2OD5A

Crystal structure of a putative nucleic acid binding protein (jcvi_pep_1096688149193) from uncultured marine organism at 1.79 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
ETESMKTVRIREKIKKFLGDRPRNTAEILEHINSTMRHGTTSQQLGNVLSKDKDIVKVGYIKRSGILSGGYDICEWATRNWVAEHCPEWTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (JCVI_PEP_1096688149193) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 1.79 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Dna binding protein
molecule keywords hypothetical protein
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2od5A00
1QO0D 3LFKA 1G4DA 4H0EA 5FD5A 3V8LA 5F1RA 3T1BA 3GFJA 2FEZA 3GEZA 5LHHA 4UV8A 2QLZA 3L2CA 3T5XA 3GX4X 3DEUA 3WGGA 2ZMEB 5JFRA 5D5XB 4HLYA 5D6FA 2P8TA 3E3VA 3ECOA 2GWRA 2UZKA 3GZ6A 1S7OA 2FOKA 3CJNA 5AIQA 1ZLJA 3LA7A 4YIIA 1HSTA 3KZYA 4DQ2A 1R7JA 2DO7A 1BBYA 4AVPA 3T8RA 4ESFA 1KU9A 4P9FA 1Z1DA 5FO5A 2D2WA 3I54A 2QWWA 4ZZLA 1R00A 3HYIA 4RGRA 3FXQA 3ISPA 2VBZA 1WKMA 2A6EF 1F9NA 2KJCA 1J9IA 5JVTA 3ULQB 3MZYA 4KT5C 1BC8C 2NYXA 2P5VA 1U5TA 3KLNA 4I01A 5FB2A 2P6TA 4LG0B 1R23A 3WTUC 5DD8A 5E18F 1QPMA 2EV6A 5CVVA 1T98A 1YG2A 4A6DA 3SXYA 1BI1A 1YS7A 2OA4A 4FT8A 4O6JA 4EM0B 3HTUA 2LDUA 1SAXA 4G7OF 3HIFA 4ESJA 1MZBA 4CHUA 4HF2A 1Z91A 3MEXA 1LB2A 5DCMA 3GFIA 2DT5A 2OU2A 3RTRA 2IT0A 1RUOA 1XB4A 1S7AA 2FMYA 1J0RA 4OMZA 1IN5A 3E6MA 4ENJA 1XGMA 1U78A 2H6BA 4WXHA 2KIFA 3E6BA 2A3SA 1OYWA 1S6LA 5L3GA 2GXBA 2PMHA 2G7HA 4KFCA 3S2WA 4LK1F 3ECHA 1XGNA 5CLSA 2EA2A 2XVCA 1MD0A 2P7VB 2IPQX 4O5VA 3DPTA 2JZYA 4IRGA 2O61A 5JR3A 4HZFA 2E1CA 3QOPA 2XAHA 1K78A 1RNLA 4MTEA 2Y0MA 6PAXA 4A0ZA 2FXAA 2RC4A 3I64A 5A2QK 2XROA 5HDNA 1U5TB 3V7RA 2FNPA 2DU9A 1BI3A 4Q5SF 1SFUA 2NS0A 1BI0A 2QBYA 1I5ZA 2CQKA 1I1GA 2COMA 1ZG5A 5EEHA 5L3CA 3LAJA 3IHUA 3KFWX 5LEJA 5BPIA 3NRVA 5E1ZB 4TV7A 5E1WA 3IWFA 2M45A 3M9AA 1V4RA 5ICGA 1TQMA 2LF8A 2M8EA 4ESBA 1OPCA 2V79A 3GFLA 3WTXC 1ZRCA 1FOKA 3FMRA 2EJRA 2ZBKA 2GIVA 5CJ9A 3VOEA 4ZYDA 3I5UA 2V1DA 4KIGA 3RKYA 1ON2A 1WRJA 4CZZA 4RB3C 2D1HA 2P4WA 3Q9SA 3I59A 1GXQA 4AIHA 3BJ6A 3BOQA 3CUQB 1USSA 2WC2A 1REPC 3WU1B 1E2XA 5ICCA 1P92A 5KK1A 2JPBA 2HTSA 4ENMA 4EQQA 3GVAA 5E8IA 1FYKA 5E17F 3WTYC 2FBIA 2XV4S 4Y15A 3KP3A 3FWEA 5D5VB 5F64A 4R8HA 3ZMUA 4G9YA 4ENKA 1KQ0A 3LAPA 1BN5A 2A61A 4IRIA 2RV8A 1K79A 3L7WA 1KA8A 4WX9A 2ZXJA 2KRFA 2CW0F 4HA8A 3C7JA 2MD5A 3CLOA 4IHSA 1JHHA 3IRQA 4EVIA 3RIRA 4BYYA 1P4XA 4CXFA 1LDJA 1PP7U 4MGRA 1D5VA 1YW8A 2Y48A 3H3ZA 2O8XA 4N0BA 3FX3A 4MNUA 3I4PA 3N4MA 4MHGA 3ZQ7A 1G6NA 4YFXF 4HAMA 2F2EA 3P9KA 5HDGA 1F4KA 1XSXA 2MH2A 4L9JA 1FT9A 3GZ5A 3ROUA 2DW4A 3QPHA 1R1VA 1QZYA 4G8XA 3C1DA 1ZREA 3BROA 3WTSC 3HSFA 4JBAA 1O3SA 4M6YA 1XDSA 2X0LA 4BXUA 1P4WA 3JAMZ 5LEKA 4KUMA 4U0VA 5E1XA 3H3UA 3M7GA 2BGCA 4L18B 3E97A 2G9WA 1P4AA 1MJAA 4U0YA 3ZPLA 1YS6A 1HSJA 5E20A 1Z7UA 5ILUA 4G94A 4Y17A 4M71A 1WSUA 2W57A 1MKMA 1ZN2A 2DI3A 3R4KA 3SHFA 3HHHA 1FC3A 1O3RA 1Z6TA 2FSWA 1ZG1A 1SMTA 3VFZA 3BZ6A 2XKOA 2YU3A 3AAFA 2VT3A 3GLXA 1FBQA 2EB7A 4B09A 3EQLF 4ON0A 3I59B 5LRSA 4HW0A 2ISZA 4IVNA 3G73A 1LNWA 4KIBA 1B59A 3I0TA 3WGIA 1Z6RA 4M9XA 1KGSA 4KICA 2HKXA 1BM9A 1XDUA 2LF7A 2A69F 3K1MA 3OV8A 3KLOA 3N97A 2P6SA 3RPQA 1I1SA 2PBIA 1TQPA 1R36A 4ZYHA 5D8LB 3SZTA 1JHFA 2CWEA 2A5YB 1FPQA 2D1VA 3NQOA 1XMKA 1ONVA 5IT3A 2P7CB 1YTYA 2NNNA 1F5TA 2Z9OA 4U7BA 2V1XA 1IXSB 4HX4A 5DD4A 1IN4A 1FNNA 1YW7A 2DK5A 2ADUA 1T6SA 2Z3YA 1KU7A 2JRTA 1SD7A 1SFXA 4YIFA 4PGHA 3BJAA 5D6EA 2NNYA 5BOXA 3ZN0A 2JT1A 4EM1A 3D5LA 1LDKB 4UVAA 4I2OA 3LA2A 1IAWA 3U1DA 3FZVA 1BC7C 1UHWA 3GW2A 2K7LA 3U9GA 4RB1A 3ABUA 4S04A 2EV5A 1MJBA 1RI7A 3DQVC 1JXSA 1LVAA 3P9IA 2V1UA 2RGVA 1XGSA 1IUYA 2DK8A 4XSZF 4EGYA 1QQIA 2XUBA 3GWZA 3RYPA 4QLCU 1H9GA 3BY6A 2PG4A 3D0SA 1O57A 3KEOA 1UB9A 1XN7A 5KVRA 3EYIA 3BWGA 4MEYF 3HOTA 2CSOA 1SD6A 2ZFWA 4UVBA 4MTDA 5HLIA 4HQMA 3K9TA 2VBXA 4LMYA 3WE2A 4P96A 1O3QA 2D45A 3BP8A 2KIUA 4LGWA 4I09A 1TW2A 2XKPA 3OOPA 1WI9A 2OD5A 1F1ZA 4UHTA 3EDPA 3SZPA 4RAZA 4WF2A 4EJOA 3PQKA 2DPDA 2XAGA 2E7WA 4M9SA 5HLHA 3MZHA 4M74A 3L09A 4L0ZB 1FSEA 5DDGA 2FF4A 3MAJA 3VB2A 5LRRA 1LEBA 1EH7A 1DP7P 3RDIA 1ZRFA 4LJZF 3GO5A 4LG0A 2FU4A 2X4HA 3E5UA 4BHBA 2IA0A 2QYOA 1S3JA 1AOYA 2M1BA 2IW5A 1XD7A 4M72A 3RI4A 1S8NA 4U0WA 1TNSA 1XCBA 3KCCA 3F8MA 3ABTA 2W24A 2BEOA 3TO7A 2YR2A 3DPLC 3ZMSA 1XMAA 4HOBA 4Q47A 1CF7A 1T0FA 2QM3A 3WU0A 2IJLA 1HKSA 3U2RA 3B02A 4BH9A 2EFWA 5HS9A 1OR7A 1ODDA 3QU6A 3WTVC 4AIKA 2AXLA 2PEXA 4A6EA 4KYWA 2L4MA 4DNCA 5A2QZ 1E17A 1KQ9A 4XBFA 1XSDA 5HLGA 4P9UA 2LSOA 2L4AA 4NHJA 4A5NA 4PZJA 2DBBA 4OU0A 2QUFA 5ERIA 2ZNYA 4RGXA 2VXZA 3ZP5A 5FFXA 3FXRA 3I58A 2HQRA 2DTRA 3FXUA 1ZLKA 1FY7A 1W5SA 4IXAA 4M73A 4XSXF 1PUEE 1D8KA 1ON1A 1OYYA 1UFMA 3JSOA 4GGGA 5CVJA 2E7XA 3F6OA 4EJWA 1I27A 5ILSA 2VE8A 4NB5A 4LK0F 1P6RA 1V3FA 4A2UA 5FGMA 2Z99A 1IXRC 1Z9CA 4HYEA 1AWCA 2HDCA 1DDNA 1FBSA 2ZKZA 4KDPA 2O3FA 1D8JA 4HX7A 4LB5A 3ZMVA 3IWZA 1B9MA 4KA4A 1MDMA 5BS6A 4N9IA 5CVRA 3KP7A 1H9TA 4YFNF 1HKTA 3E5QA 2QQAA 4WK8F 4RS8A 5LBQA 4HV5A 3RKXA 3WTWC 1ZYRF 4K2EA 3W6KB 1WQ2A 2BV6A 1TNTA 1FYLA 2R7DA 4L5IA 3QP6A 1IN8A 4D0PA 2UXNA 4OIRF 4RB2C 2VOOA 4GYIA 4I0BA 2VT2A 2STTA 3DP7A 3F21A 3BDDA 3O3KA 4KIFA 2VBYA 2L02A 5FLXZ 3HSEA 3HRTA 2QBYB 4KN4X 4XRFA 2RDPA 1TQIA 1CGPA 2BBYA 2HQNA 4BHPA 3R61A 2EFQA 1BIBA 1KQ8A 4P5OA 1FYMA 4Z2YA 2YSRA 3V7SA 3SQNA 2J5PA 3COAC 3TOAA 1DPRA 3F3XA 4LB6B 3TGNA 1YO5C 1KYWA 3T0YA 3VODA 3CO7C 4WWCA 3ERED 4EGZA 2XAFA 3EETA 3O6BB 4ASNA 2GA1A 3ZMTA 2C6YA 4QWQA 5AONA 2FA5A 2HWVA 2HYFA 4A0YA 1R5GA 1G3WA 1IW7F 1R1UA 1IXCA 1ZRDA 3WTZA 2YX4A 2CO5A 2K27A 5IT9Z 2XGXA 3P7NA 4FX0A 2BYVE 1C0WA 1HQCA 3T8TA 1U2WA 2MLGA 3CDHA 2CGPA 3DF8A 4FX4A 1U5TC 2H94A 3TQNA 2Z33A 1SD5A 5F6FA 5HOOA 3V8KA 2XIGA 3O2PE 5LHIA 1FX7A 1TLHB 4CICA 3TOBA 4EJTA 3NEUA 4G6DA 2OAZA 4HF0A 4U7DA 2K4JA 2R3SA 5TRDA 3C3WA 5LGTA 5K1YA 1Y0UA 4AD9A 3RYRA 3H92A 3DFGA 4ETSA 2HGCA 4HDVA 1K78B 2MH9A 2QQ9A 3L9FA 2VN2A 3WTTC 2VBWA 3FMQA 4MEXF 2LKPA 3KETA 1K7AA 2GXGA 2O0YA 4I7HA 1B6AA 4M9ZA 2PI0A 3F8BA 2AS5F 1W4MA 3TDZC 4R1HA 1KU2A 4U88A 1MJ9A 2GA2A 1LQ1A 4KMFA 1IN7A 2PMUA 1LDDA 1O3TA 3QP5A 3IKVA 4ZH4F 4ZYGA 4LLNA 3E6CC 2ZNZA 3TO9A 1DPUA 4HQEA 3RKWA 1NHAA 4HF1A 5TJJA 4N9HA 3WE3A 2KJBA 2NRAC 1TBXA 2H6CA 2DQRA 2OBPA 2XAQA 2JPCA 4RGSA 1T2KA 3CTAA 1ULYA 5ILVA 3HOSA 1FSHA 2Y75A 3BPXA 3VEPA 1H0MA 2RKHA 4I98B 4HLXA 2W85A 3DV8A 5BQTA 5BMZA 2F5CA 2UXXA 2F5FA 2A68F 1W7PA 4BHCA 2XAJA 1VTNC 2K4BA 4RAYA 2RVCA 3QRFF 3V4GA 3F23A 1HW5A 2HOEA 2IA1A 5JI6A 2G7UA 1O7FA 2QZ8A 4LLGF 4GO1A 3QPTA 3LSTA 3MWMA 3F8CA 3HRSA 2FE3A 1YQAA 3HSRA 1U3EM 1IZ1A 1PP8F 1ZARA 3K1PA 3GYHX 3DXJF 1ZHFA 2WWYA 1IF1A 1OYIA 3G3ZA 3R0AA 2XHKA 4CDGA 1DUXC 3QU3A 3J80Z 1HW1A 4OOIA 4JK1X 2PJPA 5DCFA 1B4AA 4PCQA 4I0AA 3IRRA 3FMSA 5HVQC 1XCVA 3MFKA 2VONA 5K5QA 1G3SA 1IN6A 1RZ4A 1J5YA 4B8XA 2K86A 2P5LC 3TDUC 1ZG3A 2FQ3A 2EFOA 5DEQA 1JE8A 4LLLA 2HFHA 1UHMA 3EYYA 1LJ9A 2HS5A 3EUHA 1KU3A 1XGOA 3CUQC 3K2ZA 3M8EA 4FHTA 5D4RA 4I02A 2HEOA 3WODF 2QQBA 2CG4A 4LD5A 1YIOA 1EH8A 5D5UB 1GHCA 2L3DA 3I53A 4HBLA 5BPDA 2O03A 2RQPA 4RB0A 2NAZA 3JAMK 1J7KA 2HR3A 4BQAA 4A5MA 4LFUA 3KP6A 1FLIA 1IRFA 2K02A 2VOPA 2BE5F 2ESHA 2ZJ2A 3P9CA 5J8FA 1R5HA 5H20A 3R0JA 1YLFA 4HV6A 1QNTA 3LWFA 1YYVA 4E70A 1KYZA 4OIOF 4BAYA 4ZZDA 2UWMA 2WTEA 5K5RA 1HW2A 5AIPA 2ACJA 1HKQA 3HUGA 4EMSA 2IA2A 1STZA 3M8FA 2PFBA 5DV5A 3JW4A 2EWNA 1W7PB 4L9VA 4JQFA 4KN7X 3WGHA 5LGNA 2IRFG 3HTSB 2VC1A 1CF7B 2B0LA 1W5TA 3RJPA 4HX8A 5HS7A 3CO6C 3TO6A 2KIMA 1TW3A 3HRMA 4A0XA 4BNCA 1O7LA 4WXCA 1J2XA 1GVJA 2E1NA 3B73A 4KMUX 1SFEA 4XLPF 3PQJA 1LEAA 5E8GA 4PDKA 3J7AO 1L0OC 1QZZA 1EV7A 2PQ8A 4F7ZA 3FHZA 2FBKA 1TTYA 3I71A 3R60A 2ZO4A 4OMYA 1QGPA 1L3LA 1R58A 1FP1D 5FLXK 2IP2A 3E5XA 3LQRA 2M30A 1OKRA 5IT9K 4G6QA 4GYGA 2V6CA 3MQ0A 3LA3A 2ETHA 3FM5A 2JTVA 1BOAA 2P5KA 3KZZA 5H6QA 4ZYEA 2YPRA 3SFZA 1YFHA 4UUVA 1JGSA 1FZPB 2VODA 3V8JA 2A07F 3KP5A 3M1EA 4S05A 4UXNA 1ZH5A 4EJVA 1P2FA 2LNBA 2HYGD 5EEGA 2V9VA 4O3MA 1J75A 4M6XA 2H27A 4PGGA 3GUDA 3IL2A 2YX7A 1B1BA 4WXDA 5L3BA 4XLNF 2FNAA 2IVMA 3HHGA 2EA4A 1SMYF 3BJOA 5CVUA 2H09A 2OZUA 2KKOA 5DCMB 4CYDA 3HRUA 5CYVA 5D5WB 3TKYA 2RN7A 1ZGJA 3ZMZA 3ZN1A 3F22A 1Q1HA 1T38A 3KE2A 1D3YA 5H6RA 3JTGA 2HTJA 2FRHA 4ENNA 1YW9A 2FBHA 3IC7A 4Q48A 3R6SA 4UNOA 3V7CA 2ZCWA 3BPVA 4YG2F 3GXOA 3F72A 5FFZA 1RIOH 1ZAOA 2JSCA 4IPAA 2DPUA 1USTA 5DUKA 3J80K 3GF2A 3K0LA 3KP4A 4OIQF 2XRNA 1MDMB 2F5DA 5L3EA 2EFNA 3F8FA 5ED4A 2CFXA 5J8CA 5J6XA 3J81K 3ZMDA 4AIJA 1A04A 1BI2A 2DQLA 4L9TA 4L0YB 5K5OA 5HDKA 4HDUA 2ZMEA 1MGTA 3Q5FA 1U6GA 3FM3A 2FMLA 4UV9A 5D8KB 2W84A 2Q0OA 2DFIA 1X3UA 4G7HF 4IF4A 2Q8KA 1FP2A 2OZ6A 3DKWA 2DLLA 3Q9VA 3F8NA 2L01A 2CYYA 2VE9A 4RGUA 5DYMA 1BJAA 2L54A 2EV0A 3IKTA 5LLQA 5LHGA 3J81Z 3CUOA 2ESNA 2MLKA 2HKOA 2ISYA 2STWA 1HBXG 2R7FA 5L3FA 1FWZA 4GXOA 1R22A 3E6DA 2GAUA 1Z05A 4Y13A 2WV0A 2XASA 1BIAA 3WG9A 3PFIA 1RUNA 2M5WA 4KNYA 1T39A 2W25A 3L00A 2QENA 1SD4A 3K69A 4Q4ZF 3F6VA 2PLYA 1OMIA 3RPUA 4G7ZF 4L9NA 4EM2A 4AWXB 4MQ9F 1FBUA 3JSPA 1J59A 1WWXA 4UVCA 3K1NA 2Z5UA 5ICFA 5FD6A 3W6JB 2RNJA 4MQVA 2GQQA 2GZWA 4CGZA 4IHTA 1W7PD 2ELHA 3QAHA 2A6HF 1IRGA 1HXDA 2HZTA 3GFMA 4GCVA 2J5OA 1U8RA 3C18A 1UCRA 4IJAA 2TDXA 1G3YA 2DAOA 2VC0A 3JTHA 2QVOA 3ELKA 3LQQA 1S29A 4EV0A 3ML6A 2EFPA 2MC3A 4CO8A 1PDNC 1GXPA 4IRHA 1K6OA 5HS8A 1EH6A 1ZGAA 3REOA 5D4SA 3MCZA 1QBJA 1G3TA 4NQWA 5CVIA 5LGUA 4WCGA 2M87A 1XSVA 2OQGA 3KEQA 1R1TA 5L3DA 4YFKF 2OQRA 3FF5A 2MA3A 4R79A 2F5EA 4EJUA 4OIPF 2O6GE 4L5JA 4A12A 5DUIA 1B9NA 1I6XA 2PN6A 2Q2EA 5ICEA 3KP2A 5JHUA 2MBFA 4OINF 3CUQA 2EK5A 4P55A
chains in the Genus database with same CATH superfamily
3GTPJ 2QCOA 1QO0D 3LFKA 3PFYA 3CCMI 1G4DA 4D5CA 4H0EA 5FD5A 2EBIA 3V8LA 2R92J 4DIQA 3T1BA 2CQQA 5F1RA 1HA8A 3CESA 3GFJA 2FEZA 3GEZA 4ZTJA 5LHHA 2D5VA 4UV8A 1H89C 2QLZA 1PUFA 3L2CA 3T5XA 2DMUA 3GX4X 1JJ6C 2JA7J 3DEUA 3HXLA 4ITVA 3WGGA 2ZMEB 3QOEA 3CJRB 2PMZN 5F08A 3JRAA 1A31A 5IYCJ 4CZCA 2Y0SN 5JFRA 5D5XB 1Z67A 4HLYA 2M4GA 1FMWA 5D6FA 4B47A 2P8TA 4UUTA 2DJNA 3E3VA 3SZGA 3ECOA 3S2DJ 1WI3A 2GWRA 2UZKA 3GZ6A 1G2HA 1S7OA 1UJ8A 2FOKA 3CJNA 4CCKA 1BR1A 5DM7F 3J7YJ 5AIQA 4ABZA 1ZLJA 3LA7A 1AA7A 2CU7A 4YIIA 1HSTA 3OYHA 3BC8A 1VNDA 4G12A 3I9V2 3KZYA 1O4XA 4DQ2A 1R7JA 2DO7A 1BBYA 3T8RA 4AVPA 4EEFG 4ESFA 4PSWA 4A93J 2LREA 2CQNA 1KU9A 3CCYA 2H8RA 4P9FA 1JI8A 1Z1DA 5FO5A 2LYCA 2MABA 2D2WA 3I54A 2QWWA 4ZZLA 1R00A 3HYIA 3VYRB 4RGRA 3FXQA 3H36A 3ISPA 3BT9A 4XN0A 3HOVJ 1IC8A 2VBZA 5GADJ 2HU9A 3EPZA 3VDXA 2XRLA 1WKMA 3QQAA 3AL0B 2A6EF 1F9NA 1LPQA 2KJCA 3OIPA 1J9IA 1HCRA 3CP8A 5JVTA 2HZDA 1VQ5I 2XF6A 2ZXHA 2Q2EB 2VPRA 3OOUA 4IOAF 1JUMA 3TP3A 3MZYA 3ULQB 1PYVA 3QYBA 4KT5C 1BC8C 2NYXA 2P5VA 2EIJH 4E7HA 3P5JA 5F0CA 1U5TA 3KLNA 3PNYA 4I01A 2XPVA 3VPRA 5FB2A 2P6TA 4UUSB 1R23A 4LG0B 1AKHB 3WTUC 2JRMA 1OCRH 3Q0UA 5DD8A 3E7LA 5J1UA 5HLTA 5E18F 2M8GX 3C2HA 1P7IA 1QPMA 1Y39A 3K10A 2EV6A 5CVVA 2LD5A 3U21A 1T98A 1YG2A 4A6DA 3BG9A 2E5ZA 4AVZA 1K6YA 2VB6A 2AHQA 3ABLH 1BI1A 3SXYA 1I3AA 2HXIA 1YS7A 2OA4A 4FT8A 4O6JA 3CCSI 4EM0B 2R93J 2RAEA 3HTUA 1TWAJ 5J3LA 2LDUA 1SAXA 4G7OF 3HIFA 4QPQA 4ESJA 1MZBA 3RZOJ 3HOYJ 4CHUA 4HF2A 2IS4A 1Z91A 3MEXA 3BQYA 1LB2A 1UAAA 1MH4A 5DCMA 3GFIA 2DT5A 1LUJB 4BQNA 2OU2A 3KPHA 5FKKA 2BHYA 3BR2A 3RTRA 1RUOA 2IT0A 1E3PA 5CPRB 5E3NA 1XB4A 3MKLA 3GBGA 1S7AA 4LIVA 1SFOJ 4NBQA 4BBSJ 2FMYA 1J0RA 4OMZA 1IN5A 1V55H 4E7IA 1MBJA 3E6MA 4RLQA 5GP9A 4ENJA 1XGMA 2ME6A 1JUSA 1U78A 3CD6I 4DJAA 3X2QH 5E3LA 3DPUA 2H6BA 4WXHA 2KIFA 3E6BA 2A3SA 4B48A 2BY0A 1OYWA 1S6LA 5L3GA 3JREA 1F43A 2GXBA 2BHZA 2PMHA 2JA6J 3ERMA 1FOXA 2NVTJ 1WJ5A 2G7HA 4KFCA 3S2WA 2ZJPF 4LK1F 3ECHA 1XGNA 5B1BH 5CLSA 3BTLA 1WJAA 2M7BA 4ZDLA 2EA2A 1MBKA 2XVCA 2JVGA 1RKTA 1MD0A 1X19A 5FRNA 2R7VA 