2OD5A

Crystal structure of a putative nucleic acid binding protein (jcvi_pep_1096688149193) from uncultured marine organism at 1.79 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
b'ETESMKTVRIREKIKKFLGDRPRNTAEILEHINSTMRHGTTSQQLGNVLSKDKDIVKVGYIKRSGILSGGYDICEWATRNWVAEHCPEWTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of hypothetical protein (JCVI_PEP_1096688149193) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 1.79 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Dna binding protein
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2od5A00
4L5IA 1O3SA 3ZN0A 3TO7A 1I1GA 4DQ2A 2UXXA 4ON0A 4S04A 1KYWA 3IKVA 1Y0UA 3FZVA 3I59B 1QGPA 3TOBA 3M8FA 4UHTA 1GXQA 4U0YA 1MGTA 3KZZA 2GQQA 1KYZA 3LA7A 5CJ9A 3L2CA 2CWEA 1XMAA 3V7RA 2K4JA 4ESJA 2GZWA 2A69F 4UXNA 3W6JB 2XIGA 3H92A 1F1ZA 2V79A 4ESFA 3GXOA 4G94A 1S3JA 4RAYA 5D6FA 1RZ4A 4L9NA 3WE2A 1K78A 3KETA 1YTYA 1SMTA 1XSVA 1GHCA 2E1CA 1B59A 3WTVC 5L3BA 3VOEA 2VN2A 1SD6A 4B09A 3BZ6A 3TDZC 3W6KB 1MZBA 1R58A 2FXAA 3DPTA 2IJLA 2P5KA 2OQRA 5A2QK 3R0JA 4I01A 2PMUA 1KGSA 3I64A 4KMFA 2DU9A 2QZ8A 1D5VA 4G8XA 4HAMA 4RGXA 3ABUA 4PCQA 1SD5A 5AIPA 2ISYA 3CDHA 1NHAA 3F8FA 2P7VB 3HHGA 3ULQB 1HQCA 5DCMB 2O3FA 1FPQA 3VFZA 2FRHA 2R7DA 1FLIA 3HRSA 3TDUC 2MA3A 2VXZA 4O3MA 5DD4A 4HYEA 1PDNC 3HOSA 3QOPA 1TNTA 1YS7A 1HW1A 5AIQA 3TO9A 2DPUA 3WGGA 1RI7A 4IF4A 1HW2A 1T6SA 4ZZDA 1U8RA 2H6BA 3F21A 1JHFA 1ZGAA 4WCGA 2VC1A 2FF4A 3RI4A 4I7HA 2OZUA 1ZRFA 5K5OA 2WTEA 1XSDA 4XSXF 2KJBA 5J6XA 3ZP5A 2OA4A 3LAJA 2UZKA 2VBXA 4HA8A 2FOKA 3KLNA 2ADUA 4GYIA 2C6YA 5CVIA 3ZMZA 3QAHA 1K6OA 3JW4A 1IN6A 4UV9A 4XBFA 4OIPF 1R22A 3HHHA 2ZXJA 3F22A 1JHHA 2P4WA 1KU9A 4M9ZA 4BH9A 4ZYGA 2OBPA 3SFZA 3EQLF 3B73A 3CO7C 3FXRA 3I59A 4Q5SF 4GO1A 4U0VA 3L09A 1IRGA 1RUOA 1HSTA 3O3KA 1TQPA 1VTNC 2VOPA 3GFMA 3D0SA 5F6FA 4HF0A 3T8RA 1ZYRF 4LLLA 1WRJA 4U7BA 3B02A 2FU4A 1RNLA 3R4KA 1G4DA 4FHTA 4L18B 4R8HA 4WXDA 1H0MA 1QZYA 1OYWA 3K0LA 2Y75A 3V7CA 2NNYA 1QQIA 4RB1A 4ASNA 2EFNA 4N9IA 5BOXA 3C18A 1YW9A 5IT3A 3BY6A 2EWNA 3R0AA 2NAZA 2L02A 1PP7U 5ILUA 2LF7A 4LMYA 2FEZA 2A07F 4I0AA 3F6OA 4U88A 1P4WA 1QNTA 1P4XA 3KFWX 4EMSA 3C3WA 3LAPA 5DCMA 1FP2A 1ZG3A 5EEGA 1MDMA 2VC0A 5ILVA 1XGNA 1O7FA 1U78A 3GFLA 3FMSA 4FX4A 4I2OA 5BPIA 1LJ9A 4LB5A 4ZYDA 2RV8A 4EVIA 1FSEA 2RNJA 1XCBA 1W5TA 3WTZA 5F1RA 2PG4A 1ZRDA 3JSOA 4IHSA 3CO6C 3CUOA 4BAYA 2D1HA 2O61A 3R60A 1GXPA 2P5VA 3KLOA 2UXNA 2DTRA 3M1EA 1BBYA 5E8GA 4MTDA 1WKMA 3BPXA 2D45A 2P8TA 1A04A 3J80Z 2DBBA 4IPAA 5E20A 4EQQA 3BOQA 2ZO4A 2PI0A 2A6HF 3F8MA 4M72A 4AWXB 3FMQA 1SD4A 2M1BA 3ZMTA 2QQAA 3ZPLA 4CGZA 1J75A 5LGNA 3EYYA 1F5TA 2PLYA 3M8EA 4A0XA 4M74A 4E70A 5LRSA 5DYMA 4IRGA 2GXGA 4CHUA 3FM5A 3BJOA 3E6CC 3ROUA 2A6EF 3U1DA 4LB6B 3WTSC 4EJTA 2O8XA 5LEJA 5ICGA 3ZMUA 1PP8F 1ZG5A 1LEBA 4KYWA 1DPUA 1O57A 1FY7A 2NRAC 1K78B 3WTWC 1FT9A 2EV5A 2IA1A 4KA4A 4BHBA 1O3QA 4ESBA 1B9NA 2KKOA 1U5TA 1O3TA 3K9TA 1RUNA 3U2RA 5D4SA 3N97A 5HOOA 2HKXA 4A2UA 2CO5A 5A2QZ 1TBXA 1IN4A 2EV6A 2MC3A 2FQ3A 4UVCA 4IJAA 2YPRA 2OU2A 1ZH5A 4AIJA 3HUGA 3I53A 2J5PA 3TOAA 2OQGA 1QO0D 2NS0A 5IT9K 3LWFA 2KIMA 3CLOA 2LSOA 5DD8A 3I5UA 2HEOA 2O0YA 4RB0A 4IHTA 1QBJA 1HBXG 2IPQX 4OMYA 2DPDA 3F8CA 3HTSB 4L5JA 5E1WA 3K1PA 3ABTA 2ZCWA 2HZTA 4TV7A 5H20A 1XMKA 4A6DA 1B4AA 1BI2A 3Q9VA 5HS7A 4EM1A 5CVUA 1BOAA 1MKMA 2PEXA 2QENA 2YSRA 1R5HA 3RPUA 2Y0MA 1UFMA 3KP7A 4N0BA 1TNSA 3FM3A 1DP7P 3GFIA 4AIHA 3BJAA 1Q1HA 4HX7A 4YIIA 5LRRA 4HV6A 1YW8A 1OKRA 5BS6A 3IL2A 1BC8C 3P9IA 4NHJA 1ZGJA 2A61A 1XN7A 3P7NA 2DQLA 5KVRA 3MFKA 1XGSA 3R61A 3REOA 3U9GA 3GO5A 1WSUA 4EV0A 1IUYA 1FYLA 2XV4S 3K69A 1HKTA 2HYFA 4Q48A 1SFXA 2M45A 4LLNA 3MAJA 1G3TA 1R1TA 3CTAA 2FE3A 3EUHA 1FYKA 3RKYA 5DEQA 1P4AA 1YG2A 2HWVA 5D8LB 1P2FA 1S7AA 5HDGA 2XAQA 3F3XA 1BM9A 2H09A 1T39A 1KU2A 1Z05A 2MBFA 2VE8A 4KIFA 3FXUA 3I71A 3I58A 4A12A 4H0EA 3KP5A 2WC2A 3SXYA 4AD9A 4HDVA 2XKPA 1K79A 2Z3YA 3J81K 1Z91A 4FX0A 3WGIA 3BP8A 4OIQF 1MJBA 5K1YA 4PGGA 2DO7A 4KN4X 4D0PA 1YO5C 4YFKF 3RKXA 1E17A 3BPVA 1MDMB 4Y17A 3FF5A 1EV7A 2K27A 2Z33A 3K2ZA 4JBAA 4KUMA 1R5GA 4ENMA 2EFPA 4UUVA 4P9FA 5E17F 4KT5C 5E18F 1XCVA 4GYGA 3WU0A 2J5OA 2TDXA 2EV0A 3T5XA 2ZNYA 1XSXA 3JTGA 3WTUC 3ZN1A 1LQ1A 3EDPA 3IWFA 4RB3C 4RGRA 4Y13A 1ZN2A 1XGMA 1O7LA 3K1MA 1D8JA 1UCRA 1BI1A 2E1NA 5DV5A 1S7OA 2O03A 3K1NA 3ISPA 4UV8A 2WWYA 1KQ0A 1V4RA 3VODA 3QPHA 2FBHA 2Y48A 2JT1A 4MEXF 2ACJA 1TQIA 2YR2A 1OYIA 5LHHA 1UB9A 1SD7A 2G7HA 2V1DA 2P5LC 2DQRA 2Z99A 3RJPA 2GXBA 4L9TA 2FNAA 2ZKZA 2F5EA 3CUQB 1R1UA 3PQJA 4I0BA 4G7OF 2VE9A 1ULYA 2QUFA 5FLXZ 4Z2YA 5HDNA 4R79A 1FOKA 1L0OC 2ESNA 2JPCA 3GEZA 4PZJA 2W57A 2VBWA 4G7HF 2W24A 5CVJA 5D4RA 3WTYC 3GZ5A 1OPCA 2PMHA 2X4HA 5D5WB 4EM0B 2XAGA 4KN7X 4N9HA 4P55A 2STTA 4WK8F 1U5TB 2CFXA 3ZMVA 5K5RA 3KE2A 2ZMEB 2OD5A 3FMRA 1IN8A 2XRNA 4MGRA 2F5DA 3EYIA 5FFXA 5L3CA 1F4KA 1PUEE 4QWQA 2H27A 3DQVC 2IRFG 5TRDA 2IP2A 2DW4A 1HKSA 3TKYA 1P92A 3PQKA 2CW0F 3KP2A 1YW7A 2JRTA 5FO5A 5IT9Z 2P6TA 3E6MA 1J9IA 2M8EA 1EH7A 4EJUA 3IHUA 2EA2A 1Z6RA 4ZH4F 3HYIA 3LFKA 2YX4A 4OINF 2Q2EA 1FBSA 1BI0A 1MJ9A 4ENNA 2QBYB 2XROA 1GVJA 1E2XA 5BQTA 5DUKA 3RKWA 4CYDA 3FHZA 1REPC 3T1BA 3LSTA 3H3UA 4OIOF 1G6NA 2VOOA 4HLYA 2PJPA 2DI3A 2F5CA 5ILSA 1R00A 4QLCU 2IA0A 2EJRA 4OOIA 4AIKA 1SAXA 4AVPA 2WV0A 2HQNA 2M5WA 1I6XA 4L9JA 1IN7A 2HR3A 1BIBA 5JFRA 1YLFA 2EFQA 2RKHA 2FBKA 4HQEA 5L3EA 4L9VA 3CUQA 4P9UA 4HOBA 4GCVA 3J7AO 3JAMZ 1TLHB 5FLXK 2FA5A 4M6XA 5LLQA 3EETA 5HS9A 4I09A 3WE3A 3RTRA 2H6CA 2BE5F 1G3SA 4IXAA 1V3FA 1USTA 2VBZA 3SZPA 2QLZA 3GUDA 4G7ZF 1ZLKA 5JR3A 4MHGA 3IWZA 2A68F 1R7JA 2QM3A 2W25A 1SFUA 2L54A 2AXLA 1BN5A 3SQNA 4HV5A 1O3RA 5H6RA 1KU7A 1W7PD 1ON2A 1T98A 1XGOA 3RIRA 2ZMEA 2DK5A 2PFBA 3O6BB 1U2WA 5HDKA 3J81Z 1IXRC 3ECHA 3NEUA 4IRIA 3QPTA 5ICFA 2GA2A 5EEHA 5E1ZB 3KP6A 4YG2F 4HQMA 4BHCA 3JSPA 2MLGA 4JQFA 5D5VB 1T2KA 3IRRA 3JTHA 2EFOA 1EH8A 4UVBA 2COMA 4OIRF 2MLKA 5H6QA 2UWMA 1X3UA 2HGCA 3QRFF 3MZYA 5BMZA 3HSFA 1W5SA 1B6AA 2MH2A 1D3YA 3ML6A 4LGWA 3WTXC 1XDUA 4LJZF 2ZFWA 3ELKA 2QBYA 2AS5F 1FWZA 4JK1X 4EGYA 4ZYHA 4PGHA 5L3DA 1ON1A 3BROA 4BNCA 3P9KA 3L9FA 1L3LA 1ZRCA 4HBLA 4MQVA 2GIVA 3FXQA 2NYXA 5HVQC 1Z6TA 2L01A 1TW3A 5LBQA 2V6CA 3F8NA 2JZYA 2GA1A 2ISZA 3NQOA 4YFNF 1R23A 4A5NA 4R1HA 2QWWA 2FNPA 1W7PA 1G3YA 1F9NA 2YU3A 2XHKA 3DV8A 4P5OA 4YFXF 2E7WA 1J0RA 1FNNA 1FSHA 1OYYA 3RYRA 5L3GA 1YYVA 4LLGF 4L0ZB 3BDDA 4RB2C 1HKQA 1J7KA 3D5LA 2HTJA 2QQBA 3JAMK 3DFGA 5CYVA 4EJWA 2E7XA 1G3WA 4HF2A 2ZJ2A 3Q5FA 2EA4A 1B1BA 1YS6A 4RGSA 4HX4A 4XRFA 5D5UB 2XAFA 4CZZA 3E6BA 2A3SA 5TJJA 4DNCA 4KIGA 2ELHA 2IVMA 3GWZA 3BJ6A 1U5TC 3ECOA 4HLXA 5HLHA 1BJAA 3HRUA 4HF1A 3MZHA 2HQRA 1IW7F 4CDGA 3V4GA 4ENKA 2IW5A 4OU0A 1ODDA 2G7UA 5J8CA 3MEXA 3GFJA 4KICA 4KMUX 1ZREA 2HYGD 3BWGA 4XLPF 1IF1A 3COAC 4O5VA 2HOEA 2K7LA 1R1VA 5KK1A 3WODF 3LA2A 2QYOA 1B9MA 5LGUA 3DP7A 3C7JA 2R3SA 3HSRA 1U6GA 5BPDA 3DKWA 1CF7B 4HZFA 3WG9A 5FD5A 3L7WA 4LG0A 5DDGA 5K5QA 4A0ZA 1YFHA 4G9YA 2FSWA 3T8TA 1BIAA 5LHIA 4RAZA 2RC4A 1YIOA 1FX7A 2PQ8A 3G3ZA 1WWXA 5ED4A 1HSJA 3C1DA 5JHUA 3HRMA 2YX7A 1JXSA 1HW5A 1LB2A 2W85A 1TTYA 2EB7A 2MD5A 1LVAA 3E3VA 2JPBA 2D1VA 2CG4A 2P7CB 2VT3A 2R7FA 5ICEA 2K02A 4ETSA 1I1SA 3HRTA 4G6DA 1MJAA 5LGTA 2FMLA 2ZNZA 4EM2A 1H9TA 3QU6A 3TGNA 1IN5A 2STWA 1TQMA 4I02A 2P6SA 4IRHA 3F23A 1LEAA 2OAZA 4CICA 2PN6A 1KU3A 3I54A 5JI6A 1J2XA 2ESHA 2JTVA 1LDDA 2RQPA 2ZBKA 2VONA 2Q8KA 3HOTA 2GAUA 4U0WA 3R6SA 1UHWA 1AOYA 4G6QA 4PDKA 4XLNF 2BYVE 3KZYA 5LHGA 1RIOH 2K86A 1OMIA 2JSCA 5DUIA 4NQWA 3DEUA 3F72A 2A5YB 3V8LA 2HTSA 2MH9A 4LFUA 2DK8A 1AWCA 2DFIA 1MD0A 5L3FA 4LD5A 1I27A 4ENJA 5ICCA 2DAOA 1LDKB 4BYYA 2KIUA 1FZPB 3VEPA 4KDPA 1QPMA 1BC7C 3TO6A 5FFZA 1IZ1A 4HW0A 2V1UA 5J8FA 5JVTA 1T38A 2IA2A 2XUBA 3L00A 4WX9A 3I4PA 2LKPA 2DT5A 1S29A 3GLXA 1ONVA 2BGCA 4K2EA 4CO8A 3KCCA 2L4MA 4S05A 2KRFA 4HX8A 3HIFA 2NNNA 3KP4A 2XAHA 2XKOA 4MQ9F 1W4MA 3PFIA 5FD6A 2CQKA 2HS5A 3F6VA 3NRVA 1IAWA 4M6YA 2IT0A 4OMZA 1IRFA 2X0LA 2L4AA 