1XGNA 1R58A 3KP6A 2HKOA 3BROA 4LK1F 1KU3A 1QZYA 1DPRA 3IKVA 4LB6B 2V79A 4BHPA 5HS8A 3BPVA 5FGMA 4EM2A 2FF4A 1S7OA 1FSHA 1YS6A 4PGGA 2P5KA 3V7CA 2PN6A 3BY6A 2Z3YA 4MTEA 3JAMK 4L18B 2ZFWA 3DFGA 3NEUA 2O6GE 1BI0A 4UVAA 3MZYA 5H6QA 5E1WA 3ZN1A 2VBYA 1DDNA 1SD5A 4IVNA 3U2RA 1ZG1A 5D6EA 3I0TA 3P9KA 2ELHA 3S2WA 1SMTA 2XAQA 1MJBA 5E1ZB 3J80Z 1X3UA 3GFJA 4I01A 4OU0A 2VOOA 2ZBKA 2P7VB 2PEXA 4IHTA 3QOPA 3E5QA 1FWZA 3DEUA 2ZXJA 1YW7A 3B73A 3KP3A 5FFXA 1XMKA 5A2QZ 3VEPA 2JPBA 2D1HA 4O3MA 2UZKA 2IPQX 4WWCA 3P9IA 2Q8KA 5HS9A 5DD4A 3HOTA 2FMYA 2BEOA 4IRHA 2ISYA 1O3SA 1REPC 3FM5A 3H92A 4L9NA 1QZZA 2GZWA 3E5UA 2EV0A 4PGHA 3D5LA 3GFIA 5D4RA 1W4MA 4CDGA 3QU3A 2ACJA 2BE5F 2KKOA 3I59B 1WKMA 2NS0A 2MLKA 4OMYA 4M9SA 3FMQA 4GO1A 1LDDA 3PFIA 2VN2A 1FNNA 2BV6A 2P4WA 3REOA 4KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BOQ A;  1P4X A;  4KFC A;  4U7D A;  2VBZ A;  3HSE A;  1B9M A;  2E7X A;  4WX9 A;  2B0L A;  1STZ A;  3FZV A;  4AIH A;  3QP6 A;  1KYZ A;  3I71 A;  3BP8 A;  4LJZ F;  1ULY A;  1XSV A;  4EJU A;  5FLX Z;  1LDJ A;  2QEN A;  2FA5 A;  5ICG A;  5DDG A;  5E1X A;  2QQ9 A;  1R00 A;  3HSR A;  4I7H A;  2HQN A;  1IF1 A;  1Q1H A;  3R60 A;  5JR3 A;  4S04 A;  2DPD A;  1G3S A;  2RC4 A;  4GYI A;  3RJP A;  3CUQ A;  1W7P A;  2HYG D;  4XSZ F;  2CG4 A;  5F6F A;  3SZT A;  5E20 A;  4QWQ A;  1HW1 A;  2JT1 A;  1U3E M;  1R7J A;  2DW4 A;  4Q4Z F;  1TBX A;  1ZGJ A;  1CF7 A;  2PQ8 A;  2L02 A;  1NHA A;  3KLO A;  1UHM A;  2O03 A;  1T2K A;  1LB2 A;  1BC7 C;  3L09 A;  2KIU A;  2X0L A;  4G6D A;  1G3T A;  3DKW A;  1HW2 A;  3E6D A;  3R61 A;  5FD6 A;  4EJW A;  2PBI A;  3WTS C;  4B09 A;  1WQ2 A;  4L0Y B;  2KRF A;  2XKP A;  5LHG A;  2A6H F;  2L4A A;  1T38 A;  1CF7 B;  2OAZ A;  4KA4 A;  1W5T A;  4PCQ A;  1F5T A;  3M7G A;  4EVI A;  3CTA A;  4G8X A;  2FE3 A;  2CO5 A;  3VOE A;  2QQA A;  3E97 A;  3TDZ C;  3ZP5 A;  2EV6 A;  2XAJ A;  1I6X A;  1OYW A;  4ESF A;  5K5O A;  3BZ6 A;  1J2X A;  5CLS A;  3IRR A;  4OIR F;  3HIF A;  4ENJ A;  1FP2 A;  4KUM A;  2HQR A;  1XCB A;  2EFN A;  5LEJ A;  3G3Z A;  2F5E A;  1O3Q A;  2UXX A;  4U88 A;  3V4G A;  3F8F A;  1XMA A;  1DPU A;  3ULQ B;  2IRF G;  4P5O A;  3GFL A;  4HX8 A;  5HDK A;  5D6F A;  3HRS A;  3RPQ A;  2M8E A;  2RNJ A;  3IRQ A;  2EFO A;  1L3L A;  4G7Z F;  1XSD A;  2VE8 A;  3FWE A;  4HQM A;  1YO5 C;  2LKP A;  3E3V A;  1FBU A;  2CW0 F;  1ZN2 A;  3RKW A;  1TNT A;  1U78 A;  5L3D A;  4HX7 A;  2DQR A;  4ENM A;  5DV5 A;  3L9F A;  3IL2 A;  4EQQ A;  2G9W A;  2CSO A;  1I5Z A;  2O3F A;  2L54 A;  5D8K B;  1USS A;  2HWV A;  3ZMT A;  5LGT A;  3EQL F;  3W6J B;  3SHF A;  2GIV A;  4BAY A;  3TOA A;  2E1N A;  2XAF A;  1MD0 A;  2CYY A;  3BJO A;  1P92 A;  1JXS A;  4OIO F;  5DCM A;  3BPX A;  4KN4 X;  3F8N A;  1KQ8 A;  1PDN C;  3ERE D;  3Q5F A;  2K7L A;  5E8G A;  2EK5 A;  2QUF A;  3HHG A;  1JE8 A;  3HUG A;  4G7O F;  4HLY A;  4AVP A;  1RNL A;  3I5U A;  3MCZ A;  4LK0 F;  4UV8 A;  3TKY A;  4UVC A;  2F5C A;  1U5T C;  5LHI A;  1W7P D;  5BOX A;  4FX0 A;  3F6O A;  5DCM B;  5CVI A;  1CGP A;  3MEX A;  1EH8 A;  5ILS A;  1FLI A;  2GXG A;  4Q5S F;  1D3Y A;  4AIK A;  4CZZ A;  3F22 A;  4HOB A;  2FEZ A;  4A0X A;  2DK8 A;  2R7F A;  2Z5U A;  1SFE A;  1OR7 A;  1GXQ A;  3T1B A;  3K1M A;  1MGT A;  2J5P A;  2L01 A;  1HBX G;  4ENN A;  5BS6 A;  3RPU A;  1FX7 A;  1WSU A;  4LLG F;  1R1T A;  2XHK A;  2VON A;  1I1S A;  4HLX A;  2A5Y B;  2BGC A;  1J75 A;  4M72 A;  3CDH A;  2PFB A;  1Y0U A;  2ESN A;  4Y15 A;  3J80 K;  1D5V A;  4U0W A;  3K1P A;  3R0J A;  5DEQ A;  4RGX A;  1ZH5 A;  2G7U A;  6PAX A;  4NHJ A;  4RS8 A;  3WU0 A;  1HW5 A;  5ILU A;  3E6M A;  5HLG A;  3KE2 A;  2QZ8 A;  4CGZ A;  3BWG A;  4HX4 A;  3OV8 A;  5A2Q K;  2KIF A;  3T5X A;  2XRO A;  1RIO H;  2K02 A;  1FC3 A;  4G7H F;  1OYI A;  1O3T A;  5D5W B;  3FX3 A;  1HST A;  4B8X A;  3EYI A;  3ZMS A;  4UNO A;  3ZMZ A;  3SFZ A;  2YPR A;  2DT5 A;  1FBQ A;  1YTY A;  1BN5 A;  3OOP A;  2K86 A;  3JSO A;  5E18 F;  2M1B A;  5LLQ A;  2ISZ A;  3RYR A;  3V7S A;  2ZME B;  2L4M A;  5J8C A;  3T8R A;  3DQV C;  2K27 A;  2OD5 A;  2XIG A;  5L3G A;  2O61 A;  2P8T A;  5LGU A;  3MFK A;  1BOA A;  1UST A;  1ZYR F;  2XRN A;  1K78 A;  2EA4 A;  4BNC A;  1IW7 F;  5ICC A;  1JHF A;  1L0O C;  3FF5 A;  3NRV A;  5D8L B;  4EGY A;  3KP2 A;  1MDM A;  4WK8 F;  4M9Z A;  1ONV A;  3FM3 A;  5FLX K;  2VT2 A;  1FYL A;  4XBF A;  2GAU A;  1K78 B;  3WTX C;  3V8L A;  2A6E F;  1R1V A;  5CYV A;  4Y13 A;  3ZMD A;  5BMZ A;  3LST A;  3KCC A;  1MDM B;  4EJV A;  3HTS B;  1O57 A;  4XLP F;  4GCV A;  3FMR A;  3DF8 A;  3LA3 A;  5K5R A;  5F1R A;  1O3R A;  4MQ9 F;  4A12 A;  5HS7 A;  1QGP A;  1KU2 A;  2OQR A;  2RN7 A;  3RDI A;  5ERI A;  1ZRF A;  3IKT A;  1XCV A;  1B6A A;  3WG9 A;  2ZNY A;  2DBB A;  2JTV A;  3K69 A;  2P6T A;  2EFP A;  2XGX A;  1ZRE A;  4G6Q A;  1PP7 U;  1ZG5 A;  4M74 A;  3WTV C;  5ILV A;  2R7D A;  4HF0 A;  1B59 A;  5JHU A;  2OQG A;  5HLH A;  1BM9 A;  2XAS A;  1P4W A;  1YIO A;  3ZQ7 A;  3GZ6 A;  4MEY F;  3FHZ A;  3W6K B;  1QO0 D;  2RKH A;  5D4S A;  1FZP B;  3MZH A;  2E1C A;  1BIB A;  3RIR A;  4P9F A;  2JSC A;  3JTG A;  1H9G A;  3K9T A;  1U5T A;  4EV0 A;  1ZG3 A;  5KK1 A;  5J8F A;  3RKX A;  2JRT A;  5L3E A;  3VOD A;  4NB5 A;  3BDD A;  3L7W A;  2EB7 A;  1ON1 A;  1XN7 A;  4DNC A;  3GZ5 A;  4ZZL A;  1TLH B;  2DTR A;  2VOP A;  4H0E A;  3FXQ A;  1YLF A;  3WTW C;  2DO7 A;  2L3D A;  2FML A;  4IPA A;  1LVA A;  1SFU A;  4IHS A;  3M8F A;  5F64 A;  5DUI A;  3LAP A;  1ZLK A;  3JTH A;  3GF2 A;  2DAO A;  1KQ9 A;  1S3J A;  4DQ2 A;  5DYM A;  3ECO A;  1R5H A;  3QAH A;  2XKO A;  2M87 A;  3EET A;  1Z05 A;  4A5N A;  3ZMV A;  3HRU A;  1TQP A;  5CVJ A;  4L9V A;  2EWN A;  4M6X A;  2OU2 A;  3K1N A;  5IT9 Z;  1QNT A;  1EV7 A;  1JGS A;  1XGO A;  4AD9 A;  2FBI A;  4RB0 A;  3ZMU A;  3O3K A;  2A61 A;  2QWW A;  2V1D A;  1ZLJ A;  2W84 A;  5AON A;  1E17 A;  2A07 F;  3CUQ B;  4LLL A;  4ASN A;  4M6Y A;  1W7P B;  1IN8 A;  2RQP A;  1I27 A;  1TW3 A;  1SMY F;  2H6B A;  3U1D A;  2W25 A;  3I64 A;  2VT3 A;  1Z9C A;  3RYP A;  4IF4 A;  2MLG A;  4EM0 B;  4RB2 C;  2IVM A;  1VTN C;  4R1H A;  3TOB A;  3KP4 A;  4HZF A;  2IA0 A;  3DPT A;  3WTZ A;  2HR3 A;  1LDK B;  2XUB A;  2STT A;  4ZZD A;  4HW0 A;  5H6R A;  5D5V B;  4LD5 A;  4XLN F;  4I2O A;  3GO5 A;  3PQJ A;  4WXD A;  2KJB A;  4I98 B;  5DCF A;  5EEH A;  2H6C A;  1EH7 A;  5FO5 A;  1HKS A;  4HV5 A;  4OOI A;  2DK5 A;  3I54 A;  4HAM A;  4EJO A;  2QQB A;  4KMF A;  2QBY A;  1O7L A;  2W85 A;  2XAH A;  5EEG A;  3CUO A;  2VBW A;  3H3U A;  2CWE A;  1B9N A;  2IW5 A;  3HYI A;  4N9I A;  5HDG A;  1H0M A;  4KIC A;  2Q2E A;  3WU1 B;  4BXU A;  1XGM A;  2ADU A;  4OMZ A;  4D0P A;  1H9T A;  2VE9 A;  4M71 A;  3ML6 A;  1K6O A;  2K4B A;  3WTT C;  1IXC A;  2XV4 S;  1MJA A;  1IRF A;  4WCG A;  4A5M A;  1SD7 A;  1QBJ A;  5K1Y A;  3Q9V A;  2QBY B;  1JHH A;  2JPC A;  1KU9 A;  1I1G A;  2ZNZ A;  2CGP A;  4XSX F;  1F9N A;  4QLC U;  4AIJ A;  3WOD F;  3QPT A;  4CO8 A;  2FSW A;  5TRD A;  4EM1 A;  3R0A A;  1V3F A;  4MNU