2P7VB 2IPQX 2E71A 4O5VA 2BVMA 1TWCJ 4F92B 4UY8I 2I10A 3DPTA 1A36A 2JZYA 4HPQA 4IRGA 4M3GA 3ZQFA 2O61A 2K3PA 5JR3A 4HZFA 1BR2A 2E1CA 2M0MA 3QOPA 2XAHA 1XG1A 1K78A 1RNLA 3PUBA 4XR6A 4MTEA 2Y0MA 6PAXA 1TWGJ 4A0ZA 1R49A 2FXAA 2RC4A 3I64A 4W97A 5A2QK 2XROA 3AL0C 5HDNA 1U5TB 1MSEC 3V7RA 4EATA 2FNPA 1Y56A 2EPFA 2DU9A 2ZMEC 1BI3A 5J4YA 2ZXWH 2LK2A 4Q5SF 1LKXA 1SFUA 2NS0A 1BI0A 2QBYA 1I5ZA 2CQKA 2Y9YA 1I1GA 2COMA 3CCUI 1ZG5A 5EEHA 1Y1WJ 5F1JA 5L3CA 3LAJA 3IHUA 3KFWX 1WJBA 5LEJA 5BPIA 1TL8A 3NRVA 3DTKA 5E1ZB 4TV7A 5F0HA 5E1WA 3IWFA 1TC3C 2M45A 3M9AA 3K4NA 1V4RA 2VLAA 5ICGA 1TQMA 2LF8A 2M8EA 4XK4A 4ESBA 1OPCA 2V79A 3GFLA 3HKZA 3NARA 1R6RA 4D7NA 3WTXC 1ZRCA 1FOKA 3FMRA 2EJRA 2ZBKA 2GIVA 5CJ9A 3VOEA 4ZYDA 3CCJI 3I5UA 3DBLB 2V1DA 2VKDA 4KIGA 3RKYA 3BTIA 1ON2A 1WRJA 3WU2C 4G6TB 4CZZA 4RB3C 1K4TA 2D1HA 2F4IA 2P4WA 3Q9SA 3I59A 1GXQA 4AIHA 3BJ6A 3BOQA 4XRMA 3CUQB 1USSA 2WC2A 1REPC 3WU1B 1E2XA 2EZKA 1T08B 1P92A 2KPMA 5KK1A 5ICCA 3S3NA 2JPBA 2HTSA 2EZIA 4EQQA 4ENMA 2ZSHB 3GVAA 1X1AA 2W7NA 5E8IA 2XGEA 1FYKA 3LSIA 4F52A 2R7UA 5E17F 3WTYC 2FBIA 2XV4S 4Y15A 2DMPA 3FWEA 3KP3A 3PO3J 3H0DA 1QRYA 2M4KA 5D5VB 5F64A 1AKHA 1ACIA 4R8HA 3ZMUA 1WJDA 4G9YA 3W2WA 2R5YA 2R5YB 2W48A 4F91B 1KQ0A 2EINH 4ENKA 1HDPA 3LAPA 3EUKL 1V5GA 1S72I 1BN5A 2A61A 4IRIA 3QYFA 5GPCA 2LKXA 2RV8A 2M2EA 1K79A 3L7WA 1KA8A 4WX9A 2ZXJA 1OLTA 2KRFA 2DDAA 3OYIA 2CW0F 4HA8A 2R4GA 2HVQA 2COBA 3C7JA 2KLOA 2LC2A 2MD5A 2RREA 3CLOA 3Q3SA 3J7ZI 5J1YA 4IHSA 3K70D 3DU6A 3G1LA 1JHHA 3IRQA 4EVIA 3RIRA 5M5YJ 3L2RA 2K3FA 4LIUA 4BYYA 1P4XA 4CXFA 4C9YA 2MYSA 4J01A 2IS6A 1LDJA 2N8GA 2KISA 1PP7U 4JX6A 3L1PA 4MGRA 2IEKA 4AYBN 1N25A 5E3MA 2Y9ZA 1D5VA 2QA4I 1ZGWA 3O8GA 1YW8A 2Y48A 3S1NJ 3ZQHA 3JRFA 3H3ZA 2O8XA 4NQWB 4N0BA 2X51A 3FXJA 3K2AA 4DBQA 3FX3A 4MNUA 5EJCA 1VI0A 3I4PA 2MC4A 4HNUA 5F27A 3N4MA 4MHGA 3W3CA 3ZQ7A 2R7TA 4BQOA 1G6NA 1VQMI 4YFXF 4IEJA 3D5RC 1NG6A 4NC8A 1IRXA 3K7AJ 3VSLA 4HAMA 1IJWC 2F2EA 3S15J 3CLQA 3P9KA 5HDGA 4UB8C 3CCLI 1F4KA 1A6IA 4QPOA 1XSXA 4JOMA 1FTTA 4BL0B 2MH2A 4L9JA 3MKYB 1FT9A 1A35A 4FASD 3E0JB 2DOEA 3GZ5A 5FKOA 3ROUA 4FETA 1ENHA 2XF5A 4XKBA 2DW4A 1T95A 3V42A 3SDBA 3QPHA 3JRBA 1W5CC 4KITB 1R1VA 1MBGA 1QZYA 2R5ZA 1U9NA 1NTCA 4G8XA 3C1DA 1ZREA 1WPKA 3BROA 2YU9J 3WTSC 5GAHJ 1MMDA 5J1RA 3CCEI 1BW5A 3HSFA 4JBAA 3DLAA 3IH4A 1O3SA 2QF7A 4M6YA 1XDSA 2X0LA 4BXUA 3MVPA 2BOLA 1P4WA 1APLC 3JAMZ 1VQPI 2OTLI 5LEKA 4KUMA 5KHDA 4U0VA 2ECBA 4MFEA 1Z21A 5E1XA 3H3UA 2B9SA 3S8PA 3M7GA 2BGCA 4XONA 3E97A 2G9WA 4N4OB 5EYRA 4L18B 1P4AA 2IGKA 5DM6F 1MJAA 4U0YA 3G1OA 1QPIA 3ZPLA 1YS6A 1HSJA 4BQQA 4CSWA 4BEHB 5E20A 1Z7UA 5ILUA 5M5WJ 1SVOA 2X6WA 2M34A 4G94A 3OYAA 3GTGJ 1UG2A 1FTZA 4Y17A 4HEA2 3ASOH 2DA1A 3A1YA 2OCCH 4M71A 1WSUA 2W57A 1MKMA 1ZN2A 2DI3A 2OTJI 3R4KA 3A01A 3SHFA 3HHHA 4A3CJ 1JKPC 1FC3A 3H5AA 4Y7NJ 1Z6TA 1O3RA 3I4NJ 2FSWA 2K9LA 1ZG1A 3GZNB 1YJNI 1GUUA 5FRMA 1SMTA 3VFZA 3BZ6A 2XKOA 3HJEA 2ZJQF 2NXNB 2YU3A 5K7FA 3AAFA 1R4NB 2VT3A 3GLXA 2L9NA 4CYCA 1FBQA 2EB7A 2X6XA 4B09A 3EQLF 3PNTA 3I59B 4ON0A 5FKLA 5LRSA 1Q1VA 5IP7J 1FOYA 4HW0A 2ISZA 4IVNA 3G73A 1LNWA 4KIBA 1W0UA 1B59A 3I0TA 2BY1A 1S5LC 3WGIA 3I4MJ 3QWLA 1Z6RA 2K40A 5IY5H 1BL0A 4M9XA 1KGSA 2DT7B 4KICA 2HKXA 2E1OA 1BM9A 1XDUA 2DA6A 2LF7A 2A69F 3K1MA 2EIMH 3KLOA 3OV8A 2MFZA 4FQGA 3N97A 2P6SA 3H5NA 3RPQA 1I1SA 2PBIA 3CP2A 1TQPA 1R36A 3F9KA 4ZYHA 5D8LB 1I3QJ 1TT5B 3SZTA 3JR9A 1JHFA 3I56I 3OIQA 2CWEA 1JTXA 2A5YB 2L2OA 1FPQA 3IAM2 2D1VA 1VFCA 3NQOA 3H35A 2NVXJ 1XMKA 1ONVA 3NWTA 4RAFA 5IT3A 5HNHA 5EEAA 3S1MJ 2P7CB 1YTYA 2NNNA 1F5TA 2FX0A 1B72A 2Z9OA 4U7BA 2V1XA 1IXSB 3K4LA 4HX4A 5DD4A 4GRIA 1IN4A 1FNNA 1YW7A 2NVYJ 2DK5A 1X3ZB 1QHGA 2ADUA 5J47A 4C2TA 1T6SA 2Z3YA 1KU7A 2L7FP 2JRTA 1SD7A 1DU0A 1SFXA 4YIFA 3L2UA 4PGHA 1MSFC 1EKEA 3BJAA 5D6EA 5EG0A 2W1OA 3CJQB 2NNYA 5BOXA 3ZN0A 2JT1A 4EM1A 3G4SI 3D5LA 1LDKB 4UVAA 4I2OA 3S16J 3LA2A 1IAWA 1Y6IA 3U1DA 3PSFA 3BG5A 2LG4A 3FZVA 1DU6A 1BC7C 1UHWA 3GW2A 2CW7A 2PJRA 2K7LA 3U9GA 4RB1A 3ABUA 2KHMA 4S04A 2EV5A 5EF6A 1MJBA 3NWSA 1YIJI 2EILH 4A3IJ 1LVKA 1MMNA 1RI7A 3DQVC 1JXSA 1LVAA 3P9IA 2Y30A 4AYBA 5FKMA 1TWFJ 3OYFA 2RGVA 2V1UA 1XGSA 1Z3YA 5IP9J 4ZYAA 4A3KJ 3DKXA 1VQ7I 1IUYA 2DK8A 4XSZF 3W6VA 2X85A 4EGYA 1QQIA 2XUBA 3GWZA 4CA0A 3RYPA 4Y52J 1XPXA 3AG1H 4V19K 4QLCU 5LD2C 1H9GA 3C2GA 4P1WA 3BY6A 2PG4A 2HPIA 3JRCA 4F3QA 4M6VA 3D0SA 4HSTA 2ICWG 1O57A 3CCRI 1G8XA 3KEOA 1UB9A 3E1SA 1XN7A 4BJ5C 2H8WA 5KVRA 3EYIA 2NOJB 3BWGA 4MEYF 3HOTA 2CSOA 5EGOB 1SD6A 5HNFA 2ZFWA 1ZKGA 1SVLA 2HI3A 4A3EJ 2DMQA 2DDBA 2V4JC 4UVBA 1DGRM 4MTDA 1J09A 5HLIA 4HQMA 3K9TA 2VBXA 4LMYA 3WE2A 4P96A 1O3QA 2D45A 3BP8A 3TL4X 1NG7A 2KIUA 4LGWA 4E7LA 4DZPA 3OYMA 1B72B 1S9HA 3DKYA 4I09A 1TW2A 2XKPA 2DYRH 4IO9F 3OOPA 2IXSA 1V5FA 1WI9A 2BVLA 1HC8A 2OD5A 1D1CA 3O8HA 2HVSA 2L7KA 1F1ZA 2R7RA 2VL8A 2B63J 4UHTA 4W1UA 2E5NA 4A3JJ 1TT0A 1JTYA 2OF7A 2K9QA 4HRIA 3EDPA 4BY7J 3SZPA 4RAZA 4WF2A 3GTOJ 1Z7LA 4D1QA 4EJOA 3PQKA 3FHNA 2DPDA 4NUBA 2CV0A 2VJIA 3GTJJ 2XAGA 2E7WA 4M3DA 4M9SA 1A6QA 9ANTA 3VSKA 2I8DA 5HLHA 3H0GJ 3MZHA 4M74A 3W2VA 3EUHC 3L09A 3LSHA 2F4MB 3OL3A 4L0ZB 4RMNA 3SYTA 1QA6A 1FSEA 4HNTA 1P9QC 2ID6A 5DDGA 2FF4A 3MAJA 3VB2A 4CYCB 5LRRA 1LEBA 1EH7A 3CDLA 1DP7P 3RDIA 2LOOA 3KIOA 2DA2A 4D9JA 1ZRFA 1OCOH 4LJZF 3GO5A 4LG0A 2FU4A 2X4HA 3E5UA 4BHBA 2IA0A 2QYOA 1MBFA 2B7EA 3OYLA 4A3FJ 3DBHB 3OS2A 3RQ4A 1S3JA 1QZEA 4BEHA 2W4SA 3JRGA 1EA3A 4U87A 1AOYA 1AHDP 2M1BA 2IW5A 1XD7A 3UNGC 4M72A 1X2MA 3RI4A 3W2AA 2R5ZB 1S8NA 2WA0A 2X6OA 4OWRB 2JUGA 2XAUA 1D0ZA 3PIPF 4U0WA 2QGUA 1TNSA 1XCBA 3KCCA 4E7ZA 3F8MA 3ABTA 3A03A 2W24A 4IKFA 2BEOA 3TO7A 3OYKA 4KT6A 3CCQI 1ZR2A 3JCUC 2YS9A 2YR2A 1B8IB 3HOZJ 3DPLC 1CQTA 3K6GA 3BCBA 1WJEA 1I39A 3MN2A 1UHSA 3ZMSA 1XMAA 3GTMJ 4HOBA 4Q47A 4ANJA 5C3EJ 1CF7A 3IAS2 1T0FA 2OCEA 3FXMA 4DGWB 2QM3A 3WU0A 5IYDJ 2IJLA 1HKSA 3U2RA 5FJ8J 3B02A 3DTEA 4PFPA 4BH9A 2EFWA 5HS9A 1OR7A 4BE0A 1ODDA 3QU6A 3ZOBA 2OV7A 1K4SA 3KYDB 3WTVC 3FXKA 4AIKA 2AXLA 3ZQGA 2PEXA 4A6EA 3UKGA 3QYEA 3CC2I 1MMAA 1YX3A 2L4MA 4KYWA 4DNCA 5A2QZ 2LH9A 1KQ9A 1E17A 4XBFA 1RR7A 2CH0A 3FK6A 1BJZA 1XSDA 2P81A 5HLGA 4P9UA 4M3BA 1YJWI 2JVHA 5DTDA 2R7XA 3CZ6A 2XGCA 2LSOA 4RA2A 2L4AA 4XORA 2QSGX 2XDVA 3G6EI 4NHJA 5CKTA 4A5NA 4PZJA 1Z3XA 1FMVA 2DBBA 1YITI 4OU0A 2QUFA 2I5UA 5ERIA 2NVUB 2ZNYA 4RGXA 5J40A 4PJMA 5IYBJ 1GT0C 3GTLJ 2VXZA 3ZP5A 5FFXA 3FDYA 3LSPA 3PM1A 3FXRA 4LITA 2JSPA 3I58A 2HQRA 2KP6A 2DTRA 3FXUA 1ZLKA 3ZQLA 2DA4A 1FY7A 1K61A 1W5SA 1M1EB 3SJMA 1X1CA 2BZTA 2E36A 2JMWA 4IXAA 2CV2A 5EZGA 1X1DA 1TP4A 4M73A 2JUCA 1ZELA 4XSXF 1PUEE 1D8KA 3FBNB 1JT6A 1QVUA 2E34A 1ON1A 3I55I 1OYYA 1SFKA 1TZLA 1UFMA 2Y0SA 5E3OA 3LOCA 4V2FA 3JSOA 4PJ0C 4GGGA 5CVJA 2CUFA 2E7XA 3F6OA 1RR8C 3DCFA 4HSRA 3ABMH 4EJWA 1I27A 5ILSA 2VKHA 2VE8A 3B6CA 4NB5A 4LK0F 2A6TA 5FROA 3ZQIA 2BW3B 5GAEJ 1P6RA 1V3FA 2R0QC 4A2UA 5FGMA 2Z99A 1DQUA 1IXRC 1MBHA 1Z9CA 2DA7A 3HGYA 4HYEA 4II3A 1MNDA 1AWCA 2HDCA 2NVQJ 3K4CA 1DDNA 1LFUP 1FBSA 2ZKZA 3HBLA 4DW6A 2L0KA 4KDPA 2O3FA 3M1CA 4B3XA 4PK4A 1D8JA 3GTQJ 4HX7A 2X1DA 4LB5A 2WV1A 3BCAA 3ZMVA 3IWZA 1GV2A 1B9MA 1LE8B 4KA4A 1D0XA 1MDMA 2WBMA 5BS6A 3LMMA 4N9IA 2KFDA 3OYBA 5CVRA 3KP7A 2R7WA 4YFNF 1H9TA 1HKTA 3E5QA 2ID3A 2QQAA 4ZC3A 3IUOA 4WK8F 2MG4A 3TEDA 4RS8A 1SVMA 3S3OA 5LBQA 4HV5A 3RKXA 4XKCA 2E1MC 3WTWC 3VWBA 2GOXB 4DYQA 1ZYRF 4K2EA 3BTJA 4XRSG 4YELA 3W6KB 5JHFA 4HNVA 1WQ2A 2BV6A 3JRDA 2R7ZJ 1BA5A 2NS8A 1Y0NA 3HOWJ 1ORKA 1JKOC 1I6HJ 1TNTA 1MH3A 1BR4A 3NAUA 2R7DA 3DEWA 3OWTA 1FYLA 4L5IA 3QP6A 1IN8A 4D0PA 1N78A 2KL4A 5JVGF 2UXNA 1H88C 3CF5F 4OIRF 4RB2C 2XF7A 5K7HA 2VOOA 4GYIA 2L7ZA 3OYEA 1UMQA 2EZHA 4I0BA 2VT2A 2STTA 2RNGA 3QPLA 3DP7A 3F21A 4AIDA 3M3YJ 1SANA 3BDDA 3O3KA 2GIZA 4KIFA 3A4CA 3SEZA 2VBYA 2L02A 4MIMA 5FLXZ 3RSNA 2ZC2A 1ETQA 3HSEA 3HRTA 2QBYB 2BXZA 5EDNA 2HYJA 5K7ZA 1MNMC 4DYCA 2OJED 3GLLA 4KN4X 2RDPA 4XRFA 5F0FA 1TQIA 1UZCA 1CGPA 2BBYA 2HQNA 3R61A 4BHPA 5M5XJ 2EFQA 2HXOA 1JJ8C 3IP4B 1BIBA 3ONQA 4NC7A 3S1RJ 2HVRA 3VYTB 1KQ8A 4P5OA 1FYMA 4XLCA 2ELKA 4Z2YA 4X1EA 1R5ID 1WVRA 2YSRA 3KYCB 3CDIA 3S2HJ 5M3MJ 1VF9A 3MKWB 3V7SA 3SQNA 2J5PA 1MW7A 2X48A 3COAC 4PJJA 3TOAA 3PSIA 1DPRA 3F3XA 4LB6B 2LBFA 3TGNA 1YO5C 3BZKA 2EQRA 2LY2A 1KYWA 3T0YA 3DTIA 3VODA 3CO7C 4WWCA 3ERED 1WJCA 1F36A 1WH5A 2KZVA 4EGZA 1LFPA 2XAFA 3EETA 3O6BB 2LLKA 1LE8A 4ASNA 2GA1A 4FCYA 1HF0A 3ZMTA 2C6YA 1DGWY 4QWQA 5AONA 2FA5A 2ME0A 2HOAA 4Y33A 4B3AA 2HWVA 5E79C 2HYFA 4A0YA 4RBOA 3G71I 4UB6C 4UUSA 2JA5J 1HDDC 1R5GA 1G3WA 1IW7F 2HQ5A 4Y4RA 1R1UA 3FIWA 1WH7A 2LY1A 3PO2J 5KAFC 1IXCA 3CMEI 5GPAA 4XQFA 1IV6A 1XC5A 3FISA 1ZRDA 2DXIA 3WTZA 2YX4A 1OCTC 4FE4A 5DS9A 3A02A 2CO5A 2K27A 1VQLI 5IT9Z 2TCTA 2XGXA 3P7NA 3H1CA 4FX0A 3HG9A 2BYVE 4RM3A 1C0WA 2QQ8A 1HQCA 3T8TA 1U2WA 2MLGA 3CDHA 2DJIA 2CGPA 4D7MA 3DF8A 2VQCA 4RAGA 2WAQA 2EH3A 2CUJA 4FX4A 1U5TC 2FJ1A 2H94A 3TQNA 2Z33A 2CQXA 1SD5A 3QPSA 1YOVB 5F6FA 4ZJZA 3H9QA 4BKXA 5HOOA 3V8KA 4A3LJ 5B66C 2XIGA 3O2PE 5LHIA 1FX7A 1VQOI 2EZLA 5C4XJ 1TLHB 1YE9A 5KAIC 4CICA 2DTZA 1ETYA 3TOBA 4EJTA 3HPGA 3NEUA 4G6DA 4I76A 2OAZA 3JRIA 2K9NA 4HF0A 4U7DA 2K4JA 2R3SA 5TRDA 3C3WA 2XGDA 2IBDA 2ZJRF 5LGTA 5K1YA 1Y0UA 4AD9A 3RYRA 3H92A 3DFGA 3K4KA 4ETSA 1SEUA 2HGCA 4BY1J 3B6AA 4XLEA 1FIAA 4HDVA 1K78B 2ZFUA 2MH9A 2QQ9A 2MGQA 3LSKA 2VASA 3N05A 3L9FA 2VN2A 3DU5A 1N77A 3WTTC 2VBWA 4JX5A 1RC9A 3DEEA 2FQ4A 1SAUA 1ETVA 3FMQA 4MEXF 2LKPA 3KETA 5CQGA 2O5RA 2WB1A 2ECCA 2L9SA 1K7AA 1ETKA 1FOWA 2BY3A 3HOUJ 4BDYA 2GXGA 2LP0A 1RRJA 2O0YA 4I7HA 2HDWA 2E2IJ 4GDFA 1B6AA 4M9ZA 2PI0A 5BNGA 2IS2A 1D5YA 3F8BA 2AS5F 3HM5A 1W4MA 3TDZC 4R1HA 3ABKH 1D1AA 1VQ6I 1QU3A 1KU2A 4U88A 1MJ9A 4AUXA 2GA2A 2E1MB 1LQ1A 2PMZA 4KMFA 1PUFB 2VKVA 1IN7A 3WG7H 2QEXI 2LVSA 2PMUA 1LDDA 1IO2A 1O3TA 3KEYA 2XB5A 2Y69H 5FLMJ 2M9HA 1DP3A 4BACA 3QP5A 3IKVA 1EF4A 3D1NI 4ZH4F 4ZYGA 4N4NB 3RZDJ 3S3MA 4LLNA 1WZ2A 4MFDA 3E6CC 2ZNZA 3TO9A 1DPUA 4HQEA 3RKWA 1E3HA 3CC7I 1NHAA 4S0HB 2Z2SB 3TW6A 3D5SC 4HF1A 4C3JJ 1R71A 2LR8A 5TJJA 4N9HA 2H1LA 2AQEA 2VI6A 3WE3A 1OFCX 1U0JA 2KJBA 2NRAC 2CJJA 1VQ8I 1TBXA 2H6CA 2DQRA 1HOMA 2OBPA 2XAQA 2JPCA 4RGSA 3PIOF 5C4JJ 2E2JJ 4RLFA 3CTAA 1T2KA 1RESA 1ULYA 3RPUD 5ILVA 3ASNH 3HOSA 2O8KA 1FSHA 4DOZA 1A5JA 5IOYA 2Y75A 1ETOA 3BPXA 3VEPA 4BBRJ 3BZCA 1H0MA 2RKHA 4I98B 4HLXA 3OR2C 1ZQ3P 3TBIA 2W85A 3DV8A 5BQTA 5BMZA 2WY7Q 2F5CA 2UXXA 4BJTA 2F5FA 2A68F 5TISC 1NK2P 1UELB 2L5QA 4CUGA 1W7PA 3G2BA 1T56A 2LY9A 4XLAA 3F0CA 2HDDA 2ZXIA 3C2BA 4QTRA 2CQ7A 4BHCA 2XAJA 1VTNC 3ZQQA 2M7AA 2K4BA 3BR5A 5GAGJ 4RAYA 2QKLB 2RVCA 3QRFF 3V4GA 3F23A 1HW5A 2HOEA 3K70C 2H1KA 4IHWA 1OCPA 1PJRA 2JN6A 2IA1A 2V26A 2E35A 2DN0A 5JI6A 1R9TJ 2G7UA 5EZHA 4BUPA 3BR6A 1XX5A 3VYSB 1O7FA 2QZ8A 4LLGF 2AQFA 3OIOA 3QPTA 3LSTA 3MWMA 4GO1A 1PVEA 4I99C 4F93B 2G0EA 1D0YA 4C30A 3F8CA 3HRSA 2FE3A 3L2VA 3ZGKA 3LSGA 3HEFA 1XS9A 1YQAA 3LNQA 3HSRA 1U3EM 1IZ1A 3TMOA 1PP8F 1ZARA 2IAIA 3K1PA 3GYHX 1ZK8A 2VQHA 1RKWA 3DXJF 1U9OA 1POGA 1ZHFA 2WWYA 5KNLA 3HUGB 3K4JA 1Y8RB 1IF1A 1OYIA 3G3ZA 3R0AA 2XHKA 4JX4A 4II2A 4CDGA 2KQRA 3QU3A 3J80Z 1HW1A 1DUXC 1JKQC 1IDYA 1W1WE 4OOIA 4JK1X 2KZGA 1VZ0A 1NK3P 2PJPA 3OYJA 5DCFA 1YRNB 2LTPA 1B4AA 4PCQA 5EGOA 4I0AA 3HC7A 3IRRA 1Y8QB 2XSDC 4AU7A 3IH2A 1IRZA 4M3EA 4BDZA 3FMSA 1XMXA 1KZHA 2V9PA 1ETXA 5HVQC 1XCVA 3MFKA 3AG3H 2VONA 2CW8A 5K5QA 1G3SA 1IN6A 2GOMA 2JQ7A 1RZ4A 3CMMA 2MSYA 3SEQA 1J5YA 3OYCA 2NOGA 3I3LA 4BXXJ 4PSXA 4B8XA 2K86A 2P5LC 3TDUC 1ZG3A 2BW3A 2FQ3A 2EFOA 5DEQA 4CCJA 1JE8A 4LLLA 1XTAA 4M3FA 4CCOA 1VQ9I 1VQNI 2DOFA 2HFHA 1UHMA 3EYYA 1OCZH 1LJ9A 2HS5A 3EUHA 2KDZA 2BXYA 1KU3A 2LFBA 1XGOA 4V2GA 1OCCH 3CUQC 3AG2H 3K2ZA 3M8EA 4FHTA 4E7SA 5D4RA 1X4OA 4I02A 3WODF 4J00A 2HEOA 2QQBA 2CG4A 4LD5A 3ZQCA 1S7EA 1YIOA 1EH8A 3OYDA 3ZCOA 