4YIFA 2BEOA 3M9AA 1XB4A 2F2EA 1ZARA 1UHMA 3DXJF 3H3ZA 1S6LA 1DUXC 4A0YA 1YQAA 1J59A 2XGXA 1CF7A 3DPLC 4O6JA 1STZA 2QQ9A 3E97A 3M7GA 1IXCA 4MEYF 1ZG1A 5HLIA 3KEOA 1I5ZA 1ZHFA 1J5YA 6PAXA 2BBYA 2LNBA 3QP5A 3ERED 2DLLA 2Z9OA 1C0WA 2M87A 1EH6A 3G73A 1P6RA 3FX3A 3LA3A 3V8KA 1D8KA 2O6GE 2F5FA 2LDUA 2PBIA 2Q0OA 2D2WA 2RGVA 2VT2A 3ZMSA 3WGHA 4RGUA 3LQQA 5AONA 4KFCA 3ZQ7A 1FP1D 2XAJA 1HXDA 1DPRA 4NB5A 1R36A 3F8BA 4UVAA 2HFHA 3E6DA 4F7ZA 1LNWA 3QU3A 4LK1F 1W7PB 1OR7A 3DF8A 4RS8A 4M71A 1TW2A 4L0YB 3GX4X 5CVRA 1SFEA 4CXFA 4WWCA 4A5MA 3AAFA 2EK5A 3V7SA 4KNYA 1U3EM 1ZAOA 2RVCA 1Z1DA 2V9VA 3IRQA 2RDPA 2FBIA 4M73A 3ZMDA 3IKTA 1SMYF 5HS8A 5DCFA 1ZLJA 3N4MA 5ERIA 5D8KB 5FGMA 4BHPA 1XD7A 2QVOA 3KP3A 2GWRA 5D5XB 2K4BA 2L3DA 2W84A 1QZZA 2H94A 1KQ9A 1KA8A 3GW2A 3P9CA 4GXOA 4HDUA 3E5UA 1DDNA 1FC3A 3V8JA 3CJNA 1WQ2A 5FB2A 2Z5UA 5CLSA 2KJCA 4U7DA 1LDJA 3I0TA 4EJVA 4M9SA 3WU1B 3FWEA 2KIFA 1FBQA 2ETHA 5LEKA 1IXSB 4ZZLA 1CGPA 2XVCA 2G9WA 4Y15A 2HDCA 1USSA 2B0LA 5CVVA 3S2WA 4P96A 1K7AA 3VB2A 3LQRA 1WI9A 4MNUA 5E8IA 1XDSA 3RPQA 1Z9CA 1T0FA 2V1XA 4XSZF 2M30A 3RDIA 4A6EA 5E1XA 3Q9SA 3HSEA 4WF2A 2CGPA 3IC7A 4LK0F 2VODA 3MWMA 4LG0B 2FMYA 2CSOA 3GZ6A 1FYMA 4Q47A 4I98B 3GF2A 4BXUA 3HTUA 1H9GA 1Z7UA 4UNOA 3GYHX 1KQ8A 4B8XA 5D6EA 3WTTC 4IVNA 4FT8A 4GGGA 5F64A 3O2PE 4KIBA 3SHFA 4WXCA 4ZYEA 4WXHA 1JE8A 3KEQA 2OZ6A 2RN7A 1S8NA 3OOPA 4EGZA 4M9XA 3TQNA 5HLGA 4BQAA 4MTEA 2HKOA 4Q4ZF 3SZTA 1JGSA 2BV6A 2XASA 3MQ0A 3CUQC 2CYYA 3E5QA 3OV8A 4EJOA 2EFWA 3E5XA 3MCZA 2VBYA 3GVAA 3T0YA 3J80K 3RYPA 1FBUA 1BI3A 3QP6A 2LF8A
chains in the Genus database with same CATH superfamily
4L5IA 3G6EI 4HNVA 1RESA 1O3SA 3ZN0A 3TO7A 2LY2A 1I1GA 4DQ2A 1YJNI 1TWFJ 5E79C 2UXXA 2LYCA 1JTYA 4ON0A 5M5YJ 4S04A 1KYWA 4A3JJ 4CA0A 3IKVA 4DOZA 2LKXA 1Y0UA 3ASOH 3FZVA 3ABMH 3I59B 1QGPA 4BQQA 3TOBA 2DA1A 3M8FA 4UHTA 1QA6A 2Q1ZB 1GXQA 3DLLF 4RDUA 1G8XA 4U0YA 5B1BH 1MGTA 3OYFA 3KZZA 3JRCA 2GQQA 1KYZA 1I50J 2DA6A 2VPRA 4FE7A 2WAQA 3LA7A 5CJ9A 5IY5H 3L2CA 2CWEA 1XMAA 3V7RA 3ZQCA 2K4JA 1ZR2A 1V5FA 2X51A 3L2WA 4ESJA 2ZMEC 2ECCA 3PUBA 2GZWA 2A69F 4UXNA 3W6JB 2WY7Q 2XIGA 3H92A 5IYCJ 1F1ZA 2V79A 2NVUB 3GXOA 4G94A 4ESFA 3CF5F 3KZIC 3OSFA 4A3GJ 2W00A 4XM3A 1S3JA 4RAYA 5D6FA 1RZ4A 3IH3A 4JX4A 4L9NA 3WE2A 1K78A 4NDLA 4A3CJ 3LSKA 3KETA 3SFIA 5J3LA 1YTYA 1SMTA 1XSVA 4PJMA 1GHCA 1NK2P 2E1CA 2IGOA 3HDDA 1B59A 2V4JC 1RPWA 5FKKA 3WTVC 2E2JJ 5L3BA 1RR8C 3VOEA 2VN2A 1BW6A 1SD6A 2M0CA 3BZ6A 4B09A 3TDZC 3W6KB 2R7QA 1K4SA 1MZBA 3HGGA 1R58A 2FXAA 1MH3A 2E1MC 3DPTA 2IJLA 2P5KA 1YITI 2OQRA 3W2VA 5A2QK 1D0ZA 1YRNB 3R0JA 4I01A 1MIJA 2PMUA 1EA3A 1KGSA 1OQYA 3MVPA 3I64A 4KMFA 2DU9A 2QZ8A 4YRVA 4G8XA 1D5VA 4HAMA 4RGXA 5F1JA 3ABUA 3HB9A 4PCQA 5FKLA 5M3MJ 1SD5A 2NOJB 5AIPA 2ISYA 3CDHA 2QSFX 1NHAA 3F8FA 1RR7A 2P7VB 3HHGA 3ULQB 2CQNA 1HQCA 4CCLA 5DCMB 5JLWA 5E3MA 2O3FA 1FPQA 3VFZA 3KYCB 2FRHA 2R7DA 1FLIA 3HRSA 2ELJA 3W2AA 3S32A 3TDUC 1Z3XA 2KDOA 2MA3A 3G1OA 4XLCA 3OYHA 2VXZA 1I3AA 2MD0A 4O3MA 4GFBA 5DD4A 5FLVA 2XSJC 4HYEA 1PDNC 3G4SI 3HOSA 3QOPA 1TNTA 1YS7A 1SVOA 2F48A 3EPZA 1HW1A 4J19A 4BXFA 5AIQA 2H8WA 3TO9A 4B3AA 3X2QH 2DPUA 3WGGA 1VQOI 4E4HA 1RI7A 1JKRC 4IF4A 1HW2A 1T6SA 2CW8A 4ZZDA 1LPQA 1U8RA 2H6BA 4XL9A 3F21A 1JHFA 4BY1J 1X2NA 1D5YA 1ITYA 2MFZA 2F4OB 3CC4I 4ABZA 1XTAA 3FK7A 1ZGAA 4RA2A 4WCGA 2VC1A 3TEDA 2FF4A 3RI4A 2OTLI 2WY8Q 3K4NA 4I7HA 2V9PA 2OZUA 1S9HA 1F36A 4FASD 4Z6YA 2WTEA 5K5OA 4A3KJ 1ZRFA 3L2RA 3OWTA 1XSDA 4XSXF 2KJBA 4XRSA 1X3WB 5J6XA 3SZGA 2K9QA 3CMMA 1TWAJ 2K3PA 3ZP5A 2OA4A 2QQ8A 4RAGA 3LAJA 2UZKA 1MNDA 2VBXA 3Q0VA 2NVYJ 4HA8A 2GM4A 2FOKA 1E3PA 3KLNA 3K70D 4II2A 2ADUA 2B9SA 5FLMJ 1Y39A 3FXJA 2KFDA 4GYIA 2C6YA 5CVIA 3ZMZA 4E7KA 1OCOH 3QAHA 1K6OA 3JW4A 1IN6A 4UV9A 4XBFA 1IG7A 4OIPF 1R22A 2HVSA 1UZCA 3HHHA 1OCPA 4ZC3A 2XDVA 5FKNA 1FOYA 2ZXJA 3F22A 5DM7F 4CCMA 1JHHA 1JGGA 1QRYA 1KU9A 1ZELA 2P4WA 4M9ZA 2ECBA 4PSXA 4BH9A 4ZYGA 2OBPA 1TT5B 4D5FA 3FISA 1XPXA 3SFZA 3EQLF 3SYTA 3B73A 3CO7C 4BQOA 3FXRA 3IV5A 3I59A 4Q5SF 4GO1A 4U0VA 1APLC 2W1OA 3L09A 4NC8A 1O4XA 1VFCA 1FJLA 1WJDA 2BHYA 1IRGA 4A3EJ 3ZGKA 1RUOA 5M5WJ 5K7ZA 2QCOA 1HSTA 2Y31A 3O3KA 3PFYA 1ACIA 3OYNA 1TQPA 1VTNC 2VJ5A 2VOPA 3GFMA 3D0SA 2COBA 5F6FA 2HPIA 4HF0A 3Q3SA 1VF9A 3T8RA 1ZYRF 1D0YA 2LVSA 4LLLA 3CCSI 4H4KC 1WRJA 4U7BA 3WU2C 3B02A 1Z3YA 3BTJA 3BTIA 2FU4A 5C3EJ 1RNLA 1R6RA 1X4OA 1Z0XA 1VQKI 3R4KA 1PUFB 4XQFA 1G4DA 2X48A 4FHTA 1FIAA 1W1WE 4L18B 4R8HA 4ZDOA 1TWGJ 4PK4A 2A05A 2VKDA 4I76A 4WXDA 5FKMA 4Y33A 4BDZA 1H0MA 1QZYA 1OYWA 3C2HA 4XR6A 3K7AJ 2LK2A 3U1KA 3K0LA 1TWHJ 2K5CA 1AA7A 2Y75A 3V7CA 2NNYA 1QQIA 2HDDA 4RB1A 4ZYAA 4ASNA 3GTKJ 2EFNA 4N9IA 5BOXA 4XKBA 3M4OJ 2K9LA 3C18A 4HRIA 3GTQJ 1YW9A 1QZEA 5IT3A 2L0KA 3BY6A 2EWNA 3L2VA 3R0AA 4B1RA 2NAZA 2X9DA 2L02A 1PP7U 4BXXJ 3CLQA 5ILUA 1X1DA 2MW8A 1YRNA 2LF7A 4LMYA 2FEZA 4FTHA 3HKZN 2A07F 1TT0A 4I0AA 3F6OA 4UUSB 4U88A 1P4WA 2IS2A 2DDBA 3TW7A 1QNTA 1P4XA 9ANTA 3KFWX 1R49A 4E7SA 4EMSA 3IAM2 2VXDA 3C3WA 2ICWG 3LAPA 5DCMA 2CJJA 1FP2A 1ZG3A 5EEGA 3DWLE 2EIJH 1MDMA 5E3LA 3MKZA 2VC0A 3HUGB 5ILVA 2O9LA 1V54H 2GIZA 2LFBA 1PVEA 1XGNA 1E3OC 1NK3P 1O7FA 2DJIA 1HLVA 1U78A 3J7YJ 1OFCX 3GFLA 5F0HA 3FMSA 4FX4A 4I2OA 2Z1DA 3VYTB 3JRDA 3H9JA 5BPIA 1LJ9A 2BW3A 3P5JA 3LSRA 4B3XA 3OMYA 4LB5A 4ZYDA 1OJLA 2CW7A 2K9NA 2RV8A 2ZB9A 2DMPA 2IEKA 4AM3A 4B47A 1S7EA 1BL0A 4F92B 2I8DA 4PJLA 2EBIA 1SFOJ 3DTIA 4EVIA 4PFPA 4BJ5C 1EKEA 2KQRA 1FSEA 1VQ6I 2RNJA 1Y1WJ 1XCBA 4YIRX 1W5TA 3WTZA 5F1RA 5HODA 3S8PA 2PG4A 3CCLI 1ZRDA 3OR2C 2DOEA 3JSOA 4IHSA 3CO6C 3CUOA 4UB8C 4BAYA 2WB1A 3RZOJ 2D1HA 2O61A 2EPFA 3R60A 3GLLA 2DDAA 3UNGC 1GXPA 2P5VA 3KLOA 2UXNA 2DTRA 3MKWB 2IGKA 3M1EA 4B4CA 1BBYA 1ETKA 1UELB 5E8GA 4MTDA 1WKMA 3BPXA 2D45A 1W36D 5FRNA 2P8TA 3JR9A 3RKQA 2L2OA 1A04A 2JVGA 1VQ7I 3J80Z 4BBRJ 2DBBA 3S2DJ 4IEJA 1MMDA 2BY3A 4IPAA 5E20A 4EQQA 1WHUA 3BOQA 4XRMA 2O5RA 2ZO4A 2Y2ZA 3ABKH 2G0EA 4N4NB 2PI0A 2A6HF 3F8MA 4M72A 3VYRB 4AWXB 1X3ZB 3FMQA 3MKYB 1SD4A 4AIDA 2M1BA 3ZMTA 2QQAA 2R7SA 2E35A 1WJFA 3ZPLA 2KL4A 3FIWA 4CGZA 1JUPA 1J75A 2L5QA 4P1WA 5LGNA 3EYYA 2KT0A 4X6AJ 1F5TA 2PLYA 3M8EA 4A0XA 3QWLA 2GOXB 4AYBN 4M74A 4E70A 2KZGA 1SC7A 3AG3H 4DBQA 5LRSA 5DYMA 4M3GA 2CUJA 2DYSH 4IRGA 2GXGA 4CHUA 3FM5A 3L2UA 1PUFA 3BJOA 1WH5A 3E6CC 3ROUA 2A6EF 2RNGA 3U1DA 3HXLA 2KLOA 3RPUD 2M34A 2V9KA 4LB6B 3WTSC 4EJTA 2O8XA 3KYDB 1I39A 4KITB 4JP0A 2JK3A 3FXKA 4II3A 3FHNA 5LEJA 5ICGA 4IO9F 1T33A 3ZMUA 1PP8F 1ZG5A 1LEBA 5E3OA 3HGYA 3O8HA 3HOXJ 3H0GJ 4KYWA 1O57A 3JRAA 1DPUA 1SVLA 2W82A 3TBIA 2KISA 1FY7A 5F04A 5J1UA 1TL8A 3WTWC 1MW7A 1K78B 2NRAC 1FT9A 2EV5A 2IA1A 4KA4A 4BHBA 1O3QA 1A36A 4ESBA 1B9NA 2KKOA 2Z2SB 4BU2A 3LSGA 1U5TA 4EEFG 1S5LC 1O3TA 3K9TA 4E7LA 1RUNA 2XAUA 2OC6A 4X1EA 2VKHA 3FBNB 3U2RA 4UUSA 1U0JA 5D4SA 3N97A 3C2BA 3A0BC 3DLAA 1SANA 2HKXA 5HOOA 1U8BA 4A2UA 2CO5A 5A2QZ 4D5CA 1TBXA 1IN4A 2EV6A 2HI3A 2MC3A 1V5GA 1T56A 2FQ3A 2UV1A 1YJ9I 2HOSA 2WV1A 4UVCA 3F0CA 5GPCA 1B8IB 4IJAA 2YPRA 3OYCA 2BXYA 2OU2A 1WH7A 3OYLA 4AIJA 5FRMA 1ZH5A 5FKOA 3HUGA 1FTZA 1TZLA 1QHHD 2LREA 3V42A 3I53A 2J5PA 3TOAA 2OQGA 1QO0D 4LG3A 2NS0A 4RMNA 3LWFA 5IT9K 2R93J 3K4BA 2V7FA 2KIMA 3ZOBA 3BTLA 3CLOA 2FX0A 2LSOA 3AG1H 5DD8A 2W48A 1H88C 3I5UA 2DFEA 2O0YA 4RB0A 2HEOA 2XGDA 4IHTA 2HYJA 1HBXG 2IPQX 1QBJA 4OMYA 2DPDA 2Y0SA 2CQXA 2VJJA 3F8CA 3FKIJ 3HTSB 5FROA 2FOWA 4L5JA 5E1WA 3K1PA 3ABTA 2ZCWA 3CD6I 4X0GA 1JTXA 2HZTA 2QEXI 2DXIA 4TV7A 5H20A 1XMKA 4A6DA 4DZPA 4BE0A 1B4AA 3BT9A 4UUTA 2HXOA 1BI2A 3Q9VA 4ZDPA 3A2KA 4IHXA 2R92J 2JQ7A 5HS7A 3PIPF 2CFOA 4EM1A 5CVUA 1BOAA 1MKMA 2NS8A 2PEXA 3HG9A 5CQEA 1OR7C 2QENA 2YSRA 1R5HA 2CQQA 2L9VA 3MMYB 3RPUA 4PJNA 2Y0MA 1UFMA 1DP3A 1WVRA 1FIPA 5J1RA 3KP7A 3F9KA 4N0BA 2JN6A 1RKTA 4MLOA 1TNSA 3FM3A 1DP7P 3GFIA 2OJED 4AIHA 3BJAA 1Q1HA 4HX7A 2KP6A 4YIIA 5LRRA 1WZ2A 4HV6A 1YW8A 3AG4H 4F3QA 1OKRA 5BS6A 1ETXA 1OCRH 5JHFA 3IL2A 2E60A 1WGXA 1BC8C 3IH4A 3P9IA 1WJCA 4NHJA 1ZGJA 3DKYA 2A61A 1E3HA 2LG4A 1XN7A 