A;  4ENK A;  1WRJ A;  2HKX A;  2HYF A;  1YG2 A;  5JI6 A;  1BI2 A;  5D5X B;  1ZRC A;  1J59 A;  1IRG A;  1IZ1 A;  3F6V A;  2ZJ2 A;  4FHT A;  4LFU A;  5BPI A;  3KEO A;  3SQN A;  4LGW A;  1KQ0 A;  4I02 A;  4U0Y A;  5HVQ C;  2KJC A;  4MGR A;  3WGI A;  2UWM A;  2FRH A;  3C1D A;  1G4D A;  3LA7 A;  2LF8 A;  2STW A;  2QLZ A;  5K5Q A;  1P4A A;  4Y17 A;  4E70 A;  4YIF A;  2FU4 A;  3R6S A;  1DP7 P;  1IXR C;  3EYY A;  4FT8 A;  2M5W A;  1YYV A;  4HF2 A;  2ZKZ A;  4ZYH A;  1KYW A;  4P9U A;  3DV8 A;  4A2U A;  3HHH A;  3CJN A;  3JW4 A;  2FXA A;  2NNN A;  4MEX F;  5CVV A;  5FFZ A;  5BQT A;  3AAF A;  5HLI A;  1B1B A;  1HKQ A;  1T98 A;  5LRR A;  2MD5 A;  1YS7 A;  3MQ0 A;  3KFW X;  5FD5 A;  3E6C C;  3Q9S A;  5TJJ A;  4OIN F;  3K2Z A;  2Z9O A;  1OPC A;  3GEZ A;  1ZAO A;  2HFH A;  1TTY A;  3DPL C;  3N4M A;  1V4R A;  3LWF A;  3P7N A;  5BPD A;  3J7A O;  3IWF A;  2K4J A;  4HA8 A;  4KT5 C;  4EGZ A;  2M45 A;  1RZ4 A;  4LMY A;  1WI9 A;  1FOK A;  1UCR A;  2DLL A;  2HTJ A;  1TQM A;  1HSJ A;  2FNP A;  2LF7 A;  4HQE A;  1FYM A;  2P7C B;  3BJ6 A;  2TDX A;  3V7R A;  4HBL A;  4HYE A;  3IHU A;  2MH9 A;  1C0W A;  1IAW A;  2HZT A;  3TO9 A;  3JSP A;  3V8J A;  1LQ1 A;  5KVR A;  1PP8 F;  3KET A;  3K0L A;  2NNY A;  2V1X A;  2FBK A;  4HV6 A;  3ZN0 A;  3E6B A;  5LRS A;  5DUK A;  1WWX A;  3G73 A;  2NRA C;  3I53 A;  4PZJ A;  1TQI A;  2IT0 A;  1A04 A;  2OZU A;  3WE3 A;  3SXY A;  1KGS A;  5LEK A;  4PDK A;  1HKT A;  3EUH A;  3LQR A;  1K7A A;  5CJ9 A;  3FXR A;  2IA2 A;  1S7A A;  2E7W A;  5IT3 A;  4CXF A;  1G3Y A;  1LJ9 A;  2VC0 A;  3HSF A;  1LEB A;  3I4P A;  1R36 A;  5FB2 A;  2MC3 A;  3C3W A;  4KIB A;  2NYX A;  1FPQ A;  1YQA A;  3LQQ A;  1OKR A;  5JFR A;  2PMH A;  3IC7 A;  3H3Z A;  2A3S A;  3HOS A;  4A6E A;  2D45 A;  1BJA A;  1J9I A;  4L9T A;  3L00 A;  2MH2 A;  4GYG A;  3J81 Z;  3VB2 A;  4KYW A;  1Z91 A;  2CFX A;  1UFM A;  3LAJ A;  3DP7 A;  2D2W A;  4HDU A;  1FYK A;  2HGC A;  5JVT A;  2Z99 A;  1AWC A;  2AXL A;  4O5V A;  1TNS A;  1ODD A;  3TGN A;  1T0F A;  2GA1 A;  4MQV A;  2P5L C;  2P6S A;  4ZH4 F;  1GHC A;  3T0Y A;  4I0A A;  2COM A;  4ETS A;  2RGV A;  5LGN A;  1LNW A;  4Q47 A;  3FMS A;  2XVC A;  1SAX A;  1XSX A;  4AWX B;  2O8X A;  4IRG A;  3N97 A;  1G3W A;  2ZO4 A;  4IRI A;  1Z1D A;  3F8B A;  4BYY A;  3GWZ A;  2F2E A;  3CO7 C;  3COA C;  4LG0 A;  2Z33 A;  2YR2 A;  5IT9 K;  1MJ9 A;  2FQ3 A;  5ICE A;  4U7B A;  2EA2 A;  3I58 A;  1FBS A;  4N0B A;  3ECH A;  2RDP A;  4ZYD A;  1U2W A;  2HEO A;  3QU6 A;  1F1Z A;  4MHG A;  4ON0 A;  3GFM A;  3FXU A;  4LG0 B;  3ABT A;  1EH6 A;  1Z7U A;  2LDU A;  1P2F A;  4I0B A;  4P55 A;  3E5X A;  2X4H A;  3M1E A;  3I59 A;  1Z6T A;  2LNB A;  3ROU A;  2WC2 A;  2PLY A;  3DXJ F;  3IWZ A;  1R1U A;  2XAG A;  1LEA A;  4FX4 A;  2W57 A;  3MWM A;  4G9Y A;  3GUD A;  5AIP A;  4UUV A;  1YW9 A;  4NQW A;  2PMU A;  2HOE A;  2A69 F;  2HDC A;  4RAY A;  4IXA A;  3KZZ A;  3F23 A;  1U5T B;  4RGR A;  2EV5 A;  4N9H A;  2GWR A;  4YII A;  1YW8 A;  1R23 A;  1GXP A;  2QYO A;  2DQL A;  3JAM Z;  3RI4 A;  4G94 A;  4IJA A;  2V9V A;  2VBX A;  2NAZ A;  2IP2 A;  4CYD A;  1FSE A;  3GX4 X;  4OIP F;  2FOK A;  2GQQ A;  3O2P E;  5E17 F;  5LHH A;  3SZP A;  3ELK A;  2OZ6 A;  2QVO A;  1W5S A;  3V8K A;  4KMU X;  1HXD A;  1P6R A;  5ICF A;  4UXN A;  2QM3 A;  3RKY A;  5HDN A;  1RI7 A;  1D8K A;  1GVJ A;  3C7J A;  2PI0 A;  4L5J A;  4YG2 F;  1XB4 A;  1ON2 A;  2A68 F;  2GXB A;  3VFZ A;  3GW2 A;  4HDV A;  4A0Y A;  2DI3 A;  3GVA A;  4I09 A;  1BBY A;  3ISP A;  4YFK F;  5AIQ A;  4BHC A;  4JBA A;  2WWY A;  3GLX A;  2D1V A;  3BJA A;  1FY7 A;  2WV0 A;  3EDP A;  4EJT A;  2RV8 A;  1IN6 A;  2IJL A;  1S6L A;  3WGG A;  1UB9 A;  3LA2 A;  2VOD A;  2PJP A;  1OMI A;  4RGS A;  4UHT A;  1BC8 C;  3WGH A;  1ZHF A;  3M8E A;  2C6Y A;  1QQI A;  2P5V A;  5HOO A;  3MAJ A;  4CHU A;  4UV9 A;  3WTU C;  5E8I A;  4LLN A;  1UHW A;  2BYV E;  3T8T A;  2DFI A;  1J7K A;  4YFN F;  4OIQ F;  1ZRD A;  2ESH A;  4P96 A;  1BI3 A;  3CLO A;  5D5U B;  1XDU A;  5H20 A;  1IN4 A;  3NQO A;  2HTS A;  4KN7 X;  1OYY A;  4O6J A;  4M73 A;  1PUE E;  3CO6 C;  3F3X A;  1SD4 A;  3KP7 A;  5L3F A;  1XGS A;  4TV7 A;  1U6G A;  4RB1 A;  2Y48 A;  4LB5 A;  2FNA A;  1RUO A;  1T39 A;  1BI1 A;  1MZB A;  4K2E A;  3ZPL A;  1QPM A;  5CVU A;  1KU7 A;  4ESJ A;  2YX7 A;  4HF1 A;  1ZGA A;  4R8H A;  4Z2Y A;  2Y0M A;  1TW2 A;  2M30 A;  1F4K A;  2YSR A;  1U8R A;  2EFW A;  3KLN A;  1DUX C;  1FP1 D;  3ABU A;  4KNY A;  2Y75 A;  3GXO A;  2KIM A;  4A0Z A;  4U0V A;  4JQF A;  2EFQ A;  5L3B A;  3M9A A;  3LFK A;  3KP5 A;  2V1U A;  3D0S A;  1G6N A;  2H27 A;  3QPH A;  2ETH A;  5LBQ A;  2F5D A;  3F8M A;  2V6C A;  3R4K A;  2J5O A;  4L0Z B;  2ZCW A;  3L2C A;  4S05 A;  2VC1 A;  4XRF A;  2JZY A;  1IUY A;  2RVC A;  2IA1 A;  3TDU C;  1T6S A;  2WTE A;  3WTY C;  3QRF F;  3PQK A;  4ESB A;  4RB3 C;  1J5Y A;  1J0R A;  4EMS A;  4CIC A;  4WF2 A;  4BQA A;  3J81 K;  2EJR A;  3F72 A;  3HRT A;  4RAZ A;  2BBY A;  4L5I A;  1S29 A;  4Q48 A;  2MBF A;  2DU9 A;  1MKM A;  2UXN A;  1XDS A;  4A6D A;  3P9C A;  3GYH X;  1B4A A;  3TO7 A;  2LSO A;  4YFX F;  4ZYE A;  3HTU A;  1IN7 A;  3O6B B;  4BH9 A;  1SD6 A;  3HRM A;  1ZAR A;  2MA3 A;  4GGG A;  4KIG A;  4UVB A;  4RGU A;  4M9X A;  1FT9 A;  3TO6 A;  1XD7 A;  4WXH A;  4ZYG A;  3F21 A;  1O7F A;  2O0Y A;  3B02 A;  1S8N A;  1BIA A;  3CUQ C;  2VXZ A;  3KZY A;  1KA8 A;  4BHB A;  1HQC A;  2H09 A;  2F5F A;  2GA2 A;  2DPU A;  1R22 A;  3F8C A;  5CVR A;  2FBH A;  2OA4 A;  2AS5 F;  2YX4 A;  2PG4 A;  5J6X A;  2YU3 A;  1R5G A;  5L3C A;  4JK1 X;  3U9G A;  4GXO A;  5DD8 A;  3RTR A;  1D8J A;  2W24 A;  3WE2 A;  2HS5 A;  2Q0O A;  2CQK A;  1YFH A;  4KDP A;  1SFX A;  1IN5 A;  4WXC A;  2ZME A;  2G7H A;  3C18 A;  4F7Z A;  1IXS B;  3TQN A;  1Z6R A;  2R3S A;  1K79 A;  2H94 A;  3KEQ A;  1E2X A;  4MTD A;  3QP5 A;  1AOY A;  4R79 A;  1RUN A;  2OBP A;  4L9J A;  5ED4 A;  1XGN A;  1R58 A;  3KP6 A;  2HKO A;  3BRO A;  4LK1 F;  1KU3 A;  1QZY A;  1DPR A;  3IKV A;  4LB6 B;  2V79 A;  4BHP A;  5HS8 A;  3BPV A;  5FGM A;  4EM2 A;  2FF4 A;  1S7O A;  1FSH A;  1YS6 A;  4PGG A;  2P5K A;  3V7C A;  2PN6 A;  3BY6 A;  2Z3Y A;  4MTE A;  3JAM K;  4L18 B;  2ZFW A;  3DFG A;  3NEU A;  2O6G E;  1BI0 A;  4UVA A;  3MZY A;  5H6Q A;  5E1W A;  3ZN1 A;  2VBY A;  1DDN A;  1SD5 A;  4IVN A;  3U2R A;  1ZG1 A;  5D6E A;  3I0T A;  3P9K A;  2ELH A;  3S2W A;  1SMT A;  2XAQ A;  1MJB A;  5E1Z B;  3J80 Z;  1X3U A;  3GFJ A;  4I01 A;  4OU0 A;  2VOO A;  2ZBK A;  2P7V B;  2PEX A;  4IHT A;  3QOP A;  3E5Q A;  1FWZ A;  3DEU A;  2ZXJ A;  1YW7 A;  3B73 A;  3KP3 A;  5FFX A;  1XMK A;  5A2Q Z;  3VEP A;  2JPB A;  2D1H A;  4O3M A;  2UZK A;  2IPQ X;  4WWC A;  3P9I A;  2Q8K A;  5HS9 A;  5DD4 A;  3HOT A;  2FMY A;  2BEO A;  4IRH A;  2ISY A;  1O3S A;  1REP C;  3FM5 A;  3H92 A;  4L9N A;  1QZZ A;  2GZW A;  3E5U A;  2EV0 A;  4PGH A;  3D5L A;  3GFI A;  5D4R A;  1W4M A;  4CDG A;  3QU3 A;  2ACJ A;  2BE5 F;  2KKO A;  3I59 B;  1WKM A;  2NS0 A;  2MLK A;  4OMY A;  4M9S A;  3FMQ A;  4GO1 A;  1LDD A;  3PFI A;  2VN2 A;  1FNN A;  2BV6 A;  2P4W A;  3REO A;  4KIF A; 