2IGNA 5IP6A 5D5UB 3S14J 1GHCA 1UG0A 2X6YA 2L3DA 3I53A 4MO7A 3OYGA 4HBLA 5BPDA 2O03A 2QSHX 2JA8J 2Q1ZB 2RQPA 4RB0A 4XM3A 2NAZA 3JAMK 1J7KA 2HR3A 1YHQI 4BQAA 4A5MA 4LFUA 3KP6A 3IH3A 1FLIA 4C2UA 2X9DA 1IRFA 2K02A 2VOPA 2BE5F 3RCOA 3JRHA 2ESHA 2ZJ2A 3SFIA 1I50J 4XNFA 4QIWN 4YIRX 5FKNA 3P9CA 5J8FA 1R5HA 5H20A 2E2HJ 1HLVA 1B8IA 3R0JA 4XKWA 1YLFA 1ZTRA 4E7KA 3WHBA 4HV6A 4E7JA 5HODA 1IG7A 1QNTA 1YRNA 1V54H 3LWFA 1YYVA 4E70A 3A2KA 5C44J 1WJFA 4XLHA 1KYZA 3MZ8A 1T33A 4OIOF 4BAYA 4ZZDA 2UWMA 3G1MA 2WTEA 4IX7A 2DA5A 5K5RA 1HW2A 5AIPA 2ACJA 1HKQA 3H9JA 3HUGA 2VJ5A 3L2QA 4EMSA 2IA2A 3L2WA 1P7JA 3LSMA 2F4OB 2DMTA 2KRCA 4IHXA 2OC6A 4C2MJ 1STZA 4CCLA 3AG4H 3M8FA 2JA2A 2PFBA 5DV5A 3JW4A 4OAYA 3BR3A 2EWNA 2TRTA 1W7PB 4XN3A 1T8IA 4L9VA 1FIPA 1X1PA 4PJNA 4JQFA 4KN7X 3WGHA 5M3FJ 5LGNA 4HG2A 1CF7B 2VC1A 2IRFG 1W5TA 2B0LA 4B1RA 3OS0A 3RJPA 3HTSB 1GV5A 4HX8A 5HS7A 4X0GA 3CO6C 1ETWA 1YX5A 2XPUA 4XICA 4PUSA 1OQYA 4YRVA 3TO6A 4ZTFA 2KIMA 1TW3A 3HRMA 4X6AJ 1GVDA 3H9GA 4A0XA 4BNCA 1O7LA 5IOZA 4WXCA 1JGGA 2LMDA 3LSJA 1J2XA 1GVJA 4NNJA 3ESWB 2DOAA 2E1NA 2VJJA 3B73A 5F04A 2CUEA 4KMUX 1SFEA 4RM2A 2L7MP 2VJ4A 2K9MA 4XLPF 3PQJA 2YUSA 1LEAA 3K4BA 5E8GA 3LL7A 3MD2A 4PDKA 1KONA 3J7AO 1L0OC 1QZZA 1EV7A 2PQ8A 3ZRGA 3FKIJ 2XPWA 1QHHD 4F7ZA 2ELJA 2A5WA 4LOCA 3BLYA 3FHZA 3GTKJ 2WAEA 2FBKA 1TTYA 1MBEA 3BQZA 3HKZN 3I71A 3R60A 3DLLF 1IDZA 2P0WA 2ZO4A 2VUMJ 4OMYA 1Y1VJ 3KX2A 1QGPA 2KMUA 3HZJA 4XMYA 2Z16A 3K4MA 1L3LA 1R58A 1W36C 1FP1D 5FLXK 4XIDA 2IP2A 4L5EA 1VQ4I 3E5XA 3LQRA 4FTHA 2M30A 1OKRA 5IT9K 4G6QA 4AC0A 4GYGA 2V6CA 3MQ0A 1JT0A 2R7QA 4KJZA 2KT0A 3LA3A 2ETHA 3FM5A 4C3HJ 2UUZA 2FD5A 2DCEA 2JTVA 3U1KA 1BOAA 2P5KA 3KZZA 1ZR4A 2W00A 5H6QA 2VXDA 4ZYEA 2YPRA 3SFZA 4JYKA 1YFHA 3OSGA 2V7FA 2AO9A 4MLOA 1G59A 2NS7A 5H2FC 1YJ9I 2LKSA 4UUVA 4PJLA 1JGSA 1FZPB 2VODA 3DBRB 2UV1A 3V8JA 2A07F 2V6EA 4E6KG 4XOTA 1W36D 3VYUB 3KP5A 3S17J 2M3AA 3M1EA 2CUZA 4S05A 4UXNA 3Q0WA 3H3VK 1ZH5A 4CCNA 4EJVA 1SC7A 4IHVA 1P2FA 2LNBA 3PNVA 2HYGD 3MMYB 5EEGA 4IQJA 2V9VA 2DFFA 2Y2ZA 4C3IJ 4O3MA 4QSHA 2VQLA 5B1AH 2MW8A 1J75A 1GDTA 4M6XA 2L9VA 2H27A 4PGGA 3GUDA 2W82A 4NC6A 3IL2A 4F55A 2F6CA 2YX7A 5B5EC 1X3WB 1WCMJ 3ZXSA 1B1BA 4WXDA 5L3BA 4XLNF 4DBRA 3GMEA 2HNHA 1JKRC 2FNAA 2IVMA 2FOWA 3PJRA 3HHGA 2EA4A 1SMYF 2BY2A 2K5CA 3FXLA 3BJOA 2GLOA 2XB0X 5CVUA 2H09A 4BU2A 2OZUA 2KKOA 3IV5A 5DCMB 4CYDA 4A3MJ 1Z0XA 3HRUA 3M07A 5CYVA 5D5WB 3TKYA 2DFHA 2RN7A 1ZGJA 3ZMZA 3ZN1A 3F22A 3OSFA 1Q1HA 1T38A 3KE2A 1D3YA 5H6RA 3JTGA 2HTJA 2FRHA 1YW9A 2FBHA 3IC7A 4Q48A 4ENNA 2DMNA 3CC4I 4JP0A 3R6SA 1U8BA 4UNOA 1N75A 4FE7A 3V7CA 1BW6A 2ZCWA 3BPVA 4YG2F 2JJ7A 3GXOA 2GM4A 4PFOA 3F72A 5FFZA 1RIOH 1ZAOA 3BR0A 2OUMA 4Y3OA 3OR1C 2JSCA 4IPAA 2DPUA 1USTA 5DUKA 3J80K 1WFXA 4IQ4A 3GF2A 2WAQN 3K0LA 3KP4A 2A05A 2JK3A 3CCVI 5J4VA 2IS1A 1IV8A 3DWLE 4OIQF 2XRNA 1MDMB 4B4CA 1AU7A 2F5DA 1MMGA 2GXAA 2M0CA 4IL6C 5L3EA 3HB9A 2EFNA 2CV1A 4A69C 2CMPA 4A3DJ 1OR7C 3BTCA 3F8FA 3CMYA 2R7SA 5ED4A 5JLWA 2CFXA 3S93A 1V5EA 5J8CA 3LFUA 4Z6YA 5J6XA 3J81K 3ZMDA 1TWHJ 4AIJA 2HPMA 2X1CA 1A04A 4DYRA 2PX9A 5B3SH 1BI2A 2DQLA 4L9TA 4L0YB 3HGGA 5K5OA 5HDKA 1OISA 4HDUA 2ZMEA 2L9RA 1W0TA 1MGTA 3Q5FA 3BR1A 1U6GA 3FM3A 3HPHA 2VIXA 4ZDOA 2FMLA 4UV9A 2XSJC 5D8KB 2W84A 2Q0OA 2DFIA 2Z1DA 1LFBA 1X3UA 4G7HF 2QKMB 4XOPA 2CRGA 4IF4A 3BG7A 1FP2A 2OZ6A 2Q8KA 3MKZA 3DKWA 4FISA 4NDLA 2DLLA 3FK7A 2DA3A 3Q9VA 1T0FC 3F8NA 2L01A 3PUFA 5TGTA 2CYYA 3CMAI 3LSRA 4BE1A 2VE9A 4RGUA 3Q0VA 5DYMA 4BE2A 1BJAA 2L54A 2E19A 2EV0A 1D1BA 4XLFA 3FXOA 2VKEA 2WB1N 3BG3A 2XC7A 5LLQA 3IKTA 5LHGA 3J81Z 3CUOA 2ESNA 2MLKA 2HKOA 2ISYA 1NH3A 2QSFX 4BXFA 1HBXG 1OJLA 2KIQA 2STWA 3HDDA 2R7FA 4RDUA 5GTIC 5L3FA 3A01B 5IPAA 4A3GJ 1FWZA 2X1EA 3OY9A 1WHUA 1MMSA 4B43A 4GXOA 3UR3C 1R22A 3BG6A 3CJTB 3RQIA 3E6DA 2GAUA 3RKQA 1Z05A 2VQGA 4Y13A 2WV0A 5EG0B 5GTHC 2XASA 4XKVA 1BIAA 1WGXA 2MD0A 3QODA 4CH7A 3WG9A 3PFIA 3OYNA 1RUNA 2KRHA 1K83J 1X2NA 2M5WA 1T39A 4KNYA 2W25A 4B44A 4CCMA 3AFHA 3L00A 1ERDA 4DZJA 3HOXJ 5JLXA 2QENA 3A0BC 3KZIC 1SD4A 3K69A 3M8JA 4Q4ZF 1R4MB 3F6VA 4BGDA 2PLYA 1OMIA 2K9SA 3RPUA 4G7ZF 2CFOA 2LBFB 4AM3A 4L9NA 4EM2A 4AWXB 4MQ9F 3H5RA 2IGMA 1FBUA 3JSPA 1Z77A 1J59A 3SDGA 4XRSA 4A3BJ 1WWXA 1IGNA 2FUG2 4OAZA 2K85A 4UVCA 2DYSH 3K1NA 2Z5UA 5ICFA 5FD6A 3W6JB 2RNJA 4MQVA 4BS9A 4KISA 2GQQA 3OS1A 3WHCA 2GZWA 2HOSA 4CGZA 5KCMA 1FEXA 4IHTA 1W7PD 2ELHA 3QAHA 2A6HF 2O7OA 4H4KC 1GLNA 1IRGA 4IHYA 1HXDA 2HZTA 5FLVA 4BJ6C 3GFMA 3PL8A 4GCVA 2J5OA 3OMYA 2HQAA 1U8RA 3C18A 4IZZA 1X1BA 1RETA 2HOTA 5LFAA 2WADA 4ZDPA 1UCRA 2E60A 2RQQA 4IJAA 2TDXA 1G3YA 2DAOA 2VC0A 1BOBA 3JTHA 2QVOA 3CQZJ 3ELKA 3LQQA 3S1QJ 4XL9A 1S29A 3TW7A 4EV0A 1ITYA 3ML6A 2EFPA 2LRDA 3FBIB 2VPLA 2R7OA 3FKJA 1YI2I 1E0EA 2OPTA 2IGOA 2MC3A 4CO8A 1X4PA 1PDNC 3EUAA 3KYLA 3AKZA 1RPWA 1GXPA 4IRHA 1K6OA 5HS8A 1EH6A 2Y31A 4D5FA 1X58A 1ZGAA 4YEJA 1E3OC 3REOA 2WY8Q 3GCMA 3ZR8X 5D4SA 3HL2A 3MCZA 2AXTC 1QBJA 1G3TA 4E4HA 4NQWA 1MNEA 2V1NA 1FJLA 2WAFA 2EIKH 5CVIA 5LGUA 4WCGA 2M87A 1VQKI 2PJRB 3J7AY 2GBYA 1XSVA 2OQGA 3KEQA 3TP0A 2KDOA 2F48A 3CF2A 4GFBA 1R1TA 5L3DA 4YFKF 3A0HC 2DODA 2OQRA 4IOCF 3FF5A 2MA3A 3S32A 4LG3A 4R79A 2CS3A 2ZSIB 2F5EA 4EJUA 1MIJA 4OIPF 2O6GE 4L5JA 1QVTA 4A12A 1B9NA 1I6XA 2PN6A 5DUIA 3M4OJ 2Q2EA 5ICEA 4I6ZA 1H8AC 3KP2A 2O9LA 5JHUA 2JWTA 1EJ9A 2DT6A 2MBFA 1IUFA 2DFEA 4OINF 5CQEA 3CUQA 2F5VA 1JUPA 2EK5A 4P55A 4J19A 2V9KA 2ZB9A 3OL4A
chains in the Genus database with same CATH topology
1QO0D 3LFKA 1G4DA 4H0EA 5FD5A 3V8LA 5F1RA 3T1BA 3GFJA 2FEZA 3GEZA 5LHHA 4UV8A 2QLZA 3L2CA 3T5XA 3GX4X 3DEUA 3WGGA 2ZMEB 5JFRA 5D5XB 4HLYA 5D6FA 2P8TA 3E3VA 3ECOA 2GWRA 2UZKA 3GZ6A 1S7OA 2FOKA 3CJNA 5AIQA 1ZLJA 3LA7A 4YIIA 1HSTA 3KZYA 4DQ2A 1R7JA 2DO7A 1BBYA 4AVPA 3T8RA 4ESFA 1KU9A 4P9FA 1Z1DA 5FO5A 2D2WA 3I54A 2QWWA 4ZZLA 1R00A 3HYIA 4RGRA 3FXQA 3ISPA 2VBZA 1WKMA 2A6EF 1F9NA 2KJCA 1J9IA 5JVTA 3ULQB 3MZYA 4KT5C 1BC8C 2NYXA 2P5VA 1U5TA 3KLNA 4I01A 5FB2A 2P6TA 4LG0B 1R23A 3WTUC 5DD8A 5E18F 1QPMA 2EV6A 5CVVA 1T98A 1YG2A 4A6DA 3SXYA 1BI1A 1YS7A 2OA4A 4FT8A 4O6JA 4EM0B 3HTUA 2LDUA 1SAXA 4G7OF 3HIFA 4ESJA 1MZBA 4CHUA 4HF2A 1Z91A 3MEXA 1LB2A 5DCMA 3GFIA 2DT5A 2OU2A 3RTRA 2IT0A 1RUOA 1XB4A 1S7AA 2FMYA 1J0RA 4OMZA 1IN5A 3E6MA 4ENJA 1XGMA 1U78A 2H6BA 4WXHA 2KIFA 3E6BA 2A3SA 1OYWA 1S6LA 5L3GA 2GXBA 2PMHA 2G7HA 4KFCA 3S2WA 4LK1F 3ECHA 1XGNA 5CLSA 2EA2A 2XVCA 1MD0A 2P7VB 2IPQX 4O5VA 3DPTA 2JZYA 4IRGA 2O61A 5JR3A 4HZFA 2E1CA 3QOPA 2XAHA 1K78A 1RNLA 4MTEA 2Y0MA 6PAXA 4A0ZA 2FXAA 2RC4A 3I64A 5A2QK 2XROA 5HDNA 1U5TB 3V7RA 2FNPA 2DU9A 1BI3A 4Q5SF 1SFUA 2NS0A 1BI0A 2QBYA 1I5ZA 2CQKA 1I1GA 2COMA 1ZG5A 5EEHA 5L3CA 3LAJA 3IHUA 3KFWX 5LEJA 5BPIA 3NRVA 5E1ZB 4TV7A 5E1WA 3IWFA 2M45A 3M9AA 1V4RA 5ICGA 1TQMA 2LF8A 2M8EA 4ESBA 1OPCA 2V79A 3GFLA 3WTXC 1ZRCA 1FOKA 3FMRA 2EJRA 2ZBKA 2GIVA 5CJ9A 3VOEA 4ZYDA 3I5UA 2V1DA 4KIGA 3RKYA 1ON2A 1WRJA 4CZZA 4RB3C 2D1HA 2P4WA 3Q9SA 3I59A 1GXQA 4AIHA 3BJ6A 3BOQA 3CUQB 1USSA 2WC2A 1REPC 3WU1B 1E2XA 5ICCA 1P92A 5KK1A 2JPBA 2HTSA 4ENMA 4EQQA 3GVAA 5E8IA 1FYKA 5E17F 3WTYC 2FBIA 2XV4S 4Y15A 3KP3A 3FWEA 5D5VB 5F64A 4R8HA 3ZMUA 4G9YA 4ENKA 1KQ0A 3LAPA 1BN5A 2A61A 4IRIA 2RV8A 1K79A 3L7WA 1KA8A 4WX9A 2ZXJA 2KRFA 2CW0F 4HA8A 3C7JA 2MD5A 3CLOA 4IHSA 1JHHA 3IRQA 4EVIA 3RIRA 4BYYA 1P4XA 4CXFA 1LDJA 1PP7U 4MGRA 1D5VA 1YW8A 2Y48A 3H3ZA 2O8XA 4N0BA 3FX3A 4MNUA 3I4PA 3N4MA 4MHGA 3ZQ7A 1G6NA 4YFXF 4HAMA 2F2EA 3P9KA 5HDGA 1F4KA 1XSXA 2MH2A 4L9JA 1FT9A 3GZ5A 3ROUA 2DW4A 3QPHA 1R1VA 1QZYA 4G8XA 3C1DA 1ZREA 3BROA 3WTSC 3HSFA 4JBAA 1O3SA 4M6YA 1XDSA 2X0LA 4BXUA 1P4WA 3JAMZ 5LEKA 4KUMA 4U0VA 5E1XA 3H3UA 3M7GA 2BGCA 4L18B 3E97A 2G9WA 1P4AA 1MJAA 4U0YA 3ZPLA 1YS6A 1HSJA 5E20A 1Z7UA 5ILUA 4G94A 4Y17A 4M71A 1WSUA 2W57A 1MKMA 1ZN2A 2DI3A 3R4KA 3SHFA 3HHHA 1FC3A 1O3RA 1Z6TA 2FSWA 1ZG1A 1SMTA 3VFZA 3BZ6A 2XKOA 2YU3A 3AAFA 2VT3A 3GLXA 1FBQA 2EB7A 4B09A 3EQLF 4ON0A 3I59B 5LRSA 4HW0A 2ISZA 4IVNA 3G73A 1LNWA 4KIBA 1B59A 3I0TA 3WGIA 1Z6RA 4M9XA 1KGSA 4KICA 2HKXA 1BM9A 1XDUA 2LF7A 2A69F 3K1MA 3OV8A 3KLOA 3N97A 2P6SA 3RPQA 1I1SA 2PBIA 1TQPA 1R36A 4ZYHA 5D8LB 3SZTA 1JHFA 2CWEA 2A5YB 1FPQA 2D1VA 3NQOA 1XMKA 1ONVA 5IT3A 2P7CB 1YTYA 2NNNA 1F5TA 2Z9OA 4U7BA 2V1XA 1IXSB 4HX4A 5DD4A 1IN4A 1FNNA 1YW7A 2DK5A 2ADUA 1T6SA 2Z3YA 1KU7A 2JRTA 1SD7A 1SFXA 4YIFA 4PGHA 3BJAA 5D6EA 2NNYA 5BOXA 3ZN0A 2JT1A 4EM1A 3D5LA 1LDKB 4UVAA 4I2OA 3LA2A 1IAWA 3U1DA 3FZVA 1BC7C 1UHWA 3GW2A 2K7LA 3U9GA 4RB1A 3ABUA 4S04A 2EV5A 1MJBA 1RI7A 3DQVC 1JXSA 1LVAA 3P9IA 2V1UA 2RGVA 1XGSA 1IUYA 2DK8A 4XSZF 4EGYA 1QQIA 2XUBA 3GWZA 3RYPA 4QLCU 1H9GA 3BY6A 2PG4A 3D0SA 1O57A 3KEOA 1UB9A 1XN7A 5KVRA 3EYIA 3BWGA 4MEYF 3HOTA 2CSOA 1SD6A 2ZFWA 4UVBA 4MTDA 5HLIA 4HQMA 3K9TA 2VBXA 4LMYA 3WE2A 4P96A 1O3QA 2D45A 3BP8A 2KIUA 4LGWA 4I09A 1TW2A 2XKPA 3OOPA 1WI9A 2OD5A 1F1ZA 4UHTA 3EDPA 3SZPA 4RAZA 4WF2A 4EJOA 3PQKA 2DPDA 2XAGA 2E7WA 4M9SA 5HLHA 3MZHA 4M74A 3L09A 4L0ZB 1FSEA 5DDGA 2FF4A 3MAJA 3VB2A 5LRRA 1LEBA 1EH7A 1DP7P 3RDIA 1ZRFA 4LJZF 3GO5A 4LG0A 2FU4A 2X4HA 3E5UA 4BHBA 2IA0A 2QYOA 1S3JA 1AOYA 2M1BA 2IW5A 1XD7A 4M72A 3RI4A 1S8NA 4U0WA 1TNSA 1XCBA 3KCCA 3F8MA 3ABTA 2W24A 2BEOA 3TO7A 2YR2A 3DPLC 3ZMSA 1XMAA 4HOBA 4Q47A 1CF7A 1T0FA 2QM3A 3WU0A 2IJLA 1HKSA 3U2RA 3B02A 4BH9A 2EFWA 5HS9A 1OR7A 1ODDA 3QU6A 3WTVC 4AIKA 2AXLA 2PEXA 4A6EA 4KYWA 2L4MA 4DNCA 5A2QZ 1E17A 1KQ9A 4XBFA 1XSDA 5HLGA 4P9UA 2LSOA 2L4AA 4NHJA 4A5NA 4PZJA 2DBBA 4OU0A 2QUFA 5ERIA 2ZNYA 4RGXA 2VXZA 3ZP5A 5FFXA 3FXRA 3I58A 2HQRA 2DTRA 3FXUA 1ZLKA 1FY7A 1W5SA 4IXAA 4M73A 4XSXF 1PUEE 1D8KA 1ON1A 1OYYA 1UFMA 3JSOA 4GGGA 5CVJA 2E7XA 3F6OA 4EJWA 1I27A 5ILSA 2VE8A 4NB5A 4LK0F 1P6RA 1V3FA 4A2UA 5FGMA 2Z99A 1IXRC 1Z9CA 4HYEA 1AWCA 2HDCA 1DDNA 1FBSA 2ZKZA 4KDPA 2O3FA 1D8JA 4HX7A 4LB5A 3ZMVA 3IWZA 1B9MA 4KA4A 1MDMA 5BS6A 4N9IA 5CVRA 3KP7A 1H9TA 4YFNF 1HKTA 3E5QA 2QQAA 4WK8F 4RS8A 5LBQA 4HV5A 3RKXA 3WTWC 1ZYRF 4K2EA 3W6KB 1WQ2A 2BV6A 1TNTA 1FYLA 2R7DA 4L5IA 3QP6A 1IN8A 4D0PA 2UXNA 4OIRF 4RB2C 2VOOA 4GYIA 4I0BA 2VT2A 2STTA 3DP7A 3F21A 3BDDA 3O3KA 4KIFA 2VBYA 2L02A 5FLXZ 3HSEA 3HRTA 2QBYB 4KN4X 4XRFA 2RDPA 1TQIA 1CGPA 2BBYA 2HQNA 4BHPA 3R61A 2EFQA 1BIBA 1KQ8A 4P5OA 1FYMA 4Z2YA 2YSRA 3V7SA 3SQNA 2J5PA 3COAC 3TOAA 1DPRA 3F3XA 4LB6B 3TGNA 1YO5C 1KYWA 3T0YA 3VODA 3CO7C 4WWCA 3ERED 4EGZA 2XAFA 3EETA 3O6BB 4ASNA 2GA1A 3ZMTA 2C6YA 4QWQA 5AONA 2FA5A 2HWVA 2HYFA 4A0YA 1R5GA 1G3WA 1IW7F 1R1UA 1IXCA 1ZRDA 3WTZA 2YX4A 2CO5A 2K27A 5IT9Z 2XGXA 3P7NA 4FX0A 2BYVE 1C0WA 1HQCA 3T8TA 1U2WA 2MLGA 3CDHA 2CGPA 3DF8A 4FX4A 1U5TC 2H94A 3TQNA 2Z33A 1SD5A 5F6FA 5HOOA 3V8KA 2XIGA 3O2PE 5LHIA 1FX7A 1TLHB 4CICA 3TOBA 4EJTA 3NEUA 4G6DA 2OAZA 4HF0A 4U7DA 2K4JA 2R3SA 5TRDA 3C3WA 5LGTA 5K1YA 1Y0UA 4AD9A 3RYRA 3H92A 3DFGA 4ETSA 2HGCA 4HDVA 1K78B 2MH9A 2QQ9A 3L9FA 2VN2A 3WTTC 2VBWA 3FMQA 4MEXF 2LKPA 3KETA 1K7AA 2GXGA 2O0YA 4I7HA 1B6AA 4M9ZA 2PI0A 3F8BA 2AS5F 1W4MA 3TDZC 4R1HA 1KU2A 4U88A 1MJ9A 2GA2A 1LQ1A 4KMFA 1IN7A 2PMUA 1LDDA 1O3TA 3QP5A 3IKVA 4ZH4F 4ZYGA 4LLNA 3E6CC 2ZNZA 3TO9A 1DPUA 4HQEA 3RKWA 1NHAA 4HF1A 5TJJA 4N9HA 3WE3A 2KJBA 2NRAC 1TBXA 2H6CA 2DQRA 2OBPA 2XAQA 2JPCA 4RGSA 1T2KA 3CTAA 1ULYA 5ILVA 3HOSA 1FSHA 2Y75A 3BPXA 3VEPA 1H0MA 2RKHA 4I98B 4HLXA 2W85A 3DV8A 5BQTA 5BMZA 2F5CA 2UXXA 2F5FA 2A68F 1W7PA 4BHCA 2XAJA 1VTNC 2K4BA 4RAYA 2RVCA 3QRFF 3V4GA 3F23A 1HW5A 2HOEA 2IA1A 5JI6A 2G7UA 1O7FA 2QZ8A 4LLGF 4GO1A 3QPTA 3LSTA 3MWMA 3F8CA 3HRSA 2FE3A 1YQAA 3HSRA 1U3EM 1IZ1A 1PP8F 1ZARA 3K1PA 3GYHX 3DXJF 1ZHFA 2WWYA 1IF1A 1OYIA 3G3ZA 3R0AA 2XHKA 4CDGA 1DUXC 3QU3A 3J80Z 1HW1A 4OOIA 4JK1X 2PJPA 5DCFA 1B4AA 4PCQA 4I0AA 3IRRA 3FMSA 5HVQC 1XCVA 3MFKA 2VONA 5K5QA 1G3SA 1IN6A 1RZ4A 1J5YA 4B8XA 2K86A 2P5LC 3TDUC 1ZG3A 2FQ3A 2EFOA 