3P7NA 3GTGJ 4M3EA 2DQLA 1A35A 3NWSA 5KVRA 2HXIA 4DYCA 2F5VA 3MFKA 3CP8A 4BL0B 2M7AA 1VZ0A 3PJRA 1XGSA 3PIOF 3R61A 1HCRA 3EUAA 3REOA 2ME0A 1ETOA 2ZJPF 3U9GA 2AQEA 3GO5A 3CCUI 1WSUA 3HOYJ 3MKLA 4EV0A 3BR5A 3M07A 1T95A 1IUYA 3OYKA 1OISA 2FJ1A 4OAYA 1IJWC 1FYLA 4C9YA 2XV4S 3K69A 1HKTA 2HYFA 2DOAA 4F91B 3ZQLA 3HOZJ 2V1NA 4Q48A 4DJAA 2M4GA 1SFXA 2QF7A 2CMPA 4AUXA 2M45A 4LLNA 3MAJA 3S1NJ 1G3TA 1R1TA 4QPOA 3CTAA 2FE3A 3VYUB 3ONQA 2KDZA 3EUHA 1FYKA 3RKYA 3CJQB 3QYFA 5DEQA 1P4AA 1YG2A 2LMDA 2HWVA 5D8LB 1JUMA 1P2FA 3PNTA 3HZJA 4BGDA 1Y8QB 1S7AA 1A6QA 2RREA 3MZ8A 5HDGA 2XAQA 4DW6A 3GTJJ 3F3XA 1MH4A 4FETA 1BM9A 1GV5A 3H3VK 4IQ4A 2H09A 3I3LA 2Y30A 4HNTA 2KMUA 1T39A 1KU2A 1POGA 1Z05A 2MBFA 2VE8A 4KIFA 3HOWJ 3FXUA 3I71A 3I58A 4A12A 4H0EA 3KP5A 2MYSA 2WC2A 3SXYA 1AKHB 4AD9A 4HDVA 2XKPA 1TC3C 1K79A 4M3BA 2JA2A 2Z3YA 3J81K 1H8AC 2NS7A 3CZ6A 1Z91A 4FX0A 3WGIA 3BP8A 4OIQF 1T0FC 4AC0A 1GV2A 1MJBA 1D0XA 4XLAA 5K1YA 1B8IA 4PGGA 4DGWB 2DO7A 5KNLA 1R5ID 1LE8A 4V2FA 3A1YA 4KN4X 4XMYA 4D0PA 3CESA 1YO5C 2BVLA 3M1CA 3AG2H 4YFKF 3RKXA 1E17A 3BPVA 1XMXA 1MDMB 4Y17A 3FF5A 5EYRA 5J4VA 2LY1A 1EV7A 1K6YA 2K27A 2Z33A 3K2ZA 5B5EC 3TMOA 4JBAA 4KUMA 4IKFA 5C44J 5DS9A 3H5NA 2XSDC 1WCMJ 1Y6IA 1G2HA 1R5GA 4ENMA 2EFPA 2DA3A 4UUVA 4P9FA 3PNYA 2ZC2A 3OYAA 5E17F 2DFFA 4KT5C 5E18F 1XCVA 1R4MB 2HVQA 2BW3B 4GYGA 4XICA 3H5RA 4RAFA 3WU0A 3CDLA 2R7RA 2E19A 2H1LA 2J5OA 4HSTA 2TDXA 1BR4A 4BEHB 1MNEA 2EV0A 2Q2EB 2QSHX 4FCYA 3T5XA 2ZNYA 4EATA 1XSXA 2W7NA 3JTGA 2DMUA 2GXAA 2VJIA 1FMWA 3WTUC 2DA5A 3ZN1A 4PUSA 1LQ1A 3CCRI 1IV6A 3GTPJ 3EDPA 3IWFA 4RB3C 4RGRA 1MMNA 1HDDC 4Y13A 1ZN2A 1XGMA 4PFOA 2Y69H 3S15J 4XKVA 4C2TA 1YOVB 2DA2A 4LIVA 1O7LA 3K1MA 1D8JA 2IS6A 1UCRA 2LKSA 2VQCA 1ERDA 1BI1A 2E1NA 4CZCA 5DV5A 4D7NA 1D1CA 1S7OA 2O03A 1X1AA 2MSYA 1KONA 2CU7A 3K1NA 5LD2C 2ZXIA 4CUGA 1QHGA 4M6VA 1UG0A 2DA4A 3ISPA 4D1QA 4UV8A 3BLYA 1KQ0A 2WWYA 1V4RA 2I5UA 3VODA 3ZXSA 3FXLA 3QPHA 2FBHA 3OYBA 2Y48A 2JT1A 4MEXF 2ACJA 2DYRH 2IGMA 2IS4A 4F52A 1TQIA 2DMTA 2OPTA 2YR2A 4IHYA 1OYIA 3OYIA 5LHHA 1UB9A 1ZK8A 3TL4X 3AL0B 3IH2A 3CCYA 2JA7J 1SD7A 2G7HA 2EQRA 3LL7A 1VQMI 1IDYA 2V1DA 1Y8RB 4ZTJA 2KPMA 4AVZA 5EGOB 2DQRA 2Z99A 2P5LC 3RJPA 2GXBA 4L9TA 2FNAA 2ZKZA 5TGTA 2F5EA 3CUQB 1K83J 1R1UA 4XORA 2JUGA 2L9SA 2HOAA 2XB0X 3OYJA 3I55I 3MN2A 3PQJA 4DZJA 4I0BA 1A5JA 4G7OF 2VE9A 2DA7A 1ULYA 1TP4A 2QUFA 2E2HJ 5FLXZ 3EUHC 4Z2YA 5EG0B 5HDNA 3S2HJ 4R79A 1N75A 3E1SA 5HNFA 4XN0A 1FOKA 1L0OC 2ESNA 2LP0A 4B43A 1HOMA 2JPCA 2M0MA 3W2WA 3GEZA 4PZJA 4Y7NJ 2P81A 3W6VA 5C4JJ 1OCZH 3BR0A 4DYQA 2W57A 1VQNI 2VBWA 2VB6A 3G71I 4G7HF 2W24A 4QSHA 5CVJA 1DQUA 5D4RA 2VKEA 4LOCA 5J1YA 3A0HC 3WTYC 3G2BA 3GZ5A 1OPCA 2PMHA 2X4HA 2O7OA 4CCJA 5D5WB 2JMWA 4EM0B 1VQ8I 1D1BA 2XAGA 3HOUJ 3HPGA 2R5ZB 2WAQN 5J47A 2QA4I 1AKHA 3GTLJ 4KN7X 2HPMA 4N9HA 4P55A 3QYEA 3K4CA 3PSFA 5IYDJ 2STTA 4WK8F 2VQGA 1U5TB 2CFXA 3ZMVA 5K5RA 1WPKA 2ELKA 3KE2A 2ZMEB 2M9HA 4CCOA 1XC5A 3S1QJ 1BOBA 5GTIC 2OD5A 3FMRA 4W1UA 2EIKH 1IN8A 2XRNA 4HG2A 3N05A 4MGRA 2F5DA 1N25A 3EYIA 1FOXA 3DBRB 5FFXA 5L3CA 1F4KA 1PUEE 4NUBA 4QWQA 2H27A 3DQVC 2IRFG 5TRDA 2IP2A 2DW4A 3ZQQA 1HKSA 3TKYA 2LOOA 1P92A 2ID6A 1ENHA 2QKLB 2X1EA 1VQ4I 2QGUA 1JUSA 3H9QA 3PQKA 2ZJQF 1MBEA 2CW0F 3KP2A 2JWTA 1YW7A 2JRTA 5FO5A 3DTEA 3WHCA 5IT9Z 2P6TA 4NNJA 1MBFA 3E6MA 2R0QC 2HQAA 4D9JA 3OIPA 1J9IA 2M8EA 3DTKA 1EH7A 1XG1A 4EJUA 3IHUA 5KHDA 2EA2A 1Z6RA 4ZH4F 2E1OA 3HYIA 3LFKA 2YX4A 2BXZA 4OINF 4FQGA 4BEHA 1YHQI 2Q2EA 4NC6A 1G59A 1DU0A 1FBSA 1BI0A 1MJ9A 3IAS2 5E3NA 1MMSA 3KIOA 3OYMA 4ENNA 2QBYB 2R4GA 2V26A 3SEZA 2PMZA 3K2AA 2XROA 1GVJA 1E2XA 4QPQA 3JREA 3HPHA 1WJ5A 5BQTA 2NVQJ 3K4LA 5DUKA 3RKWA 4CYDA 3FHZA 1REPC 3Q0UA 2VL8A 2DJNA 5KCMA 3T1BA 1X19A 3LSTA 1ETWA 3OS1A 3H3UA 4OIOF 2ZXHA 1G6NA 2VOOA 4HLYA 2PJPA 2DI3A 2VKVA 2F5CA 3ZR8X 5ILSA 1R00A 1LFBA 2ZFUA 3BG9A 4QLCU 5B1AH 2XPVA 2IA0A 2EJRA 4LIUA 5GAGJ 1CQTA 4OOIA 4AIKA 1R9TJ 2L9RA 4MFEA 1SAXA 2IXSA 4AVPA 2WV0A 5EF6A 2HQNA 2M5WA 1I6XA 4L9JA 4XNFA 1IN7A 3AKZA 3OSGA 2HR3A 1X1CA 1BIBA 5JFRA 3CCMI 1I3QJ 1YLFA 1FOWA 2EFQA 4E7HA 2RKHA 2FBKA 2R7UA 4HQEA 5L3EA 4L9VA 5EGOA 2E2IJ 3BR6A 3SJMA 1YX3A 2UUZA 4RLFA 1XX5A 2M7BA 2X6WA 3CUQA 1F43A 4P9UA 4HOBA 4GCVA 2IS1A 2HNHA 3J7AO 2M3AA 2BY2A 3JAMZ 5LFAA 2OTJI 1TLHB 2X6YA 1P7IA 2FA5A 4M6XA 5LLQA 5FLXK 3EETA 5HS9A 5EG0A 5IP6A 2OCCH 4I09A 4RBOA 4XLEA 3WE3A 5BNGA 3RTRA 3C2GA 2GLOA 2NVTJ 2H6CA 2BE5F 1G3SA 4IXAA 4IOAF 3D5RC 1V3FA 1USTA 3HBLA 2VBZA 3SZPA 2QLZA 2E5NA 1SAUA 1VI0A 2F4MB 1RC9A 3E7LA 3GUDA 2E36A 2JRMA 3HEFA 3GZNB 4G7ZF 1ZLKA 4QTRA 5JR3A 4G12A 2XB5A 4MHGA 3IWZA 2A68F 1R7JA 2QM3A 2W25A 1SFUA 1MSEC 4A3IJ 3PO2J 3OS2A 2L54A 4F93B 4XIDA 2M2EA 2AXLA 1BN5A 3I9V2 2IBDA 3SQNA 4IZZA 4HV5A 1O3RA 1U9OA 5H6RA 2R5ZA 1UJ8A 1UMQA 1KU7A 1W7PD 2WA0A 4B48A 1AHDP 1ON2A 4J01A 1T98A 1XGOA 3GBGA 3ZCOA 2MG4A 4NC7A 2EZHA 5EJCA 3RIRA 1YIJI 2ZMEA 2DK5A 2PFBA 1BJZA 3O6BB 1U2WA 5HDKA 1WI3A 2BZTA 1IXRC 3J81Z 3ECHA 3NEUA 3K70C 4IRIA 3QPTA 5ICFA 2VPLA 5EZHA 3G1MA 3ZQHA 2GA2A 4IHVA 4J00A 5EEHA 3CC7I 5E1ZB 3KP6A 4YG2F 1EJ9A 4HQMA 1LE8B 2B7EA 4BHCA 3JSPA 2MLGA 4JQFA 1H89C 3H9GA 5HNHA 4OWRB 5D5VB 3BR3A 4A3MJ 4E7JA 1T2KA 3IRRA 3NWTA 3JTHA 2EFOA 1EH8A 4UVBA 2COMA 1WJAA 2KZVA 1MBGA 3ZRGA 4OIRF 2MLKA 5H6QA 2UWMA 1X3UA 3FKJA 3K4JA 2HGCA 4UB6C 2X6XA 3QRFF 3MZYA 5BMZA 1PYVA 4Y3OA 2YU9J 3HSFA 1W5SA 3LSHA 2F4IA 5J4YA 2QSGX 3LOCA 1B6AA 2MH2A 2M8GX 3ZQIA 1D3YA 2WADA 4MFDA 3ML6A 4LGWA 3WTXC 1XDUA 3HOVJ 4LJZF 2WAFA 3RZDJ 1VQ9I 4JYKA 2ZFWA 3ELKA 2QBYA 3HL2A 3I4NJ 2AS5F 1FWZA 4JK1X 2AXTC 3VDXA 2KRHA 4EGYA 4ZYHA 3PUFA 4PGHA 5L3DA 1ON1A 3BROA 1ZQ3P 3P9KA 4BNCA 1J09A 3L9FA 1NH3A 1RETA 1L3LA 1ZRCA 4HBLA 4MQVA 4C2UA 2VUMJ 1GLNA 4RM2A 2GIVA 3BG5A 4XK4A 3FXQA 2NYXA 1Y1VJ 2R5YB 3FXMA 5HVQC 1Z6TA 3QYBA 2L01A 1X1BA 2L7ZA 1DGWY 3A03A 5EZGA 2O8KA 3OYDA 4A3BJ 1TW3A 5LBQA 2MABA 2V6CA 4AU7A 3L1PA 1UHSA 1JKPC 2TCTA 3F8NA 2B63J 2JZYA 2GA1A 3ERMA 4A3LJ 2ISZA 3NQOA 3FXOA 3AL0C 5JLXA 4YFNF 4D7MA 1R23A 4A5NA 4R1HA 2QWWA 2FNPA 1W7PA 1K61A 1G3YA 1F9NA 2YU3A 2XHKA 3JRHA 4MO7A 2BHZA 3DV8A 4P5OA 4YFXF 2E7WA 1J0RA 1FNNA 1FSHA 1OYYA 3RYRA 5L3GA 1YYVA 4LLGF 3S1MJ 4L0ZB 2WB1N 3H0DA 3BDDA 2OV7A 2DTZA 1K4TA 2ZSIB 4RB2C 1W0TA 1HKQA 1J7KA 5GTHC 2CV1A 3D5LA 2H8RA 2LY9A 3PM1A 2HTJA 2QQBA 3S17J 5DTDA 3JAMK 3EUKL 2EIMH 5M3FJ 1JT6A 3DFGA 4KT6A 1ETVA 5CYVA 2L7KA 4EJWA 2E7XA 4BS9A 1G3WA 5IPAA 3SDGA 3GTOJ 2DMQA 4HF2A 2ZJ2A 3Q5FA 4HNUA 2EA4A 1B1BA 1YS6A 2AQFA 3BCAA 2HQ5A 3OYEA 4E7IA 4RGSA 4B44A 4HX4A 1A6IA 2DT6A 2F6CA 4XRFA 4NQWB 5D5UB 3RCOA 3S3MA 2XAFA 3ESWB 4CZZA 3L2QA 3E6BA 3BZKA 5GP9A 2A3SA 1ZKGA 2Y9ZA 5TJJA 4DNCA 4KIGA 2ELHA 1T08B 3BQZA 2IVMA 3RQ4A 2DFHA 3GWZA 2A6TA 2K9SA 3BJ6A 2E5ZA 2X85A 1AU7A 4A3DJ 1BR1A 2KIQA 1U5TC 2LRDA 3ECOA 3QPLA 3TP0A 2CV0A 4HLXA 5HLHA 1BJAA 1WJBA 3HRUA 4HF1A 1SFKA 3HKZA 1IO2A 3MZHA 3W3CA 1GUUA 3SDBA 2HQRA 3DBHB 1IW7F 3A4CA 3CCVI 1ZTRA 4CDGA 1BR2A 3CJRB 3BR2A 4C3HJ 3LSMA 3V4GA 1B72B 1RKWA 3HC7A 4ENKA 2MC4A 1HF0A 4FE4A 3TP3A 2IW5A 4OU0A 1VQPI 2KHMA 2XGEA 1ODDA 3GCMA 3IP4B 1I6HJ 2G7UA 5J8CA 1QPIA 3MEXA 2EZLA 1P9QC 1W36C 3GFJA 4BJ6C 4KICA 2DOFA 4KMUX 1ZREA 4RM3A 2HYGD 3BR1A 3BWGA 4XONA 4JOMA 3S3NA 1IUFA 4XLPF 2CUFA 1IF1A 3COAC 4U87A 4O5VA 1QU3A 4ZDLA 2HOEA 1HC8A 3VWBA 3OL4A 2K7LA 1VQ5I 2DODA 1R1VA 2CRGA 5KK1A 3LSIA 3WODF 3LA2A 4ZJZA 2E71A 2BY0A 2QYOA 1B9MA 2M4KA 3DKXA 5LGUA 2R7VA 1MSFC 3JRFA 3DP7A 3C7JA 2CUEA 3LMMA 2R3SA 4RLQA 3HSRA 1U6GA 2L7FP 5BPDA 3DKWA 1CF7B 4HZFA 3WG9A 5FD5A 1Z21A 1Z77A 3L7WA 5FJ8J 4JX6A 3A01B 3OS0A 2EH3A 4LG0A 5DDGA 5K5QA 4A0ZA 1YFHA 3SEQA 3UR3C 2V6EA 4G9YA 5DM6F 2NOGA 4JX5A 1ETYA 2FSWA 4W97A 1N77A 3T8TA 1HA8A 3QPSA 2CUZA 2PX9A 3FK6A 1BIAA 5LHIA 4IX7A 2JA8J 4RAZA 2RC4A 1E0EA 2LR8A 1YIOA 1FX7A 1YE9A 1OCCH 3NARA 2PQ8A 4XLFA 2R5YA 2W4SA 5IP9J 3G3ZA 1WWXA 4CCKA 5ED4A 1HSJA 2IAIA 3PSIA 3C1DA 5JHUA 3UKGA 4ANJA 5F27A 3HRMA 2YX7A 1S72I 1JXSA 3CCEI 2Y0SN 1HW5A 1LB2A 4I99C 1JKOC 4FISA 2W85A 