#chains in the Genus database with same CATH topology
 3BOQ A;  1W0U A;  1P4X A;  2HOA A;  2OPT A;  4KFC A;  4HNU A;  4U7D A;  5CQG A;  2VBZ A;  5FRM A;  3CLQ A;  3HSE A;  1B9M A;  2E7X A;  5GAD J;  4WX9 A;  2B0L A;  2OTJ I;  3OYK A;  2A6T A;  1STZ A;  2M0M A;  3FZV A;  4AIH A;  2BOL A;  1LVK A;  3QP6 A;  3TMO A;  1KYZ A;  3FBN B;  1R5I D;  3I71 A;  3BP8 A;  4LJZ F;  1ULY A;  1XSV A;  4EJU A;  5FLX Z;  1LDJ A;  2OV7 A;  2QEN A;  3DU5 A;  5FRN A;  2FA5 A;  5ICG A;  4C2U A;  4CCK A;  5DDG A;  2L7F P;  1Q1V A;  2QQ9 A;  5E1X A;  5M5W J;  1IDY A;  1R00 A;  3HSR A;  1DU6 A;  4I7H A;  2HQN A;  1IF1 A;  2H8R A;  1Q1H A;  5GAH J;  3R60 A;  2JMW A;  4V19 K;  4NC7 A;  5JR3 A;  3ESW B;  4S04 A;  2DPD A;  4JX5 A;  1U9O A;  2L7M P;  4CZC A;  3LSH A;  2X9D A;  1G3S A;  1I39 A;  2RC4 A;  1WFX A;  2HDD A;  4GYI A;  2KLO A;  3RJP A;  2JVG A;  1MH4 A;  3CUQ A;  1W7P A;  5B66 C;  4BY7 J;  3K4N A;  2HYG D;  1SVL A;  4XSZ F;  2CG4 A;  3GCM A;  5F6F A;  2XRL A;  3SZT A;  5KNL A;  1N77 A;  3OL4 A;  5E20 A;  4QWQ A;  3OY9 A;  3OYF A;  3LSJ A;  3CCM I;  1HW1 A;  2YUS A;  2YS9 A;  3E0J B;  2XAU A;  2CV0 A;  1MMS A;  2JT1 A;  1R6R A;  2PMZ A;  1R7J A;  2DW4 A;  4Q4Z F;  1U3E M;  4C2T A;  1TBX A;  1ZGJ A;  1CF7 A;  5KCM A;  3J7Z I;  1IUF A;  2PX9 A;  2ME0 A;  2PQ8 A;  3QYF A;  4HEA 2;  5B1B H;  2L02 A;  1NHA A;  3KLO A;  1UHM A;  2O03 A;  1T2K A;  1LB2 A;  3S1Q J;  1BC7 C;  5K7F A;  3L09 A;  2KIU A;  2VPR A;  2OC6 A;  1NK3 P;  2X0L A;  1A6Q A;  4G6D A;  1G3T A;  1D0X A;  2EBI A;  2X1D A;  3DKW A;  1HW2 A;  3E6D A;  3R61 A;  1MND A;  3EUH C;  5FD6 A;  4EJW A;  2PBI A;  3WTS C;  1QHH D;  4B09 A;  4XKB A;  1WQ2 A;  3W3C A;  3OS0 A;  4L0Y B;  3PO2 J;  2M9H A;  1ERD A;  2KRF A;  2M4G A;  2EZI A;  3ZRG A;  2XKP A;  5LHG A;  3F0C A;  2JRM A;  2A6H F;  2L4A A;  1T38 A;  3ZQF A;  2EIN H;  1CF7 B;  2OAZ A;  4KA4 A;  1W5T A;  4PCQ A;  1F5T A;  2DCE A;  3M7G A;  1UG2 A;  4EVI A;  3G71 I;  3CTA A;  1AU7 A;  2P0W A;  4G8X A;  2B63 J;  2DN0 A;  4IKF A;  3H9J A;  2F4M B;  2FE3 A;  3OL3 A;  4KT6 A;  1SAN A;  1Z3Y A;  2CO5 A;  4W97 A;  3VOE A;  2QQA A;  4E7K A;  3E97 A;  3TDZ C;  3HGG A;  3ZP5 A;  2M4K A;  2KHM A;  4CUG A;  3ZCO A;  2EV6 A;  2BY3 A;  2XAJ A;  1QVT A;  4RM2 A;  1I6X A;  1OYW A;  1WH7 A;  3ERM A;  3MKW B;  3H5N A;  2KP6 A;  4ESF A;  1Y1W J;  4XK4 A;  2WV1 A;  3BZ6 A;  5K5O A;  1J2X A;  5CLS A;  3IRR A;  4OIR F;  3HIF A;  4J01 A;  4ENJ A;  1WJF A;  3S3M A;  1FP2 A;  4KUM A;  2HQR A;  1XCB A;  2EFN A;  5LEJ A;  2JUC A;  3G3Z A;  3QYE A;  2OUM A;  2F5E A;  3OS2 A;  3CCQ I;  1O3Q A;  1WJA A;  4ABZ A;  1D1A A;  3JRG A;  1B72 A;  1WJC A;  2UXX A;  4U88 A;  4OWR B;  3V4G A;  4DBR A;  3F8F A;  1XMA A;  1RR7 A;  1DPU A;  4ZDO A;  3ULQ B;  2IRF G;  1BR4 A;  1G8X A;  4P5O A;  5F1J A;  1E3H A;  1DQU A;  3GFL A;  4HX8 A;  5HDK A;  3A01 A;  2OCE A;  5D6F A;  3HRS A;  4Y52 J;  3RPQ A;  2ZXH A;  1W5C C;  2M8E A;  3BT9 A;  2RNJ A;  3IRQ A;  2EFO A;  1L3L A;  4G7Z F;  1MBJ A;  3LNQ A;  4W1U A;  5E3O A;  1XSD A;  4UB6 C;  2XPV A;  5M3F J;  2VE8 A;  3FWE A;  4HQM A;  2NOJ B;  3JRE A;  1YO5 C;  1B72 B;  2LKP A;  3E3V A;  2MSY A;  1FMW A;  1FBU A;  2CW0 F;  1ZN2 A;  3HJE A;  3RKW A;  4AVZ A;  3RSN A;  3GTP J;  1TNT A;  3J7Y J;  4FAS D;  4E7L A;  1U78 A;  2FD5 A;  5L3D A;  4NBQ A;  1OFC X;  1XG1 A;  4HX7 A;  2HU9 A;  2HXO A;  3S3N A;  4IHV A;  2DQR A;  4ENM A;  4XKV A;  5EDN A;  5DV5 A;  2E1O A;  3L9F A;  3IL2 A;  2ME6 A;  3OSG A;  2NVQ J;  4EQQ A;  2G9W A;  3L2Q A;  2K3F A;  5GTH C;  2CSO A;  4D7M A;  1I5Z A;  2O3F A;  2L54 A;  5D8K B;  1USS A;  2HWV A;  2KL4 A;  2WA0 A;  4CH7 A;  3ZMT A;  2DA4 A;  2JVH A;  3W2V A;  5LGT A;  3RZO J;  3SJM A;  3EQL F;  3RKQ A;  2XSJ C;  3C2G A;  3W6J B;  3SHF A;  4BGD A;  5IOY A;  2O5R A;  5IP6 A;  2GIV A;  2R7T A;  4BAY A;  2IAI A;  1T33 A;  3TOA A;  2E1N A;  2X6Y A;  2XAF A;  1MD0 A;  2CYY A;  3BQZ A;  2CJJ A;  3O8G A;  3BJO A;  2K9N A;  2LG4 A;  1P92 A;  1JXS A;  4OIO F;  3W2W A;  1VQ9 I;  5DCM A;  3BPX A;  4KN4 X;  3K7A J;  2L9N A;  3F8N A;  1KQ8 A;  1PDN C;  2WAD A;  4DBQ A;  3ERE D;  3CC7 I;  1YX5 A;  2GBY A;  3Q5F A;  2K7L A;  5E8G A;  1BA5 A;  1TWC J;  2EK5 A;  2QUF A;  3HHG A;  1JE8 A;  3HUG A;  4G7O F;  2DDA A;  4XLH A;  4HLY A;  4AVP A;  1RNL A;  3L2R A;  3I5U A;  5DTD A;  1A6I A;  1QU3 A;  3MCZ A;  4LK0 F;  4UV8 A;  3TKY A;  4UVC A;  2F5C A;  1WH5 A;  2R7Q A;  1V5F A;  1M1E B;  1U5T C;  4OAZ A;  5LHI A;  1W7P D;  3W2A A;  5BOX A;  4FX0 A;  3TED A;  1X19 A;  3QYB A;  2HI3 A;  4B44 A;  1ORK A;  3F6O A;  4YEJ A;  5DCM B;  4DZJ A;  4Z6Y A;  5B3S H;  5CVI A;  1CGP A;  3MEX A;  3OSF A;  1EH8 A;  5ILS A;  3ZXS A;  3GTJ J;  4Y4R A;  1FLI A;  2GXG A;  4Q5S F;  3KIO A;  2WAF A;  1D3Y A;  4AIK A;  3HUG B;  4CZZ A;  2DMQ A;  4JX6 A;  1MMA A;  3F22 A;  3S1N J;  3DTI A;  4BJ5 C;  4HOB A;  2FEZ A;  4A0X A;  3CCL I;  2DMN A;  2DK8 A;  2R7F A;  2Z5U A;  4A3M J;  3OIO A;  2VIX A;  1D1C A;  4BUP A;  1IRX A;  1A31 A;  1SFE A;  1OR7 A;  2AXT C;  5F04 A;  4XNF A;  1GXQ A;  3T1B A;  4E7J A;  1AKH A;  4BQQ A;  1MH3 A;  2DMU A;  3K1M A;  1MGT A;  2J5P A;  2L01 A;  2VL8 A;  5JVG F;  4ENN A;  1HBX G;  5BS6 A;  3DPU A;  3RPU A;  1FX7 A;  1H8A C;  2HXI A;  1RR8 C;  2VUM J;  1WSU A;  4LLG F;  1FMV A;  1R1T A;  3ZOB A;  2XHK A;  2RNG A;  2WB1 A;  2P81 A;  3DTE A;  2VON A;  1IJW C;  3L2U A;  1I1S A;  4HLX A;  1WPK A;  2A5Y B;  1TWF J;  2BGC A;  3OYG A;  1J75 A;  4NC8 A;  4M72 A;  3CDH A;  1YOV B;  2PFB A;  1OCR H;  3KYL A;  1Y0U A;  2ESN A;  4Y15 A;  3J80 K;  3FHN A;  1D5V A;  3GME A;  1JT6 A;  4U0W A;  3PJR A;  1G59 A;  4IZZ A;  3K1P A;  3DCF A;  3R0J A;  5DEQ A;  4RGX A;  1ZH5 A;  1AKH B;  2JA7 J;  2G7U A;  2HOS A;  2CH0 A;  2JSP A;  1APL C;  6PAX A;  4M3D A;  4ZJZ A;  4NHJ A;  3HBL A;  4RS8 A;  3WU0 A;  1HW5 A;  5ILU A;  3E6M A;  2DJN A;  4CCM A;  3DEW A;  3HOV J;  5HLG A;  3KE2 A;  4H4K C;  2Y31 A;  2QZ8 A;  5J3L A;  3PFY A;  3EUK L;  2QCO A;  4CGZ A;  3H3V K;  2L7Z A;  2UUZ A;  1R4M B;  3BWG A;  2GXA A;  4HX4 A;  3OV8 A;  5A2Q K;  4HSR A;  2KIF A;  3T5X A;  2XRO A;  2QQ8 A;  1RIO H;  2K02 A;  1R9T J;  5EG0 A;  1BW6 A;  4MLO A;  1FC3 A;  4G7H F;  1R71 A;  4IHX A;  1OYI A;  1O3T A;  2OCC H;  4CCN A;  2XPW A;  2HYJ A;  5D5W B;  3DU6 A;  2CU7 A;  3PO3 J;  3OYI A;  3FX3 A;  4F92 B;  1HST A;  3HPH A;  4B8X A;  3ZMS A;  4LG3 A;  3EYI A;  1SC7 A;  4UNO A;  1QVU A;  3ZMZ A;  1U8B A;  3SFZ A;  2YPR A;  4F55 A;  2DT5 A;  3DBH B;  1FBQ A;  1QZE A;  1YTY A;  2M7B A;  3KYD B;  3JR9 A;  3FIS A;  1BJZ A;  1BN5 A;  3H1C A;  2OJE D;  3OOP A;  2K86 A;  3BCB A;  3JSO A;  5E18 F;  4M3F A;  2XPU A;  2M1B A;  5EG0 B;  2LOO A;  5LLQ A;  3TW6 A;  3DKX A;  2ISZ A;  2IGO A;  3CQZ J;  3RYR A;  2ZME B;  3V7S A;  2L4M A;  1AHD P;  3GTL J;  4BE2 A;  5J8C A;  3H9Q A;  3T8R A;  3DQV C;  3FDY A;  2ZJQ F;  