5DEQA 1JE8A 4LLLA 2HFHA 1UHMA 3EYYA 1LJ9A 2HS5A 3EUHA 1KU3A 1XGOA 3CUQC 3K2ZA 3M8EA 4FHTA 5D4RA 4I02A 2HEOA 3WODF 2QQBA 2CG4A 4LD5A 1YIOA 1EH8A 5D5UB 1GHCA 2L3DA 3I53A 4HBLA 5BPDA 2O03A 2RQPA 4RB0A 2NAZA 3JAMK 1J7KA 2HR3A 4BQAA 4A5MA 4LFUA 3KP6A 1FLIA 1IRFA 2K02A 2VOPA 2BE5F 2ESHA 2ZJ2A 3P9CA 5J8FA 1R5HA 5H20A 3R0JA 1YLFA 4HV6A 1QNTA 3LWFA 1YYVA 4E70A 1KYZA 4OIOF 4BAYA 4ZZDA 2UWMA 2WTEA 5K5RA 1HW2A 5AIPA 2ACJA 1HKQA 3HUGA 4EMSA 2IA2A 1STZA 3M8FA 2PFBA 5DV5A 3JW4A 2EWNA 1W7PB 4L9VA 4JQFA 4KN7X 3WGHA 5LGNA 2IRFG 3HTSB 2VC1A 1CF7B 2B0LA 1W5TA 3RJPA 4HX8A 5HS7A 3CO6C 3TO6A 2KIMA 1TW3A 3HRMA 4A0XA 4BNCA 1O7LA 4WXCA 1J2XA 1GVJA 2E1NA 3B73A 4KMUX 1SFEA 4XLPF 3PQJA 1LEAA 5E8GA 4PDKA 3J7AO 1L0OC 1QZZA 1EV7A 2PQ8A 4F7ZA 3FHZA 2FBKA 1TTYA 3I71A 3R60A 2ZO4A 4OMYA 1QGPA 1L3LA 1R58A 1FP1D 5FLXK 2IP2A 3E5XA 3LQRA 2M30A 1OKRA 5IT9K 4G6QA 4GYGA 2V6CA 3MQ0A 3LA3A 2ETHA 3FM5A 2JTVA 1BOAA 2P5KA 3KZZA 5H6QA 4ZYEA 2YPRA 3SFZA 1YFHA 4UUVA 1JGSA 1FZPB 2VODA 3V8JA 2A07F 3KP5A 3M1EA 4S05A 4UXNA 1ZH5A 4EJVA 1P2FA 2LNBA 2HYGD 5EEGA 2V9VA 4O3MA 1J75A 4M6XA 2H27A 4PGGA 3GUDA 3IL2A 2YX7A 1B1BA 4WXDA 5L3BA 4XLNF 2FNAA 2IVMA 3HHGA 2EA4A 1SMYF 3BJOA 5CVUA 2H09A 2OZUA 2KKOA 5DCMB 4CYDA 3HRUA 5CYVA 5D5WB 3TKYA 2RN7A 1ZGJA 3ZMZA 3ZN1A 3F22A 1Q1HA 1T38A 3KE2A 1D3YA 5H6RA 3JTGA 2HTJA 2FRHA 4ENNA 1YW9A 2FBHA 3IC7A 4Q48A 3R6SA 4UNOA 3V7CA 2ZCWA 3BPVA 4YG2F 3GXOA 3F72A 5FFZA 1RIOH 1ZAOA 2JSCA 4IPAA 2DPUA 1USTA 5DUKA 3J80K 3GF2A 3K0LA 3KP4A 4OIQF 2XRNA 1MDMB 2F5DA 5L3EA 2EFNA 3F8FA 5ED4A 2CFXA 5J8CA 5J6XA 3J81K 3ZMDA 4AIJA 1A04A 1BI2A 2DQLA 4L9TA 4L0YB 5K5OA 5HDKA 4HDUA 2ZMEA 1MGTA 3Q5FA 1U6GA 3FM3A 2FMLA 4UV9A 5D8KB 2W84A 2Q0OA 2DFIA 1X3UA 4G7HF 4IF4A 2Q8KA 1FP2A 2OZ6A 3DKWA 2DLLA 3Q9VA 3F8NA 2L01A 2CYYA 2VE9A 4RGUA 5DYMA 1BJAA 2L54A 2EV0A 3IKTA 5LLQA 5LHGA 3J81Z 3CUOA 2ESNA 2MLKA 2HKOA 2ISYA 2STWA 1HBXG 2R7FA 5L3FA 1FWZA 4GXOA 1R22A 3E6DA 2GAUA 1Z05A 4Y13A 2WV0A 2XASA 1BIAA 3WG9A 3PFIA 1RUNA 2M5WA 4KNYA 1T39A 2W25A 3L00A 2QENA 1SD4A 3K69A 4Q4ZF 3F6VA 2PLYA 1OMIA 3RPUA 4G7ZF 4L9NA 4EM2A 4AWXB 4MQ9F 1FBUA 3JSPA 1J59A 1WWXA 4UVCA 3K1NA 2Z5UA 5ICFA 5FD6A 3W6JB 2RNJA 4MQVA 2GQQA 2GZWA 4CGZA 4IHTA 1W7PD 2ELHA 3QAHA 2A6HF 1IRGA 1HXDA 2HZTA 3GFMA 4GCVA 2J5OA 1U8RA 3C18A 1UCRA 4IJAA 2TDXA 1G3YA 2DAOA 2VC0A 3JTHA 2QVOA 3ELKA 3LQQA 1S29A 4EV0A 3ML6A 2EFPA 2MC3A 4CO8A 1PDNC 1GXPA 4IRHA 1K6OA 5HS8A 1EH6A 1ZGAA 3REOA 5D4SA 3MCZA 1QBJA 1G3TA 4NQWA 5CVIA 5LGUA 4WCGA 2M87A 1XSVA 2OQGA 3KEQA 1R1TA 5L3DA 4YFKF 2OQRA 3FF5A 2MA3A 4R79A 2F5EA 4EJUA 4OIPF 2O6GE 4L5JA 4A12A 5DUIA 1B9NA 1I6XA 2PN6A 2Q2EA 5ICEA 3KP2A 5JHUA 2MBFA 4OINF 3CUQA 2EK5A 4P55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QO0 D;  3LFK A;  1G4D A;  4H0E A;  5FD5 A;  3V8L A;  5F1R A;  3T1B A;  3GFJ A;  2FEZ A;  3GEZ A;  5LHH A;  4UV8 A;  2QLZ A;  3L2C A;  3T5X A;  3GX4 X;  3DEU A;  3WGG A;  2ZME B;  5JFR A;  5D5X B;  4HLY A;  5D6F A;  2P8T A;  3E3V A;  3ECO A;  2GWR A;  2UZK A;  3GZ6 A;  1S7O A;  2FOK A;  3CJN A;  5AIQ A;  1ZLJ A;  3LA7 A;  4YII A;  1HST A;  3KZY A;  4DQ2 A;  1R7J A;  2DO7 A;  1BBY A;  4AVP A;  3T8R A;  4ESF A;  1KU9 A;  4P9F A;  1Z1D A;  5FO5 A;  2D2W A;  3I54 A;  2QWW A;  4ZZL A;  1R00 A;  3HYI A;  4RGR A;  3FXQ A;  3ISP A;  2VBZ A;  1WKM A;  2A6E F;  1F9N A;  2KJC A;  1J9I A;  5JVT A;  3ULQ B;  3MZY A;  4KT5 C;  1BC8 C;  2NYX A;  2P5V A;  1U5T A;  3KLN A;  4I01 A;  5FB2 A;  2P6T A;  4LG0 B;  1R23 A;  3WTU C;  5DD8 A;  5E18 F;  1QPM A;  2EV6 A;  5CVV A;  1T98 A;  1YG2 A;  4A6D A;  3SXY A;  1BI1 A;  1YS7 A;  2OA4 A;  4FT8 A;  4O6J A;  4EM0 B;  3HTU A;  2LDU A;  1SAX A;  4G7O F;  3HIF A;  4ESJ A;  1MZB A;  4CHU A;  4HF2 A;  1Z91 A;  3MEX A;  1LB2 A;  5DCM A;  3GFI A;  2DT5 A;  2OU2 A;  3RTR A;  2IT0 A;  1RUO A;  1XB4 A;  1S7A A;  2FMY A;  1J0R A;  4OMZ A;  1IN5 A;  3E6M A;  4ENJ A;  1XGM A;  1U78 A;  2H6B A;  4WXH A;  2KIF A;  3E6B A;  2A3S A;  1OYW A;  1S6L A;  5L3G A;  2GXB A;  2PMH A;  2G7H A;  4KFC A;  3S2W A;  4LK1 F;  3ECH A;  1XGN A;  5CLS A;  2EA2 A;  2XVC A;  1MD0 A;  2P7V B;  2IPQ X;  4O5V A;  3DPT A;  2JZY A;  4IRG A;  2O61 A;  5JR3 A;  4HZF A;  2E1C A;  3QOP A;  2XAH A;  1K78 A;  1RNL A;  4MTE A;  2Y0M A;  6PAX A;  4A0Z A;  2FXA A;  2RC4 A;  3I64 A;  5A2Q K;  2XRO A;  5HDN A;  1U5T B;  3V7R A;  2FNP A;  2DU9 A;  1BI3 A;  4Q5S F;  1SFU A;  2NS0 A;  1BI0 A;  2QBY A;  1I5Z A;  2CQK A;  1I1G A;  2COM A;  1ZG5 A;  5EEH A;  5L3C A;  3LAJ A;  3IHU A;  3KFW X;  5LEJ A;  5BPI A;  3NRV A;  5E1Z B;  4TV7 A;  5E1W A;  3IWF A;  2M45 A;  3M9A A;  1V4R A;  5ICG A;  1TQM A;  2LF8 A;  2M8E A;  4ESB A;  1OPC A;  2V79 A;  3GFL A;  3WTX C;  1ZRC A;  1FOK A;  3FMR A;  2EJR A;  2ZBK A;  2GIV A;  5CJ9 A;  3VOE A;  4ZYD A;  3I5U A;  2V1D A;  4KIG A;  3RKY A;  1ON2 A;  1WRJ A;  4CZZ A;  4RB3 C;  2D1H A;  2P4W A;  3Q9S A;  3I59 A;  1GXQ A;  4AIH A;  3BJ6 A;  3BOQ A;  3CUQ B;  1USS A;  2WC2 A;  1REP C;  3WU1 B;  1E2X A;  5ICC A;  1P92 A;  5KK1 A;  2JPB A;  2HTS A;  4ENM A;  4EQQ A;  3GVA A;  5E8I A;  1FYK A;  5E17 F;  3WTY C;  2FBI A;  2XV4 S;  4Y15 A;  3KP3 A;  3FWE A;  5D5V B;  5F64 A;  4R8H A;  3ZMU A;  4G9Y A;  4ENK A;  1KQ0 A;  3LAP A;  1BN5 A;  2A61 A;  4IRI A;  2RV8 A;  1K79 A;  3L7W A;  1KA8 A;  4WX9 A;  2ZXJ A;  2KRF A;  2CW0 F;  4HA8 A;  3C7J A;  2MD5 A;  3CLO A;  4IHS A;  1JHH A;  3IRQ A;  4EVI A;  3RIR A;  4BYY A;  1P4X A;  4CXF A;  1LDJ A;  1PP7 U;  4MGR A;  1D5V A;  1YW8 A;  2Y48 A;  3H3Z A;  2O8X A;  4N0B A;  3FX3 A;  4MNU A;  3I4P A;  3N4M A;  4MHG A;  3ZQ7 A;  1G6N A;  4YFX F;  4HAM A;  2F2E A;  3P9K A;  5HDG A;  1F4K A;  1XSX A;  2MH2 A;  4L9J A;  1FT9 A;  3GZ5 A;  3ROU A;  2DW4 A;  3QPH A;  1R1V A;  1QZY A;  4G8X A;  3C1D A;  1ZRE A;  3BRO A;  3WTS C;  3HSF A;  4JBA A;  1O3S A;  4M6Y A;  1XDS A;  2X0L A;  4BXU A;  1P4W A;  3JAM Z;  5LEK A;  4KUM A;  4U0V A;  5E1X A;  3H3U A;  3M7G A;  2BGC A;  4L18 B;  3E97 A;  2G9W A;  1P4A A;  1MJA A;  4U0Y A;  3ZPL A;  1YS6 A;  1HSJ A;  5E20 A;  1Z7U A;  5ILU A;  4G94 A;  4Y17 A;  4M71 A;  1WSU A;  2W57 A;  1MKM A;  1ZN2 A;  2DI3 A;  3R4K A;  3SHF A;  3HHH A;  1FC3 A;  1O3R A;  1Z6T A;  2FSW A;  1ZG1 A;  1SMT A;  3VFZ A;  3BZ6 A;  2XKO A;  2YU3 A;  3AAF A;  2VT3 A;  3GLX A;  1FBQ A;  2EB7 A;  4B09 A;  3EQL F;  4ON0 A;  3I59 B;  5LRS A;  4HW0 A;  2ISZ A;  4IVN A;  3G73 A;  1LNW A;  4KIB A;  1B59 A;  3I0T A;  3WGI A;  1Z6R A;  4M9X A;  1KGS A;  4KIC A;  2HKX A;  1BM9 A;  1XDU A;  2LF7 A;  2A69 F;  3K1M A;  3OV8 A;  3KLO A;  3N97 A;  2P6S A;  3RPQ A;  1I1S A;  2PBI A;  1TQP A;  1R36 A;  4ZYH A;  5D8L B;  3SZT A;  1JHF A;  2CWE A;  2A5Y B;  1FPQ A;  2D1V A;  3NQO A;  1XMK A;  1ONV A;  5IT3 A;  2P7C B;  1YTY A;  2NNN A;  1F5T A;  2Z9O A;  4U7B A;  2V1X A;  1IXS B;  4HX4 A;  5DD4 A;  1IN4 A;  1FNN A;  1YW7 A;  2DK5 A;  2ADU A;  1T6S A;  2Z3Y A;  1KU7 A;  2JRT A;  1SD7 A;  1SFX A;  4YIF A;  4PGH A;  3BJA A;  5D6E A;  2NNY A;  5BOX A;  3ZN0 A;  2JT1 A;  4EM1 A;  3D5L A;  1LDK B;  4UVA A;  4I2O A;  3LA2 A;  1IAW A;  3U1D A;  3FZV A;  1BC7 C;  1UHW A;  3GW2 A;  2K7L A;  3U9G A;  4RB1 A;  3ABU A;  4S04 A;  2EV5 A;  1MJB A;  1RI7 A;  3DQV C;  1JXS A;  1LVA A;  3P9I A;  2V1U A;  2RGV A;  1XGS A;  1IUY A;  2DK8 A;  4XSZ F;  4EGY A;  1QQI A;  2XUB A;  3GWZ A;  3RYP A;  4QLC U;  1H9G A;  3BY6 A;  2PG4 A;  3D0S A;  1O57 A;  3KEO A;  1UB9 A;  1XN7 A;  5KVR A;  3EYI A;  3BWG A;  4MEY F;  3HOT A;  2CSO A;  1SD6 A;  2ZFW A;  4UVB A;  4MTD A;  5HLI A;  4HQM A;  3K9T A;  2VBX A;  4LMY A;  3WE2 A;  4P96 A;  1O3Q A;  2D45 A;  3BP8 A;  2KIU A;  4LGW A;  4I09 A;  1TW2 A;  2XKP A;  3OOP A;  1WI9 A;  2OD5 A;  1F1Z A;  4UHT A;  3EDP A;  3SZP A;  4RAZ A;  4WF2 A;  4EJO A;  3PQK A;  2DPD A;  2XAG A;  2E7W A;  4M9S A;  5HLH A;  3MZH A;  4M74 A;  3L09 A;  4L0Z B;  1FSE A;  5DDG A;  2FF4 A;  3MAJ A;  3VB2 A;  5LRR A;  1LEB A;  1EH7 A;  1DP7 P;  3RDI A;  1ZRF A;  4LJZ F;  3GO5 A;  4LG0 A;  2FU4 A;  2X4H A;  3E5U A;  4BHB A;  2IA0 A;  2QYO A;  1S3J A;  1AOY A;  2M1B A;  2IW5 A;  1XD7 A;  4M72 A;  3RI4 A;  1S8N A;  4U0W A;  1TNS A;  1XCB A;  3KCC A;  3F8M A;  3ABT A;  2W24 A;  2BEO A;  3TO7 A;  2YR2 A;  3DPL C;  3ZMS A;  1XMA A;  4HOB A;  4Q47 A;  1CF7 A;  1T0F A;  2QM3 A;  3WU0 A;  2IJL A;  1HKS A;  3U2R A;  3B02 A;  4BH9 A;  2EFW A;  5HS9 A;  1OR7 A;  1ODD A;  3QU6 A;  3WTV C;  4AIK A;  2AXL A;  2PEX A;  4A6E A;  4KYW A;  2L4M A;  4DNC A;  5A2Q Z;  1E17 A;  1KQ9 A;  4XBF A;  1XSD A;  5HLG A;  4P9U A;  2LSO A;  2L4A A;  4NHJ A;  4A5N A;  4PZJ A;  2DBB A;  4OU0 A;  2QUF A;  5ERI A;  2ZNY A;  4RGX A;  2VXZ A;  3ZP5 A;  5FFX A;  3FXR A;  3I58 A;  2HQR A;  2DTR A;  3FXU A;  1ZLK A;  1FY7 A;  1W5S A;  4IXA A;  4M73 A;  4XSX F;  1PUE E;  1D8K A;  1ON1 A;  1OYY A;  1UFM A;  3JSO A;  4GGG A;  5CVJ A;  2E7X A;  3F6O A;  4EJW A;  1I27 A;  5ILS A;  2VE8 A;  4NB5 A;  4LK0 F;  1P6R A;  1V3F A;  4A2U A;  5FGM A;  2Z99 A;  1IXR C;  1Z9C A;  4HYE A;  1AWC A;  2HDC A;  1DDN A;  1FBS A;  2ZKZ A;  4KDP A;  2O3F A;  1D8J A;  4HX7 A;  4LB5 A;  3ZMV A;  3IWZ A;  1B9M A;  4KA4 A;  1MDM A;  5BS6 A;  4N9I A;  5CVR A;  3KP7 A;  1H9T A;  4YFN F;  1HKT A;  3E5Q A;  2QQA A;  4WK8 F;  4RS8 A;  5LBQ A;  4HV5 A;  3RKX A;  3WTW C;  1ZYR F;  4K2E A;  3W6K B;  1WQ2 A;  2BV6 A;  1TNT A;  1FYL A;  2R7D A;  4L5I A;  3QP6 A;  1IN8 A;  4D0P A;  2UXN A;  4OIR F;  4RB2 C;  2VOO A;  4GYI A;  4I0B A;  2VT2 A;  2STT A;  3DP7 A;  3F21 A;  3BDD A;  3O3K A;  4KIF A;  2VBY A;  2L02 A;  5FLX Z;  3HSE A;  3HRT A;  2QBY B;  4KN4 X;  4XRF A;  2RDP A;  1TQI A;  1CGP A;  2BBY A;  2HQN A;  4BHP A;  3R61 A;  2EFQ A;  1BIB A;  1KQ8 A;  4P5O A;  1FYM A;  4Z2Y A;  2YSR A;  3V7S A;  3SQN A;  2J5P A;  3COA C;  3TOA A;  1DPR A;  3F3X A;  4LB6 B;  3TGN A;  1YO5 C;  1KYW A;  3T0Y A;  3VOD A;  3CO7 C;  4WWC A;  3ERE D;  4EGZ A;  2XAF A;  3EET A;  3O6B B;  4ASN A;  2GA1 A;  3ZMT A;  2C6Y A;  4QWQ A;  5AON A;  2FA5 A;  2HWV A;  2HYF A;  4A0Y A;  1R5G A;  1G3W A;  1IW7 F;  1R1U A;  1IXC A;  1ZRD A;  3WTZ A;  2YX4 A;  2CO5 A;  2K27 A;  5IT9 Z;  2XGX A;  3P7N A;  4FX0 A;  2BYV E;  1C0W A;  1HQC A;  3T8T A;  1U2W A;  2MLG A;  3CDH A;  2CGP A;  3DF8 A;  4FX4 A;  1U5T C;  2H94 A;  3TQN A;  2Z33 A;  1SD5 A;  5F6F A;  5HOO A;  3V8K A;  2XIG A;  3O2P E;  5LHI A;  1FX7 A;  1TLH B;  4CIC A;  3TOB A;  4EJT A;  3NEU A;  4G6D A;  2OAZ A;  4HF0 A;  4U7D A;  2K4J A;  2R3S A;  5TRD A;  3C3W A;  5LGT A;  5K1Y A;  1Y0U A;  4AD9 A;  3RYR A;  3H92 A;  3DFG A;  4ETS A;  2HGC A;  4HDV A;  1K78 B;  2MH9 A;  2QQ9 A;  3L9F A;  2VN2 A;  3WTT C;  2VBW A;  3FMQ A;  4MEX F;  2LKP A;  3KET A;  1K7A A;  2GXG A;  2O0Y A;  4I7H A;  1B6A A;  4M9Z A;  2PI0 A;  3F8B A;  2AS5 F;  1W4M A;  3TDZ C;  4R1H A;  1KU2 A;  4U88 A;  1MJ9 A;  2GA2 A;  1LQ1 A;  4KMF A;  1IN7 A;  2PMU A;  1LDD A;  1O3T A;  3QP5 A;  3IKV A;  4ZH4 F;  4ZYG A;  4LLN A;  3E6C C;  2ZNZ A;  3TO9 A;  1DPU A;  4HQE A;  3RKW A;  1NHA A;  4HF1 A;  5TJJ A;  4N9H A;  3WE3 A;  2KJB A;  2NRA C;  1TBX A;  2H6C A;  2DQR A;  2OBP A;  2XAQ A;  2JPC A;  4RGS A;  1T2K A;  3CTA A;  1ULY A;  5ILV A;  3HOS A;  1FSH A;  2Y75 A;  3BPX A;  3VEP A;  1H0M A;  2RKH A;  4I98 B;  4HLX A;  2W85 A;  3DV8 A;  5BQT A;  5BMZ A;  2F5C A;  2UXX A;  2F5F A;  2A68 F;  1W7P A;  4BHC A;  2XAJ A;  1VTN C;  2K4B A;  4RAY A;  2RVC A;  3QRF F;  3V4G A;  3F23 A;  1HW5 A;  2HOE A;  2IA1 A;  5JI6 A;  2G7U A;  1O7F A;  2QZ8 A;  4LLG F;  4GO1 A;  3QPT A;  3LST A;  3MWM A;  3F8C A;  3HRS A;  2FE3 A;  1YQA A;  3HSR A;  1U3E M;  1IZ1 A;  1PP8 F;  1ZAR A;  3K1P A;  3GYH X;  3DXJ F;  1ZHF A;  2WWY A;  1IF1 A;  1OYI A;  3G3Z A;  3R0A A;  2XHK A;  4CDG A;  1DUX C;  3QU3 A;  3J80 Z;  1HW1 A;  4OOI A;  4JK1 X;  2PJP A;  5DCF A;  1B4A A;  4PCQ A;  4I0A A;  3IRR A;  3FMS A;  5HVQ C;  1XCV A;  3MFK A;  2VON A;  5K5Q A;  1G3S A;  1IN6 A;  1RZ4 A;  1J5Y A;  4B8X A;  2K86 A;  2P5L C;  3TDU C;  1ZG3 A;  2FQ3 A;  2EFO A;  5DEQ A;  1JE8 A;  4LLL A;  2HFH A;  1UHM A;  3EYY A;  1LJ9 A;  2HS5 A;  3EUH A;  1KU3 A;  1XGO A;  3CUQ C;  3K2Z A;  3M8E A;  4FHT A;  5D4R A;  4I02 A;  2HEO A;  3WOD F;  2QQB A;  2CG4 A;  4LD5 A;  1YIO A;  1EH8 A;  5D5U B;  1GHC A;  2L3D A;  3I53 A;  4HBL A;  5BPD A;  2O03 A;  2RQP A;  4RB0 A;  2NAZ A;  3JAM K;  1J7K A;  2HR3 A;  4BQA A;  4A5M A;  4LFU A;  3KP6 A;  1FLI A;  1IRF A;  2K02 A;  2VOP A;  2BE5 F;  2ESH A;  2ZJ2 A;  3P9C A;  5J8F A;  1R5H A;  5H20 A;  3R0J A;  1YLF A;  4HV6 A;  1QNT A;  3LWF A;  1YYV A;  4E70 A;  1KYZ A;  4OIO F;  4BAY A;  4ZZD A;  2UWM A;  2WTE A;  5K5R A;  1HW2 A;  5AIP A;  2ACJ A;  1HKQ A;  3HUG A;  4EMS A;  2IA2 A;  1STZ A;  3M8F A;  2PFB A;  5DV5 A;  3JW4 A;  2EWN A;  1W7P B;  4L9V A;  4JQF A;  4KN7 X;  3WGH A;  5LGN A;  2IRF G;  3HTS B;  2VC1 A;  1CF7 B;  2B0L A;  1W5T A;  3RJP A;  4HX8 A;  5HS7 A;  3CO6 C;  3TO6 A;  2KIM A;  1TW3 A;  3HRM A;  4A0X A;  4BNC A;  1O7L A;  4WXC A;  1J2X A;  1GVJ A;  2E1N A;  3B73 A;  4KMU X;  1SFE A;  4XLP F;  3PQJ A;  1LEA A;  5E8G A;  4PDK A;  3J7A O;  1L0O C;  1QZZ A;  1EV7 A;  2PQ8 A;  4F7Z A;  3FHZ A;  2FBK A;  1TTY A;  3I71 A;  3R60 A;  2ZO4 A;  4OMY A;  1QGP A;  1L3L A;  1R58 A;  1FP1 D;  5FLX K;  2IP2 A;  3E5X A;  3LQR A;  2M30 A;  1OKR A;  5IT9 K;  4G6Q A;  4GYG A;  2V6C A;  3MQ0 A;  3LA3 A;  2ETH A;  3FM5 A;  2JTV A;  1BOA A;  2P5K A;  3KZZ A;  5H6Q A;  4ZYE A;  2YPR A;  3SFZ A;  1YFH A;  4UUV A;  1JGS A;  1FZP B;  2VOD A;  3V8J A;  2A07 F;  3KP5 A;  3M1E A;  4S05 A;  4UXN A;  1ZH5 A;  4EJV A;  1P2F A;  2LNB A;  2HYG D;  5EEG A;  2V9V A;  4O3M A;  1J75 A;  4M6X A;  2H27 A;  4PGG A;  3GUD A;  3IL2 A;  2YX7 A;  1B1B A;  4WXD A;  5L3B A;  4XLN F;  2FNA A;  2IVM A;  3HHG A;  2EA4 A;  1SMY F;  3BJO A;  5CVU A;  2H09 A;  2OZU A;  2KKO A;  5DCM B;  4CYD A;  3HRU A;  5CYV A;  5D5W B;  3TKY A;  2RN7 A;  1ZGJ A;  3ZMZ A;  3ZN1 A;  3F22 A;  1Q1H A;  1T38 A;  3KE2 A;  1D3Y A;  5H6R A;  3JTG A;  2HTJ A;  2FRH A;  4ENN A;  1YW9 A;  2FBH A;  3IC7 A;  4Q48 A;  3R6S A;  4UNO A;  3V7C A;  2ZCW A;  3BPV A;  4YG2 F;  3GXO A;  3F72 A;  5FFZ A;  1RIO H;  1ZAO A;  2JSC A;  4IPA A;  2DPU A;  1UST A;  5DUK A;  3J80 K;  3GF2 A;  3K0L A;  3KP4 A;  4OIQ F;  2XRN A;  1MDM B;  2F5D A;  5L3E A;  2EFN A;  3F8F A;  5ED4 A;  2CFX A;  5J8C A;  5J6X A;  3J81 K;  3ZMD A;  4AIJ A;  1A04 A;  1BI2 A;  2DQL A;  4L9T A;  4L0Y B;  5K5O A;  5HDK A;  4HDU A;  2ZME A;  1MGT A;  3Q5F A;  1U6G A;  3FM3 A;  2FML A;  4UV9 A;  5D8K B;  2W84 A;  2Q0O A;  2DFI A;  1X3U A;  4G7H F;  4IF4 A;  2Q8K A;  1FP2 A;  2OZ6 A;  3DKW A;  2DLL A;  3Q9V A;  3F8N A;  2L01 A;  2CYY A;  2VE9 A;  4RGU A;  5DYM A;  1BJA A;  2L54 A;  2EV0 A;  3IKT A;  5LLQ A;  5LHG A;  3J81 Z;  3CUO A;  2ESN A;  2MLK A;  2HKO A;  2ISY A;  2STW A;  1HBX G;  2R7F A;  5L3F A;  1FWZ A;  4GXO A;  1R22 A;  3E6D A;  2GAU A;  1Z05 A;  4Y13 A;  2WV0 A;  2XAS A;  1BIA A;  3WG9 A;  3PFI A;  1RUN A;  2M5W A;  4KNY A;  1T39 A;  2W25 A;  3L00 A;  2QEN A;  1SD4 A;  3K69 A;  4Q4Z F;  3F6V A;  2PLY A;  1OMI A;  3RPU A;  4G7Z F;  4L9N A;  4EM2 A;  4AWX B;  4MQ9 F;  1FBU A;  3JSP A;  1J59 A;  1WWX A;  4UVC A;  3K1N A;  2Z5U A;  5ICF A;  5FD6 A;  3W6J B;  2RNJ A;  4MQV A;  2GQQ A;  2GZW A;  4CGZ A;  4IHT A;  1W7P D;  2ELH A;  3QAH A;  2A6H F;  1IRG A;  1HXD A;  2HZT A;  3GFM A;  4GCV A;  2J5O A;  1U8R A;  3C18 A;  1UCR A;  4IJA A;  2TDX A;  1G3Y A;  2DAO A;  2VC0 A;  3JTH A;  2QVO A;  3ELK A;  3LQQ A;  1S29 A;  4EV0 A;  3ML6 A;  2EFP A;  2MC3 A;  4CO8 A;  1PDN C;  1GXP A;  4IRH A;  1K6O A;  5HS8 A;  1EH6 A;  1ZGA A;  3REO A;  5D4S A;  3MCZ A;  1QBJ A;  1G3T A;  4NQW A;  5CVI A;  5LGU A;  4WCG A;  2M87 A;  1XSV A;  2OQG A;  3KEQ A;  1R1T A;  5L3D A;  4YFK F;  2OQR A;  3FF5 A;  2MA3 A;  4R79 A;  2F5E A;  4EJU A;  4OIP F;  2O6G E;  4L5J A;  4A12 A;  5DUI A;  1B9N A;  1I6X A;  2PN6 A;  2Q2E A;  5ICE A;  3KP2 A;  5JHU A;  2MBF A;  4OIN F;  3CUQ A;  2EK5 A;  4P55 A; 
#chains in the Genus database with same CATH topology
 3GTP J;  2QCO A;  1QO0 D;  3LFK A;  3PFY A;  3CCM I;  1G4D A;  4D5C A;  4H0E A;  5FD5 A;  2EBI A;  3V8L A;  2R92 J;  4DIQ A;  3T1B A;  2CQQ A;  5F1R A;  1HA8 A;  3CES A;  3GFJ A;  2FEZ A;  3GEZ A;  4ZTJ A;  5LHH A;  2D5V A;  4UV8 A;  1H89 C;  2QLZ A;  1PUF A;  3L2C A;  3T5X A;  2DMU A;  3GX4 X;  1JJ6 C;  2JA7 J;  3DEU A;  3HXL A;  4ITV A;  3WGG A;  2ZME B;  3QOE A;  3CJR B;  2PMZ N;  5F08 A;  3JRA A;  1A31 A;  5IYC J;  4CZC A;  2Y0S N;  5JFR A;  5D5X B;  1Z67 A;  4HLY A;  2M4G A;  1FMW A;  5D6F A;  4B47 A;  2P8T A;  4UUT A;  2DJN A;  3E3V A;  3SZG A;  3ECO A;  3S2D J;  1WI3 A;  2GWR A;  2UZK A;  3GZ6 A;  1G2H A;  1S7O A;  1UJ8 A;  2FOK A;  3CJN A;  4CCK A;  1BR1 A;  5DM7 F;  3J7Y J;  5AIQ A;  4ABZ A;  1ZLJ A;  3LA7 A;  1AA7 A;  2CU7 A;  4YII A;  1HST A;  3OYH A;  3BC8 A;  1VND A;  4G12 A;  3I9V 2;  3KZY A;  1O4X A;  4DQ2 A;  1R7J A;  2DO7 A;  1BBY A;  3T8R A;  4AVP A;  4EEF G;  4ESF A;  4PSW A;  4A93 J;  2LRE A;  2CQN A;  1KU9 A;  3CCY A;  2H8R A;  4P9F A;  1JI8 A;  1Z1D A;  5FO5 A;  2LYC A;  2MAB A;  2D2W A;  3I54 A;  2QWW A;  4ZZL A;  1R00 A;  3HYI A;  3VYR B;  4RGR A;  3FXQ A;  3H36 A;  3ISP A;  3BT9 A;  4XN0 A;  3HOV J;  1IC8 A;  2VBZ A;  5GAD J;  2HU9 A;  3EPZ A;  3VDX A;  2XRL A;  1WKM A;  3QQA A;  3AL0 B;  2A6E F;  1F9N A;  1LPQ A;  2KJC A;  3OIP A;  1J9I A;  1HCR A;  3CP8 A;  5JVT A;  2HZD A;  1VQ5 I;  2XF6 A;  2ZXH A;  2Q2E B;  2VPR A;  3OOU A;  4IOA F;  1JUM A;  3TP3 A;  3MZY A;  3ULQ B;  1PYV A;  3QYB A;  4KT5 C;  1BC8 C;  2NYX A;  2P5V A;  2EIJ H;  4E7H A;  3P5J A;  5F0C A;  1U5T A;  3KLN A;  3PNY A;  4I01 A;  2XPV A;  3VPR A;  5FB2 A;  2P6T A;  4UUS B;  1R23 A;  4LG0 B;  1AKH B;  3WTU C;  2JRM A;  1OCR H;  3Q0U A;  5DD8 A;  3E7L A;  5J1U A;  5HLT A;  5E18 F;  2M8G X;  3C2H A;  1P7I A;  1QPM A;  1Y39 A;  3K10 A;  2EV6 A;  5CVV A;  2LD5 A;  3U21 A;  1T98 A;  1YG2 A;  4A6D A;  3BG9 A;  2E5Z A;  4AVZ A;  1K6Y A;  2VB6 A;  2AHQ A;  3ABL H;  1BI1 A;  3SXY A;  1I3A A;  2HXI A;  1YS7 A;  2OA4 A;  4FT8 A;  4O6J A;  3CCS I;  4EM0 B;  2R93 J;  2RAE A;  3HTU A;  1TWA J;  5J3L A;  2LDU A;  1SAX A;  4G7O F;  3HIF A;  4QPQ A;  4ESJ A;  1MZB A;  3RZO J;  3HOY J;  4CHU A;  4HF2 A;  2IS4 A;  1Z91 A;  3MEX A;  3BQY A;  1LB2 A;  1UAA A;  1MH4 A;  5DCM A;  3GFI A;  2DT5 A;  1LUJ B;  4BQN A;  2OU2 A;  3KPH A;  5FKK A;  2BHY A;  3BR2 A;  3RTR A;  1RUO A;  2IT0 A;  1E3P A;  5CPR B;  5E3N A;  1XB4 A;  3MKL A;  3GBG A;  1S7A A;  4LIV A;  1SFO J;  4NBQ A;  4BBS J;  2FMY A;  1J0R A;  4OMZ A;  1IN5 A;  1V55 H;  4E7I A;  1MBJ A;  3E6M A;  4RLQ A;  5GP9 A;  4ENJ A;  1XGM A;  2ME6 A;  1JUS A;  1U78 A;  3CD6 I;  4DJA A;  3X2Q H;  5E3L A;  3DPU A;  2H6B A;  4WXH A;  2KIF A;  3E6B A;  2A3S A;  4B48 A;  2BY0 A;  1OYW A;  1S6L A;  5L3G A;  3JRE A;  1F43 A;  2GXB A;  2BHZ A;  2PMH A;  2JA6 J;  3ERM A;  1FOX A;  2NVT J;  1WJ5 A;  2G7H A;  4KFC A;  3S2W A;  2ZJP F;  4LK1 F;  3ECH A;  1XGN A;  5B1B H;  5CLS A;  3BTL A;  1WJA A;  2M7B A;  4ZDL A;  2EA2 A;  1MBK A;  2XVC A;  2JVG A;  1RKT A;  1MD0 A;  1X19 A;  5FRN A;  2R7V A;  2P7V B;  2IPQ X;  2E71 A;  4O5V A;  2BVM A;  1TWC J;  4F92 B;  4UY8 I;  2I10 A;  3DPT A;  1A36 A;  2JZY A;  4HPQ A;  4IRG A;  4M3G A;  3ZQF A;  2O61 A;  2K3P A;  5JR3 A;  4HZF A;  1BR2 A;  2E1C A;  2M0M A;  3QOP A;  2XAH A;  1XG1 A;  1K78 A;  1RNL A;  3PUB A;  4XR6 A;  4MTE A;  2Y0M A;  6PAX A;  1TWG J;  4A0Z A;  1R49 A;  2FXA A;  2RC4 A;  3I64 A;  4W97 A;  5A2Q K;  2XRO A;  3AL0 C;  5HDN A;  1U5T B;  1MSE C;  3V7R A;  4EAT A;  2FNP A;  1Y56 A;  2EPF A;  2DU9 A;  2ZME C;  1BI3 A;  5J4Y A;  2ZXW H;  2LK2 A;  4Q5S F;  1LKX A;  1SFU A;  2NS0 A;  1BI0 A;  2QBY A;  1I5Z A;  2CQK A;  2Y9Y A;  1I1G A;  2COM A;  3CCU I;  1ZG5 A;  5EEH A;  1Y1W J;  5F1J A;  5L3C A;  3LAJ A;  3IHU A;  3KFW X;  1WJB A;  5LEJ A;  5BPI A;  1TL8 A;  3NRV A;  3DTK A;  5E1Z B;  4TV7 A;  5F0H A;  5E1W A;  3IWF A;  1TC3 C;  2M45 A;  3M9A A;  3K4N A;  1V4R A;  2VLA A;  5ICG A;  1TQM A;  2LF8 A;  2M8E A;  4XK4 A;  4ESB A;  1OPC A;  2V79 A;  3GFL A;  3HKZ A;  3NAR A;  1R6R A;  4D7N A;  3WTX C;  1ZRC A;  1FOK A;  3FMR A;  2EJR A;  2ZBK A;  2GIV A;  5CJ9 A;  3VOE A;  4ZYD A;  3CCJ I;  3I5U A;  3DBL B;  2V1D A;  2VKD A;  4KIG A;  3RKY A;  3BTI A;  1ON2 A;  1WRJ A;  3WU2 C;  4G6T B;  4CZZ A;  4RB3 C;  1K4T A;  2D1H A;  2F4I A;  2P4W A;  3Q9S A;  3I59 A;  1GXQ A;  4AIH A;  3BJ6 A;  3BOQ A;  4XRM A;  3CUQ B;  1USS A;  2WC2 A;  1REP C;  3WU1 B;  1E2X A;  2EZK A;  1T08 B;  1P92 A;  2KPM A;  5KK1 A;  5ICC A;  3S3N A;  2JPB A;  2HTS A;  2EZI A;  4EQQ A;  4ENM A;  2ZSH B;  3GVA A;  1X1A A;  2W7N A;  5E8I A;  2XGE A;  1FYK A;  3LSI A;  4F52 A;  2R7U A;  5E17 F;  3WTY C;  2FBI A;  2XV4 S;  4Y15 A;  2DMP A;  3FWE A;  3KP3 A;  3PO3 J;  3H0D A;  1QRY A;  2M4K A;  5D5V B;  5F64 A;  1AKH A;  1ACI A;  4R8H A;  3ZMU A;  1WJD A;  4G9Y A;  3W2W A;  2R5Y A;  2R5Y B;  2W48 A;  4F91 B;  1KQ0 A;  2EIN H;  4ENK A;  1HDP A;  3LAP A;  3EUK L;  1V5G A;  1S72 I;  1BN5 A;  2A61 A;  4IRI A;  3QYF A;  5GPC A;  2LKX A;  2RV8 A;  2M2E A;  1K79 A;  3L7W A;  1KA8 A;  4WX9 A;  2ZXJ A;  1OLT A;  2KRF A;  2DDA A;  3OYI A;  2CW0 F;  4HA8 A;  2R4G A;  2HVQ A;  2COB A;  3C7J A;  2KLO A;  2LC2 A;  2MD5 A;  2RRE A;  3CLO A;  3Q3S A;  3J7Z I;  5J1Y A;  4IHS A;  3K70 D;  3DU6 A;  3G1L A;  1JHH A;  3IRQ A;  4EVI A;  3RIR A;  5M5Y J;  3L2R A;  2K3F A;  4LIU A;  4BYY A;  1P4X A;  4CXF A;  4C9Y A;  2MYS A;  4J01 A;  2IS6 A;  1LDJ A;  2N8G A;  2KIS A;  1PP7 U;  4JX6 A;  3L1P A;  4MGR A;  2IEK A;  4AYB N;  1N25 A;  5E3M A;  2Y9Z A;  1D5V A;  2QA4 I;  1ZGW A;  3O8G A;  1YW8 A;  2Y48 A;  3S1N J;  3ZQH A;  3JRF A;  3H3Z A;  2O8X A;  4NQW B;  4N0B A;  2X51 A;  3FXJ A;  3K2A A;  4DBQ A;  3FX3 A;  4MNU A;  5EJC A;  1VI0 A;  3I4P A;  2MC4 A;  4HNU A;  5F27 A;  3N4M A;  4MHG A;  3W3C A;  3ZQ7 A;  2R7T A;  4BQO A;  1G6N A;  1VQM I;  4YFX F;  4IEJ A;  3D5R C;  1NG6 A;  4NC8 A;  1IRX A;  3K7A J;  3VSL A;  4HAM A;  1IJW C;  2F2E A;  3S15 J;  3CLQ A;  3P9K A;  5HDG A;  4UB8 C;  3CCL I;  1F4K A;  1A6I A;  4QPO A;  1XSX A;  4JOM A;  1FTT A;  4BL0 B;  2MH2 A;  4L9J A;  3MKY B;  1FT9 A;  1A35 A;  4FAS D;  3E0J B;  2DOE A;  3GZ5 A;  5FKO A;  3ROU A;  4FET A;  1ENH A;  2XF5 A;  4XKB A;  2DW4 A;  1T95 A;  3V42 A;  3SDB A;  3QPH A;  3JRB A;  1W5C C;  4KIT B;  1R1V A;  1MBG A;  1QZY A;  2R5Z A;  1U9N A;  1NTC A;  4G8X A;  3C1D A;  1ZRE A;  1WPK A;  3BRO A;  2YU9 J;  3WTS C;  5GAH J;  1MMD A;  5J1R A;  3CCE I;  1BW5 A;  3HSF A;  4JBA A;  3DLA A;  3IH4 A;  1O3S A;  2QF7 A;  4M6Y A;  1XDS A;  2X0L A;  4BXU A;  3MVP A;  2BOL A;  1P4W A;  1APL C;  3JAM Z;  1VQP I;  2OTL I;  5LEK A;  4KUM A;  5KHD A;  4U0V A;  2ECB A;  4MFE A;  1Z21 A;  5E1X A;  3H3U A;  2B9S A;  3S8P A;  3M7G A;  2BGC A;  4XON A;  3E97 A;  2G9W A;  4N4O B;  5EYR A;  4L18 B;  1P4A A;  2IGK A;  5DM6 F;  1MJA A;  4U0Y A;  3G1O A;  1QPI A;  3ZPL A;  1YS6 A;  1HSJ A;  4BQQ A;  4CSW A;  4BEH B;  5E20 A;  1Z7U A;  5ILU A;  5M5W J;  1SVO A;  2X6W A;  2M34 A;  4G94 A;  3OYA A;  3GTG J;  1UG2 A;  1FTZ A;  4Y17 