1TTYA 2EB7A 2MD5A 1LVAA 3E3VA 1VQLI 2XF7A 2JPBA 2D1VA 1V5EA 4PSWA 1ETQA 2CG4A 2P7CB 2VT3A 2R7FA 5ICEA 4KJZA 2K02A 4ETSA 2ZXWH 1I1SA 4E6KG 3HRTA 4G6DA 1MJAA 5LGTA 2FMLA 2ZNZA 2JSPA 4EM2A 3FBIB 1MNMC 4IL6C 1H9TA 3QU6A 3TGNA 1YX5A 2LBFB 2QKMB 1IN5A 2STWA 1TQMA 4N4OB 3FDYA 4I02A 2P6SA 3DEEA 4IRHA 1LEAA 2OAZA 4CICA 3F23A 1JKQC 1YI2I 2PN6A 5F0CA 1T8IA 1OLTA 1KU3A 3I54A 3OL3A 2LD5A 4AYBA 3Q0WA 2BVMA 5JI6A 2D5VA 3VPRA 3LSJA 3CMAI 4S0HB 1J2XA 4G6TB 1Z7LA 2ESHA 3PNVA 1BW5A 2JTVA 2YS9A 1LDDA 1XS9A 2RQPA 3H5AA 1Z67A 2ZBKA 2VONA 2R7XA 2Q8KA 3HOTA 2MGQA 4YELA 2GAUA 4U0WA 4YEJA 3R6SA 3WG7H 1UHWA 1AOYA 4G6QA 3IUOA 5B3SH 5GADJ 4PDKA 4XLNF 2BYVE 3KZYA 5LHGA 3ZQGA 2K86A 1OMIA 4E7ZA 1RIOH 2JSCA 5DUIA 4NQWA 3DEUA 3JRGA 2L7MP 3F72A 2A5YB 3V8LA 2HTSA 3RQIA 1NTCA 5GAHJ 2MH9A 4LFUA 2DK8A 1AWCA 2DFIA 3GMEA 1MD0A 5L3FA 4LD5A 1FEXA 1I27A 4C3IJ 5ICCA 2DAOA 4ENJA 1MMAA 3PL8A 1LDKB 2JJ7A 3CP2A 4BYYA 5GAEJ 1JT0A 2KIUA 1FZPB 3VEPA 3S14J 1YJWI 4KDPA 3M8JA 3RSNA 4HSRA 1QPMA 1BC7C 3TO6A 5FFZA 1IZ1A 4HW0A 2V1UA 5J8FA 5JVTA 1T38A 2IA2A 1IRZA 2E34A 2DN0A 2XUBA 2CV2A 3L00A 2K9MA 4PJ0C 1B72A 1W5CC 2XF6A 4WX9A 3I4PA 1LFUP 2LKPA 2DT5A 1S29A 3OY9A 2CS3A 3GLXA 1ONVA 5IYBJ 2BGCA 4K2EA 4CO8A 2VLAA 2GBYA 3KCCA 1D1AA 2L4MA 3K4KA 4S05A 1LFPA 1Y56A 2KRFA 2FUG2 4HX8A 3HIFA 2R7ZJ 3S3OA 1DU6A 2A5WA 2NNNA 3KP4A 2XAHA 3WHBA 4A93J 1OCTC 2XKOA 2DT7B 3CC2I 2X6OA 1HDPA 4MQ9F 4CYCB 2EINH 2DCEA 1W4MA 3A02A 3OIQA 3H1CA 3PFIA 4UY8I 3LNQA 2VQLA 4GDFA 3DU5A 5FD6A 2CQKA 2HS5A 3JCUC 2FQ4A 2XRLA 3F6VA 3NRVA 3VSLA 1IAWA 4M6YA 1LUJB 3G1LA 2IT0A 4OMZA 5J40A 1IRFA 2X0LA 2L4AA 3QOEA 4YIFA 3OOUA 2BEOA 3BCBA 3M9AA 1XB4A 2F2EA 3HM5A 5EEAA 1ZARA 1UHMA 2GOMA 3DXJF 4A69C 3H3ZA 1S6LA 1DUXC 2E1MB 1YQAA 3H35A 4A0YA 4F55A 3CCJI 1J59A 2XGXA 2VI6A 1CF7A 2KRCA 3DPLC 4O6JA 3A01A 1STZA 2QQ9A 1NG6A 3E97A 3M7GA 1IXCA 4MEYF 1QVUA 4DIQA 5HLIA 3KEOA 1ZG1A 1I5ZA 1ZHFA 1J5YA 2EZIA 5GPAA 3LSPA 6PAXA 2BBYA 2LNBA 3QP5A 4I6ZA 3CF2A 3K10A 1LVKA 3ERED 2DLLA 2Z9OA 1C0WA 2M87A 1EH6A 3G73A 1P6RA 2JUCA 3BQYA 3FX3A 3LA3A 3S93A 2HU9A 3VYSB 3MD2A 2ID3A 1D8KA 3V8KA 3JRBA 4CSWA 2H1KA 2O6GE 5CKTA 2F5FA 2LDUA 2PBIA 2Q0OA 2D2WA 3H36A 5IOYA 4QIWN 2PJRB 5B66C 2YUSA 2RGVA 2VT2A 4MIMA 4A3FJ 3ZMSA 3WGHA 4RGUA 5K7HA 3LQQA 2AHQA 1A31A 2HOTA 5AONA 3DPUA 1GDTA 4KFCA 3ZQ7A 3S16J 1FP1D 4M3FA 1X1PA 2XAJA 4BE2A 2TRTA 3J7AY 1FTTA 3ABLH 2K40A 1JJ6C 2VQHA 1HXDA 1DPRA 4NB5A 2P0WA 4BQNA 1GT0C 1R36A 3OIOA 3J7ZI 3CDIA 3F8BA 1MBHA 4UVAA 3ASNH 2HFHA 1P7JA 3BG7A 3E6DA 2LBFA 4F7ZA 1LNWA 3QU3A 4LK1F 1W7PB 1OR7A 1U9NA 5F0FA 2R7OA 4KISA 3DF8A 5IP7J 4RS8A 1ZR4A 4M71A 4XN3A 1TW2A 1V55H 4L0YB 3GX4X 1IV8A 5CVRA 1SFEA 2JVHA 4CXFA 3DCFA 3PO3J 1Y0NA 3BZCA 4WWCA 1R4NB 1VNDA 5HLTA 4A5MA 1ORKA 3TW6A 3AAFA 2EK5A 3V7SA 3OYGA 2ZSHB 4KNYA 2DMNA 1ZAOA 2IGNA 1U3EM 2RVCA 1Z1DA 1PJRA 2V9VA 3IRQA 1UG2A 2RDPA 4BJTA 3QODA 1WFXA 2FBIA 4M73A 1FMVA 3ZMDA 3B6AA 3IKTA 3DBLB 2Y9YA 1SMYF 2EILH 4ITVA 5HS8A 2K3FA 5DCFA 1KZHA 2JA5J 1ZLJA 3N4MA 4L5EA 5ERIA 3BTCA 5D8KB 5FGMA 4BACA 4BHPA 1N78A 5EDNA 2LC2A 3KX2A 1XD7A 4BUPA 2QVOA 1MBKA 3KP3A 2GWRA 2LH9A 2NXNB 5D5XB 2K4BA 3O8GA 5KAIC 5H2FC 2L3DA 5JVGF 2OCEA 2W84A 2VJ4A 4IOCF 1QZZA 2H94A 1KQ9A 1KA8A 1MBJA 3BG3A 3GW2A 4XOPA 3CMEI 1JJ8C 3P9CA 4GRIA 4GXOA 4HDUA 4IHWA 3E5UA 1DDNA 5IOZA 1FC3A 3V8JA 3ZQFA 3CJNA 5M5XJ 3D1NI 1WQ2A 5FB2A 1X2MA 2Z5UA 5CLSA 3CJTB 4XRSG 2KJCA 3U21A 1TWCJ 4U7DA 1LDJA 3I0TA 4EJVA 4BE1A 1BA5A 4M9SA 3WU1B 3FWEA 2Z16A 2KIFA 1FBQA 2ETHA 1UAAA 5LEKA 2WAEA 2AO9A 1IXSB 1EF4A 1RRJA 3B6CA 4CYCA 4ZZLA 4ZTFA 2R7TA 1WJEA 1CGPA 2XPUA 2XVCA 2HDWA 3OR1C 3CCQI 3NAUA 4V19K 2G9WA 4Y15A 4IQJA 2HDCA 1USSA 2B0LA 2CH0A 1DGRM 5CVVA 2CQ7A 2X1DA 4DBRA 3S2WA 3GTMJ 2EZKA 4P96A 1Q1VA 4M3DA 1K7AA 1X58A 2ZJRF 4Y52J 3BG6A 3VB2A 5KAFC 3LQRA 1WI9A 3AFHA 4MNUA 5E8IA 1XDSA 3RPQA 3CQZJ 1Z9CA 1T0FA 2HZDA 2OF7A 1W0UA 4BKXA 4BBSJ 3VSKA 4XKCA 2V1XA 1JI8A 4XSZF 2M30A 1IC8A 3RDIA 4A6EA 3D5SC 5E1XA 3Q9SA 3HSEA 2I10A 4WF2A 5F08A 2CGPA 2XC7A 3IC7A 4LK0F 1M1EB 2RQQA 2VASA 2XF5A 2XGCA 5CPRB 3E0JB 4CCNA 2VODA 3LFUA 4PJJA 2K85A 2N8GA 3MWMA 3I56I 3K4MA 4LG0B 2FMYA 3KPHA 2CSOA 3GZ6A 1FYMA 4Q47A 4I98B 3GF2A 3KYLA 2XPWA 4BXUA 3HTUA 1H9GA 4HPQA 1LKXA 1Z7UA 1GVDA 4UNOA 2RAEA 3GYHX 1KQ8A 1IRXA 4B8XA 2PJRA 4V2GA 5D6EA 3WTTC 2NVXJ 3HJEA 5CQGA 4IVNA 3KEYA 4FT8A 1MMGA 2R7WA 3I4MJ 4DYRA 4GGGA 5F64A 3O2PE 4XOTA 2LLKA 4KIBA 4OAZA 3SHFA 2L9NA 4WXCA 4ZYEA 4WXHA 1JE8A 3KEQA 4Y4RA 2OZ6A 4BY7J 2RN7A 5TISC 1IGNA 1S8NA 4BDYA 2BOLA 3OOPA 4EGZA 4M9XA 3TQNA 1SVMA 2LTPA 3BC8A 1ZGWA 2ME6A 3QQAA 4HEA2 5HLGA 3CMYA 2OUMA 1IDZA 4C30A 4MTEA 4BQAA 3DEWA 2VIXA 3JRIA 1QVTA 4XLHA 2HKOA 1NG7A 2PMZN 4Q4ZF 3SZTA 1JGSA 2BY1A 4CH7A 3S1RJ 2BV6A 4C2MJ 2XASA 5C4XJ 4C3JJ 3MQ0A 3CUQC 2CYYA 5K7FA 2WBMA 3E5QA 3OV8A 4EJOA 2HVRA 2EFWA 3DU6A 3E5XA 3K6GA 4NBQA 3MCZA 1X4PA 2JA6J 2FD5A 3M3YJ 2VBYA 3GVAA 3T0YA 2X1CA 3J80K 1SEUA 3RYPA 1FBUA 1BI3A 3QP6A 1R71A 2LF8A 4XKWA 4LITA
chains in the Genus database with same CATH topology
4L5IA 1O3SA 3ZN0A 3TO7A 1I1GA 4DQ2A 2UXXA 4ON0A 4S04A 1KYWA 3IKVA 1Y0UA 3FZVA 3I59B 1QGPA 3TOBA 3M8FA 4UHTA 1GXQA 4U0YA 1MGTA 3KZZA 2GQQA 1KYZA 3LA7A 5CJ9A 3L2CA 2CWEA 1XMAA 3V7RA 2K4JA 4ESJA 2GZWA 2A69F 4UXNA 3W6JB 2XIGA 3H92A 1F1ZA 2V79A 4ESFA 3GXOA 4G94A 1S3JA 4RAYA 5D6FA 1RZ4A 4L9NA 3WE2A 1K78A 3KETA 1YTYA 1SMTA 1XSVA 1GHCA 2E1CA 1B59A 3WTVC 5L3BA 3VOEA 2VN2A 1SD6A 4B09A 3BZ6A 3TDZC 3W6KB 1MZBA 1R58A 2FXAA 3DPTA 2IJLA 2P5KA 2OQRA 5A2QK 3R0JA 4I01A 2PMUA 1KGSA 3I64A 4KMFA 2DU9A 2QZ8A 1D5VA 4G8XA 4HAMA 4RGXA 3ABUA 4PCQA 1SD5A 5AIPA 2ISYA 3CDHA 1NHAA 3F8FA 2P7VB 3HHGA 3ULQB 1HQCA 5DCMB 2O3FA 1FPQA 3VFZA 2FRHA 2R7DA 1FLIA 3HRSA 3TDUC 2MA3A 2VXZA 4O3MA 5DD4A 4HYEA 1PDNC 3HOSA 3QOPA 1TNTA 1YS7A 1HW1A 5AIQA 3TO9A 2DPUA 3WGGA 1RI7A 4IF4A 1HW2A 1T6SA 4ZZDA 1U8RA 2H6BA 3F21A 1JHFA 1ZGAA 4WCGA 2VC1A 2FF4A 3RI4A 4I7HA 2OZUA 1ZRFA 5K5OA 2WTEA 1XSDA 4XSXF 2KJBA 5J6XA 3ZP5A 2OA4A 3LAJA 2UZKA 2VBXA 4HA8A 2FOKA 3KLNA 2ADUA 4GYIA 2C6YA 5CVIA 3ZMZA 3QAHA 1K6OA 3JW4A 1IN6A 4UV9A 4XBFA 4OIPF 1R22A 3HHHA 2ZXJA 3F22A 1JHHA 2P4WA 1KU9A 4M9ZA 4BH9A 4ZYGA 2OBPA 3SFZA 3EQLF 3B73A 3CO7C 3FXRA 3I59A 4Q5SF 4GO1A 4U0VA 3L09A 1IRGA 1RUOA 1HSTA 3O3KA 1TQPA 1VTNC 2VOPA 3GFMA 3D0SA 5F6FA 4HF0A 3T8RA 1ZYRF 4LLLA 1WRJA 4U7BA 3B02A 2FU4A 1RNLA 3R4KA 1G4DA 4FHTA 4L18B 4R8HA 4WXDA 1H0MA 1QZYA 1OYWA 3K0LA 2Y75A 3V7CA 2NNYA 1QQIA 4RB1A 4ASNA 2EFNA 4N9IA 5BOXA 3C18A 1YW9A 5IT3A 3BY6A 2EWNA 3R0AA 2NAZA 2L02A 1PP7U 5ILUA 2LF7A 4LMYA 2FEZA 2A07F 4I0AA 3F6OA 4U88A 1P4WA 1QNTA 1P4XA 3KFWX 4EMSA 3C3WA 3LAPA 5DCMA 1FP2A 1ZG3A 5EEGA 1MDMA 2VC0A 5ILVA 1XGNA 1O7FA 1U78A 3GFLA 3FMSA 4FX4A 4I2OA 5BPIA 1LJ9A 4LB5A 4ZYDA 2RV8A 4EVIA 1FSEA 2RNJA 1XCBA 1W5TA 3WTZA 5F1RA 2PG4A 1ZRDA 3JSOA 4IHSA 3CO6C 3CUOA 4BAYA 2D1HA 2O61A 3R60A 1GXPA 2P5VA 3KLOA 2UXNA 2DTRA 3M1EA 1BBYA 5E8GA 4MTDA 1WKMA 3BPXA 2D45A 2P8TA 1A04A 3J80Z 2DBBA 4IPAA 5E20A 4EQQA 3BOQA 2ZO4A 2PI0A 2A6HF 3F8MA 4M72A 4AWXB 3FMQA 1SD4A 2M1BA 3ZMTA 2QQAA 3ZPLA 4CGZA 1J75A 5LGNA 3EYYA 1F5TA 2PLYA 3M8EA 4A0XA 4M74A 4E70A 5LRSA 5DYMA 4IRGA 2GXGA 4CHUA 3FM5A 3BJOA 3E6CC 3ROUA 2A6EF 3U1DA 4LB6B 3WTSC 4EJTA 2O8XA 5LEJA 5ICGA 3ZMUA 1PP8F 1ZG5A 1LEBA 4KYWA 1DPUA 1O57A 1FY7A 2NRAC 1K78B 3WTWC 1FT9A 2EV5A 2IA1A 4KA4A 4BHBA 1O3QA 4ESBA 1B9NA 2KKOA 1U5TA 1O3TA 3K9TA 1RUNA 3U2RA 5D4SA 3N97A 5HOOA 2HKXA 4A2UA 2CO5A 5A2QZ 1TBXA 1IN4A 2EV6A 2MC3A 2FQ3A 4UVCA 4IJAA 2YPRA 2OU2A 1ZH5A 4AIJA 3HUGA 3I53A 2J5PA 3TOAA 2OQGA 1QO0D 2NS0A 5IT9K 3LWFA 2KIMA 3CLOA 2LSOA 5DD8A 3I5UA 2HEOA 2O0YA 4RB0A 4IHTA 1QBJA 1HBXG 2IPQX 4OMYA 2DPDA 3F8CA 3HTSB 4L5JA 5E1WA 3K1PA 3ABTA 2ZCWA 2HZTA 4TV7A 5H20A 1XMKA 4A6DA 1B4AA 1BI2A 3Q9VA 5HS7A 4EM1A 5CVUA 1BOAA 1MKMA 2PEXA 2QENA 2YSRA 1R5HA 3RPUA 2Y0MA 1UFMA 3KP7A 4N0BA 1TNSA 3FM3A 1DP7P 3GFIA 4AIHA 3BJAA 1Q1HA 4HX7A 4YIIA 5LRRA 4HV6A 1YW8A 1OKRA 5BS6A 3IL2A 1BC8C 3P9IA 4NHJA 1ZGJA 2A61A 1XN7A 3P7NA 2DQLA 