2V7F A;  3HEF A;  2K27 A;  2OD5 A;  2XIG A;  5L3G A;  1IV6 A;  2D5V A;  2O61 A;  1IO2 A;  2IGN A;  3G1M A;  2ZXI A;  2P8T A;  5LGU A;  3MFK A;  1BOA A;  1UST A;  1ZYR F;  4KIT B;  1NG7 A;  2DA7 A;  2DOF A;  2XRN A;  5KHD A;  4GFB A;  1ACI A;  1K78 A;  2A05 A;  2EA4 A;  3FK6 A;  4C9Y A;  1KZH A;  4BNC A;  1IW7 F;  1AA7 A;  1X4O A;  5JLW A;  5ICC A;  4BS9 A;  3A0H C;  1JHF A;  4A3B J;  1NG6 A;  1L0O C;  3FF5 A;  2L5Q A;  3IAS 2;  3NRV A;  3CP2 A;  4QSH A;  4X1E A;  4DJA A;  2LKS A;  5FJ8 J;  5D8L B;  4EGY A;  3KP2 A;  1UAA A;  2CW7 A;  1XX5 A;  3BTJ A;  1MDM A;  4FQG A;  4WK8 F;  3PIP F;  2QEX I;  3GBG A;  1ONV A;  4M9Z A;  3FM3 A;  1ITY A;  1PUF A;  3PNT A;  5FLX K;  2VT2 A;  1VQM I;  3K70 D;  1FYL A;  3OYJ A;  4XBF A;  2GAU A;  3BR1 A;  2IBD A;  1K4T A;  3DBR B;  1JKO C;  1K78 B;  3WTX C;  3V8L A;  2DOE A;  2A6E F;  1DP3 A;  3VYU B;  1R4N B;  3GLL A;  4II2 A;  2XF5 A;  1R1V A;  4HST A;  5CYV A;  2KQR A;  5GP9 A;  3S15 J;  2I10 A;  3ZMD A;  4Y13 A;  1LFP A;  4ZTF A;  5BMZ A;  3LST A;  2DMT A;  3KCC A;  1K6Y A;  4JP0 A;  2AQF A;  1MDM B;  2JK3 A;  4EJV A;  3UKG A;  3HTS B;  1O57 A;  4XLP F;  1GT0 C;  4GCV A;  3FMR A;  1PUF B;  3DF8 A;  3LA3 A;  5K5R A;  3HGY A;  5F1R A;  1BR1 A;  2XF6 A;  2BW3 A;  2CUJ A;  3PSF A;  1Z3X A;  2KIQ A;  2HZD A;  1VFC A;  1O3R A;  2JUG A;  1Z77 A;  4MQ9 F;  4A12 A;  5HS7 A;  1QGP A;  1KU2 A;  4N4N B;  2OQR A;  2RN7 A;  3RDI A;  5ERI A;  1ZRF A;  3PL8 A;  3IKT A;  5EEA A;  1XCV A;  3CME I;  1B6A A;  2NVX J;  2K9S A;  1OCP A;  2CV2 A;  5E3N A;  3WG9 A;  5JLX A;  3AG4 H;  2ZNY A;  1SAU A;  2DBB A;  3CJQ B;  2JTV A;  3FIW A;  4RMN A;  3K69 A;  2R93 J;  1P9Q C;  4XQF A;  2IGK A;  1UG0 A;  2P6T A;  2EFP A;  5TGT A;  2XGX A;  4AYB A;  1VQ4 I;  2E71 A;  3DBL B;  1CQT A;  1ZRE A;  1IG7 A;  4G6Q A;  1PP7 U;  1ZG5 A;  1MNE A;  2M3A A;  4M74 A;  2BW3 B;  3WTV C;  5ILV A;  2R7D A;  4HF0 A;  1B59 A;  2ID6 A;  1I50 J;  5JHU A;  2OQG A;  5HLH A;  2XAS A;  1BM9 A;  2O9L A;  1P4W A;  1YIO A;  3E7L A;  3ZQ7 A;  5EF6 A;  3GZ6 A;  2NS7 A;  4MEY F;  3FHZ A;  3W6K B;  1YIJ I;  3BR5 A;  1JJ8 C;  1QO0 D;  2RKH A;  2TCT A;  5D4S A;  3KZI C;  1FZP B;  3MZH A;  2E1C A;  2CRG A;  1BIB A;  4RDU A;  3RIR A;  2MYS A;  2VKE A;  2JSC A;  4P9F A;  3JTG A;  3A1Y A;  4ZTJ A;  1H9G A;  2MW8 A;  2WAQ N;  1U5T A;  3K9T A;  2KDZ A;  3CCE I;  4EV0 A;  2HNH A;  1ZG3 A;  2XC7 A;  3FK7 A;  4QPQ A;  1JI8 A;  5KK1 A;  3VYT B;  2X6W A;  4ZC3 A;  3C2H A;  4E7I A;  1Z7L A;  5J8F A;  3RKX A;  2JRT A;  5EZG A;  5L3E A;  3BC8 A;  3VOD A;  2W82 A;  4HNT A;  2W48 A;  4NB5 A;  3BDD A;  3ZQQ A;  3L7W A;  2EB7 A;  2NOG A;  4GRI A;  1ON1 A;  1Z0X A;  2GIZ A;  3LSK A;  2EH3 A;  1XN7 A;  3O8H A;  2MFZ A;  2F4O B;  4DNC A;  3RZD J;  1FJL A;  2XB5 A;  4CYC A;  3GZ5 A;  4ZZL A;  1TLH B;  2DTR A;  2VOP A;  4H0E A;  5IP7 J;  5TIS C;  3FXQ A;  4S0H B;  1YLF A;  4DW6 A;  5M5X J;  2HVS A;  2DO7 A;  2L3D A;  3WTW C;  2FML A;  2W00 A;  3HOY J;  4IPA A;  4XLA A;  1YJ9 I;  2KRC A;  1LVA A;  1SFU A;  2IS1 A;  3ZQL A;  1JUS A;  4IHS A;  3ASO H;  3JRH A;  3M8F A;  5F64 A;  1X1D A;  3BG7 A;  5E3L A;  1P7J A;  2LFB A;  5DUI A;  4X0G A;  1SFK A;  3LAP A;  2R7V A;  1T56 A;  1ZLK A;  4IX7 A;  3JTH A;  3GF2 A;  3GTO J;  2IXS A;  3B6C A;  4FET A;  5H2F C;  2DAO A;  1V5E A;  1KQ9 A;  1S3J A;  2DA2 A;  4DQ2 A;  3I3L A;  2O8K A;  1HLV A;  5DYM A;  3JRD A;  3ECO A;  4B4C A;  4CYC B;  3RCO A;  2VQH A;  1R5H A;  3QAH A;  2XKO A;  2M87 A;  2KZG A;  3EET A;  3HOW J;  2BXZ A;  4C2M J;  1Z05 A;  4A5N A;  2DT7 B;  1JJ6 C;  3ZMV A;  3HRU A;  4UB8 C;  1VZ0 A;  1E3O C;  2VKV A;  1TQP A;  5CVJ A;  2JA2 A;  4HG2 A;  2BY1 A;  1XTA A;  3BQY A;  4XLE A;  4L9V A;  1TL8 A;  2EWN A;  1GV5 A;  3SEQ A;  2ZXW H;  3S93 A;  4M6X A;  2OU2 A;  1SEU A;  1X1P A;  2QGU A;  1E0E A;  3K1N A;  2E5N A;  2JA5 J;  3TL4 X;  4RAF A;  5LFA A;  3CCY A;  5IT9 Z;  1QNT A;  4CCO A;  1EV7 A;  1JGS A;  1XGO A;  4AD9 A;  2FBI A;  4B3X A;  1MMN A;  4RB0 A;  3ZMU A;  2W1O A;  3O3K A;  1OLT A;  2A61 A;  2M8G X;  2QWW A;  3CF2 A;  2B9S A;  1ZTR A;  4X6A J;  2V1D A;  1ZLJ A;  2W84 A;  5AON A;  1E17 A;  2A07 F;  3CUQ B;  2NVY J;  4LLL A;  4M6Y A;  1GLN A;  3K4L A;  4PFO A;  1W7P B;  1IN8 A;  4ASN A;  2RQP A;  3PUF A;  1I27 A;  1TW3 A;  1SMY F;  2BHY A;  3M07 A;  2H6B A;  3OYM A;  2DFF A;  3U1D A;  2V9P A;  1DGW Y;  2W25 A;  5IPA A;  3I64 A;  2VT3 A;  2KRH A;  2LP0 A;  1Z9C A;  3RYP A;  2L7K A;  4IF4 A;  2VPL A;  4XN3 A;  2EIL H;  2MLG A;  4EM0 B;  4YEL A;  2PJR A;  1WI3 A;  4MFE A;  3HKZ A;  4RB2 C;  2IS6 A;  1HA8 A;  3BG3 A;  2IVM A;  1VTN C;  1OQY A;  5DM6 F;  4BY1 J;  4R1H A;  2X85 A;  3TOB A;  1WJB A;  2UV1 A;  3NWS A;  1JUP A;  3KP4 A;  1ZK8 A;  4HZF A;  4LOC A;  1T8I A;  2IA0 A;  5IY5 H;  2IEK A;  4A3E J;  4XLC A;  3DPT A;  3WTZ A;  4ANJ A;  2HR3 A;  1LDK B;  2XUB A;  3H9G A;  2STT A;  4ZZD A;  4HW0 A;  5H6R A;  3E1S A;  4B3A A;  5D5V B;  4M3G A;  3GZN B;  5J40 A;  3CMY A;  4LD5 A;  4XLN F;  4I2O A;  3GO5 A;  3PQJ A;  4WXD A;  2KJB A;  4BQO A;  4I98 B;  3IH4 A;  2DDB A;  5DCF A;  5C4X J;  5EEH A;  2H6C A;  3U1K A;  2DA1 A;  1EH7 A;  1ETY A;  1HKS A;  5FO5 A;  4B48 A;  4HV5 A;  3FXK A;  4OOI A;  2DK5 A;  3I54 A;  1D0Y A;  4HAM A;  4EJO A;  3CMM A;  2QQB A;  4KMF A;  3L1P A;  2QBY A;  1O7L A;  2HQ5 A;  2W85 A;  2XAH A;  5EEG A;  1RET A;  3CUO A;  3FKJ A;  2VBW A;  1ETV A;  3F9K A;  3H3U A;  3CP8 A;  2CWE A;  4MO7 A;  2M34 A;  3HDD A;  2L9S A;  3LSG A;  4DYR A;  1B9N A;  2CMP A;  4HPQ A;  2IW5 A;  3FKI J;  3HYI A;  4BEH A;  4N9I A;  5HDG A;  2R7W A;  2PMZ N;  1H0M A;  4KIC A;  2Q2E A;  9ANT A;  2ZC2 A;  3WU1 B;  2W4S A;  4BXU A;  1XGM A;  2VJJ A;  2ADU A;  4OMZ A;  4D0P A;  4DYQ A;  1H9T A;  2VE9 A;  4M71 A;  3ML6 A;  1K6O A;  2X6O A;  2K4B A;  3MKY B;  3WTT C;  4PUS A;  1IXC A;  1WGX A;  2XV4 S;  1MJA A;  3IP4 B;  3MD2 A;  1T0F C;  1IRF A;  2LTP A;  2NVU B;  1S5L C;  3S8P A;  4WCG A;  4A5M A;  1SD7 A;  3OOU A;  3BG5 A;  3NAR A;  1QBJ A;  3K2A A;  5K1Y A;  3Q9V A;  2QBY B;  3BZC A;  1JHH A;  2JPC A;  1HF0 A;  5FKN A;  1OCO H;  3JCU C;  1BW5 A;  1VF9 A;  1KU9 A;  1YX3 A;  4BEH B;  1I1G A;  2ZNZ A;  4HNV A;  2CGP A;  2V1N A;  5B5E C;  2Q2E B;  4XSX F;  2XF7 A;  1F9N A;  5M3M J;  4QLC U;  4AIJ A;  4NNJ A;  3WOD F;  3QPT A;  4CO8 A;  2FSW A;  5TRD A;  4EM1 A;  3R0A A;  1V3F A;  4MNU A;  3A01 B;  4ENK A;  4XOT A;  2LKX A;  3UNG C;  2FJ1 A;  3M1C A;  3X2Q H;  1WRJ A;  2DA3 A;  2E60 A;  4XRM A;  2F48 A;  3ZQH A;  2HKX A;  2HYF A;  2WY8 Q;  3CCJ I;  2H1K A;  2NXN B;  1YG2 A;  2E1M B;  2K5C A;  3GTM J;  5JI6 A;  1BI2 A;  3TP3 A;  3K4J A;  5D5X B;  4PSW A;  1ZRC A;  1J59 A;  1WJD A;  4LIT A;  1IRG A;  1IZ1 A;  3F6V A;  2ZJ2 A;  1SVM A;  4FHT A;  4LFU A;  3D5R C;  5BPI A;  3KEO A;  3SQN A;  4LGW A;  3S2H J;  1KQ0 A;  3I56 I;  1DU0 A;  2V6E A;  4I02 A;  4U0Y A;  2K40 A;  4A3L J;  5HVQ C;  2KJC A;  4MGR A;  3WGI A;  2UWM A;  2FRH A;  1S7E A;  