A;  4HEA 2;  3ASO H;  2DA1 A;  3A1Y A;  2OCC H;  4M71 A;  1WSU A;  2W57 A;  1MKM A;  1ZN2 A;  2DI3 A;  2OTJ I;  3R4K A;  3A01 A;  3SHF A;  3HHH A;  4A3C J;  1JKP C;  1FC3 A;  3H5A A;  4Y7N J;  1Z6T A;  1O3R A;  3I4N J;  2FSW A;  2K9L A;  1ZG1 A;  3GZN B;  1YJN I;  1GUU A;  5FRM A;  1SMT A;  3VFZ A;  3BZ6 A;  2XKO A;  3HJE A;  2ZJQ F;  2NXN B;  2YU3 A;  5K7F A;  3AAF A;  1R4N B;  2VT3 A;  3GLX A;  2L9N A;  4CYC A;  1FBQ A;  2EB7 A;  2X6X A;  4B09 A;  3EQL F;  3PNT A;  3I59 B;  4ON0 A;  5FKL A;  5LRS A;  1Q1V A;  5IP7 J;  1FOY A;  4HW0 A;  2ISZ A;  4IVN A;  3G73 A;  1LNW A;  4KIB A;  1W0U A;  1B59 A;  3I0T A;  2BY1 A;  1S5L C;  3WGI A;  3I4M J;  3QWL A;  1Z6R A;  2K40 A;  5IY5 H;  1BL0 A;  4M9X A;  1KGS A;  2DT7 B;  4KIC A;  2HKX A;  2E1O A;  1BM9 A;  1XDU A;  2DA6 A;  2LF7 A;  2A69 F;  3K1M A;  2EIM H;  3KLO A;  3OV8 A;  2MFZ A;  4FQG A;  3N97 A;  2P6S A;  3H5N A;  3RPQ A;  1I1S A;  2PBI A;  3CP2 A;  1TQP A;  1R36 A;  3F9K A;  4ZYH A;  5D8L B;  1I3Q J;  1TT5 B;  3SZT A;  3JR9 A;  1JHF A;  3I56 I;  3OIQ A;  2CWE A;  1JTX A;  2A5Y B;  2L2O A;  1FPQ A;  3IAM 2;  2D1V A;  1VFC A;  3NQO A;  3H35 A;  2NVX J;  1XMK A;  1ONV A;  3NWT A;  4RAF A;  5IT3 A;  5HNH A;  5EEA A;  3S1M J;  2P7C B;  1YTY A;  2NNN A;  1F5T A;  2FX0 A;  1B72 A;  2Z9O A;  4U7B A;  2V1X A;  1IXS B;  3K4L A;  4HX4 A;  5DD4 A;  4GRI A;  1IN4 A;  1FNN A;  1YW7 A;  2NVY J;  2DK5 A;  1X3Z B;  1QHG A;  2ADU A;  5J47 A;  4C2T A;  1T6S A;  2Z3Y A;  1KU7 A;  2L7F P;  2JRT A;  1SD7 A;  1DU0 A;  1SFX A;  4YIF A;  3L2U A;  4PGH A;  1MSF C;  1EKE A;  3BJA A;  5D6E A;  5EG0 A;  2W1O A;  3CJQ B;  2NNY A;  5BOX A;  3ZN0 A;  2JT1 A;  4EM1 A;  3G4S I;  3D5L A;  1LDK B;  4UVA A;  4I2O A;  3S16 J;  3LA2 A;  1IAW A;  1Y6I A;  3U1D A;  3PSF A;  3BG5 A;  2LG4 A;  3FZV A;  1DU6 A;  1BC7 C;  1UHW A;  3GW2 A;  2CW7 A;  2PJR A;  2K7L A;  3U9G A;  4RB1 A;  3ABU A;  2KHM A;  4S04 A;  2EV5 A;  5EF6 A;  1MJB A;  3NWS A;  1YIJ I;  2EIL H;  4A3I J;  1LVK A;  1MMN A;  1RI7 A;  3DQV C;  1JXS A;  1LVA A;  3P9I A;  2Y30 A;  4AYB A;  5FKM A;  1TWF J;  3OYF A;  2RGV A;  2V1U A;  1XGS A;  1Z3Y A;  5IP9 J;  4ZYA A;  4A3K J;  3DKX A;  1VQ7 I;  1IUY A;  2DK8 A;  4XSZ F;  3W6V A;  2X85 A;  4EGY A;  1QQI A;  2XUB A;  3GWZ A;  4CA0 A;  3RYP A;  4Y52 J;  1XPX A;  3AG1 H;  4V19 K;  4QLC U;  5LD2 C;  1H9G A;  3C2G A;  4P1W A;  3BY6 A;  2PG4 A;  2HPI A;  3JRC A;  4F3Q A;  4M6V A;  3D0S A;  4HST A;  2ICW G;  1O57 A;  3CCR I;  1G8X A;  3KEO A;  1UB9 A;  3E1S A;  1XN7 A;  4BJ5 C;  2H8W A;  5KVR A;  3EYI A;  2NOJ B;  3BWG A;  4MEY F;  3HOT A;  2CSO A;  5EGO B;  1SD6 A;  5HNF A;  2ZFW A;  1ZKG A;  1SVL A;  2HI3 A;  4A3E J;  2DMQ A;  2DDB A;  2V4J C;  4UVB A;  1DGR M;  4MTD A;  1J09 A;  5HLI A;  4HQM A;  3K9T A;  2VBX A;  4LMY A;  3WE2 A;  4P96 A;  1O3Q A;  2D45 A;  3BP8 A;  3TL4 X;  1NG7 A;  2KIU A;  4LGW A;  4E7L A;  4DZP A;  3OYM A;  1B72 B;  1S9H A;  3DKY A;  4I09 A;  1TW2 A;  2XKP A;  2DYR H;  4IO9 F;  3OOP A;  2IXS A;  1V5F A;  1WI9 A;  2BVL A;  1HC8 A;  2OD5 A;  1D1C A;  3O8H A;  2HVS A;  2L7K A;  1F1Z A;  2R7R A;  2VL8 A;  2B63 J;  4UHT A;  4W1U A;  2E5N A;  4A3J J;  1TT0 A;  1JTY A;  2OF7 A;  2K9Q A;  4HRI A;  3EDP A;  4BY7 J;  3SZP A;  4RAZ A;  4WF2 A;  3GTO J;  1Z7L A;  4D1Q A;  4EJO A;  3PQK A;  3FHN A;  2DPD A;  4NUB A;  2CV0 A;  2VJI A;  3GTJ J;  2XAG A;  2E7W A;  4M3D A;  4M9S A;  1A6Q A;  9ANT A;  3VSK A;  2I8D A;  5HLH A;  3H0G J;  3MZH A;  4M74 A;  3W2V A;  3EUH C;  3L09 A;  3LSH A;  2F4M B;  3OL3 A;  4L0Z B;  4RMN A;  3SYT A;  1QA6 A;  1FSE A;  4HNT A;  1P9Q C;  2ID6 A;  5DDG A;  2FF4 A;  3MAJ A;  3VB2 A;  4CYC B;  5LRR A;  1LEB A;  1EH7 A;  3CDL A;  1DP7 P;  3RDI A;  2LOO A;  3KIO A;  2DA2 A;  4D9J A;  1ZRF A;  1OCO H;  4LJZ F;  3GO5 A;  4LG0 A;  2FU4 A;  2X4H A;  3E5U A;  4BHB A;  2IA0 A;  2QYO A;  1MBF A;  2B7E A;  3OYL A;  4A3F J;  3DBH B;  3OS2 A;  3RQ4 A;  1S3J A;  1QZE A;  4BEH A;  2W4S A;  3JRG A;  1EA3 A;  4U87 A;  1AOY A;  1AHD P;  2M1B A;  2IW5 A;  1XD7 A;  3UNG C;  4M72 A;  1X2M A;  3RI4 A;  3W2A A;  2R5Z B;  1S8N A;  2WA0 A;  2X6O A;  4OWR B;  2JUG A;  2XAU A;  1D0Z A;  3PIP F;  4U0W A;  2QGU A;  1TNS A;  1XCB A;  3KCC A;  4E7Z A;  3F8M A;  3ABT A;  3A03 A;  2W24 A;  4IKF A;  2BEO A;  3TO7 A;  3OYK A;  4KT6 A;  3CCQ I;  1ZR2 A;  3JCU C;  2YS9 A;  2YR2 A;  1B8I B;  3HOZ J;  3DPL C;  1CQT A;  3K6G A;  3BCB A;  1WJE A;  1I39 A;  3MN2 A;  1UHS A;  3ZMS A;  1XMA A;  3GTM J;  4HOB A;  4Q47 A;  4ANJ A;  5C3E J;  1CF7 A;  3IAS 2;  1T0F A;  2OCE A;  3FXM A;  4DGW B;  2QM3 A;  3WU0 A;  5IYD J;  2IJL A;  1HKS A;  3U2R A;  5FJ8 J;  3B02 A;  3DTE A;  4PFP A;  4BH9 A;  2EFW A;  5HS9 A;  1OR7 A;  4BE0 A;  1ODD A;  3QU6 A;  3ZOB A;  2OV7 A;  1K4S A;  3KYD B;  3WTV C;  3FXK A;  4AIK A;  2AXL A;  3ZQG A;  2PEX A;  4A6E A;  3UKG A;  3QYE A;  3CC2 I;  1MMA A;  1YX3 A;  2L4M A;  4KYW A;  4DNC A;  5A2Q Z;  2LH9 A;  1KQ9 A;  1E17 A;  4XBF A;  1RR7 A;  2CH0 A;  3FK6 A;  1BJZ A;  1XSD A;  2P81 A;  5HLG A;  4P9U A;  4M3B A;  1YJW I;  2JVH A;  5DTD A;  2R7X A;  3CZ6 A;  2XGC A;  2LSO A;  4RA2 A;  2L4A A;  4XOR A;  2QSG X;  2XDV A;  3G6E I;  4NHJ A;  5CKT A;  4A5N A;  4PZJ A;  1Z3X A;  1FMV A;  2DBB A;  1YIT I;  4OU0 A;  2QUF A;  2I5U A;  5ERI A;  2NVU B;  2ZNY A;  4RGX A;  5J40 A;  4PJM A;  5IYB J;  1GT0 C;  3GTL J;  2VXZ A;  3ZP5 A;  5FFX A;  3FDY A;  3LSP A;  3PM1 A;  3FXR A;  4LIT A;  2JSP A;  3I58 A;  2HQR A;  2KP6 A;  2DTR A;  3FXU A;  1ZLK A;  3ZQL A;  2DA4 A;  1FY7 A;  1K61 A;  1W5S A;  1M1E B;  3SJM A;  1X1C A;  2BZT A;  2E36 A;  2JMW A;  4IXA A;  2CV2 A;  5EZG A;  1X1D A;  1TP4 A;  4M73 A;  2JUC A;  1ZEL A;  4XSX F;  1PUE E;  1D8K A;  3FBN B;  1JT6 A;  1QVU A;  2E34 A;  1ON1 A;  3I55 I;  1OYY A;  1SFK A;  1TZL A;  1UFM A;  2Y0S A;  5E3O A;  3LOC A;  4V2F A;  3JSO A;  4PJ0 C;  4GGG A;  5CVJ A;  2CUF A;  2E7X A;  3F6O A;  1RR8 C;  3DCF A;  4HSR A;  3ABM H;  4EJW A;  1I27 A;  5ILS A;  2VKH A;  2VE8 A;  3B6C A;  4NB5 A;  4LK0 F;  2A6T A;  5FRO A;  3ZQI A;  2BW3 B;  5GAE J;  1P6R A;  1V3F A;  2R0Q C;  4A2U A;  5FGM A;  2Z99 A;  1DQU A;  1IXR C;  1MBH A;  1Z9C A;  2DA7 A;  3HGY A;  4HYE A;  4II3 A;  1MND A;  1AWC A;  2HDC A;  2NVQ J;  3K4C A;  1DDN A;  1LFU P;  1FBS A;  2ZKZ A;  3HBL A;  4DW6 A;  2L0K A;  4KDP A;  2O3F A;  3M1C A;  4B3X A;  4PK4 A;  1D8J A;  3GTQ J;  4HX7 A;  2X1D A;  4LB5 A;  2WV1 A;  3BCA A;  3ZMV A;  3IWZ A;  1GV2 A;  1B9M A;  1LE8 B;  4KA4 A;  1D0X A;  1MDM A;  2WBM A;  5BS6 A;  3LMM A;  4N9I A;  2KFD A;  3OYB A;  5CVR A;  3KP7 A;  2R7W A;  4YFN F;  1H9T A;  1HKT A;  3E5Q A;  2ID3 A;  2QQA A;  4ZC3 A;  3IUO A;  4WK8 F;  2MG4 A;  3TED A;  4RS8 A;  1SVM A;  3S3O A;  5LBQ A;  4HV5 A;  3RKX A;  4XKC A;  2E1M C;  3WTW C;  3VWB A;  2GOX B;  4DYQ A;  1ZYR F;  4K2E A;  3BTJ A;  4XRS G;  4YEL A;  3W6K B;  5JHF A;  4HNV A;  1WQ2 A;  2BV6 A;  3JRD A;  2R7Z J;  1BA5 A;  2NS8 A;  1Y0N A;  3HOW J;  1ORK A;  1JKO C;  1I6H J;  1TNT A;  1MH3 A;  1BR4 A;  3NAU A;  2R7D A;  3DEW A;  3OWT A;  1FYL A;  4L5I A;  3QP6 A;  1IN8 A;  4D0P A;  1N78 A;  2KL4 A;  5JVG F;  2UXN A;  1H88 C;  3CF5 F;  4OIR F;  4RB2 C;  2XF7 A;  5K7H A;  2VOO A;  4GYI A;  2L7Z A;  3OYE A;  1UMQ A;  2EZH A;  4I0B A;  2VT2 A;  2STT A;  2RNG A;  3QPL A;  3DP7 A;  3F21 A;  4AID A;  3M3Y J;  1SAN A;  3BDD A;  3O3K A;  2GIZ A;  4KIF A;  3A4C A;  3SEZ A;  2VBY A;  2L02 A;  4MIM A;  5FLX Z;  3RSN A;  2ZC2 A;  1ETQ A;  3HSE A;  3HRT A;  2QBY B;  2BXZ A;  5EDN A;  2HYJ A;  5K7Z A;  1MNM C;  4DYC A;  2OJE D;  3GLL A;  4KN4 X;  2RDP A;  4XRF A;  5F0F A;  1TQI A;  1UZC A;  1CGP A;  2BBY A;  2HQN A;  3R61 A;  4BHP A;  5M5X J;  2EFQ A;  2HXO A;  1JJ8 C;  3IP4 B;  1BIB A;  3ONQ A;  4NC7 A;  3S1R J;  2HVR A;  3VYT B;  1KQ8 A;  4P5O A;  1FYM A;  4XLC A;  2ELK A;  4Z2Y A;  4X1E A;  1R5I D;  1WVR A;  2YSR A;  3KYC B;  3CDI A;  3S2H J;  5M3M J;  1VF9 A;  3MKW B;  3V7S A;  3SQN A;  2J5P A;  1MW7 A;  2X48 A;  3COA C;  4PJJ A;  3TOA A;  3PSI A;  1DPR A;  3F3X A;  4LB6 B;  2LBF A;  3TGN A;  1YO5 C;  3BZK A;  2EQR A;  2LY2 A;  1KYW A;  3T0Y A;  3DTI A;  3VOD A;  3CO7 C;  4WWC A;  3ERE D;  1WJC A;  1F36 A;  1WH5 A;  2KZV A;  4EGZ A;  1LFP A;  2XAF A;  3EET A;  3O6B B;  2LLK A;  1LE8 A;  4ASN A;  2GA1 A;  4FCY A;  1HF0 A;  3ZMT A;  2C6Y A;  1DGW Y;  4QWQ A;  5AON A;  2FA5 A;  2ME0 A;  2HOA A;  4Y33 A;  4B3A A;  2HWV A;  5E79 C;  2HYF A;  4A0Y A;  4RBO A;  3G71 I;  4UB6 C;  4UUS A;  2JA5 J;  1HDD C;  1R5G A;  1G3W A;  1IW7 F;  2HQ5 A;  4Y4R A;  1R1U A;  3FIW A;  1WH7 A;  2LY1 A;  3PO2 J;  5KAF C;  1IXC A;  3CME I;  5GPA A;  4XQF A;  1IV6 A;  1XC5 A;  3FIS A;  1ZRD A;  2DXI A;  3WTZ A;  2YX4 A;  1OCT C;  4FE4 A;  5DS9 A;  3A02 A;  2CO5 A;  2K27 A;  1VQL I;  5IT9 Z;  2TCT A;  2XGX A;  3P7N A;  3H1C A;  4FX0 A;  3HG9 A;  2BYV E;  4RM3 A;  1C0W A;  2QQ8 A;  1HQC A;  3T8T A;  1U2W A;  2MLG A;  3CDH A;  2DJI A;  2CGP A;  4D7M A;  3DF8 A;  2VQC A;  4RAG A;  2WAQ A;  2EH3 A;  2CUJ A;  4FX4 A;  1U5T C;  2FJ1 A;  2H94 A;  3TQN A;  2Z33 A;  2CQX A;  1SD5 A;  3QPS A;  1YOV B;  5F6F A;  4ZJZ A;  3H9Q A;  4BKX A;  5HOO A;  3V8K A;  4A3L J;  5B66 C;  2XIG A;  3O2P E;  5LHI A;  1FX7 A;  1VQO I;  2EZL A;  5C4X J;  1TLH B;  1YE9 A;  5KAI C;  4CIC A;  2DTZ A;  1ETY A;  3TOB A;  4EJT A;  3HPG A;  3NEU A;  4G6D A;  4I76 A;  2OAZ A;  3JRI A;  2K9N A;  4HF0 A;  4U7D A;  2K4J A;  2R3S A;  5TRD A;  3C3W A;  2XGD A;  2IBD A;  2ZJR F;  5LGT A;  5K1Y A;  1Y0U A;  4AD9 A;  3RYR A;  3H92 A;  3DFG A;  3K4K A;  4ETS A;  1SEU A;  2HGC A;  4BY1 J;  3B6A A;  4XLE A;  1FIA A;  4HDV A;  1K78 B;  2ZFU A;  2MH9 A;  2QQ9 A;  2MGQ A;  3LSK A;  2VAS A;  3N05 A;  3L9F A;  2VN2 A;  3DU5 A;  1N77 A;  3WTT C;  2VBW A;  4JX5 A;  1RC9 A;  3DEE A;  2FQ4 A;  1SAU A;  1ETV A;  3FMQ A;  4MEX F;  2LKP A;  3KET A;  5CQG A;  2O5R A;  2WB1 A;  2ECC A;  2L9S A;  1K7A A;  1ETK A;  1FOW A;  2BY3 A;  3HOU J;  4BDY A;  2GXG A;  2LP0 A;  1RRJ A;  2O0Y A;  4I7H A;  2HDW A;  2E2I J;  4GDF A;  1B6A A;  4M9Z A;  2PI0 A;  5BNG A;  2IS2 A;  1D5Y A;  3F8B A;  2AS5 F;  3HM5 A;  1W4M A;  3TDZ C;  4R1H A;  3ABK H;  1D1A A;  1VQ6 I;  1QU3 A;  1KU2 A;  4U88 A;  1MJ9 A;  4AUX A;  2GA2 A;  2E1M B;  1LQ1 A;  2PMZ A;  4KMF A;  1PUF B;  2VKV A;  1IN7 A;  3WG7 H;  2QEX I;  2LVS A;  2PMU A;  1LDD A;  1IO2 A;  1O3T A;  3KEY A;  2XB5 A;  2Y69 H;  5FLM J;  2M9H A;  1DP3 A;  4BAC A;  3QP5 A;  3IKV A;  1EF4 A;  3D1N I;  4ZH4 F;  4ZYG A;  4N4N B;  3RZD J;  3S3M A;  4LLN A;  1WZ2 A;  4MFD A;  3E6C C;  2ZNZ A;  3TO9 A;  1DPU A;  4HQE A;  3RKW A;  1E3H A;  3CC7 I;  1NHA A;  4S0H B;  2Z2S B;  3TW6 A;  3D5S C;  4HF1 A;  4C3J J;  1R71 A;  2LR8 A;  5TJJ A;  4N9H A;  2H1L A;  2AQE A;  2VI6 A;  3WE3 A;  1OFC X;  1U0J A;  2KJB A;  2NRA C;  2CJJ A;  1VQ8 I;  1TBX A;  2H6C A;  2DQR A;  1HOM A;  2OBP A;  2XAQ A;  2JPC A;  4RGS A;  3PIO F;  5C4J J;  2E2J J;  4RLF A;  3CTA A;  1T2K A;  1RES A;  1ULY A;  3RPU D;  5ILV A;  3ASN H;  3HOS A;  2O8K A;  1FSH A;  4DOZ A;  1A5J A;  5IOY A;  2Y75 A;  1ETO A;  3BPX A;  3VEP A;  4BBR J;  3BZC A;  1H0M A;  2RKH A;  4I98 B;  4HLX A;  3OR2 C;  1ZQ3 P;  3TBI A;  2W85 A;  3DV8 A;  5BQT A;  5BMZ A;  2WY7 Q;  2F5C A;  2UXX A;  4BJT A;  2F5F A;  2A68 F;  5TIS C;  1NK2 P;  1UEL B;  2L5Q A;  4CUG A;  1W7P A;  3G2B A;  1T56 A;  2LY9 A;  4XLA A;  3F0C A;  2HDD A;  2ZXI A;  3C2B A;  4QTR A;  2CQ7 A;  4BHC A;  2XAJ A;  1VTN C;  3ZQQ A;  2M7A A;  2K4B A;  3BR5 A;  5GAG J;  4RAY A;  2QKL B;  2RVC A;  3QRF F;  