5KVRA 3MFKA 1XGSA 3R61A 3REOA 3U9GA 3GO5A 1WSUA 4EV0A 1IUYA 1FYLA 2XV4S 3K69A 1HKTA 2HYFA 4Q48A 1SFXA 2M45A 4LLNA 3MAJA 1G3TA 1R1TA 3CTAA 2FE3A 3EUHA 1FYKA 3RKYA 5DEQA 1P4AA 1YG2A 2HWVA 5D8LB 1P2FA 1S7AA 5HDGA 2XAQA 3F3XA 1BM9A 2H09A 1T39A 1KU2A 1Z05A 2MBFA 2VE8A 4KIFA 3FXUA 3I71A 3I58A 4A12A 4H0EA 3KP5A 2WC2A 3SXYA 4AD9A 4HDVA 2XKPA 1K79A 2Z3YA 3J81K 1Z91A 4FX0A 3WGIA 3BP8A 4OIQF 1MJBA 5K1YA 4PGGA 2DO7A 4KN4X 4D0PA 1YO5C 4YFKF 3RKXA 1E17A 3BPVA 1MDMB 4Y17A 3FF5A 1EV7A 2K27A 2Z33A 3K2ZA 4JBAA 4KUMA 1R5GA 4ENMA 2EFPA 4UUVA 4P9FA 5E17F 4KT5C 5E18F 1XCVA 4GYGA 3WU0A 2J5OA 2TDXA 2EV0A 3T5XA 2ZNYA 1XSXA 3JTGA 3WTUC 3ZN1A 1LQ1A 3EDPA 3IWFA 4RB3C 4RGRA 4Y13A 1ZN2A 1XGMA 1O7LA 3K1MA 1D8JA 1UCRA 1BI1A 2E1NA 5DV5A 1S7OA 2O03A 3K1NA 3ISPA 4UV8A 2WWYA 1KQ0A 1V4RA 3VODA 3QPHA 2FBHA 2Y48A 2JT1A 4MEXF 2ACJA 1TQIA 2YR2A 1OYIA 5LHHA 1UB9A 1SD7A 2G7HA 2V1DA 2P5LC 2DQRA 2Z99A 3RJPA 2GXBA 4L9TA 2FNAA 2ZKZA 2F5EA 3CUQB 1R1UA 3PQJA 4I0BA 4G7OF 2VE9A 1ULYA 2QUFA 5FLXZ 4Z2YA 5HDNA 4R79A 1FOKA 1L0OC 2ESNA 2JPCA 3GEZA 4PZJA 2W57A 2VBWA 4G7HF 2W24A 5CVJA 5D4RA 3WTYC 3GZ5A 1OPCA 2PMHA 2X4HA 5D5WB 4EM0B 2XAGA 4KN7X 4N9HA 4P55A 2STTA 4WK8F 1U5TB 2CFXA 3ZMVA 5K5RA 3KE2A 2ZMEB 2OD5A 3FMRA 1IN8A 2XRNA 4MGRA 2F5DA 3EYIA 5FFXA 5L3CA 1F4KA 1PUEE 4QWQA 2H27A 3DQVC 2IRFG 5TRDA 2IP2A 2DW4A 1HKSA 3TKYA 1P92A 3PQKA 2CW0F 3KP2A 1YW7A 2JRTA 5FO5A 5IT9Z 2P6TA 3E6MA 1J9IA 2M8EA 1EH7A 4EJUA 3IHUA 2EA2A 1Z6RA 4ZH4F 3HYIA 3LFKA 2YX4A 4OINF 2Q2EA 1FBSA 1BI0A 1MJ9A 4ENNA 2QBYB 2XROA 1GVJA 1E2XA 5BQTA 5DUKA 3RKWA 4CYDA 3FHZA 1REPC 3T1BA 3LSTA 3H3UA 4OIOF 1G6NA 2VOOA 4HLYA 2PJPA 2DI3A 2F5CA 5ILSA 1R00A 4QLCU 2IA0A 2EJRA 4OOIA 4AIKA 1SAXA 4AVPA 2WV0A 2HQNA 2M5WA 1I6XA 4L9JA 1IN7A 2HR3A 1BIBA 5JFRA 1YLFA 2EFQA 2RKHA 2FBKA 4HQEA 5L3EA 4L9VA 3CUQA 4P9UA 4HOBA 4GCVA 3J7AO 3JAMZ 1TLHB 5FLXK 2FA5A 4M6XA 5LLQA 3EETA 5HS9A 4I09A 3WE3A 3RTRA 2H6CA 2BE5F 1G3SA 4IXAA 1V3FA 1USTA 2VBZA 3SZPA 2QLZA 3GUDA 4G7ZF 1ZLKA 5JR3A 4MHGA 3IWZA 2A68F 1R7JA 2QM3A 2W25A 1SFUA 2L54A 2AXLA 1BN5A 3SQNA 4HV5A 1O3RA 5H6RA 1KU7A 1W7PD 1ON2A 1T98A 1XGOA 3RIRA 2ZMEA 2DK5A 2PFBA 3O6BB 1U2WA 5HDKA 3J81Z 1IXRC 3ECHA 3NEUA 4IRIA 3QPTA 5ICFA 2GA2A 5EEHA 5E1ZB 3KP6A 4YG2F 4HQMA 4BHCA 3JSPA 2MLGA 4JQFA 5D5VB 1T2KA 3IRRA 3JTHA 2EFOA 1EH8A 4UVBA 2COMA 4OIRF 2MLKA 5H6QA 2UWMA 1X3UA 2HGCA 3QRFF 3MZYA 5BMZA 3HSFA 1W5SA 1B6AA 2MH2A 1D3YA 3ML6A 4LGWA 3WTXC 1XDUA 4LJZF 2ZFWA 3ELKA 2QBYA 2AS5F 1FWZA 4JK1X 4EGYA 4ZYHA 4PGHA 5L3DA 1ON1A 3BROA 4BNCA 3P9KA 3L9FA 1L3LA 1ZRCA 4HBLA 4MQVA 2GIVA 3FXQA 2NYXA 5HVQC 1Z6TA 2L01A 1TW3A 5LBQA 2V6CA 3F8NA 2JZYA 2GA1A 2ISZA 3NQOA 4YFNF 1R23A 4A5NA 4R1HA 2QWWA 2FNPA 1W7PA 1G3YA 1F9NA 2YU3A 2XHKA 3DV8A 4P5OA 4YFXF 2E7WA 1J0RA 1FNNA 1FSHA 1OYYA 3RYRA 5L3GA 1YYVA 4LLGF 4L0ZB 3BDDA 4RB2C 1HKQA 1J7KA 3D5LA 2HTJA 2QQBA 3JAMK 3DFGA 5CYVA 4EJWA 2E7XA 1G3WA 4HF2A 2ZJ2A 3Q5FA 2EA4A 1B1BA 1YS6A 4RGSA 4HX4A 4XRFA 5D5UB 2XAFA 4CZZA 3E6BA 2A3SA 5TJJA 4DNCA 4KIGA 2ELHA 2IVMA 3GWZA 3BJ6A 1U5TC 3ECOA 4HLXA 5HLHA 1BJAA 3HRUA 4HF1A 3MZHA 2HQRA 1IW7F 4CDGA 3V4GA 4ENKA 2IW5A 4OU0A 1ODDA 2G7UA 5J8CA 3MEXA 3GFJA 4KICA 4KMUX 1ZREA 2HYGD 3BWGA 4XLPF 1IF1A 3COAC 4O5VA 2HOEA 2K7LA 1R1VA 5KK1A 3WODF 3LA2A 2QYOA 1B9MA 5LGUA 3DP7A 3C7JA 2R3SA 3HSRA 1U6GA 5BPDA 3DKWA 1CF7B 4HZFA 3WG9A 5FD5A 3L7WA 4LG0A 5DDGA 5K5QA 4A0ZA 1YFHA 4G9YA 2FSWA 3T8TA 1BIAA 5LHIA 4RAZA 2RC4A 1YIOA 1FX7A 2PQ8A 3G3ZA 1WWXA 5ED4A 1HSJA 3C1DA 5JHUA 3HRMA 2YX7A 1JXSA 1HW5A 1LB2A 2W85A 1TTYA 2EB7A 2MD5A 1LVAA 3E3VA 2JPBA 2D1VA 2CG4A 2P7CB 2VT3A 2R7FA 5ICEA 2K02A 4ETSA 1I1SA 3HRTA 4G6DA 1MJAA 5LGTA 2FMLA 2ZNZA 4EM2A 1H9TA 3QU6A 3TGNA 1IN5A 2STWA 1TQMA 4I02A 2P6SA 4IRHA 3F23A 1LEAA 2OAZA 4CICA 2PN6A 1KU3A 3I54A 5JI6A 1J2XA 2ESHA 2JTVA 1LDDA 2RQPA 2ZBKA 2VONA 2Q8KA 3HOTA 2GAUA 4U0WA 3R6SA 1UHWA 1AOYA 4G6QA 4PDKA 4XLNF 2BYVE 3KZYA 5LHGA 1RIOH 2K86A 1OMIA 2JSCA 5DUIA 4NQWA 3DEUA 3F72A 2A5YB 3V8LA 2HTSA 2MH9A 4LFUA 2DK8A 1AWCA 2DFIA 1MD0A 5L3FA 4LD5A 1I27A 4ENJA 5ICCA 2DAOA 1LDKB 4BYYA 2KIUA 1FZPB 3VEPA 4KDPA 1QPMA 1BC7C 3TO6A 5FFZA 1IZ1A 4HW0A 2V1UA 5J8FA 5JVTA 1T38A 2IA2A 2XUBA 3L00A 4WX9A 3I4PA 2LKPA 2DT5A 1S29A 3GLXA 1ONVA 2BGCA 4K2EA 4CO8A 3KCCA 2L4MA 4S05A 2KRFA 4HX8A 3HIFA 2NNNA 3KP4A 2XAHA 2XKOA 4MQ9F 1W4MA 3PFIA 5FD6A 2CQKA 2HS5A 3F6VA 3NRVA 1IAWA 4M6YA 2IT0A 4OMZA 1IRFA 2X0LA 2L4AA 4YIFA 2BEOA 3M9AA 1XB4A 2F2EA 1ZARA 1UHMA 3DXJF 3H3ZA 1S6LA 1DUXC 4A0YA 1YQAA 1J59A 2XGXA 1CF7A 3DPLC 4O6JA 1STZA 2QQ9A 3E97A 3M7GA 1IXCA 4MEYF 1ZG1A 5HLIA 3KEOA 1I5ZA 1ZHFA 1J5YA 6PAXA 2BBYA 2LNBA 3QP5A 3ERED 2DLLA 2Z9OA 1C0WA 2M87A 1EH6A 3G73A 1P6RA 3FX3A 3LA3A 3V8KA 1D8KA 2O6GE 2F5FA 2LDUA 2PBIA 2Q0OA 2D2WA 2RGVA 2VT2A 3ZMSA 3WGHA 4RGUA 3LQQA 5AONA 4KFCA 3ZQ7A 1FP1D 2XAJA 1HXDA 1DPRA 4NB5A 1R36A 3F8BA 4UVAA 2HFHA 3E6DA 4F7ZA 1LNWA 3QU3A 4LK1F 1W7PB 1OR7A 3DF8A 4RS8A 4M71A 1TW2A 4L0YB 3GX4X 5CVRA 1SFEA 4CXFA 4WWCA 4A5MA 3AAFA 2EK5A 3V7SA 4KNYA 1U3EM 1ZAOA 2RVCA 1Z1DA 2V9VA 3IRQA 2RDPA 2FBIA 4M73A 3ZMDA 3IKTA 1SMYF 5HS8A 5DCFA 1ZLJA 3N4MA 5ERIA 5D8KB 5FGMA 4BHPA 1XD7A 2QVOA 3KP3A 2GWRA 5D5XB 2K4BA 2L3DA 2W84A 1QZZA 2H94A 1KQ9A 1KA8A 3GW2A 3P9CA 4GXOA 4HDUA 3E5UA 1DDNA 1FC3A 3V8JA 3CJNA 1WQ2A 5FB2A 2Z5UA 5CLSA 2KJCA 4U7DA 1LDJA 3I0TA 4EJVA 4M9SA 3WU1B 3FWEA 2KIFA 1FBQA 2ETHA 5LEKA 1IXSB 4ZZLA 1CGPA 2XVCA 2G9WA 4Y15A 2HDCA 1USSA 2B0LA 5CVVA 3S2WA 4P96A 1K7AA 3VB2A 3LQRA 1WI9A 4MNUA 5E8IA 1XDSA 3RPQA 1Z9CA 1T0FA 2V1XA 4XSZF 2M30A 3RDIA 4A6EA 5E1XA 3Q9SA 3HSEA 4WF2A 2CGPA 3IC7A 4LK0F 2VODA 3MWMA 4LG0B 2FMYA 2CSOA 3GZ6A 1FYMA 4Q47A 4I98B 3GF2A 4BXUA 3HTUA 1H9GA 1Z7UA 4UNOA 3GYHX 1KQ8A 4B8XA 5D6EA 3WTTC 4IVNA 4FT8A 4GGGA 5F64A 3O2PE 4KIBA 3SHFA 4WXCA 4ZYEA 4WXHA 1JE8A 3KEQA 2OZ6A 2RN7A 1S8NA 3OOPA 4EGZA 4M9XA 3TQNA 5HLGA 4BQAA 4MTEA 2HKOA 4Q4ZF 3SZTA 1JGSA 2BV6A 2XASA 3MQ0A 3CUQC 2CYYA 3E5QA 3OV8A 4EJOA 2EFWA 3E5XA 3MCZA 2VBYA 3GVAA 3T0YA 3J80K 3RYPA 1FBUA 1BI3A 3QP6A 2LF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5I A;  1O3S A;  3ZN0 A;  3TO7 A;  1I1G A;  4DQ2 A;  2UXX A;  4ON0 A;  4S04 A;  1KYW A;  3IKV A;  1Y0U A;  3FZV A;  3I59 B;  1QGP A;  3TOB A;  3M8F A;  4UHT A;  1GXQ A;  4U0Y A;  1MGT A;  3KZZ A;  2GQQ A;  1KYZ A;  3LA7 A;  5CJ9 A;  3L2C A;  2CWE A;  1XMA A;  3V7R A;  2K4J A;  4ESJ A;  2GZW A;  2A69 F;  4UXN A;  3W6J B;  2XIG A;  3H92 A;  1F1Z A;  2V79 A;  4ESF A;  3GXO A;  4G94 A;  1S3J A;  4RAY A;  5D6F A;  1RZ4 A;  4L9N A;  3WE2 A;  1K78 A;  3KET A;  1YTY A;  1SMT A;  1XSV A;  1GHC A;  2E1C A;  1B59 A;  3WTV C;  5L3B A;  3VOE A;  2VN2 A;  1SD6 A;  4B09 A;  3BZ6 A;  3TDZ C;  3W6K B;  1MZB A;  1R58 A;  2FXA A;  3DPT A;  2IJL A;  2P5K A;  2OQR A;  5A2Q K;  3R0J A;  4I01 A;  2PMU A;  1KGS A;  3I64 A;  4KMF A;  2DU9 A;  2QZ8 A;  1D5V A;  4G8X A;  4HAM A;  4RGX A;  3ABU A;  4PCQ A;  1SD5 A;  5AIP A;  2ISY A;  3CDH A;  1NHA A;  3F8F A;  2P7V B;  3HHG A;  3ULQ B;  1HQC A;  5DCM B;  2O3F A;  1FPQ A;  3VFZ A;  2FRH A;  2R7D A;  1FLI A;  3HRS A;  3TDU C;  2MA3 A;  2VXZ A;  4O3M A;  5DD4 A;  4HYE A;  1PDN C;  3HOS A;  3QOP A;  1TNT A;  1YS7 A;  1HW1 A;  5AIQ A;  3TO9 A;  2DPU A;  3WGG A;  1RI7 A;  4IF4 A;  1HW2 A;  1T6S A;  4ZZD A;  1U8R A;  2H6B A;  3F21 A;  1JHF A;  1ZGA A;  4WCG A;  2VC1 A;  2FF4 A;  3RI4 A;  4I7H A;  2OZU A;  1ZRF A;  5K5O A;  2WTE A;  1XSD A;  4XSX F;  2KJB A;  5J6X A;  3ZP5 A;  2OA4 A;  3LAJ A;  2UZK A;  2VBX A;  4HA8 A;  2FOK A;  3KLN A;  2ADU A;  4GYI A;  2C6Y A;  5CVI A;  3ZMZ A;  3QAH A;  1K6O A;  3JW4 A;  1IN6 A;  4UV9 A;  4XBF A;  4OIP F;  1R22 A;  3HHH A;  2ZXJ A;  3F22 A;  1JHH A;  2P4W A;  1KU9 A;  4M9Z A;  4BH9 A;  4ZYG A;  2OBP A;  3SFZ A;  3EQL F;  3B73 A;  3CO7 C;  3FXR A;  3I59 A;  4Q5S F;  4GO1 A;  4U0V A;  3L09 A;  1IRG A;  1RUO A;  1HST A;  3O3K A;  1TQP A;  1VTN C;  2VOP A;  3GFM A;  3D0S A;  5F6F A;  4HF0 A;  3T8R A;  1ZYR F;  4LLL A;  