3C1D A;  3ONQ A;  1G4D A;  1ETK A;  3LA7 A;  4IHY A;  3QQA A;  2LF8 A;  2VJ4 A;  2STW A;  3HPG A;  2QLZ A;  2Y0S A;  5K5Q A;  2R0Q C;  2WBM A;  1P4A A;  4Y17 A;  4E70 A;  4YIF A;  3TP0 A;  5CKT A;  2FU4 A;  4FE7 A;  3R6S A;  2Y69 H;  2AQE A;  1DP7 P;  1IXR C;  1A36 A;  3OR2 C;  4A3K J;  3EYY A;  1D0Z A;  1IRZ A;  5IP9 J;  3W6V A;  4FT8 A;  3S16 J;  2M5W A;  1YYV A;  2NS8 A;  1N78 A;  4HF2 A;  3AL0 B;  5EGO A;  3A4C A;  2ZKZ A;  4ZYH A;  3C2B A;  4FTH A;  1KYW A;  4P9U A;  3DV8 A;  5J4Y A;  1VQ5 I;  3SFI A;  1DGR M;  2CQQ A;  3BTC A;  4A2U A;  5C4J J;  3L2W A;  3HHH A;  3CJN A;  3JW4 A;  2XDV A;  2XSD C;  4FCY A;  1NH3 A;  1H88 C;  4D5C A;  4L5E A;  2FXA A;  2NNN A;  4MEX F;  5CVV A;  4IL6 C;  5FFZ A;  5BQT A;  3AAF A;  5HLI A;  1VQP I;  1B1B A;  1HKQ A;  1T98 A;  5LRR A;  2MD5 A;  1YS7 A;  1JUM A;  3MQ0 A;  3CCV I;  3KFW X;  5FD5 A;  1XPX A;  3E6C C;  1ZEL A;  3Q9S A;  2LY9 A;  5EGO B;  3GTK J;  5TJJ A;  4AUX A;  4OIN F;  4A93 J;  1Y8R B;  3G1O A;  2N8G A;  3K2Z A;  4AM3 A;  1R49 A;  1RKW A;  3ZQC A;  1YI2 I;  2Z9O A;  1OPC A;  3GEZ A;  1D1B A;  1ZAO A;  2R5Y A;  2HFH A;  1TTY A;  3DPL C;  3N4M A;  1V4R A;  3LWF A;  3P7N A;  5BPD A;  3J7A O;  3IWF A;  2K4J A;  4HA8 A;  3LSM A;  2CV1 A;  2H8W A;  2VQG A;  4KT5 C;  2LBF A;  4EGZ A;  2M45 A;  2WAE A;  1RZ4 A;  4LMY A;  5HNF A;  3S2D J;  1WI9 A;  1FOK A;  1UCR A;  2DLL A;  1FOW A;  4RLQ A;  2HTJ A;  1LUJ B;  1LFB A;  1TQM A;  1HSJ A;  2HPM A;  3Q3S A;  2FNP A;  2LF7 A;  4I99 C;  2DFH A;  2F6C A;  3Q0V A;  4HQE A;  1FYM A;  1EKE A;  2P7C B;  3BJ6 A;  2TDX A;  3CCR I;  3V7R A;  4HBL A;  4HYE A;  3IHU A;  2MH9 A;  4C3I J;  2ECB A;  1C0W A;  1VND A;  1ZR2 A;  4C3J J;  2R5Y B;  4JYK A;  1IAW A;  2MD0 A;  4BDY A;  4BJ6 C;  2HDW A;  2HZT A;  3TO9 A;  2E2H J;  1TWH J;  3BTL A;  3SDB A;  3FXM A;  3JSP A;  2E35 A;  2KIS A;  3V8J A;  1LQ1 A;  5KVR A;  2F4I A;  1PP8 F;  1KON A;  2OF7 A;  3KET A;  3K0L A;  2NNY A;  2V1X A;  1BL0 A;  2FBK A;  4EAT A;  2LH9 A;  4HV6 A;  3ZN0 A;  3E6B A;  5LRS A;  3BCA A;  4XKC A;  4RM3 A;  5DUK A;  3I4M J;  1WWX A;  5JHF A;  1X2N A;  1JTX A;  3G73 A;  2NRA C;  3I53 A;  4PZJ A;  1QPI A;  1TQI A;  2IT0 A;  2EZL A;  1A04 A;  4BE1 A;  2OZU A;  3WE3 A;  3SXY A;  1KGS A;  5LEK A;  4PDK A;  1HKT A;  1JT0 A;  3EUH A;  4BQN A;  3LQR A;  1K7A A;  2FQ4 A;  3QWL A;  5CJ9 A;  1VQ8 I;  3FXR A;  2JWT A;  2IA2 A;  1S7A A;  2E7W A;  4II3 A;  5IT3 A;  2DYR H;  4CXF A;  1G3Y A;  1LJ9 A;  2VC0 A;  3HSF A;  1LEB A;  3I4P A;  1R36 A;  3H0D A;  5FB2 A;  2HVQ A;  3OYE A;  2MC3 A;  3C3W A;  4KIB A;  3AKZ A;  2Y2Z A;  4BXF A;  4D5F A;  2LR8 A;  2HOT A;  2NYX A;  1GVD A;  5LD2 C;  1FPQ A;  3G2B A;  4BXX J;  1YQA A;  3HXL A;  2CUE A;  3S1R J;  2KMU A;  3H0G J;  4XL9 A;  1A35 A;  3LQQ A;  1OKR A;  2KT0 A;  2WB1 N;  1WZ2 A;  5JFR A;  2PMH A;  3IC7 A;  5F0F A;  3H3Z A;  2BVM A;  3CCU I;  2A3S A;  2KPM A;  5IOZ A;  4A6E A;  3HOS A;  4XRS G;  2EIK H;  2X1C A;  2D45 A;  1K61 A;  1BJA A;  1J9I A;  4L9T A;  2DOA A;  3L00 A;  2DOD A;  2MH2 A;  4GYG A;  1BR2 A;  3J81 Z;  5E3M A;  3IV5 A;  4FIS A;  3VB2 A;  4KYW A;  3BTI A;  1Z91 A;  2CFX A;  1B8I A;  1ZKG A;  2JN6 A;  1UFM A;  3FBI B;  4A3I J;  3LOC A;  3LAJ A;  3DP7 A;  2D2W A;  4A3G J;  4BBR J;  1SFO J;  4HDU A;  3SEZ A;  3VWB A;  1FYK A;  2HGC A;  5JVT A;  2Z99 A;  1AWC A;  2AXL A;  4NUB A;  1XS9 A;  2LYC A;  1U9N A;  1XC5 A;  4O5V A;  1TNS A;  1ODD A;  3TGN A;  2MGQ A;  1T0F A;  2GA1 A;  1W36 C;  4Y33 A;  4MQV A;  3LSP A;  1Y39 A;  1OCT C;  2P5L C;  1O4X A;  2LD5 A;  3AG2 H;  2P6S A;  4ZH4 F;  1WJE A;  1GHC A;  3DWL E;  4I0A A;  2COM A;  3T0Y A;  4ETS A;  3CDL A;  2RGV A;  5LGN A;  2GM4 A;  3M3Y J;  1B8I B;  1LNW A;  4Q47 A;  3PIO F;  1RES A;  3FMS A;  2XVC A;  1SAX A;  1LFU P;  2R7R A;  1OIS A;  1VQL I;  1XSX A;  1UEL B;  4ZDP A;  4AWX B;  2H1L A;  3S1M J;  1ETQ A;  1X3W B;  2L2O A;  2O8X A;  4N4O B;  1IV8 A;  4DIQ A;  2CQN A;  4IQ4 A;  4IRG A;  3OYB A;  3N97 A;  3ABL H;  1G3W A;  2ZO4 A;  2KZV A;  4IRI A;  1Z1D A;  3F8B A;  4BYY A;  4F93 B;  3JRA A;  3GWZ A;  2F2E A;  4AID A;  3CO7 C;  3COA C;  2QF7 A;  4U87 A;  1D5Y A;  4LG0 A;  3CC4 I;  2R7U A;  1OJL A;  3FXL A;  2Z33 A;  2YR2 A;  5IT9 K;  3PSI A;  1MJ9 A;  2VJI A;  2FQ3 A;  3H5A A;  3PUB A;  1I3Q J;  4DGW B;  3K4M A;  5ICE A;  4UUS A;  2AHQ A;  2X1E A;  4U7B A;  5CQE A;  3Q0U A;  2ZFU A;  2EA2 A;  4CA0 A;  3JRB A;  3I58 A;  1FBS A;  4N0B A;  2K9Q A;  3ECH A;  2RDP A;  1WCM J;  4ZYD A;  1U2W A;  1QHG A;  4RAG A;  1MBG A;  3BG9 A;  4MIM A;  2HEO A;  3QU6 A;  1F1Z A;  2ECC A;  4MHG A;  3JRF A;  2F5V A;  2X48 A;  4PJ0 C;  4F3Q A;  4QTR A;  4ON0 A;  3GFM A;  3FXU A;  4LG0 B;  3ABT A;  1J09 A;  2X6X A;  1EH6 A;  2ZSI B;  1Z7U A;  2LDU A;  4UUS B;  1P2F A;  4I0B A;  4M3B A;  1JGG A;  4P55 A;  3E5X A;  2X4H A;  4ITV A;  3M1E A;  3I59 A;  3MKL A;  3K70 C;  1Z6T A;  2LNB A;  3ROU A;  3MVP A;  3K4C A;  2WC2 A;  2PLY A;  3DEE A;  1A5J A;  3DXJ F;  3IWZ A;  4PSX A;  1R1U A;  2Y9Y A;  1S9H A;  3D5S C;  1VQN I;  1E3P A;  5J1R A;  2R5Z A;  3EUA A;  2XAG A;  1LEA A;  4FX4 A;  1TWG J;  2W57 A;  1T08 B;  1FTZ A;  5J1Y A;  3IH2 A;  4PK4 A;  3MWM A;  3MKZ A;  4DYC A;  1FOY A;  2TRT A;  3KX2 A;  3Q0W A;  4G9Y A;  1Z67 A;  4PFP A;  3GUD A;  5AIP A;  4UUV A;  1YW9 A;  4XON A;  3AG1 H;  4NQW A;  2VXD A;  3FXJ A;  2PMU A;  2DJI A;  2HOE A;  2A69 F;  2HDC A;  1Y0N A;  2EZH A;  1X1B A;  2ELJ A;  4NC6 A;  2E2I J;  4RAY A;  4IXA A;  1MIJ A;  2Z2S B;  3KZZ A;  3F23 A;  3HC7 A;  3CZ6 A;  5IYB J;  1U5T B;  4D9J A;  4RGR A;  2R5Z B;  1W0T A;  2EV5 A;  4N9H A;  2GWR A;  4YII A;  1VQO I;  1YW8 A;  1R23 A;  3ZQG A;  1GXP A;  1YHQ I;  2ZJR F;  2X51 A;  2QYO A;  2V4J C;  5F27 A;  4BDZ A;  2DQL A;  4HRI A;  3JAM Z;  3RI4 A;  2E5Z A;  4G94 A;  2CUF A;  4IJA A;  2V9V A;  2VBX A;  4NQW B;  3A03 A;  2NAZ A;  1OCZ H;  2IP2 A;  2LY2 A;  2JJ7 A;  1OR7 C;  4CYD A;  4AYB N;  2EIM H;  2DYS H;  1FSE A;  5HLT A;  3GX4 X;  4OIP F;  2EQR A;  2FOK A;  2GQQ A;  1ZGW A;  4I76 A;  1VQ6 I;  5C44 J;  3O2P E;  1MSE C;  5E17 F;  3GTG J;  5LHH A;  3SZP A;  3IUO A;  4G12 A;  3ELK A;  2OZ6 A;  2QVO A;  1W5S A;  3V8K A;  3WHB A;  4XOP A;  4KMU X;  1HXD A;  4B43 A;  3WU2 C;  1P6R A;  5ICF A;  4UXN A;  2VQC A;  1TT0 A;  2QM3 A;  3RKY A;  5HDN A;  4RA2 A;  1MBK A;  2V9K A;  4G6T B;  4PJN A;  2M0C A;  2BY2 A;  3DLL F;  1RI7 A;  3ZGK A;  2M7A A;  1D8K A;  1HCR A;  3OYC A;  1GVJ A;  1QA6 A;  1Z21 A;  2VB6 A;  3SYT A;  3C7J A;  1EA3 A;  3DLA A;  2PI0 A;  4L5J A;  4YG2 F;  1XB4 A;  2VKH A;  1ON2 A;  2A68 F;  2GXB A;  3VFZ A;  3VPR A;  5GTI C;  3GW2 A;  4HDV A;  4E7Z A;  4A0Y A;  3CCS I;  2DI3 A;  3S32 A;  3GVA A;  5GAE J;  4I09 A;  1BBY A;  1BOB A;  3ISP A;  4YFK F;  2R7Z J;  5AIQ A;  2VI6 A;  2BHZ A;  4BHC A;  1ZR4 A;  3P5J A;  2XB0 X;  4JBA A;  2WWY A;  3GLX A;  2D1V A;  3BJA A;  2K85 A;  1FY7 A;  2WV0 A;  4E4H A;  3TW7 A;  3EDP A;  4EJT A;  3VDX A;  2ZME C;  3GTQ J;  1X2M A;  2RV8 A;  3QPL A;  4JOM A;  1IN6 A;  2IJL A;  1S6L A;  3WGG A;  1MMG A;  3WHC A;  1UB9 A;  1K83 J;  3LA2 A;  2VOD A;  2PJP A;  1H89 C;  1OMI A;  2HVR A;  4RGS A;  4UHT A;  1BC8 C;  3WGH A;  1TP4 A;  1VQ7 I;  1ZHF A;  1UHS A;  2PJR B;  3M8E A;  4CSW A;  1N75 A;  2B7E A;  3OR1 C;  2C6Y A;  1QQI A;  2P5V A;  5HOO A;  3MAJ A;  3H35 A;  4CHU A;  1SVO A;  4XIC A;  4UV9 A;  1EF4 A;  3WTU C;  5E8I A;  4LLN A;  4XRS A;  1UHW A;  2BYV E;  3T8T A;  4A69 C;  4C3H J;  3IAM 2;  1RKT A;  2DA6 A;  3J7A Y;  3PNY A;  1J7K A;  2DFI A;  1X1A A;  1F43 A;  4IOC F;  4YFN F;  4IHW A;  4CCJ A;  4OIQ F;  3U21 A;  2E36 A;  3K4K A;  1ZRD A;  4V2F A;  2R7S A;  2ESH A;  3S3O A;  1ETX A;  5EJC A;  2LRD A;  4P96 A;  4XM3 A;  2CUZ A;  1BI3 A;  1F36 A;  2ELK A;  3CLO A;  3A0B C;  4LIU A;  1VQK I;  2KFD A;  5D5U B;  1XDU A;  5H20 A;  1IN4 A;  3NQO A;  2HTS A;  4KN7 X;  5FKK A;  2Z1D A;  1OYY A;  5K7H A;  4O6J A;  4M73 A;  3BR3 A;  4ZYA A;  3CO6 C;  2HQA A;  3F3X A;  1PUE E;  1SD4 A;  3A02 A;  3KP7 A;  1GV2 A;  5CPR B;  1WHU A;  3HKZ N;  3LSR A;  3OYH A;  4E7S A;  3MMY B;  5L3F A;  3CJR B;  1XGS A;  4TV7 A;  1U6G A;  4RB1 A;  2Y48 A;  4LB5 A;  4B47 A;  2FNA A;  5J1U A;  1ENH A;  1QRY A;  5BNG A;  1RUO A;  5F0C A;  3HB9 A;  1T39 A;  1BI1 A;  1MZB A;  4K2E A;  3ZPL A;  1QPM A;  5CVU A;  5FRO A;  1KU7 A;  2EPF A;  3TBI A;  3SZG A;  1I3A A;  1JTY A;  4ESJ A;  2YX7 A;  4HF1 A;  1ZGA A;  1MW7 A;  4R8H A;  4Z2Y A;  2Y0M A;  4CCL A;  1TC3 C;  1Y8Q B;  4F91 B;  1TW2 A;  4ZDL A;  2M30 A;  1F4K A;  2YSR A;  1FOX A;  1U8R A;  2EFW A;  3KLN A;  1JKP C;  2DTZ A;  1DUX C;  2XGC A;  5HOD A;  2EZK A;  4IO9 F;  1FP1 D;  3ABU A;  4KNY A;  2DA5 A;  2A5W A;  5KAI C;  2Q1Z B;  2Y75 A;  1G2H A;  2FUG 2;  2KIM A;  3GXO A;  1XMX A;  4A0Z A;  5FLM J;  4U0V A;  4JQF A;  1TWA J;  2EFQ A;  5L3B A;  3PM1 A;  4P1W A;  5EZH A;  3N05 A;  3M9A A;  3LFK A;  3KP5 A;  2V1U A;  3D0S A;  2QKM B;  3M4O J;  1EJ9 A;  1G6N A;  1N25 A;  3LMM A;  1TT5 B;  2H27 A;  3QPH A;  4BBS J;  2BY0 A;  2ETH A;  5LBQ A;  2F5D A;  3F8M A;  2V6C A;  1FIP A;  3R4K A;  3HOU J;  3PNV A;  4KJZ A;  2J5O A;  4L0Z B;  2R92 J;  2ZCW A;  2LLK A;  3L2C A;  4S05 A;  2VC1 A;  2IGM A;  4XRF A;  3BLY A;  2JZY A;  1IUY A;  2DMP A;  2RVC A;  2IA1 A;  3TDU C;  3G4S I;  3LFU A;  2LY1 A;  2CW8 A;  2WY7 Q;  4Y7N J;  2G0E A;  1T6S A;  2WTE A;  3WTY C;  1S72 I;  2V26 A;  3QRF F;  1K4S A;  2E19 A;  1PJR A;  3PQK A;  5J4V A;  2E2J J;  2QKL B;  4ESB A;  1FEX A;  2R4G A;  1MNM C;  4RB3 C;  1J5Y A;  2LVS A;  3AFH A;  5DS9 A;  1J0R A;  4EMS A;  3QOD A;  1Y56 A;  3OIQ A;  4CIC A;  4WF2 A;  3OYD A;  4BQA A;  4DOZ A;  1HOM A;  4C30 A;  4D1Q A;  3J81 K;  2EIJ H;  3V42 A;  3AG3 H;  3ZQI A;  2EJR A;  2RAE A;  3K10 A;  1NTC A;  4E6K G;  1JKR C;  4QIW N;  3F72 A;  3HRT A;  3HZJ A;  4RAZ A;  2BBY A;  1FIA A;  4L5I A;  1S29 A;  4Q48 A;  2MBF A;  4M6V A;  2DU9 A;  4BJT A;  5DM7 F;  2GLO A;  1MKM A;  3B6A A;  2UXN A;  5GPA A;  1XDS A;  4A6D A;  3P9C A;  4XLF A;  2QSG X;  2LK2 A;  3GYH X;  1B4A A;  1V5G A;  3M8J A;  3TO7 A;  3OWT A;  2LSO A;  4YFX F;  3OIP A;  4ZYE A;  3RQ4 A;  3HTU A;  4BU2 A;  1ETO A;  1IN7 A;  3O6B B;  3CF5 F;  2JA8 J;  4BH9 A;  3H5R A;  2MAB A;  1SD6 A;  3SDG A;  4J00 A;  3HRM A;  2VLA A;  1ZAR A;  2MA3 A;  4GGG A;  3OYA A;  4RLF A;  4KIG A;  4BE0 A;  4UVB A;  3KEY A;  1OCC H;  3VSL A;  4RGU A;  4M9X A;  2Y0S N;  2LMD A;  1FT9 A;  3TO6 A;  2L0K A;  5J47 A;  5F0H A;  1XD7 A;  1IGN A;  4WXH A;  4ZYG A;  2CFO A;  2LBF B;  3F21 A;  1O7F A;  2O0Y A;  1V54 H;  1ETW A;  3B02 A;  1IDZ A;  3BG6 A;  2BXY A;  4UY8 I;  1S8N A;  1BIA A;  3CUQ C;  2NVT J;  1HDP A;  1POG A;  4F52 A;  2VXZ A;  3KZY A;  1I6H J;  1KA8 A;  4BHB A;  4J19 A;  1HQC A;  4MFD A;  2H09 A;  2F5F A;  2GA2 A;  1LPQ A;  1X3Z B;  4FE4 A;  2DPU A;  1R22 A;  3F8C A;  4NDL A;  1UMQ A;  5CVR A;  3ABK H;  2CQ7 A;  3LL7 A;  1P7I A;  2FBH A;  2OA4 A;  2Y30 A;  3HOZ J;  2AS5 F;  2YX4 A;  4E7H A;  2PG4 A;  2M2E A;  3BR6 A;  5J6X A;  2MG4 A;  2K9L A;  2YU3 A;  1R5G A;  5L3C A;  4PJM A;  4JK1 X;  3U9G A;  3HL2 A;  4GXO A;  5DD8 A;  3RTR A;  1D8J A;  3S17 J;  2GOM A;  2W24 A;  2O7O A;  3WE2 A;  3WG7 H;  2HS5 A;  2Q0O A;  2CQK A;  3I9V 2;  1YFH A;  4KDP A;  3DKY A;  2MC4 A;  1PVE A;  1SFX A;  3CDI A;  3MZ8 A;  4UUT A;  1IN5 A;  1HDD C;  4WXC A;  2ZME A;  4RBO A;  2G7H A;  1W36 D;  1JKQ C;  3C18 A;  4F7Z A;  1IXS B;  3TQN A;  2YU9 J;  1Z6R A;  2DT6 A;  2R3S A;  1K79 A;  2H94 A;  2ICW G;  3KEQ A;  4A3F J;  4BKX A;  1E2X A;  2E34 A;  1MBF A;  1NK2 P;  5FLV A;  1W1W E;  2RRE A;  3ZR8 X;  2R7O A;  4MTD A;  3QP5 A;  3S14 J;  1AOY A;  4R79 A;  1RRJ A;  3KPH A;  1RUN A;  1IC8 A;  2COB A;  2OBP A;  4KIS A;  4L9J A;  5ED4 A;  3OS1 A;  1FTT A;  3LSI A;  1XGN A;  1R58 A;  1GUU A;  3K4B A;  3KP6 A;  4OAY A;  2HKO A;  1LKX A;  3CD6 I;  3G6E I;  3K6G A;  3CMA I;  3BRO A;  4LK1 F;  3I55 I;  1KU3 A;  2FOW A;  3OMY A;  1QZY A;  3BR0 A;  3EPZ A;  3ABM H;  1DPR A;  3IKV A;  2W7N A;  3QPS A;  2XGE A;  1MMD A;  4LB6 B;  2V79 A;  5E79 C;  4BHP A;  5HS8 A;  4GDF A;  3BPV A;  3IH3 A;  1GDT A;  5FGM A;  2ZJP F;  4EM2 A;  4IQJ A;  2FF4 A;  1S7O A;  1FSH A;  1YE9 A;  1YS6 A;  1TZL A;  4XR6 A;  1UJ8 A;  2QSF X;  4AU7 A;  3NAU A;  4PGG A;  2GOX B;  4M3E A;  1RPW A;  2ZB9 A;  2P5K A;  3V7C A;  1T95 A;  2CQX A;  2PN6 A;  4YIR X;  2K9M A;  4A3D J;  3BY6 A;  2K3P A;  2Z3Y A;  4MTE A;  2I8D A;  3OYN A;  3QOE A;  3JAM K;  1YRN A;  4L18 B;  2ZFW A;  3DFG A;  4DZP A;  1Y6I A;  3NEU A;  2LRE A;  3BZK A;  2O6G E;  1BI0 A;  3VSK A;  3HM5 A;  4XOR A;  4UVA A;  3HG9 A;  3CC2 I;  3MZY A;  2Y9Z A;  5H6Q A;  5E1W A;  3ZN1 A;  4XID A;  3H36 A;  5C3E J;  2AO9 A;  2VBY A;  1DDN A;  1SD5 A;  4IVN A;  3U2R A;  1VI0 A;  1ZG1 A;  1X4P A;  5D6E A;  1X58 A;  3HOX J;  1LE8 A;  3JRI A;  2I5U A;  3I0T A;  2E1M C;  2WAQ A;  3P9K A;  2ELH A;  3S2W A;  1SMT A;  5F08 A;  2XAQ A;  1RC9 A;  2ZSH B;  4V2G A;  4QPO A;  1YRN B;  3OYL A;  1MJB A;  3ASN H;  5E1Z B;  3J80 Z;  1UZC A;  1YIT I;  1X3U A;  3GFJ A;  4I01 A;  4OU0 A;  3RQI A;  2VOO A;  1V55 H;  5GAG J;  2ZBK A;  2IS4 A;  2P7V B;  1U0J A;  2PEX A;  2VAS A;  4IHT A;  3QOP A;  3NWT A;  3E5Q A;  4BL0 B;  1FWZ A;  2VQL A;  3G1L A;  5IYD J;  3DEU A;  2VKD A;  3CES A;  3UR3 C;  4B1R A;  4I6Z A;  2ZXJ A;  1YW7 A;  3B73 A;  2RQQ A;  3KP3 A;  5FFX A;  3VYR B;  1LE8 B;  1XMK A;  5A2Q Z;  3VEP A;  1ZQ3 P;  2JPB A;  2XGD A;  2D1H A;  2IS2 A;  4IOA F;  4JX4 A;  5FKM A;  3L2V A;  3JRC A;  1MBH A;  4O3M A;  4XKW A;  4Y3O A;  5KAF C;  5B1A H;  2UZK A;  1WJ5 A;  2IPQ X;  1MBE A;  4WWC A;  3AL0 C;  2VJ5 A;  3P9I A;  3KYC B;  2Q8K A;  5HS9 A;  3DTK A;  2BVL A;  5M5Y J;  4YRV A;  1X1C A;  2DXI A;  5DD4 A;  3HOT A;  2BZT A;  2FMY A;  2BEO A;  4IRH A;  2ISY A;  1O3S A;  1REP C;  4A3C J;  3FM5 A;  3H92 A;  3CJT B;  4L9N A;  1QZZ A;  2R7X A;  2GZW A;  4XN0 A;  3E5U A;  2EV0 A;  2KDO A;  4BAC A;  4PGH A;  3D5L A;  3GFI A;  3RPU D;  2HPI A;  4XMY A;  3BR2 A;  5D4R A;  3A2K A;  4AC0 A;  1Y1V J;  2CS3 A;  1W4M A;  2L9R A;  4CDG A;  2JQ7 A;  4EEF G;  3QU3 A;  5K7Z A;  2L9V A;  1YJN I;  5FKO A;  2ACJ A;  4PJL A;  2ID3 A;  5IYC J;  3FXO A;  5GPC A;  2QA4 I;  1MSF C;  2BE5 F;  3I4N J;  2KKO A;  3I59 B;  4A3J J;  4LIV A;  3D1N I;  2OTL I;  1WKM A;  1YJW I;  1WVR A;  2DFE A;  2NS0 A;  2MLK A;  2FX0 A;  2QSH X;  1PYV A;  4OMY A;  4M9S A;  3FMQ A;  4GO1 A;  4D7N A;  1LDD A;  3MN2 A;  2Z16 A;  3VYS B;  4IEJ A;  5EYR A;  5HNH A;  2LC2 A;  2JA6 J;  5FKL A;  3PFI A;  1HC8 A;  2VN2 A;  4PJJ A;  1FNN A;  2BV6 A;  2P4W A;  3REO A;  4KIF A; 