3V4G A;  3F23 A;  1HW5 A;  2HOE A;  3K70 C;  2H1K A;  4IHW A;  1OCP A;  1PJR A;  2JN6 A;  2IA1 A;  2V26 A;  2E35 A;  2DN0 A;  5JI6 A;  1R9T J;  2G7U A;  5EZH A;  4BUP A;  3BR6 A;  1XX5 A;  3VYS B;  1O7F A;  2QZ8 A;  4LLG F;  2AQF A;  3OIO A;  3QPT A;  3LST A;  3MWM A;  4GO1 A;  1PVE A;  4I99 C;  4F93 B;  2G0E A;  1D0Y A;  4C30 A;  3F8C A;  3HRS A;  2FE3 A;  3L2V A;  3ZGK A;  3LSG A;  3HEF A;  1XS9 A;  1YQA A;  3LNQ A;  3HSR A;  1U3E M;  1IZ1 A;  3TMO A;  1PP8 F;  1ZAR A;  2IAI A;  3K1P A;  3GYH X;  1ZK8 A;  2VQH A;  1RKW A;  3DXJ F;  1U9O A;  1POG A;  1ZHF A;  2WWY A;  5KNL A;  3HUG B;  3K4J A;  1Y8R B;  1IF1 A;  1OYI A;  3G3Z A;  3R0A A;  2XHK A;  4JX4 A;  4II2 A;  4CDG A;  2KQR A;  3QU3 A;  3J80 Z;  1HW1 A;  1DUX C;  1JKQ C;  1IDY A;  1W1W E;  4OOI A;  4JK1 X;  2KZG A;  1VZ0 A;  1NK3 P;  2PJP A;  3OYJ A;  5DCF A;  1YRN B;  2LTP A;  1B4A A;  4PCQ A;  5EGO A;  4I0A A;  3HC7 A;  3IRR A;  1Y8Q B;  2XSD C;  4AU7 A;  3IH2 A;  1IRZ A;  4M3E A;  4BDZ A;  3FMS A;  1XMX A;  1KZH A;  2V9P A;  1ETX A;  5HVQ C;  1XCV A;  3MFK A;  3AG3 H;  2VON A;  2CW8 A;  5K5Q A;  1G3S A;  1IN6 A;  2GOM A;  2JQ7 A;  1RZ4 A;  3CMM A;  2MSY A;  3SEQ A;  1J5Y A;  3OYC A;  2NOG A;  3I3L A;  4BXX J;  4PSX A;  4B8X A;  2K86 A;  2P5L C;  3TDU C;  1ZG3 A;  2BW3 A;  2FQ3 A;  2EFO A;  5DEQ A;  4CCJ A;  1JE8 A;  4LLL A;  1XTA A;  4M3F A;  4CCO A;  1VQ9 I;  1VQN I;  2DOF A;  2HFH A;  1UHM A;  3EYY A;  1OCZ H;  1LJ9 A;  2HS5 A;  3EUH A;  2KDZ A;  2BXY A;  1KU3 A;  2LFB A;  1XGO A;  4V2G A;  1OCC H;  3CUQ C;  3AG2 H;  3K2Z A;  3M8E A;  4FHT A;  4E7S A;  5D4R A;  1X4O A;  4I02 A;  3WOD F;  4J00 A;  2HEO A;  2QQB A;  2CG4 A;  4LD5 A;  3ZQC A;  1S7E A;  1YIO A;  1EH8 A;  3OYD A;  3ZCO A;  2IGN A;  5IP6 A;  5D5U B;  3S14 J;  1GHC A;  1UG0 A;  2X6Y A;  2L3D A;  3I53 A;  4MO7 A;  3OYG A;  4HBL A;  5BPD A;  2O03 A;  2QSH X;  2JA8 J;  2Q1Z B;  2RQP A;  4RB0 A;  4XM3 A;  2NAZ A;  3JAM K;  1J7K A;  2HR3 A;  1YHQ I;  4BQA A;  4A5M A;  4LFU A;  3KP6 A;  3IH3 A;  1FLI A;  4C2U A;  2X9D A;  1IRF A;  2K02 A;  2VOP A;  2BE5 F;  3RCO A;  3JRH A;  2ESH A;  2ZJ2 A;  3SFI A;  1I50 J;  4XNF A;  4QIW N;  4YIR X;  5FKN A;  3P9C A;  5J8F A;  1R5H A;  5H20 A;  2E2H J;  1HLV A;  1B8I A;  3R0J A;  4XKW A;  1YLF A;  1ZTR A;  4E7K A;  3WHB A;  4HV6 A;  4E7J A;  5HOD A;  1IG7 A;  1QNT A;  1YRN A;  1V54 H;  3LWF A;  1YYV A;  4E70 A;  3A2K A;  5C44 J;  1WJF A;  4XLH A;  1KYZ A;  3MZ8 A;  1T33 A;  4OIO F;  4BAY A;  4ZZD A;  2UWM A;  3G1M A;  2WTE A;  4IX7 A;  2DA5 A;  5K5R A;  1HW2 A;  5AIP A;  2ACJ A;  1HKQ A;  3H9J A;  3HUG A;  2VJ5 A;  3L2Q A;  4EMS A;  2IA2 A;  3L2W A;  1P7J A;  3LSM A;  2F4O B;  2DMT A;  2KRC A;  4IHX A;  2OC6 A;  4C2M J;  1STZ A;  4CCL A;  3AG4 H;  3M8F A;  2JA2 A;  2PFB A;  5DV5 A;  3JW4 A;  4OAY A;  3BR3 A;  2EWN A;  2TRT A;  1W7P B;  4XN3 A;  1T8I A;  4L9V A;  1FIP A;  1X1P A;  4PJN A;  4JQF A;  4KN7 X;  3WGH A;  5M3F J;  5LGN A;  4HG2 A;  1CF7 B;  2VC1 A;  2IRF G;  1W5T A;  2B0L A;  4B1R A;  3OS0 A;  3RJP A;  3HTS B;  1GV5 A;  4HX8 A;  5HS7 A;  4X0G A;  3CO6 C;  1ETW A;  1YX5 A;  2XPU A;  4XIC A;  4PUS A;  1OQY A;  4YRV A;  3TO6 A;  4ZTF A;  2KIM A;  1TW3 A;  3HRM A;  4X6A J;  1GVD A;  3H9G A;  4A0X A;  4BNC A;  1O7L A;  5IOZ A;  4WXC A;  1JGG A;  2LMD A;  3LSJ A;  1J2X A;  1GVJ A;  4NNJ A;  3ESW B;  2DOA A;  2E1N A;  2VJJ A;  3B73 A;  5F04 A;  2CUE A;  4KMU X;  1SFE A;  4RM2 A;  2L7M P;  2VJ4 A;  2K9M A;  4XLP F;  3PQJ A;  2YUS A;  1LEA A;  3K4B A;  5E8G A;  3LL7 A;  3MD2 A;  4PDK A;  1KON A;  3J7A O;  1L0O C;  1QZZ A;  1EV7 A;  2PQ8 A;  3ZRG A;  3FKI J;  2XPW A;  1QHH D;  4F7Z A;  2ELJ A;  2A5W A;  4LOC A;  3BLY A;  3FHZ A;  3GTK J;  2WAE A;  2FBK A;  1TTY A;  1MBE A;  3BQZ A;  3HKZ N;  3I71 A;  3R60 A;  3DLL F;  1IDZ A;  2P0W A;  2ZO4 A;  2VUM J;  4OMY A;  1Y1V J;  3KX2 A;  1QGP A;  2KMU A;  3HZJ A;  4XMY A;  2Z16 A;  3K4M A;  1L3L A;  1R58 A;  1W36 C;  1FP1 D;  5FLX K;  4XID A;  2IP2 A;  4L5E A;  1VQ4 I;  3E5X A;  3LQR A;  4FTH A;  2M30 A;  1OKR A;  5IT9 K;  4G6Q A;  4AC0 A;  4GYG A;  2V6C A;  3MQ0 A;  1JT0 A;  2R7Q A;  4KJZ A;  2KT0 A;  3LA3 A;  2ETH A;  3FM5 A;  4C3H J;  2UUZ A;  2FD5 A;  2DCE A;  2JTV A;  3U1K A;  1BOA A;  2P5K A;  3KZZ A;  1ZR4 A;  2W00 A;  5H6Q A;  2VXD A;  4ZYE A;  2YPR A;  3SFZ A;  4JYK A;  1YFH A;  3OSG A;  2V7F A;  2AO9 A;  4MLO A;  1G59 A;  2NS7 A;  5H2F C;  1YJ9 I;  2LKS A;  4UUV A;  4PJL A;  1JGS A;  1FZP B;  2VOD A;  3DBR B;  2UV1 A;  3V8J A;  2A07 F;  2V6E A;  4E6K G;  4XOT A;  1W36 D;  3VYU B;  3KP5 A;  3S17 J;  2M3A A;  3M1E A;  2CUZ A;  4S05 A;  4UXN A;  3Q0W A;  3H3V K;  1ZH5 A;  4CCN A;  4EJV A;  1SC7 A;  4IHV A;  1P2F A;  2LNB A;  3PNV A;  2HYG D;  3MMY B;  5EEG A;  4IQJ A;  2V9V A;  2DFF A;  2Y2Z A;  4C3I J;  4O3M A;  4QSH A;  2VQL A;  5B1A H;  2MW8 A;  1J75 A;  1GDT A;  4M6X A;  2L9V A;  2H27 A;  4PGG A;  3GUD A;  2W82 A;  4NC6 A;  3IL2 A;  4F55 A;  2F6C A;  2YX7 A;  5B5E C;  1X3W B;  1WCM J;  3ZXS A;  1B1B A;  4WXD A;  5L3B A;  4XLN F;  4DBR A;  3GME A;  2HNH A;  1JKR C;  2FNA A;  2IVM A;  2FOW A;  3PJR A;  3HHG A;  2EA4 A;  1SMY F;  2BY2 A;  2K5C A;  3FXL A;  3BJO A;  2GLO A;  2XB0 X;  5CVU A;  2H09 A;  4BU2 A;  2OZU A;  2KKO A;  3IV5 A;  5DCM B;  4CYD A;  4A3M J;  1Z0X A;  3HRU A;  3M07 A;  5CYV A;  5D5W B;  3TKY A;  2DFH A;  2RN7 A;  1ZGJ A;  3ZMZ A;  3ZN1 A;  3F22 A;  3OSF A;  1Q1H A;  1T38 A;  3KE2 A;  1D3Y A;  5H6R A;  3JTG A;  2HTJ A;  2FRH A;  1YW9 A;  2FBH A;  3IC7 A;  4Q48 A;  4ENN A;  2DMN A;  3CC4 I;  4JP0 A;  3R6S A;  1U8B A;  4UNO A;  1N75 A;  4FE7 A;  3V7C A;  1BW6 A;  2ZCW A;  3BPV A;  4YG2 F;  2JJ7 A;  3GXO A;  2GM4 A;  4PFO A;  3F72 A;  5FFZ A;  1RIO H;  1ZAO A;  3BR0 A;  2OUM A;  4Y3O A;  3OR1 C;  2JSC A;  4IPA A;  2DPU A;  1UST A;  5DUK A;  3J80 K;  1WFX A;  4IQ4 A;  3GF2 A;  2WAQ N;  3K0L A;  3KP4 A;  2A05 A;  2JK3 A;  3CCV I;  5J4V A;  2IS1 A;  1IV8 A;  3DWL E;  4OIQ F;  2XRN A;  1MDM B;  4B4C A;  1AU7 A;  2F5D A;  1MMG A;  2GXA A;  2M0C A;  4IL6 C;  5L3E A;  3HB9 A;  2EFN A;  2CV1 A;  4A69 C;  2CMP A;  4A3D J;  1OR7 C;  3BTC A;  3F8F A;  3CMY A;  2R7S A;  5ED4 A;  5JLW A;  2CFX A;  3S93 A;  1V5E A;  5J8C A;  3LFU A;  4Z6Y A;  5J6X A;  3J81 K;  3ZMD A;  1TWH J;  4AIJ A;  2HPM A;  2X1C A;  1A04 A;  4DYR A;  2PX9 A;  5B3S H;  1BI2 A;  2DQL A;  4L9T A;  4L0Y B;  3HGG A;  5K5O A;  5HDK A;  1OIS A;  4HDU A;  2ZME A;  2L9R A;  1W0T A;  1MGT A;  3Q5F A;  3BR1 A;  1U6G A;  3FM3 A;  3HPH A;  2VIX A;  4ZDO A;  2FML A;  4UV9 A;  2XSJ C;  5D8K B;  2W84 A;  2Q0O A;  2DFI A;  2Z1D A;  1LFB A;  1X3U A;  4G7H F;  2QKM B;  4XOP A;  2CRG A;  4IF4 A;  3BG7 A;  1FP2 A;  2OZ6 A;  2Q8K A;  3MKZ A;  3DKW A;  4FIS A;  4NDL A;  2DLL A;  3FK7 A;  2DA3 A;  3Q9V A;  1T0F C;  3F8N A;  2L01 A;  3PUF A;  5TGT A;  2CYY A;  3CMA I;  3LSR A;  4BE1 A;  2VE9 A;  4RGU A;  3Q0V A;  5DYM A;  4BE2 A;  1BJA A;  2L54 A;  2E19 A;  2EV0 A;  1D1B A;  4XLF A;  3FXO A;  2VKE A;  2WB1 N;  3BG3 A;  2XC7 A;  5LLQ A;  3IKT A;  5LHG A;  3J81 Z;  3CUO A;  2ESN A;  2MLK A;  2HKO A;  2ISY A;  1NH3 A;  2QSF X;  4BXF A;  1HBX G;  1OJL A;  2KIQ A;  2STW A;  3HDD A;  2R7F A;  4RDU A;  5GTI C;  5L3F A;  3A01 B;  5IPA A;  4A3G J;  1FWZ A;  2X1E A;  3OY9 A;  1WHU A;  1MMS A;  4B43 A;  4GXO A;  3UR3 C;  1R22 A;  3BG6 A;  3CJT B;  3RQI A;  3E6D A;  2GAU A;  3RKQ A;  1Z05 A;  2VQG A;  4Y13 A;  2WV0 A;  5EG0 B;  5GTH C;  2XAS A;  4XKV A;  1BIA A;  1WGX A;  2MD0 A;  3QOD A;  4CH7 A;  3WG9 A;  3PFI A;  3OYN A;  1RUN A;  2KRH A;  1K83 J;  1X2N A;  2M5W A;  1T39 A;  4KNY A;  2W25 A;  4B44 A;  4CCM A;  3AFH A;  3L00 A;  1ERD A;  4DZJ A;  3HOX J;  5JLX A;  2QEN A;  3A0B C;  3KZI C;  1SD4 A;  3K69 A;  3M8J A;  4Q4Z F;  1R4M B;  3F6V A;  4BGD A;  2PLY A;  1OMI A;  2K9S A;  3RPU A;  4G7Z F;  2CFO A;  2LBF B;  4AM3 A;  4L9N A;  4EM2 A;  4AWX B;  4MQ9 F;  3H5R A;  2IGM A;  1FBU A;  3JSP A;  1Z77 A;  1J59 A;  3SDG A;  4XRS A;  4A3B J;  1WWX A;  1IGN A;  2FUG 2;  4OAZ A;  2K85 A;  4UVC A;  2DYS H;  3K1N A;  2Z5U A;  5ICF A;  5FD6 A;  3W6J B;  2RNJ A;  4MQV A;  4BS9 A;  4KIS A;  2GQQ A;  3OS1 A;  3WHC A;  2GZW A;  2HOS A;  4CGZ A;  5KCM A;  1FEX A;  4IHT A;  1W7P D;  2ELH A;  3QAH A;  2A6H F;  2O7O A;  4H4K C;  1GLN A;  1IRG A;  4IHY A;  1HXD A;  2HZT A;  5FLV A;  4BJ6 C;  3GFM A;  3PL8 A;  4GCV A;  2J5O A;  3OMY A;  2HQA A;  1U8R A;  3C18 A;  4IZZ A;  1X1B A;  1RET A;  2HOT A;  5LFA A;  2WAD A;  4ZDP A;  1UCR A;  2E60 A;  2RQQ A;  4IJA A;  2TDX A;  1G3Y A;  2DAO A;  2VC0 A;  1BOB A;  3JTH A;  2QVO A;  3CQZ J;  3ELK A;  3LQQ A;  3S1Q J;  4XL9 A;  1S29 A;  3TW7 A;  4EV0 A;  1ITY A;  3ML6 A;  2EFP A;  2LRD A;  3FBI B;  2VPL A;  2R7O A;  3FKJ A;  1YI2 I;  1E0E A;  2OPT A;  2IGO A;  2MC3 A;  4CO8 A;  1X4P A;  1PDN C;  3EUA A;  3KYL A;  3AKZ A;  1RPW A;  1GXP A;  4IRH A;  1K6O A;  5HS8 A;  1EH6 A;  2Y31 A;  4D5F A;  1X58 A;  1ZGA A;  4YEJ A;  1E3O C;  3REO A;  2WY8 Q;  3GCM A;  3ZR8 X;  5D4S A;  3HL2 A;  3MCZ A;  2AXT C;  1QBJ A;  1G3T A;  4E4H A;  4NQW A;  1MNE A;  2V1N A;  1FJL A;  2WAF A;  2EIK H;  5CVI A;  5LGU A;  4WCG A;  2M87 A;  1VQK I;  2PJR B;  3J7A Y;  2GBY A;  1XSV A;  2OQG A;  3KEQ A;  3TP0 A;  2KDO A;  2F48 A;  3CF2 A;  4GFB A;  1R1T A;  5L3D A;  4YFK F;  3A0H C;  2DOD A;  2OQR A;  4IOC F;  3FF5 A;  2MA3 A;  3S32 A;  4LG3 A;  4R79 A;  2CS3 A;  2ZSI B;  2F5E A;  4EJU A;  1MIJ A;  4OIP F;  2O6G E;  4L5J A;  1QVT A;  4A12 A;  1B9N A;  1I6X A;  2PN6 A;  5DUI A;  3M4O J;  2Q2E A;  5ICE A;  4I6Z A;  1H8A C;  3KP2 A;  2O9L A;  5JHU A;  2JWT A;  1EJ9 A;  2DT6 A;  2MBF A;  1IUF A;  2DFE A;  4OIN F;  5CQE A;  3CUQ A;  2F5V A;  1JUP A;  2EK5 A;  4P55 A;  4J19 A;  2V9K A;  2ZB9 A;  3OL4 A; 
#chains in the Genus database with same CATH homology