1WRJ A;  4U7B A;  3B02 A;  2FU4 A;  1RNL A;  3R4K A;  1G4D A;  4FHT A;  4L18 B;  4R8H A;  4WXD A;  1H0M A;  1QZY A;  1OYW A;  3K0L A;  2Y75 A;  3V7C A;  2NNY A;  1QQI A;  4RB1 A;  4ASN A;  2EFN A;  4N9I A;  5BOX A;  3C18 A;  1YW9 A;  5IT3 A;  3BY6 A;  2EWN A;  3R0A A;  2NAZ A;  2L02 A;  1PP7 U;  5ILU A;  2LF7 A;  4LMY A;  2FEZ A;  2A07 F;  4I0A A;  3F6O A;  4U88 A;  1P4W A;  1QNT A;  1P4X A;  3KFW X;  4EMS A;  3C3W A;  3LAP A;  5DCM A;  1FP2 A;  1ZG3 A;  5EEG A;  1MDM A;  2VC0 A;  5ILV A;  1XGN A;  1O7F A;  1U78 A;  3GFL A;  3FMS A;  4FX4 A;  4I2O A;  5BPI A;  1LJ9 A;  4LB5 A;  4ZYD A;  2RV8 A;  4EVI A;  1FSE A;  2RNJ A;  1XCB A;  1W5T A;  3WTZ A;  5F1R A;  2PG4 A;  1ZRD A;  3JSO A;  4IHS A;  3CO6 C;  3CUO A;  4BAY A;  2D1H A;  2O61 A;  3R60 A;  1GXP A;  2P5V A;  3KLO A;  2UXN A;  2DTR A;  3M1E A;  1BBY A;  5E8G A;  4MTD A;  1WKM A;  3BPX A;  2D45 A;  2P8T A;  1A04 A;  3J80 Z;  2DBB A;  4IPA A;  5E20 A;  4EQQ A;  3BOQ A;  2ZO4 A;  2PI0 A;  2A6H F;  3F8M A;  4M72 A;  4AWX B;  3FMQ A;  1SD4 A;  2M1B A;  3ZMT A;  2QQA A;  3ZPL A;  4CGZ A;  1J75 A;  5LGN A;  3EYY A;  1F5T A;  2PLY A;  3M8E A;  4A0X A;  4M74 A;  4E70 A;  5LRS A;  5DYM A;  4IRG A;  2GXG A;  4CHU A;  3FM5 A;  3BJO A;  3E6C C;  3ROU A;  2A6E F;  3U1D A;  4LB6 B;  3WTS C;  4EJT A;  2O8X A;  5LEJ A;  5ICG A;  3ZMU A;  1PP8 F;  1ZG5 A;  1LEB A;  4KYW A;  1DPU A;  1O57 A;  1FY7 A;  2NRA C;  1K78 B;  3WTW C;  1FT9 A;  2EV5 A;  2IA1 A;  4KA4 A;  4BHB A;  1O3Q A;  4ESB A;  1B9N A;  2KKO A;  1U5T A;  1O3T A;  3K9T A;  1RUN A;  3U2R A;  5D4S A;  3N97 A;  5HOO A;  2HKX A;  4A2U A;  2CO5 A;  5A2Q Z;  1TBX A;  1IN4 A;  2EV6 A;  2MC3 A;  2FQ3 A;  4UVC A;  4IJA A;  2YPR A;  2OU2 A;  1ZH5 A;  4AIJ A;  3HUG A;  3I53 A;  2J5P A;  3TOA A;  2OQG A;  1QO0 D;  2NS0 A;  5IT9 K;  3LWF A;  2KIM A;  3CLO A;  2LSO A;  5DD8 A;  3I5U A;  2HEO A;  2O0Y A;  4RB0 A;  4IHT A;  1QBJ A;  1HBX G;  2IPQ X;  4OMY A;  2DPD A;  3F8C A;  3HTS B;  4L5J A;  5E1W A;  3K1P A;  3ABT A;  2ZCW A;  2HZT A;  4TV7 A;  5H20 A;  1XMK A;  4A6D A;  1B4A A;  1BI2 A;  3Q9V A;  5HS7 A;  4EM1 A;  5CVU A;  1BOA A;  1MKM A;  2PEX A;  2QEN A;  2YSR A;  1R5H A;  3RPU A;  2Y0M A;  1UFM A;  3KP7 A;  4N0B A;  1TNS A;  3FM3 A;  1DP7 P;  3GFI A;  4AIH A;  3BJA A;  1Q1H A;  4HX7 A;  4YII A;  5LRR A;  4HV6 A;  1YW8 A;  1OKR A;  5BS6 A;  3IL2 A;  1BC8 C;  3P9I A;  4NHJ A;  1ZGJ A;  2A61 A;  1XN7 A;  3P7N A;  2DQL A;  5KVR A;  3MFK A;  1XGS A;  3R61 A;  3REO A;  3U9G A;  3GO5 A;  1WSU A;  4EV0 A;  1IUY A;  1FYL A;  2XV4 S;  3K69 A;  1HKT A;  2HYF A;  4Q48 A;  1SFX A;  2M45 A;  4LLN A;  3MAJ A;  1G3T A;  1R1T A;  3CTA A;  2FE3 A;  3EUH A;  1FYK A;  3RKY A;  5DEQ A;  1P4A A;  1YG2 A;  2HWV A;  5D8L B;  1P2F A;  1S7A A;  5HDG A;  2XAQ A;  3F3X A;  1BM9 A;  2H09 A;  1T39 A;  1KU2 A;  1Z05 A;  2MBF A;  2VE8 A;  4KIF A;  3FXU A;  3I71 A;  3I58 A;  4A12 A;  4H0E A;  3KP5 A;  2WC2 A;  3SXY A;  4AD9 A;  4HDV A;  2XKP A;  1K79 A;  2Z3Y A;  3J81 K;  1Z91 A;  4FX0 A;  3WGI A;  3BP8 A;  4OIQ F;  1MJB A;  5K1Y A;  4PGG A;  2DO7 A;  4KN4 X;  4D0P A;  1YO5 C;  4YFK F;  3RKX A;  1E17 A;  3BPV A;  1MDM B;  4Y17 A;  3FF5 A;  1EV7 A;  2K27 A;  2Z33 A;  3K2Z A;  4JBA A;  4KUM A;  1R5G A;  4ENM A;  2EFP A;  4UUV A;  4P9F A;  5E17 F;  4KT5 C;  5E18 F;  1XCV A;  4GYG A;  3WU0 A;  2J5O A;  2TDX A;  2EV0 A;  3T5X A;  2ZNY A;  1XSX A;  3JTG A;  3WTU C;  3ZN1 A;  1LQ1 A;  3EDP A;  3IWF A;  4RB3 C;  4RGR A;  4Y13 A;  1ZN2 A;  1XGM A;  1O7L A;  3K1M A;  1D8J A;  1UCR A;  1BI1 A;  2E1N A;  5DV5 A;  1S7O A;  2O03 A;  3K1N A;  3ISP A;  4UV8 A;  2WWY A;  1KQ0 A;  1V4R A;  3VOD A;  3QPH A;  2FBH A;  2Y48 A;  2JT1 A;  4MEX F;  2ACJ A;  1TQI A;  2YR2 A;  1OYI A;  5LHH A;  1UB9 A;  1SD7 A;  2G7H A;  2V1D A;  2P5L C;  2DQR A;  2Z99 A;  3RJP A;  2GXB A;  4L9T A;  2FNA A;  2ZKZ A;  2F5E A;  3CUQ B;  1R1U A;  3PQJ A;  4I0B A;  4G7O F;  2VE9 A;  1ULY A;  2QUF A;  5FLX Z;  4Z2Y A;  5HDN A;  4R79 A;  1FOK A;  1L0O C;  2ESN A;  2JPC A;  3GEZ A;  4PZJ A;  2W57 A;  2VBW A;  4G7H F;  2W24 A;  5CVJ A;  5D4R A;  3WTY C;  3GZ5 A;  1OPC A;  2PMH A;  2X4H A;  5D5W B;  4EM0 B;  2XAG A;  4KN7 X;  4N9H A;  4P55 A;  2STT A;  4WK8 F;  1U5T B;  2CFX A;  3ZMV A;  5K5R A;  3KE2 A;  2ZME B;  2OD5 A;  3FMR A;  1IN8 A;  2XRN A;  4MGR A;  2F5D A;  3EYI A;  5FFX A;  5L3C A;  1F4K A;  1PUE E;  4QWQ A;  2H27 A;  3DQV C;  2IRF G;  5TRD A;  2IP2 A;  2DW4 A;  1HKS A;  3TKY A;  1P92 A;  3PQK A;  2CW0 F;  3KP2 A;  1YW7 A;  2JRT A;  5FO5 A;  5IT9 Z;  2P6T A;  3E6M A;  1J9I A;  2M8E A;  1EH7 A;  4EJU A;  3IHU A;  2EA2 A;  1Z6R A;  4ZH4 F;  3HYI A;  3LFK A;  2YX4 A;  4OIN F;  2Q2E A;  1FBS A;  1BI0 A;  1MJ9 A;  4ENN A;  2QBY B;  2XRO A;  1GVJ A;  1E2X A;  5BQT A;  5DUK A;  3RKW A;  4CYD A;  3FHZ A;  1REP C;  3T1B A;  3LST A;  3H3U A;  4OIO F;  1G6N A;  2VOO A;  4HLY A;  2PJP A;  2DI3 A;  2F5C A;  5ILS A;  1R00 A;  4QLC U;  2IA0 A;  2EJR A;  4OOI A;  4AIK A;  1SAX A;  4AVP A;  2WV0 A;  2HQN A;  2M5W A;  1I6X A;  4L9J A;  1IN7 A;  2HR3 A;  1BIB A;  5JFR A;  1YLF A;  2EFQ A;  2RKH A;  2FBK A;  4HQE A;  5L3E A;  4L9V A;  3CUQ A;  4P9U A;  4HOB A;  4GCV A;  3J7A O;  3JAM Z;  1TLH B;  5FLX K;  2FA5 A;  4M6X A;  5LLQ A;  3EET A;  5HS9 A;  4I09 A;  3WE3 A;  3RTR A;  2H6C A;  2BE5 F;  1G3S A;  4IXA A;  1V3F A;  1UST A;  2VBZ A;  3SZP A;  2QLZ A;  3GUD A;  4G7Z F;  1ZLK A;  5JR3 A;  4MHG A;  3IWZ A;  2A68 F;  1R7J A;  2QM3 A;  2W25 A;  1SFU A;  2L54 A;  2AXL A;  1BN5 A;  3SQN A;  4HV5 A;  1O3R A;  5H6R A;  1KU7 A;  1W7P D;  1ON2 A;  1T98 A;  1XGO A;  3RIR A;  2ZME A;  2DK5 A;  2PFB A;  3O6B B;  1U2W A;  5HDK A;  3J81 Z;  1IXR C;  3ECH A;  3NEU A;  4IRI A;  3QPT A;  5ICF A;  2GA2 A;  5EEH A;  5E1Z B;  3KP6 A;  4YG2 F;  4HQM A;  4BHC A;  3JSP A;  2MLG A;  4JQF A;  5D5V B;  1T2K A;  3IRR A;  3JTH A;  2EFO A;  1EH8 A;  4UVB A;  2COM A;  4OIR F;  2MLK A;  5H6Q A;  2UWM A;  1X3U A;  2HGC A;  3QRF F;  3MZY A;  5BMZ A;  3HSF A;  1W5S A;  1B6A A;  2MH2 A;  1D3Y A;  3ML6 A;  4LGW A;  3WTX C;  1XDU A;  4LJZ F;  2ZFW A;  3ELK A;  2QBY A;  2AS5 F;  1FWZ A;  4JK1 X;  4EGY A;  4ZYH A;  4PGH A;  5L3D A;  1ON1 A;  3BRO A;  4BNC A;  3P9K A;  3L9F A;  1L3L A;  1ZRC A;  4HBL A;  4MQV A;  2GIV A;  3FXQ A;  2NYX A;  5HVQ C;  1Z6T A;  2L01 A;  1TW3 A;  5LBQ A;  2V6C A;  3F8N A;  2JZY A;  2GA1 A;  2ISZ A;  3NQO A;  4YFN F;  1R23 A;  4A5N A;  4R1H A;  2QWW A;  2FNP A;  1W7P A;  1G3Y A;  1F9N A;  2YU3 A;  2XHK A;  3DV8 A;  4P5O A;  4YFX F;  2E7W A;  1J0R A;  1FNN A;  1FSH A;  1OYY A;  3RYR A;  5L3G A;  1YYV A;  4LLG F;  4L0Z B;  3BDD A;  4RB2 C;  1HKQ A;  1J7K A;  3D5L A;  2HTJ A;  2QQB A;  3JAM K;  3DFG A;  5CYV A;  4EJW A;  2E7X A;  1G3W A;  4HF2 A;  2ZJ2 A;  3Q5F A;  2EA4 A;  1B1B A;  1YS6 A;  4RGS A;  4HX4 A;  4XRF A;  5D5U B;  2XAF A;  4CZZ A;  3E6B A;  2A3S A;  5TJJ A;  4DNC A;  4KIG A;  2ELH A;  2IVM A;  3GWZ A;  3BJ6 A;  1U5T C;  3ECO A;  4HLX A;  5HLH A;  1BJA A;  3HRU A;  4HF1 A;  3MZH A;  2HQR A;  1IW7 F;  4CDG A;  3V4G A;  4ENK A;  2IW5 A;  4OU0 A;  1ODD A;  2G7U A;  5J8C A;  3MEX A;  3GFJ A;  4KIC A;  4KMU X;  1ZRE A;  2HYG D;  3BWG A;  4XLP F;  1IF1 A;  3COA C;  4O5V A;  2HOE A;  2K7L A;  1R1V A;  5KK1 A;  3WOD F;  3LA2 A;  2QYO A;  1B9M A;  5LGU A;  3DP7 A;  3C7J A;  2R3S A;  3HSR A;  1U6G A;  5BPD A;  3DKW A;  1CF7 B;  4HZF A;  3WG9 A;  5FD5 A;  3L7W A;  4LG0 A;  5DDG A;  5K5Q A;  4A0Z A;  1YFH A;  4G9Y A;  2FSW A;  3T8T A;  1BIA A;  5LHI A;  4RAZ A;  2RC4 A;  1YIO A;  1FX7 A;  2PQ8 A;  3G3Z A;  1WWX A;  5ED4 A;  1HSJ A;  3C1D A;  5JHU A;  3HRM A;  2YX7 A;  1JXS A;  1HW5 A;  1LB2 A;  2W85 A;  1TTY A;  2EB7 A;  2MD5 A;  1LVA A;  3E3V A;  2JPB A;  2D1V A;  2CG4 A;  2P7C B;  2VT3 A;  2R7F A;  5ICE A;  2K02 A;  4ETS A;  1I1S A;  3HRT A;  4G6D