#chains in the Genus database with same CATH homology
 3BOQ A;  1P4X A;  4KFC A;  4U7D A;  2VBZ A;  3HSE A;  1B9M A;  2E7X A;  4WX9 A;  2B0L A;  1STZ A;  3FZV A;  4AIH A;  3QP6 A;  1KYZ A;  3I71 A;  3BP8 A;  4LJZ F;  1ULY A;  1XSV A;  4EJU A;  5FLX Z;  1LDJ A;  2QEN A;  2FA5 A;  5ICG A;  5DDG A;  5E1X A;  2QQ9 A;  1R00 A;  3HSR A;  4I7H A;  2HQN A;  1IF1 A;  1Q1H A;  3R60 A;  5JR3 A;  4S04 A;  2DPD A;  1G3S A;  2RC4 A;  4GYI A;  3RJP A;  3CUQ A;  1W7P A;  2HYG D;  4XSZ F;  2CG4 A;  5F6F A;  3SZT A;  5E20 A;  4QWQ A;  1HW1 A;  2JT1 A;  1U3E M;  1R7J A;  2DW4 A;  4Q4Z F;  1TBX A;  1ZGJ A;  1CF7 A;  2PQ8 A;  2L02 A;  1NHA A;  3KLO A;  1UHM A;  2O03 A;  1T2K A;  1LB2 A;  1BC7 C;  3L09 A;  2KIU A;  2X0L A;  4G6D A;  1G3T A;  3DKW A;  1HW2 A;  3E6D A;  3R61 A;  5FD6 A;  4EJW A;  2PBI A;  3WTS C;  4B09 A;  1WQ2 A;  4L0Y B;  2KRF A;  2XKP A;  5LHG A;  2A6H F;  2L4A A;  1T38 A;  1CF7 B;  2OAZ A;  4KA4 A;  1W5T A;  4PCQ A;  1F5T A;  3M7G A;  4EVI A;  3CTA A;  4G8X A;  2FE3 A;  2CO5 A;  3VOE A;  2QQA A;  3E97 A;  3TDZ C;  3ZP5 A;  2EV6 A;  2XAJ A;  1I6X A;  1OYW A;  4ESF A;  5K5O A;  3BZ6 A;  1J2X A;  5CLS A;  3IRR A;  4OIR F;  3HIF A;  4ENJ A;  1FP2 A;  4KUM A;  2HQR A;  1XCB A;  2EFN A;  5LEJ A;  3G3Z A;  2F5E A;  1O3Q A;  2UXX A;  4U88 A;  3V4G A;  3F8F A;  1XMA A;  1DPU A;  3ULQ B;  2IRF G;  4P5O A;  3GFL A;  4HX8 A;  5HDK A;  5D6F A;  3HRS A;  3RPQ A;  2M8E A;  2RNJ A;  3IRQ A;  2EFO A;  1L3L A;  4G7Z F;  1XSD A;  2VE8 A;  3FWE A;  4HQM A;  1YO5 C;  2LKP A;  3E3V A;  1FBU A;  2CW0 F;  1ZN2 A;  3RKW A;  1TNT A;  1U78 A;  5L3D A;  4HX7 A;  2DQR A;  4ENM A;  5DV5 A;  3L9F A;  3IL2 A;  4EQQ A;  2G9W A;  2CSO A;  1I5Z A;  2O3F A;  2L54 A;  5D8K B;  1USS A;  2HWV A;  3ZMT A;  5LGT A;  3EQL F;  3W6J B;  3SHF A;  2GIV A;  4BAY A;  3TOA A;  2E1N A;  2XAF A;  1MD0 A;  2CYY A;  3BJO A;  1P92 A;  1JXS A;  4OIO F;  5DCM A;  3BPX A;  4KN4 X;  3F8N A;  1KQ8 A;  1PDN C;  3ERE D;  3Q5F A;  2K7L A;  5E8G A;  2EK5 A;  2QUF A;  3HHG A;  1JE8 A;  3HUG A;  4G7O F;  4HLY A;  4AVP A;  1RNL A;  3I5U A;  3MCZ A;  4LK0 F;  4UV8 A;  3TKY A;  4UVC A;  2F5C A;  1U5T C;  5LHI A;  1W7P D;  5BOX A;  4FX0 A;  3F6O A;  5DCM B;  5CVI A;  1CGP A;  3MEX A;  1EH8 A;  5ILS A;  1FLI A;  2GXG A;  4Q5S F;  1D3Y A;  4AIK A;  4CZZ A;  3F22 A;  4HOB A;  2FEZ A;  4A0X A;  2DK8 A;  2R7F A;  2Z5U A;  1SFE A;  1OR7 A;  1GXQ A;  3T1B A;  3K1M A;  1MGT A;  2J5P A;  2L01 A;  1HBX G;  4ENN A;  5BS6 A;  3RPU A;  1FX7 A;  1WSU A;  4LLG F;  1R1T A;  2XHK A;  2VON A;  1I1S A;  4HLX A;  2A5Y B;  2BGC A;  1J75 A;  4M72 A;  3CDH A;  2PFB A;  1Y0U A;  2ESN A;  4Y15 A;  3J80 K;  1D5V A;  4U0W A;  3K1P A;  3R0J A;  5DEQ A;  4RGX A;  1ZH5 A;  2G7U A;  6PAX A;  4NHJ A;  4RS8 A;  3WU0 A;  1HW5 A;  5ILU A;  3E6M A;  5HLG A;  3KE2 A;  2QZ8 A;  4CGZ A;  3BWG A;  4HX4 A;  3OV8 A;  5A2Q K;  2KIF A;  3T5X A;  2XRO A;  1RIO H;  2K02 A;  1FC3 A;  4G7H F;  1OYI A;  1O3T A;  5D5W B;  3FX3 A;  1HST A;  4B8X A;  3EYI A;  3ZMS A;  4UNO A;  3ZMZ A;  3SFZ A;  2YPR A;  2DT5 A;  1FBQ A;  1YTY A;  1BN5 A;  3OOP A;  2K86 A;  3JSO A;  5E18 F;  2M1B A;  5LLQ A;  2ISZ A;  3RYR A;  3V7S A;  2ZME B;  2L4M A;  5J8C A;  3T8R A;  3DQV C;  2K27 A;  2OD5 A;  2XIG A;  5L3G A;  2O61 A;  2P8T A;  5LGU A;  3MFK A;  1BOA A;  1UST A;  1ZYR F;  2XRN A;  1K78 A;  2EA4 A;  4BNC A;  1IW7 F;  5ICC A;  1JHF A;  1L0O C;  3FF5 A;  3NRV A;  5D8L B;  4EGY A;  3KP2 A;  1MDM A;  4WK8 F;  4M9Z A;  1ONV A;  3FM3 A;  5FLX K;  2VT2 A;  1FYL A;  4XBF A;  2GAU A;  1K78 B;  3WTX C;  3V8L A;  2A6E F;  1R1V A;  5CYV A;  4Y13 A;  3ZMD A;  5BMZ A;  3LST A;  3KCC A;  1MDM B;  4EJV A;  3HTS B;  1O57 A;  4XLP F;  4GCV A;  3FMR A;  3DF8 A;  3LA3 A;  5K5R A;  5F1R A;  1O3R A;  4MQ9 F;  4A12 A;  5HS7 A;  1QGP A;  1KU2 A;  2OQR A;  2RN7 A;  3RDI A;  5ERI A;  1ZRF A;  3IKT A;  1XCV A;  1B6A A;  3WG9 A;  2ZNY A;  2DBB A;  2JTV A;  3K69 A;  2P6T A;  2EFP A;  2XGX A;  1ZRE A;  4G6Q A;  1PP7 U;  1ZG5 A;  4M74 A;  3WTV C;  5ILV A;  2R7D A;  4HF0 A;  1B59 A;  5JHU A;  2OQG A;  5HLH A;  1BM9 A;  2XAS A;  1P4W A;  1YIO A;  3ZQ7 A;  3GZ6 A;  4MEY F;  3FHZ A;  3W6K B;  1QO0 D;  2RKH A;  5D4S A;  1FZP B;  3MZH A;  2E1C A;  1BIB A;  3RIR A;  4P9F A;  2JSC A;  3JTG A;  1H9G A;  3K9T A;  1U5T A;  4EV0 A;  1ZG3 A;  5KK1 A;  5J8F A;  3RKX A;  2JRT A;  5L3E A;  3VOD A;  4NB5 A;  3BDD A;  3L7W A;  2EB7 A;  1ON1 A;  1XN7 A;  4DNC A;  3GZ5 A;  4ZZL A;  1TLH B;  2DTR A;  2VOP A;  4H0E A;  3FXQ A;  1YLF A;  3WTW C;  2DO7 A;  2L3D A;  2FML A;  4IPA A;  1LVA A;  1SFU A;  4IHS A;  3M8F A;  5F64 A;  5DUI A;  3LAP A;  1ZLK A;  3JTH A;  3GF2 A;  2DAO A;  1KQ9 A;  1S3J A;  4DQ2 A;  5DYM A;  3ECO A;  1R5H A;  3QAH A;  2XKO A;  2M87 A;  3EET A;  1Z05 A;  4A5N A;  3ZMV A;  3HRU A;  1TQP A;  5CVJ A;  4L9V A;  2EWN A;  4M6X A;  2OU2 A;  3K1N A;  5IT9 Z;  1QNT A;  1EV7 A;  1JGS A;  1XGO A;  4AD9 A;  2FBI A;  4RB0 A;  3ZMU A;  3O3K A;  2A61 A;  2QWW A;  2V1D A;  1ZLJ A;  2W84 A;  5AON A;  1E17 A;  2A07 F;  3CUQ B;  4LLL A;  4ASN A;  4M6Y A;  1W7P B;  1IN8 A;  2RQP A;  1I27 A;  1TW3 A;  1SMY F;  2H6B A;  3U1D A;  2W25 A;  3I64 A;  2VT3 A;  1Z9C A;  3RYP A;  4IF4 A;  2MLG A;  4EM0 B;  4RB2 C;  2IVM A;  1VTN C;  4R1H A;  3TOB A;  3KP4 A;  4HZF A;  2IA0 A;  3DPT A;  3WTZ A;  2HR3 A;  1LDK B;  2XUB A;  2STT A;  4ZZD A;  4HW0 A;  5H6R A;  5D5V B;  4LD5 A;  4XLN F;  4I2O A;  3GO5 A;  3PQJ A;  4WXD A;  2KJB A;  4I98 B;  5DCF A;  5EEH A;  2H6C A;  1EH7 A;  5FO5 A;  1HKS A;  4HV5 A;  4OOI A;  2DK5 A;  3I54 A;  4HAM A;  4EJO A;  2QQB A;  4KMF A;  2QBY A;  1O7L A;  2W85 A;  2XAH A;  5EEG A;  3CUO A;  2VBW A;  3H3U A;  2CWE A;  1B9N A;  2IW5 A;  3HYI A;  4N9I A;  5HDG A;  1H0M A;  4KIC A;  2Q2E A;  3WU1 B;  4BXU A;  1XGM A;  2ADU A;  4OMZ A;  4D0P A;  1H9T A;  2VE9 A;  4M71 A;  3ML6 A;  1K6O A;  2K4B A;  3WTT C;  1IXC A;  2XV4 S;  1MJA A;  1IRF A;  4WCG A;  4A5M A;  1SD7 A;  1QBJ A;  5K1Y A;  3Q9V A;  2QBY B;  1JHH A;  2JPC A;  1KU9 A;  1I1G A;  2ZNZ A;  2CGP A;  4XSX F;  1F9N A;  4QLC U;  4AIJ A;  3WOD F;  3QPT A;  4CO8 A;  2FSW A;  5TRD A;  4EM1 A;  3R0A A;  1V3F A;  4MNU A;  4ENK A;  1WRJ A;  2HKX A;  2HYF A;  1YG2 A;  5JI6 A;  1BI2 A;  5D5X B;  1ZRC A;  1J59 A;  1IRG A;  1IZ1 A;  3F6V A;  2ZJ2 A;  4FHT A;  