 1QO0 D;  3LFK A;  1G4D A;  4H0E A;  5FD5 A;  3V8L A;  5F1R A;  3T1B A;  3GFJ A;  2FEZ A;  3GEZ A;  5LHH A;  4UV8 A;  2QLZ A;  3L2C A;  3T5X A;  3GX4 X;  3DEU A;  3WGG A;  2ZME B;  5JFR A;  5D5X B;  4HLY A;  5D6F A;  2P8T A;  3E3V A;  3ECO A;  2GWR A;  2UZK A;  3GZ6 A;  1S7O A;  2FOK A;  3CJN A;  5AIQ A;  1ZLJ A;  3LA7 A;  4YII A;  1HST A;  3KZY A;  4DQ2 A;  1R7J A;  2DO7 A;  1BBY A;  4AVP A;  3T8R A;  4ESF A;  1KU9 A;  4P9F A;  1Z1D A;  5FO5 A;  2D2W A;  3I54 A;  2QWW A;  4ZZL A;  1R00 A;  3HYI A;  4RGR A;  3FXQ A;  3ISP A;  2VBZ A;  1WKM A;  2A6E F;  1F9N A;  2KJC A;  1J9I A;  5JVT A;  3ULQ B;  3MZY A;  4KT5 C;  1BC8 C;  2NYX A;  2P5V A;  1U5T A;  3KLN A;  4I01 A;  5FB2 A;  2P6T A;  4LG0 B;  1R23 A;  3WTU C;  5DD8 A;  5E18 F;  1QPM A;  2EV6 A;  5CVV A;  1T98 A;  1YG2 A;  4A6D A;  3SXY A;  1BI1 A;  1YS7 A;  2OA4 A;  4FT8 A;  4O6J A;  4EM0 B;  3HTU A;  2LDU A;  1SAX A;  4G7O F;  3HIF A;  4ESJ A;  1MZB A;  4CHU A;  4HF2 A;  1Z91 A;  3MEX A;  1LB2 A;  5DCM A;  3GFI A;  2DT5 A;  2OU2 A;  3RTR A;  2IT0 A;  1RUO A;  1XB4 A;  1S7A A;  2FMY A;  1J0R A;  4OMZ A;  1IN5 A;  3E6M A;  4ENJ A;  1XGM A;  1U78 A;  2H6B A;  4WXH A;  2KIF A;  3E6B A;  2A3S A;  1OYW A;  1S6L A;  5L3G A;  2GXB A;  2PMH A;  2G7H A;  4KFC A;  3S2W A;  4LK1 F;  3ECH A;  1XGN A;  5CLS A;  2EA2 A;  2XVC A;  1MD0 A;  2P7V B;  2IPQ X;  4O5V A;  3DPT A;  2JZY A;  4IRG A;  2O61 A;  5JR3 A;  4HZF A;  2E1C A;  3QOP A;  2XAH A;  1K78 A;  1RNL A;  4MTE A;  2Y0M A;  6PAX A;  4A0Z A;  2FXA A;  2RC4 A;  3I64 A;  5A2Q K;  2XRO A;  5HDN A;  1U5T B;  3V7R A;  2FNP A;  2DU9 A;  1BI3 A;  4Q5S F;  1SFU A;  2NS0 A;  1BI0 A;  2QBY A;  1I5Z A;  2CQK A;  1I1G A;  2COM A;  1ZG5 A;  5EEH A;  5L3C A;  3LAJ A;  3IHU A;  3KFW X;  5LEJ A;  5BPI A;  3NRV A;  5E1Z B;  4TV7 A;  5E1W A;  3IWF A;  2M45 A;  3M9A A;  1V4R A;  5ICG A;  1TQM A;  2LF8 A;  2M8E A;  4ESB A;  1OPC A;  2V79 A;  3GFL A;  3WTX C;  1ZRC A;  1FOK A;  3FMR A;  2EJR A;  2ZBK A;  2GIV A;  5CJ9 A;  3VOE A;  4ZYD A;  3I5U A;  2V1D A;  4KIG A;  3RKY A;  1ON2 A;  1WRJ A;  4CZZ A;  4RB3 C;  2D1H A;  2P4W A;  3Q9S A;  3I59 A;  1GXQ A;  4AIH A;  3BJ6 A;  3BOQ A;  3CUQ B;  1USS A;  2WC2 A;  1REP C;  3WU1 B;  1E2X A;  5ICC A;  1P92 A;  5KK1 A;  2JPB A;  2HTS A;  4ENM A;  4EQQ A;  3GVA A;  5E8I A;  1FYK A;  5E17 F;  3WTY C;  2FBI A;  2XV4 S;  4Y15 A;  3KP3 A;  3FWE A;  5D5V B;  5F64 A;  4R8H A;  3ZMU A;  4G9Y A;  4ENK A;  1KQ0 A;  3LAP A;  1BN5 A;  2A61 A;  4IRI A;  2RV8 A;  1K79 A;  3L7W A;  1KA8 A;  4WX9 A;  2ZXJ A;  2KRF A;  2CW0 F;  4HA8 A;  3C7J A;  2MD5 A;  3CLO A;  4IHS A;  1JHH A;  3IRQ A;  4EVI A;  3RIR A;  4BYY A;  1P4X A;  4CXF A;  1LDJ A;  1PP7 U;  4MGR A;  1D5V A;  1YW8 A;  2Y48 A;  3H3Z A;  2O8X A;  4N0B A;  3FX3 A;  4MNU A;  3I4P A;  3N4M A;  4MHG A;  3ZQ7 A;  1G6N A;  4YFX F;  4HAM A;  2F2E A;  3P9K A;  5HDG A;  1F4K A;  1XSX A;  2MH2 A;  4L9J A;  1FT9 A;  3GZ5 A;  3ROU A;  2DW4 A;  3QPH A;  1R1V A;  1QZY A;  4G8X A;  3C1D A;  1ZRE A;  3BRO A;  3WTS C;  3HSF A;  4JBA A;  1O3S A;  4M6Y A;  1XDS A;  2X0L A;  4BXU A;  1P4W A;  3JAM Z;  5LEK A;  4KUM A;  4U0V A;  5E1X A;  3H3U A;  3M7G A;  2BGC A;  4L18 B;  3E97 A;  2G9W A;  1P4A A;  1MJA A;  4U0Y A;  3ZPL A;  1YS6 A;  1HSJ A;  5E20 A;  1Z7U A;  5ILU A;  4G94 A;  4Y17 A;  4M71 A;  1WSU A;  2W57 A;  1MKM A;  1ZN2 A;  2DI3 A;  3R4K A;  3SHF A;  3HHH A;  1FC3 A;  1O3R A;  1Z6T A;  2FSW A;  1ZG1 A;  1SMT A;  3VFZ A;  3BZ6 A;  2XKO A;  2YU3 A;  3AAF A;  2VT3 A;  3GLX A;  1FBQ A;  2EB7 A;  4B09 A;  3EQL F;  4ON0 A;  3I59 B;  5LRS A;  4HW0 A;  2ISZ A;  4IVN A;  3G73 A;  1LNW A;  4KIB A;  1B59 A;  3I0T A;  3WGI A;  1Z6R A;  4M9X A;  1KGS A;  4KIC A;  2HKX A;  1BM9 A;  1XDU A;  2LF7 A;  2A69 F;  3K1M A;  3OV8 A;  3KLO A;  3N97 A;  2P6S A;  3RPQ A;  1I1S A;  2PBI A;  1TQP A;  1R36 A;  4ZYH A;  5D8L B;  3SZT A;  1JHF A;  2CWE A;  2A5Y B;  1FPQ A;  2D1V A;  3NQO A;  1XMK A;  1ONV A;  5IT3 A;  2P7C B;  1YTY A;  2NNN A;  1F5T A;  2Z9O A;  4U7B A;  2V1X A;  1IXS B;  4HX4 A;  5DD4 A;  1IN4 A;  1FNN A;  1YW7 A;  2DK5 A;  2ADU A;  1T6S A;  2Z3Y A;  1KU7 A;  2JRT A;  1SD7 A;  1SFX A;  4YIF A;  4PGH A;  3BJA A;  5D6E A;  2NNY A;  5BOX A;  3ZN0 A;  2JT1 A;  4EM1 A;  3D5L A;  1LDK B;  4UVA A;  4I2O A;  3LA2 A;  1IAW A;  3U1D A;  3FZV A;  1BC7 C;  1UHW A;  3GW2 A;  2K7L A;  3U9G A;  4RB1 A;  3ABU A;  4S04 A;  2EV5 A;  1MJB A;  1RI7 A;  3DQV C;  1JXS A;  1LVA A;  3P9I A;  2V1U A;  2RGV A;  1XGS A;  1IUY A;  2DK8 A;  4XSZ F;  4EGY A;  1QQI A;  2XUB A;  3GWZ A;  3RYP A;  4QLC U;  1H9G A;  3BY6 A;  2PG4 A;  3D0S A;  1O57 A;  3KEO A;  1UB9 A;  1XN7 A;  5KVR A;  3EYI A;  3BWG A;  4MEY F;  3HOT A;  2CSO A;  1SD6 A;  2ZFW A;  4UVB A;  4MTD A;  5HLI A;  4HQM A;  3K9T A;  2VBX A;  4LMY A;  3WE2 A;  4P96 A;  1O3Q A;  2D45 A;  3BP8 A;  2KIU A;  4LGW A;  4I09 A;  1TW2 A;  2XKP A;  3OOP A;  1WI9 A;  2OD5 A;  1F1Z A;  4UHT A;  3EDP A;  3SZP A;  4RAZ A;  4WF2 A;  4EJO A;  3PQK A;  2DPD A;  2XAG A;  2E7W A;  4M9S A;  5HLH A;  3MZH A;  4M74 A;  3L09 A;  4L0Z B;  1FSE A;  5DDG A;  2FF4 A;  3MAJ A;  3VB2 A;  5LRR A;  1LEB A;  1EH7 A;  1DP7 P;  3RDI A;  1ZRF A;  4LJZ F;  3GO5 A;  4LG0 A;  2FU4 A;  2X4H A;  3E5U A;  4BHB A;  2IA0 A;  2QYO A;  1S3J A;  1AOY A;  2M1B A;  2IW5 A;  1XD7 A;  4M72 A;  3RI4 A;  1S8N A;  4U0W A;  1TNS A;  1XCB A;  3KCC A;  3F8M A;  3ABT A;  2W24 A;  2BEO A;  3TO7 A;  2YR2 A;  3DPL C;  3ZMS A;  1XMA A;  4HOB A;  4Q47 A;  1CF7 A;  1T0F A;  2QM3 A;  3WU0 A;  2IJL A;  1HKS A;  3U2R A;  3B02 A;  4BH9 A;  2EFW A;  5HS9 A;  1OR7 A;  1ODD A;  3QU6 A;  3WTV C;  4AIK A;  2AXL A;  2PEX A;  4A6E A;  4KYW A;  2L4M A;  4DNC A;  5A2Q Z;  1E17 A;  1KQ9 A;  4XBF A;  1XSD A;  5HLG A;  4P9U A;  2LSO A;  2L4A A;  4NHJ A;  4A5N A;  4PZJ A;  2DBB A;  4OU0 A;  2QUF A;  5ERI A;  2ZNY A;  4RGX A;  2VXZ A;  3ZP5 A;  5FFX A;  3FXR A;  3I58 A;  2HQR A;  2DTR A;  3FXU A;  1ZLK A;  1FY7 A;  1W5S A;  4IXA A;  4M73 A;  4XSX F;  1PUE E;  1D8K A;  1ON1 A;  1OYY A;  1UFM A;  3JSO A;  4GGG A;  5CVJ A;  2E7X A;  3F6O A;  4EJW A;  1I27 A;  5ILS A;  2VE8 A;  4NB5 A;  4LK0 F;  1P6R A;  1V3F A;  4A2U A;  5FGM A;  2Z99 A;  1IXR C;  1Z9C A;  4HYE A;  1AWC A;  2HDC A;  1DDN A;  1FBS A;  2ZKZ A;  4KDP A;  2O3F A;  1D8J A;  4HX7 A;  4LB5 A;  3ZMV A;  3IWZ A;  1B9M A;  4KA4 A;  1MDM A;  5BS6 A;  4N9I A;  5CVR A;  3KP7 A;  1H9T A;  4YFN F;  1HKT A;  3E5Q A;  2QQA A;  4WK8 F;  4RS8 A;  5LBQ A;  4HV5 A;  3RKX A;  3WTW C;  1ZYR F;  4K2E A;  3W6K B;  1WQ2 A;  2BV6 A;  1TNT A;  1FYL A;  2R7D A;  4L5I A;  3QP6 A;  1IN8 A;  4D0P A;  2UXN A;  4OIR F;  4RB2 C;  2VOO A;  4GYI A;  4I0B A;  2VT2 A;  2STT A;  3DP7 A;  3F21 A;  3BDD A;  3O3K A;  4KIF A;  2VBY A;  2L02 A;  5FLX Z;  3HSE A;  3HRT A;  2QBY B;  4KN4 X;  4XRF A;  2RDP A;  1TQI A;  1CGP A;  2BBY A;  2HQN A;  4BHP A;  3R61 A;  2EFQ A;  1BIB A;  1KQ8 A;  4P5O A;  1FYM A;  4Z2Y A;  2YSR A;  3V7S A;  3SQN A;  2J5P A;  3COA C;  3TOA A;  1DPR A;  3F3X A;  4LB6 B;  3TGN A;  1YO5 C;  1KYW A;  3T0Y A;  3VOD A;  3CO7 C;  4WWC A;  3ERE D;  4EGZ A;  2XAF A;  3EET A;  3O6B B;  4ASN A;  2GA1 A;  3ZMT A;  2C6Y A;  4QWQ A;  5AON A;  2FA5 A;  2HWV A;  2HYF A;  4A0Y A;  1R5G A;  1G3W A;  1IW7 F;  1R1U A;  1IXC A;  1ZRD A;  3WTZ A;  2YX4 A;  2CO5 A;  2K27 A;  5IT9 Z;  2XGX A;  3P7N A;  4FX0 A;  2BYV E;  1C0W A;  1HQC A;  3T8T A;  1U2W A;  2MLG A;  3CDH A;  2CGP A;  3DF8 A;  4FX4 A;  1U5T C;  2H94 A;  3TQN A;  2Z33 A;  1SD5 A;  5F6F A;  5HOO A;  3V8K A;  2XIG A;  3O2P E;  5LHI A;  1FX7 A;  1TLH B;  4CIC A;  3TOB A;  4EJT A;  3NEU A;  4G6D A;  2OAZ A;  4HF0 A;  4U7D A;  2K4J A;  2R3S A;  5TRD A;  3C3W A;  5LGT A;  5K1Y A;  1Y0U A;  4AD9 A;  3RYR A;  3H92 A;  3DFG A;  4ETS A;  2HGC A;  4HDV A;  1K78 B;  2MH9 A;  2QQ9 A;  3L9F A;  2VN2 A;  3WTT C;  2VBW A;  3FMQ A;  4MEX F;  2LKP A;  3KET A;  1K7A A;  2GXG A;  2O0Y A;  4I7H A;  1B6A A;  4M9Z A;  2PI0 A;  3F8B A;  2AS5 F;  1W4M A;  3TDZ C;  4R1H A;  1KU2 A;  4U88 A;  1MJ9 A;  2GA2 A;  1LQ1 A;  4KMF A;  1IN7 A;  2PMU A;  1LDD A;  1O3T A;  3QP5 A;  3IKV A;  4ZH4 F;  4ZYG A;  4LLN A;  3E6C C;  2ZNZ A;  3TO9 A;  1DPU A;  4HQE A;  3RKW A;  1NHA A;  4HF1 A;  5TJJ A;  4N9H A;  3WE3 A;  2KJB A;  2NRA C;  1TBX A;  2H6C A;  2DQR A;  2OBP A;  2XAQ A;  2JPC A;  4RGS A;  1T2K A;  3CTA A;  1ULY A;  5ILV A;  3HOS A;  1FSH A;  2Y75 A;  3BPX A;  3VEP A;  1H0M A;  2RKH A;  4I98 B;  4HLX A;  2W85 A;  3DV8 A;  5BQT A;  5BMZ A;  2F5C A;  2UXX A;  2F5F A;  2A68 F;  1W7P A;  4BHC A;  2XAJ A;  1VTN C;  2K4B A;  4RAY A;  2RVC A;  3QRF F;  3V4G A;  3F23 A;  1HW5 A;  2HOE A;  2IA1 A;  5JI6 A;  2G7U A;  1O7F A;  2QZ8 A;  4LLG F;  4GO1 A;  3QPT A;  3LST A;  3MWM A;  3F8C A;  3HRS A;  2FE3 A;  1YQA A;  3HSR A;  1U3E M;  1IZ1 A;  1PP8 F;  1ZAR A;  3K1P A;  3GYH X;  3DXJ F;  1ZHF A;  2WWY A;  1IF1 A;  1OYI A;  3G3Z A;  3R0A A;  2XHK A;  4CDG A;  1DUX C;  3QU3 A;  3J80 Z;  1HW1 A;  4OOI A;  4JK1 X;  2PJP A;  5DCF A;  1B4A A;  4PCQ A;  4I0A A;  3IRR A;  3FMS A;  5HVQ C;  1XCV A;  3MFK A;  2VON A;  5K5Q A;  1G3S A;  1IN6 A;  1RZ4 A;  1J5Y A;  4B8X A;  2K86 A;  2P5L C;  3TDU C;  1ZG3 A;  2FQ3 A;  2EFO A;  5DEQ A;  1JE8 A;  4LLL A;  2HFH A;  1UHM A;  3EYY A;  1LJ9 A;  2HS5 A;  3EUH A;  1KU3 A;  1XGO A;  3CUQ C;  3K2Z A;  3M8E A;  4FHT A;  5D4R A;  4I02 A;  2HEO A;  3WOD F;  2QQB A;  2CG4 A;  4LD5 A;  1YIO A;  1EH8 A;  5D5U B;  1GHC A;  2L3D A;  3I53 A;  4HBL A;  5BPD A;  2O03 A;  2RQP A;  4RB0 A;  2NAZ A;  3JAM K;  1J7K A;  2HR3 A;  4BQA A;  4A5M A;  4LFU A;  3KP6 A;  1FLI A;  1IRF A;  2K02 A;  2VOP A;  2BE5 F;  2ESH A;  2ZJ2 A;  3P9C A;  5J8F A;  1R5H A;  5H20 A;  3R0J A;  1YLF A;  4HV6 A;  1QNT A;  3LWF A;  1YYV A;  4E70 A;  1KYZ A;  4OIO F;  4BAY A;  4ZZD A;  2UWM A;  2WTE A;  5K5R A;  1HW2 A;  5AIP A;  2ACJ A;  1HKQ A;  3HUG A;  4EMS A;  2IA2 A;  1STZ A;  3M8F A;  2PFB A;  5DV5 A;  3JW4 A;  2EWN A;  1W7P B;  4L9V A;  4JQF A;  4KN7 X;  3WGH A;  5LGN A;  2IRF G;  3HTS B;  2VC1 A;  1CF7 B;  2B0L A;  1W5T A;  3RJP A;  4HX8 A;  5HS7 A;  3CO6 C;  3TO6 A;  2KIM A;  1TW3 A;  3HRM A;  4A0X A;  4BNC A;  1O7L A;  4WXC A;  1J2X A;  1GVJ A;  2E1N A;  3B73 A;  4KMU X;  1SFE A;  4XLP F;  3PQJ A;  1LEA A;  5E8G A;  4PDK A;  3J7A O;  1L0O C;  1QZZ A;  1EV7 A;  2PQ8 A;  4F7Z A;  3FHZ A;  2FBK A;  1TTY A;  3I71 A;  3R60 A;  2ZO4 A;  4OMY A;  1QGP A;  1L3L A;  1R58 A;  1FP1 D;  5FLX K;  2IP2 A;  3E5X A;  3LQR A;  2M30 A;  1OKR A;  5IT9 K;  4G6Q A;  4GYG A;  2V6C A;  3MQ0 A;  3LA3 A;  2ETH A;  3FM5 A;  2JTV A;  1BOA A;  2P5K A;  3KZZ A;  5H6Q A;  4ZYE A;  2YPR A;  3SFZ A;  1YFH A;  4UUV A;  1JGS A;  1FZP B;  2VOD A;  3V8J A;  2A07 F;  3KP5 A;  3M1E A;  4S05 A;  4UXN A;  1ZH5 A;  4EJV A;  1P2F A;  2LNB A;  2HYG D;  5EEG A;  2V9V A;  4O3M A;  1J75 A;  4M6X A;  2H27 A;  4PGG A;  3GUD A;  3IL2 A;  2YX7 A;  1B1B A;  4WXD A;  5L3B A;  4XLN F;  2FNA A;  2IVM A;  3HHG A;  2EA4 A;  1SMY F;  3BJO A;  5CVU A;  2H09 A;  2OZU A;  2KKO A;  5DCM B;  4CYD A;  3HRU A;  5CYV A;  5D5W B;  3TKY A;  2RN7 A;  1ZGJ A;  3ZMZ A;  3ZN1 A;  3F22 A;  1Q1H A;  1T38 A;  3KE2 A;  1D3Y A;  5H6R A;  3JTG A;  2HTJ A;  2FRH A;  4ENN A;  1YW9 A;  2FBH A;  3IC7 A;  4Q48 A;  3R6S A;  4UNO A;  3V7C A;  2ZCW A;  3BPV A;  4YG2 F;  3GXO A;  3F72 A;  5FFZ A;  1RIO H;  1ZAO A;  2JSC A;  4IPA A;  2DPU A;  1UST A;  5DUK A;  3J80 K;  3GF2 A;  3K0L A;  3KP4 A;  4OIQ F;  2XRN A;  1MDM B;  2F5D A;  5L3E A;  2EFN A;  3F8F A;  5ED4 A;  2CFX A;  5J8C A;  5J6X A;  3J81 K;  3ZMD A;  4AIJ A;  1A04 A;  1BI2 A;  2DQL A;  4L9T A;  4L0Y B;  5K5O A;  5HDK A;  4HDU A;  2ZME A;  1MGT A;  3Q5F A;  1U6G A;  3FM3 A;  2FML A;  4UV9 A;  5D8K B;  2W84 A;  2Q0O A;  2DFI A;  1X3U A;  4G7H F;  4IF4 A;  2Q8K A;  1FP2 A;  2OZ6 A;  3DKW A;  2DLL A;  3Q9V A;  3F8N A;  2L01 A;  2CYY A;  2VE9 A;  4RGU A;  5DYM A;  1BJA A;  2L54 A;  2EV0 A;  3IKT A;  5LLQ A;  5LHG A;  3J81 Z;  3CUO A;  2ESN A;  2MLK A;  2HKO A;  2ISY A;  2STW A;  1HBX G;  2R7F A;  5L3F A;  1FWZ A;  4GXO A;  1R22 A;  3E6D A;  2GAU A;  1Z05 A;  4Y13 A;  2WV0 A;  2XAS A;  1BIA A;  3WG9 A;  3PFI A;  1RUN A;  2M5W A;  4KNY A;  1T39 A;  2W25 A;  3L00 A;  2QEN A;  1SD4 A;  3K69 A;  4Q4Z F;  3F6V A;  2PLY A;  1OMI A;  3RPU A;  4G7Z F;  4L9N A;  4EM2 A;  4AWX B;  4MQ9 F;  1FBU A;  3JSP A;  1J59 A;  1WWX A;  4UVC A;  3K1N A;  2Z5U A;  5ICF A;  5FD6 A;  3W6J B;  2RNJ A;  4MQV A;  2GQQ A;  2GZW A;  4CGZ A;  4IHT A;  1W7P D;  2ELH A;  3QAH A;  2A6H F;  1IRG A;  1HXD A;  2HZT A;  3GFM A;  4GCV A;  2J5O A;  1U8R A;  3C18 A;  1UCR A;  4IJA A;  2TDX A;  1G3Y A;  2DAO A;  2VC0 A;  3JTH A;  2QVO A;  3ELK A;  3LQQ A;  1S29 A;  4EV0 A;  3ML6 A;  2EFP A;  2MC3 A;  4CO8 A;  1PDN C;  1GXP A;  4IRH A;  1K6O A;  5HS8 A;  1EH6 A;  1ZGA A;  3REO A;  5D4S A;  3MCZ A;  1QBJ A;  1G3T A;  4NQW A;  5CVI A;  5LGU A;  4WCG A;  2M87 A;  1XSV A;  2OQG A;  3KEQ A;  1R1T A;  5L3D A;  4YFK F;  2OQR A;  3FF5 A;  2MA3 A;  4R79 A;  2F5E A;  4EJU A;  4OIP F;  2O6G E;  4L5J A;  4A12 A;  5DUI A;  1B9N A;  1I6X A;  2PN6 A;  2Q2E A;  5ICE A;  3KP2 A;  5JHU A;  2MBF A;  4OIN F;  3CUQ A;  2EK5 A;  4P55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...