A;  1MJA A;  5LGT A;  2FML A;  2ZNZ A;  4EM2 A;  1H9T A;  3QU6 A;  3TGN A;  1IN5 A;  2STW A;  1TQM A;  4I02 A;  2P6S A;  4IRH A;  3F23 A;  1LEA A;  2OAZ A;  4CIC A;  2PN6 A;  1KU3 A;  3I54 A;  5JI6 A;  1J2X A;  2ESH A;  2JTV A;  1LDD A;  2RQP A;  2ZBK A;  2VON A;  2Q8K A;  3HOT A;  2GAU A;  4U0W A;  3R6S A;  1UHW A;  1AOY A;  4G6Q A;  4PDK A;  4XLN F;  2BYV E;  3KZY A;  5LHG A;  1RIO H;  2K86 A;  1OMI A;  2JSC A;  5DUI A;  4NQW A;  3DEU A;  3F72 A;  2A5Y B;  3V8L A;  2HTS A;  2MH9 A;  4LFU A;  2DK8 A;  1AWC A;  2DFI A;  1MD0 A;  5L3F A;  4LD5 A;  1I27 A;  4ENJ A;  5ICC A;  2DAO A;  1LDK B;  4BYY A;  2KIU A;  1FZP B;  3VEP A;  4KDP A;  1QPM A;  1BC7 C;  3TO6 A;  5FFZ A;  1IZ1 A;  4HW0 A;  2V1U A;  5J8F A;  5JVT A;  1T38 A;  2IA2 A;  2XUB A;  3L00 A;  4WX9 A;  3I4P A;  2LKP A;  2DT5 A;  1S29 A;  3GLX A;  1ONV A;  2BGC A;  4K2E A;  4CO8 A;  3KCC A;  2L4M A;  4S05 A;  2KRF A;  4HX8 A;  3HIF A;  2NNN A;  3KP4 A;  2XAH A;  2XKO A;  4MQ9 F;  1W4M A;  3PFI A;  5FD6 A;  2CQK A;  2HS5 A;  3F6V A;  3NRV A;  1IAW A;  4M6Y A;  2IT0 A;  4OMZ A;  1IRF A;  2X0L A;  2L4A A;  4YIF A;  2BEO A;  3M9A A;  1XB4 A;  2F2E A;  1ZAR A;  1UHM A;  3DXJ F;  3H3Z A;  1S6L A;  1DUX C;  4A0Y A;  1YQA A;  1J59 A;  2XGX A;  1CF7 A;  3DPL C;  4O6J A;  1STZ A;  2QQ9 A;  3E97 A;  3M7G A;  1IXC A;  4MEY F;  1ZG1 A;  5HLI A;  3KEO A;  1I5Z A;  1ZHF A;  1J5Y A;  6PAX A;  2BBY A;  2LNB A;  3QP5 A;  3ERE D;  2DLL A;  2Z9O A;  1C0W A;  2M87 A;  1EH6 A;  3G73 A;  1P6R A;  3FX3 A;  3LA3 A;  3V8K A;  1D8K A;  2O6G E;  2F5F A;  2LDU A;  2PBI A;  2Q0O A;  2D2W A;  2RGV A;  2VT2 A;  3ZMS A;  3WGH A;  4RGU A;  3LQQ A;  5AON A;  4KFC A;  3ZQ7 A;  1FP1 D;  2XAJ A;  1HXD A;  1DPR A;  4NB5 A;  1R36 A;  3F8B A;  4UVA A;  2HFH A;  3E6D A;  4F7Z A;  1LNW A;  3QU3 A;  4LK1 F;  1W7P B;  1OR7 A;  3DF8 A;  4RS8 A;  4M71 A;  1TW2 A;  4L0Y B;  3GX4 X;  5CVR A;  1SFE A;  4CXF A;  4WWC A;  4A5M A;  3AAF A;  2EK5 A;  3V7S A;  4KNY A;  1U3E M;  1ZAO A;  2RVC A;  1Z1D A;  2V9V A;  3IRQ A;  2RDP A;  2FBI A;  4M73 A;  3ZMD A;  3IKT A;  1SMY F;  5HS8 A;  5DCF A;  1ZLJ A;  3N4M A;  5ERI A;  5D8K B;  5FGM A;  4BHP A;  1XD7 A;  2QVO A;  3KP3 A;  2GWR A;  5D5X B;  2K4B A;  2L3D A;  2W84 A;  1QZZ A;  2H94 A;  1KQ9 A;  1KA8 A;  3GW2 A;  3P9C A;  4GXO A;  4HDU A;  3E5U A;  1DDN A;  1FC3 A;  3V8J A;  3CJN A;  1WQ2 A;  5FB2 A;  2Z5U A;  5CLS A;  2KJC A;  4U7D A;  1LDJ A;  3I0T A;  4EJV A;  4M9S A;  3WU1 B;  3FWE A;  2KIF A;  1FBQ A;  2ETH A;  5LEK A;  1IXS B;  4ZZL A;  1CGP A;  2XVC A;  2G9W A;  4Y15 A;  2HDC A;  1USS A;  2B0L A;  5CVV A;  3S2W A;  4P96 A;  1K7A A;  3VB2 A;  3LQR A;  1WI9 A;  4MNU A;  5E8I A;  1XDS A;  3RPQ A;  1Z9C A;  1T0F A;  2V1X A;  4XSZ F;  2M30 A;  3RDI A;  4A6E A;  5E1X A;  3Q9S A;  3HSE A;  4WF2 A;  2CGP A;  3IC7 A;  4LK0 F;  2VOD A;  3MWM A;  4LG0 B;  2FMY A;  2CSO A;  3GZ6 A;  1FYM A;  4Q47 A;  4I98 B;  3GF2 A;  4BXU A;  3HTU A;  1H9G A;  1Z7U A;  4UNO A;  3GYH X;  1KQ8 A;  4B8X A;  5D6E A;  3WTT C;  4IVN A;  4FT8 A;  4GGG A;  5F64 A;  3O2P E;  4KIB A;  3SHF A;  4WXC A;  4ZYE A;  4WXH A;  1JE8 A;  3KEQ A;  2OZ6 A;  2RN7 A;  1S8N A;  3OOP A;  4EGZ A;  4M9X A;  3TQN A;  5HLG A;  4BQA A;  4MTE A;  2HKO A;  4Q4Z F;  3SZT A;  1JGS A;  2BV6 A;  2XAS A;  3MQ0 A;  3CUQ C;  2CYY A;  3E5Q A;  3OV8 A;  4EJO A;  2EFW A;  3E5X A;  3MCZ A;  2VBY A;  3GVA A;  3T0Y A;  3J80 K;  3RYP A;  1FBU A;  1BI3 A;  3QP6 A;  2LF8 A; 
#chains in the Genus database with same CATH topology
 4L5I A;  3G6E I;  4HNV A;  1RES A;  1O3S A;  3ZN0 A;  3TO7 A;  2LY2 A;  1I1G A;  4DQ2 A;  1YJN I;  1TWF J;  5E79 C;  2UXX A;  2LYC A;  1JTY A;  4ON0 A;  5M5Y J;  4S04 A;  1KYW A;  4A3J J;  4CA0 A;  3IKV A;  4DOZ A;  2LKX A;  1Y0U A;  3ASO H;  3FZV A;  3ABM H;  3I59 B;  1QGP A;  4BQQ A;  3TOB A;  2DA1 A;  3M8F A;  4UHT A;  1QA6 A;  2Q1Z B;  1GXQ A;  3DLL F;  4RDU A;  1G8X A;  4U0Y A;  5B1B H;  1MGT A;  3OYF A;  3KZZ A;  3JRC A;  2GQQ A;  1KYZ A;  1I50 J;  2DA6 A;  2VPR A;  4FE7 A;  2WAQ A;  3LA7 A;  5CJ9 A;  5IY5 H;  3L2C A;  2CWE A;  1XMA A;  3V7R A;  3ZQC A;  2K4J A;  1ZR2 A;  1V5F A;  2X51 A;  3L2W A;  4ESJ A;  2ZME C;  2ECC A;  3PUB A;  2GZW A;  2A69 F;  4UXN A;  3W6J B;  2WY7 Q;  2XIG A;  3H92 A;  5IYC J;  1F1Z A;  2V79 A;  2NVU B;  3GXO A;  4G94 A;  4ESF A;  3CF5 F;  3KZI C;  3OSF A;  4A3G J;  2W00 A;  4XM3 A;  1S3J A;  4RAY A;  5D6F A;  1RZ4 A;  3IH3 A;  4JX4 A;  4L9N A;  3WE2 A;  1K78 A;  4NDL A;  4A3C J;  3LSK A;  3KET A;  3SFI A;  5J3L A;  1YTY A;  1SMT A;  1XSV A;  4PJM A;  1GHC A;  1NK2 P;  2E1C A;  2IGO A;  3HDD A;  1B59 A;  2V4J C;  1RPW A;  5FKK A;  3WTV C;  2E2J J;  5L3B A;  1RR8 C;  3VOE A;  2VN2 A;  1BW6 A;  1SD6 A;  2M0C A;  3BZ6 A;  4B09 A;  3TDZ C;  3W6K B;  2R7Q A;  1K4S A;  1MZB A;  3HGG A;  1R58 A;  2FXA A;  1MH3 A;  2E1M C;  3DPT A;  2IJL A;  2P5K A;  1YIT I;  2OQR A;  3W2V A;  5A2Q K;  1D0Z A;  1YRN B;  3R0J A;  4I01 A;  1MIJ A;  2PMU A;  1EA3 A;  1KGS A;  1OQY A;  3MVP A;  3I64 A;  4KMF A;  2DU9 A;  2QZ8 A;  4YRV A;  4G8X A;  1D5V A;  4HAM A;  4RGX A;  5F1J A;  3ABU A;  3HB9 A;  4PCQ A;  5FKL A;  5M3M J;  1SD5 A;  2NOJ B;  5AIP A;  2ISY A;  3CDH A;  2QSF X;  1NHA A;  3F8F A;  1RR7 A;  2P7V B;  3HHG A;  3ULQ B;  2CQN A;  1HQC A;  4CCL A;  5DCM B;  5JLW A;  5E3M A;  2O3F A;  1FPQ A;  3VFZ A;  3KYC B;  2FRH A;  2R7D A;  1FLI A;  3HRS A;  2ELJ A;  3W2A A;  3S32 A;  3TDU C;  1Z3X A;  2KDO A;  2MA3 A;  3G1O A;  4XLC A;  3OYH A;  2VXZ A;  1I3A A;  2MD0 A;  4O3M A;  4GFB A;  5DD4 A;  5FLV A;  2XSJ C;  4HYE A;  1PDN C;  3G4S I;  3HOS A;  3QOP A;  1TNT A;  1YS7 A;  1SVO A;  2F48 A;  3EPZ A;  1HW1 A;  4J19 A;  4BXF A;  5AIQ A;  2H8W A;  3TO9 A;  4B3A A;  3X2Q H;  2DPU A;  3WGG A;  1VQO I;  4E4H A;  1RI7 A;  1JKR C;  4IF4 A;  1HW2 A;  1T6S A;  2CW8 A;  4ZZD A;  1LPQ A;  1U8R A;  2H6B A;  4XL9 A;  3F21 A;  1JHF A;  4BY1 J;  1X2N A;  1D5Y A;  1ITY A;  2MFZ A;  2F4O B;  3CC4 I;  4ABZ A;  1XTA A;  3FK7 A;  1ZGA A;  4RA2 A;  4WCG A;  2VC1 A;  3TED A;  2FF4 A;  3RI4 A;  2OTL I;  2WY8 Q;  3K4N A;  4I7H A;  2V9P A;  2OZU A;  1S9H A;  1F36 A;  4FAS D;  4Z6Y A;  2WTE A;  5K5O A;  4A3K J;  1ZRF A;  3L2R A;  3OWT A;  1XSD A;  4XSX F;  2KJB A;  4XRS A;  1X3W B;  5J6X A;  3SZG A;  2K9Q A;  3CMM A;  1TWA J;  2K3P A;  3ZP5 A;  2OA4 A;  2QQ8 A;  4RAG A;  3LAJ A;  2UZK A;  1MND A;  2VBX A;  3Q0V A;  2NVY J;  4HA8 A;  2GM4 A;  2FOK A;  1E3P A;  3KLN A;  3K70 D;  4II2 A;  2ADU A;  2B9S A;  5FLM J;  1Y39 A;  3FXJ A;  2KFD A;  4GYI A;  2C6Y A;  5CVI A;  3ZMZ A;  4E7K A;  1OCO H;  3QAH A;  1K6O A;  3JW4 A;  1IN6 A;  4UV9 A;  4XBF A;  1IG7 A;  4OIP F;  1R22 A;  2HVS A;  1UZC A;  3HHH A;  1OCP A;  4ZC3 A;  2XDV A;  5FKN A;  1FOY A;  2ZXJ A;  3F22 A;  5DM7 F;  4CCM A;  1JHH A;  1JGG A;  1QRY A;  1KU9 A;  1ZEL A;  2P4W A;  4M9Z A;  2ECB A;  4PSX A;  4BH9 A;  4ZYG A;  2OBP A;  1TT5 B;  4D5F A;  3FIS A;  1XPX A;  3SFZ A;  3EQL F;  3SYT A;  3B73 A;  3CO7 C;  4BQO A;  3FXR A;  3IV5 A;  3I59 A;  4Q5S F;  4GO1 A;  4U0V A;  1APL C;  2W1O A;  3L09 A;  4NC8 A;  1O4X A;  1VFC A;  1FJL A;  1WJD A;  2BHY A;  1IRG A;  4A3E J;  3ZGK A;  1RUO A;  5M5W J;  5K7Z A;  2QCO A;  1HST A;  2Y31 A;  3O3K A;  3PFY A;  1ACI A;  3OYN A;  1TQP A;  1VTN C;  2VJ5 A;  2VOP A;  3GFM A;  3D0S A;  2COB A;  5F6F A;  2HPI A;  4HF0 A;  3Q3S A;  1VF9 A;  3T8R A;  1ZYR F;  1D0Y A;  2LVS A;  4LLL A;  3CCS I;  4H4K C;  1WRJ A;  4U7B A;  3WU2 C;  3B02 A;  1Z3Y A;  3BTJ A;  3BTI A;  2FU4 A;  5C3E J;  1RNL A;  1R6R A;  1X4O A;  1Z0X A;  1VQK I;  3R4K A;  1PUF B;  4XQF A;  1G4D A;  2X48 A;  4FHT A;  1FIA A;  1W1W E;  4L18 B;  4R8H A;  4ZDO A;  1TWG J;  4PK4 A;  2A05 A;  2VKD A;  4I76 A;  4WXD A;  5FKM A;  4Y33 A;  4BDZ A;  1H0M A;  1QZY A;  1OYW A;  3C2H A;  4XR6 A;  3K7A J;  2LK2 