4LFU A;  5BPI A;  3KEO A;  3SQN A;  4LGW A;  1KQ0 A;  4I02 A;  4U0Y A;  5HVQ C;  2KJC A;  4MGR A;  3WGI A;  2UWM A;  2FRH A;  3C1D A;  1G4D A;  3LA7 A;  2LF8 A;  2STW A;  2QLZ A;  5K5Q A;  1P4A A;  4Y17 A;  4E70 A;  4YIF A;  2FU4 A;  3R6S A;  1DP7 P;  1IXR C;  3EYY A;  4FT8 A;  2M5W A;  1YYV A;  4HF2 A;  2ZKZ A;  4ZYH A;  1KYW A;  4P9U A;  3DV8 A;  4A2U A;  3HHH A;  3CJN A;  3JW4 A;  2FXA A;  2NNN A;  4MEX F;  5CVV A;  5FFZ A;  5BQT A;  3AAF A;  5HLI A;  1B1B A;  1HKQ A;  1T98 A;  5LRR A;  2MD5 A;  1YS7 A;  3MQ0 A;  3KFW X;  5FD5 A;  3E6C C;  3Q9S A;  5TJJ A;  4OIN F;  3K2Z A;  2Z9O A;  1OPC A;  3GEZ A;  1ZAO A;  2HFH A;  1TTY A;  3DPL C;  3N4M A;  1V4R A;  3LWF A;  3P7N A;  5BPD A;  3J7A O;  3IWF A;  2K4J A;  4HA8 A;  4KT5 C;  4EGZ A;  2M45 A;  1RZ4 A;  4LMY A;  1WI9 A;  1FOK A;  1UCR A;  2DLL A;  2HTJ A;  1TQM A;  1HSJ A;  2FNP A;  2LF7 A;  4HQE A;  1FYM A;  2P7C B;  3BJ6 A;  2TDX A;  3V7R A;  4HBL A;  4HYE A;  3IHU A;  2MH9 A;  1C0W A;  1IAW A;  2HZT A;  3TO9 A;  3JSP A;  3V8J A;  1LQ1 A;  5KVR A;  1PP8 F;  3KET A;  3K0L A;  2NNY A;  2V1X A;  2FBK A;  4HV6 A;  3ZN0 A;  3E6B A;  5LRS A;  5DUK A;  1WWX A;  3G73 A;  2NRA C;  3I53 A;  4PZJ A;  1TQI A;  2IT0 A;  1A04 A;  2OZU A;  3WE3 A;  3SXY A;  1KGS A;  5LEK A;  4PDK A;  1HKT A;  3EUH A;  3LQR A;  1K7A A;  5CJ9 A;  3FXR A;  2IA2 A;  1S7A A;  2E7W A;  5IT3 A;  4CXF A;  1G3Y A;  1LJ9 A;  2VC0 A;  3HSF A;  1LEB A;  3I4P A;  1R36 A;  5FB2 A;  2MC3 A;  3C3W A;  4KIB A;  2NYX A;  1FPQ A;  1YQA A;  3LQQ A;  1OKR A;  5JFR A;  2PMH A;  3IC7 A;  3H3Z A;  2A3S A;  3HOS A;  4A6E A;  2D45 A;  1BJA A;  1J9I A;  4L9T A;  3L00 A;  2MH2 A;  4GYG A;  3J81 Z;  3VB2 A;  4KYW A;  1Z91 A;  2CFX A;  1UFM A;  3LAJ A;  3DP7 A;  2D2W A;  4HDU A;  1FYK A;  2HGC A;  5JVT A;  2Z99 A;  1AWC A;  2AXL A;  4O5V A;  1TNS A;  1ODD A;  3TGN A;  1T0F A;  2GA1 A;  4MQV A;  2P5L C;  2P6S A;  4ZH4 F;  1GHC A;  3T0Y A;  4I0A A;  2COM A;  4ETS A;  2RGV A;  5LGN A;  1LNW A;  4Q47 A;  3FMS A;  2XVC A;  1SAX A;  1XSX A;  4AWX B;  2O8X A;  4IRG A;  3N97 A;  1G3W A;  2ZO4 A;  4IRI A;  1Z1D A;  3F8B A;  4BYY A;  3GWZ A;  2F2E A;  3CO7 C;  3COA C;  4LG0 A;  2Z33 A;  2YR2 A;  5IT9 K;  1MJ9 A;  2FQ3 A;  5ICE A;  4U7B A;  2EA2 A;  3I58 A;  1FBS A;  4N0B A;  3ECH A;  2RDP A;  4ZYD A;  1U2W A;  2HEO A;  3QU6 A;  1F1Z A;  4MHG A;  4ON0 A;  3GFM A;  3FXU A;  4LG0 B;  3ABT A;  1EH6 A;  1Z7U A;  2LDU A;  1P2F A;  4I0B A;  4P55 A;  3E5X A;  2X4H A;  3M1E A;  3I59 A;  1Z6T A;  2LNB A;  3ROU A;  2WC2 A;  2PLY A;  3DXJ F;  3IWZ A;  1R1U A;  2XAG A;  1LEA A;  4FX4 A;  2W57 A;  3MWM A;  4G9Y A;  3GUD A;  5AIP A;  4UUV A;  1YW9 A;  4NQW A;  2PMU A;  2HOE A;  2A69 F;  2HDC A;  4RAY A;  4IXA A;  3KZZ A;  3F23 A;  1U5T B;  4RGR A;  2EV5 A;  4N9H A;  2GWR A;  4YII A;  1YW8 A;  1R23 A;  1GXP A;  2QYO A;  2DQL A;  3JAM Z;  3RI4 A;  4G94 A;  4IJA A;  2V9V A;  2VBX A;  2NAZ A;  2IP2 A;  4CYD A;  1FSE A;  3GX4 X;  4OIP F;  2FOK A;  2GQQ A;  3O2P E;  5E17 F;  5LHH A;  3SZP A;  3ELK A;  2OZ6 A;  2QVO A;  1W5S A;  3V8K A;  4KMU X;  1HXD A;  1P6R A;  5ICF A;  4UXN A;  2QM3 A;  3RKY A;  5HDN A;  1RI7 A;  1D8K A;  1GVJ A;  3C7J A;  2PI0 A;  4L5J A;  4YG2 F;  1XB4 A;  1ON2 A;  2A68 F;  2GXB A;  3VFZ A;  3GW2 A;  4HDV A;  4A0Y A;  2DI3 A;  3GVA A;  4I09 A;  1BBY A;  3ISP A;  4YFK F;  5AIQ A;  4BHC A;  4JBA A;  2WWY A;  3GLX A;  2D1V A;  3BJA A;  1FY7 A;  2WV0 A;  3EDP A;  4EJT A;  2RV8 A;  1IN6 A;  2IJL A;  1S6L A;  3WGG A;  1UB9 A;  3LA2 A;  2VOD A;  2PJP A;  1OMI A;  4RGS A;  4UHT A;  1BC8 C;  3WGH A;  1ZHF A;  3M8E A;  2C6Y A;  1QQI A;  2P5V A;  5HOO A;  3MAJ A;  4CHU A;  4UV9 A;  3WTU C;  5E8I A;  4LLN A;  1UHW A;  2BYV E;  3T8T A;  2DFI A;  1J7K A;  4YFN F;  4OIQ F;  1ZRD A;  2ESH A;  4P96 A;  1BI3 A;  3CLO A;  5D5U B;  1XDU A;  5H20 A;  1IN4 A;  3NQO A;  2HTS A;  4KN7 X;  1OYY A;  4O6J A;  4M73 A;  1PUE E;  3CO6 C;  3F3X A;  1SD4 A;  3KP7 A;  5L3F A;  1XGS A;  4TV7 A;  1U6G A;  4RB1 A;  2Y48 A;  4LB5 A;  2FNA A;  1RUO A;  1T39 A;  1BI1 A;  1MZB A;  4K2E A;  3ZPL A;  1QPM A;  5CVU A;  1KU7 A;  4ESJ A;  2YX7 A;  4HF1 A;  1ZGA A;  4R8H A;  4Z2Y A;  2Y0M A;  1TW2 A;  2M30 A;  1F4K A;  2YSR A;  1U8R A;  2EFW A;  3KLN A;  1DUX C;  1FP1 D;  3ABU A;  4KNY A;  2Y75 A;  3GXO A;  2KIM A;  4A0Z A;  4U0V A;  4JQF A;  2EFQ A;  5L3B A;  3M9A A;  3LFK A;  3KP5 A;  2V1U A;  3D0S A;  1G6N A;  2H27 A;  3QPH A;  2ETH A;  5LBQ A;  2F5D A;  3F8M A;  2V6C A;  3R4K A;  2J5O A;  4L0Z B;  2ZCW A;  3L2C A;  4S05 A;  2VC1 A;  4XRF A;  2JZY A;  1IUY A;  2RVC A;  2IA1 A;  3TDU C;  1T6S A;  2WTE A;  3WTY C;  3QRF F;  3PQK A;  4ESB A;  4RB3 C;  1J5Y A;  1J0R A;  4EMS A;  4CIC A;  4WF2 A;  4BQA A;  3J81 K;  2EJR A;  3F72 A;  3HRT A;  4RAZ A;  2BBY A;  4L5I A;  1S29 A;  4Q48 A;  2MBF A;  2DU9 A;  1MKM A;  2UXN A;  1XDS A;  4A6D A;  3P9C A;  3GYH X;  1B4A A;  3TO7 A;  2LSO A;  4YFX F;  4ZYE A;  3HTU A;  1IN7 A;  3O6B B;  4BH9 A;  1SD6 A;  3HRM A;  1ZAR A;  2MA3 A;  4GGG A;  4KIG A;  4UVB A;  4RGU A;  4M9X A;  1FT9 A;  3TO6 A;  1XD7 A;  4WXH A;  4ZYG A;  3F21 A;  1O7F A;  2O0Y A;  3B02 A;  1S8N A;  1BIA A;  3CUQ C;  2VXZ A;  3KZY A;  1KA8 A;  4BHB A;  1HQC A;  2H09 A;  2F5F A;  2GA2 A;  2DPU A;  1R22 A;  3F8C A;  5CVR A;  2FBH A;  2OA4 A;  2AS5 F;  2YX4 A;  2PG4 A;  5J6X A;  2YU3 A;  1R5G A;  5L3C A;  4JK1 X;  3U9G A;  4GXO A;  5DD8 A;  3RTR A;  1D8J A;  2W24 A;  3WE2 A;  2HS5 A;  2Q0O A;  2CQK A;  1YFH A;  4KDP A;  1SFX A;  1IN5 A;  4WXC A;  2ZME A;  2G7H A;  3C18 A;  4F7Z A;  1IXS B;  3TQN A;  1Z6R A;  2R3S A;  1K79 A;  2H94 A;  3KEQ A;  1E2X A;  4MTD A;  3QP5 A;  1AOY A;  4R79 A;  1RUN A;  2OBP A;  4L9J A;  5ED4 A;  1XGN A;  1R58 A;  3KP6 A;  2HKO A;  3BRO A;  4LK1 F;  1KU3 A;  1QZY A;  1DPR A;  3IKV A;  4LB6 B;  2V79 A;  4BHP A;  5HS8 A;  3BPV A;  5FGM A;  4EM2 A;  2FF4 A;  1S7O A;  1FSH A;  1YS6 A;  4PGG A;  2P5K A;  3V7C A;  2PN6 A;  3BY6 A;  2Z3Y A;  4MTE A;  3JAM K;  4L18 B;  2ZFW A;  3DFG A;  3NEU A;  2O6G E;  1BI0 A;  4UVA A;  3MZY A;  5H6Q A;  5E1W A;  3ZN1 A;  2VBY A;  1DDN A;  1SD5 A;  4IVN A;  3U2R A;  1ZG1 A;  5D6E A;  3I0T A;  3P9K A;  2ELH A;  3S2W A;  1SMT A;  2XAQ A;  1MJB A;  5E1Z B;  3J80 Z;  1X3U A;  3GFJ A;  4I01 A;  4OU0 A;  2VOO A;  2ZBK A;  2P7V B;  2PEX A;  4IHT A;  3QOP A;  3E5Q A;  1FWZ A;  3DEU A;  2ZXJ A;  1YW7 A;  3B73 A;  3KP3 A;  5FFX A;  1XMK A;  5A2Q Z;  3VEP A;  2JPB A;  2D1H A;  4O3M A;  2UZK A;  2IPQ X;  4WWC A;  3P9I A;  2Q8K A;  5HS9 A;  5DD4 A;  3HOT A;  2FMY A;  2BEO A;  4IRH A;  2ISY A;  1O3S A;  1REP C;  3FM5 A;  3H92 A;  4L9N A;  1QZZ A;  2GZW A;  3E5U A;  2EV0 A;  4PGH A;  3D5L A;  3GFI A;  5D4R A;  1W4M A;  4CDG A;  3QU3 A;  2ACJ A;  2BE5 F;  2KKO A;  3I59 B;  1WKM A;  2NS0 A;  2MLK A;  4OMY A;  4M9S A;  3FMQ A;  4GO1 A;  1LDD A;  3PFI A;  2VN2 A;  1FNN A;  2BV6 A;  2P4W A;  3REO A;  4KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...