A;  3U1K A;  3K0L A;  1TWH J;  2K5C A;  1AA7 A;  2Y75 A;  3V7C A;  2NNY A;  1QQI A;  2HDD A;  4RB1 A;  4ZYA A;  4ASN A;  3GTK J;  2EFN A;  4N9I A;  5BOX A;  4XKB A;  3M4O J;  2K9L A;  3C18 A;  4HRI A;  3GTQ J;  1YW9 A;  1QZE A;  5IT3 A;  2L0K A;  3BY6 A;  2EWN A;  3L2V A;  3R0A A;  4B1R A;  2NAZ A;  2X9D A;  2L02 A;  1PP7 U;  4BXX J;  3CLQ A;  5ILU A;  1X1D A;  2MW8 A;  1YRN A;  2LF7 A;  4LMY A;  2FEZ A;  4FTH A;  3HKZ N;  2A07 F;  1TT0 A;  4I0A A;  3F6O A;  4UUS B;  4U88 A;  1P4W A;  2IS2 A;  2DDB A;  3TW7 A;  1QNT A;  1P4X A;  9ANT A;  3KFW X;  1R49 A;  4E7S A;  4EMS A;  3IAM 2;  2VXD A;  3C3W A;  2ICW G;  3LAP A;  5DCM A;  2CJJ A;  1FP2 A;  1ZG3 A;  5EEG A;  3DWL E;  2EIJ H;  1MDM A;  5E3L A;  3MKZ A;  2VC0 A;  3HUG B;  5ILV A;  2O9L A;  1V54 H;  2GIZ A;  2LFB A;  1PVE A;  1XGN A;  1E3O C;  1NK3 P;  1O7F A;  2DJI A;  1HLV A;  1U78 A;  3J7Y J;  1OFC X;  3GFL A;  5F0H A;  3FMS A;  4FX4 A;  4I2O A;  2Z1D A;  3VYT B;  3JRD A;  3H9J A;  5BPI A;  1LJ9 A;  2BW3 A;  3P5J A;  3LSR A;  4B3X A;  3OMY A;  4LB5 A;  4ZYD A;  1OJL A;  2CW7 A;  2K9N A;  2RV8 A;  2ZB9 A;  2DMP A;  2IEK A;  4AM3 A;  4B47 A;  1S7E A;  1BL0 A;  4F92 B;  2I8D A;  4PJL A;  2EBI A;  1SFO J;  3DTI A;  4EVI A;  4PFP A;  4BJ5 C;  1EKE A;  2KQR A;  1FSE A;  1VQ6 I;  2RNJ A;  1Y1W J;  1XCB A;  4YIR X;  1W5T A;  3WTZ A;  5F1R A;  5HOD A;  3S8P A;  2PG4 A;  3CCL I;  1ZRD A;  3OR2 C;  2DOE A;  3JSO A;  4IHS A;  3CO6 C;  3CUO A;  4UB8 C;  4BAY A;  2WB1 A;  3RZO J;  2D1H A;  2O61 A;  2EPF A;  3R60 A;  3GLL A;  2DDA A;  3UNG C;  1GXP A;  2P5V A;  3KLO A;  2UXN A;  2DTR A;  3MKW B;  2IGK A;  3M1E A;  4B4C A;  1BBY A;  1ETK A;  1UEL B;  5E8G A;  4MTD A;  1WKM A;  3BPX A;  2D45 A;  1W36 D;  5FRN A;  2P8T A;  3JR9 A;  3RKQ A;  2L2O A;  1A04 A;  2JVG A;  1VQ7 I;  3J80 Z;  4BBR J;  2DBB A;  3S2D J;  4IEJ A;  1MMD A;  2BY3 A;  4IPA A;  5E20 A;  4EQQ A;  1WHU A;  3BOQ A;  4XRM A;  2O5R A;  2ZO4 A;  2Y2Z A;  3ABK H;  2G0E A;  4N4N B;  2PI0 A;  2A6H F;  3F8M A;  4M72 A;  3VYR B;  4AWX B;  1X3Z B;  3FMQ A;  3MKY B;  1SD4 A;  4AID A;  2M1B A;  3ZMT A;  2QQA A;  2R7S A;  2E35 A;  1WJF A;  3ZPL A;  2KL4 A;  3FIW A;  4CGZ A;  1JUP A;  1J75 A;  2L5Q A;  4P1W A;  5LGN A;  3EYY A;  2KT0 A;  4X6A J;  1F5T A;  2PLY A;  3M8E A;  4A0X A;  3QWL A;  2GOX B;  4AYB N;  4M74 A;  4E70 A;  2KZG A;  1SC7 A;  3AG3 H;  4DBQ A;  5LRS A;  5DYM A;  4M3G A;  2CUJ A;  2DYS H;  4IRG A;  2GXG A;  4CHU A;  3FM5 A;  3L2U A;  1PUF A;  3BJO A;  1WH5 A;  3E6C C;  3ROU A;  2A6E F;  2RNG A;  3U1D A;  3HXL A;  2KLO A;  3RPU D;  2M34 A;  2V9K A;  4LB6 B;  3WTS C;  4EJT A;  2O8X A;  3KYD B;  1I39 A;  4KIT B;  4JP0 A;  2JK3 A;  3FXK A;  4II3 A;  3FHN A;  5LEJ A;  5ICG A;  4IO9 F;  1T33 A;  3ZMU A;  1PP8 F;  1ZG5 A;  1LEB A;  5E3O A;  3HGY A;  3O8H A;  3HOX J;  3H0G J;  4KYW A;  1O57 A;  3JRA A;  1DPU A;  1SVL A;  2W82 A;  3TBI A;  2KIS A;  1FY7 A;  5F04 A;  5J1U A;  1TL8 A;  3WTW C;  1MW7 A;  1K78 B;  2NRA C;  1FT9 A;  2EV5 A;  2IA1 A;  4KA4 A;  4BHB A;  1O3Q A;  1A36 A;  4ESB A;  1B9N A;  2KKO A;  2Z2S B;  4BU2 A;  3LSG A;  1U5T A;  4EEF G;  1S5L C;  1O3T A;  3K9T A;  4E7L A;  1RUN A;  2XAU A;  2OC6 A;  4X1E A;  2VKH A;  3FBN B;  3U2R A;  4UUS A;  1U0J A;  5D4S A;  3N97 A;  3C2B A;  3A0B C;  3DLA A;  1SAN A;  2HKX A;  5HOO A;  1U8B A;  4A2U A;  2CO5 A;  5A2Q Z;  4D5C A;  1TBX A;  1IN4 A;  2EV6 A;  2HI3 A;  2MC3 A;  1V5G A;  1T56 A;  2FQ3 A;  2UV1 A;  1YJ9 I;  2HOS A;  2WV1 A;  4UVC A;  3F0C A;  5GPC A;  1B8I B;  4IJA A;  2YPR A;  3OYC A;  2BXY A;  2OU2 A;  1WH7 A;  3OYL A;  4AIJ A;  5FRM A;  1ZH5 A;  5FKO A;  3HUG A;  1FTZ A;  1TZL A;  1QHH D;  2LRE A;  3V42 A;  3I53 A;  2J5P A;  3TOA A;  2OQG A;  1QO0 D;  4LG3 A;  2NS0 A;  4RMN A;  3LWF A;  5IT9 K;  2R93 J;  3K4B A;  2V7F A;  2KIM A;  3ZOB A;  3BTL A;  3CLO A;  2FX0 A;  2LSO A;  3AG1 H;  5DD8 A;  2W48 A;  1H88 C;  3I5U A;  2DFE A;  2O0Y A;  4RB0 A;  2HEO A;  2XGD A;  4IHT A;  2HYJ A;  1HBX G;  2IPQ X;  1QBJ A;  4OMY A;  2DPD A;  2Y0S A;  2CQX A;  2VJJ A;  3F8C A;  3FKI J;  3HTS B;  5FRO A;  2FOW A;  4L5J A;  5E1W A;  3K1P A;  3ABT A;  2ZCW A;  3CD6 I;  4X0G A;  1JTX A;  2HZT A;  2QEX I;  2DXI A;  4TV7 A;  5H20 A;  1XMK A;  4A6D A;  4DZP A;  4BE0 A;  1B4A A;  3BT9 A;  4UUT A;  2HXO A;  1BI2 A;  3Q9V A;  4ZDP A;  3A2K A;  4IHX A;  2R92 J;  2JQ7 A;  5HS7 A;  3PIP F;  2CFO A;  4EM1 A;  5CVU A;  1BOA A;  1MKM A;  2NS8 A;  2PEX A;  3HG9 A;  5CQE A;  1OR7 C;  2QEN A;  2YSR A;  1R5H A;  2CQQ A;  2L9V A;  3MMY B;  3RPU A;  4PJN A;  2Y0M A;  1UFM A;  1DP3 A;  1WVR A;  1FIP A;  5J1R A;  3KP7 A;  3F9K A;  4N0B A;  2JN6 A;  1RKT A;  4MLO A;  1TNS A;  3FM3 A;  1DP7 P;  3GFI A;  2OJE D;  4AIH A;  3BJA A;  1Q1H A;  4HX7 A;  2KP6 A;  4YII A;  5LRR A;  1WZ2 A;  4HV6 A;  1YW8 A;  3AG4 H;  4F3Q A;  1OKR A;  5BS6 A;  1ETX A;  1OCR H;  5JHF A;  3IL2 A;  2E60 A;  1WGX A;  1BC8 C;  3IH4 A;  3P9I A;  1WJC A;  4NHJ A;  1ZGJ A;  3DKY A;  2A61 A;  1E3H A;  2LG4 A;  1XN7 A;  3P7N A;  3GTG J;  4M3E A;  2DQL A;  1A35 A;  3NWS A;  5KVR A;  2HXI A;  4DYC A;  2F5V A;  3MFK A;  3CP8 A;  4BL0 B;  2M7A A;  1VZ0 A;  3PJR A;  1XGS A;  3PIO F;  3R61 A;  1HCR A;  3EUA A;  3REO A;  2ME0 A;  1ETO A;  2ZJP F;  3U9G A;  2AQE A;  3GO5 A;  3CCU I;  1WSU A;  3HOY J;  3MKL A;  4EV0 A;  3BR5 A;  3M07 A;  1T95 A;  1IUY A;  3OYK A;  1OIS A;  2FJ1 A;  4OAY A;  1IJW C;  1FYL A;  4C9Y A;  2XV4 S;  3K69 A;  1HKT A;  2HYF A;  2DOA A;  4F91 B;  3ZQL A;  3HOZ J;  2V1N A;  4Q48 A;  4DJA A;  2M4G A;  1SFX A;  2QF7 A;  2CMP A;  4AUX A;  2M45 A;  4LLN A;  3MAJ A;  3S1N J;  1G3T A;  1R1T A;  4QPO A;  3CTA A;  2FE3 A;  3VYU B;  3ONQ A;  2KDZ A;  3EUH A;  1FYK A;  3RKY A;  3CJQ B;  3QYF A;  5DEQ A;  1P4A A;  1YG2 A;  2LMD A;  2HWV A;  5D8L B;  1JUM A;  1P2F A;  3PNT A;  3HZJ A;  4BGD A;  1Y8Q B;  1S7A A;  1A6Q A;  2RRE A;  3MZ8 A;  5HDG A;  2XAQ A;  4DW6 A;  3GTJ J;  3F3X A;  1MH4 A;  4FET A;  1BM9 A;  1GV5 A;  3H3V K;  4IQ4 A;  2H09 A;  3I3L A;  2Y30 A;  4HNT A;  2KMU A;  1T39 A;  1KU2 A;  1POG A;  1Z05 A;  2MBF A;  2VE8 A;  4KIF A;  3HOW J;  3FXU A;  3I71 A;  3I58 A;  4A12 A;  4H0E A;  3KP5 A;  2MYS A;  2WC2 A;  3SXY A;  1AKH B;  4AD9 A;  4HDV A;  2XKP A;  1TC3 C;  1K79 A;  4M3B A;  2JA2 A;  2Z3Y A;  3J81 K;  1H8A C;  2NS7 A;  3CZ6 A;  1Z91 A;  4FX0 A;  3WGI A;  3BP8 A;  4OIQ F;  1T0F C;  4AC0 A;  1GV2 A;  1MJB A;  1D0X A;  4XLA A;  5K1Y A;  1B8I A;  4PGG A;  4DGW B;  2DO7 A;  5KNL A;  1R5I D;  1LE8 A;  4V2F A;  3A1Y A;  4KN4 X;  4XMY A;  4D0P A;  3CES A;  1YO5 C;  2BVL A;  3M1C A;  3AG2 H;  4YFK F;  3RKX A;  1E17 A;  3BPV A;  1XMX A;  1MDM B;  4Y17 A;  3FF5 A;  5EYR A;  5J4V A;  2LY1 A;  1EV7 A;  1K6Y A;  2K27 A;  2Z33 A;  3K2Z A;  5B5E C;  3TMO A;  4JBA A;  4KUM A;  4IKF A;  5C44 J;  5DS9 A;  3H5N A;  2XSD C;  1WCM J;  1Y6I A;  1G2H A;  1R5G A;  4ENM A;  2EFP A;  2DA3 A;  4UUV A;  4P9F A;  3PNY A;  2ZC2 A;  3OYA A;  5E17 F;  2DFF A;  4KT5 C;  5E18 F;  1XCV A;  1R4M B;  2HVQ A;  2BW3 B;  4GYG A;  4XIC A;  3H5R A;  4RAF A;  3WU0 A;  3CDL A;  2R7R A;  2E19 A;  2H1L A;  2J5O A;  4HST A;  2TDX A;  1BR4 A;  4BEH B;  1MNE A;  2EV0 A;  2Q2E B;  2QSH X;  4FCY A;  3T5X A;  2ZNY A;  4EAT A;  1XSX A;  2W7N A;  3JTG A;  2DMU A;  2GXA A;  2VJI A;  1FMW A;  3WTU C;  2DA5 A;  3ZN1 A;  4PUS A;  1LQ1 A;  3CCR I;  1IV6 A;  3GTP J;  3EDP A;  3IWF A;  4RB3 C;  4RGR A;  1MMN A;  1HDD C;  4Y13 A;  1ZN2 A;  1XGM A;  4PFO A;  2Y69 H;  3S15 J;  4XKV A;  4C2T A;  1YOV B;  2DA2 A;  4LIV A;  1O7L A;  3K1M A;  1D8J A;  2IS6 A;  1UCR A;  2LKS A;  2VQC A;  1ERD A;  1BI1 A;  2E1N A;  4CZC A;  5DV5 A;  4D7N A;  1D1C A;  1S7O A;  2O03 A;  1X1A A;  2MSY A;  1KON A;  2CU7 A;  3K1N A;  5LD2 C;  2ZXI A;  4CUG A;  1QHG A;  4M6V A;  1UG0 A;  2DA4 A;  3ISP A;  4D1Q A;  4UV8 A;  3BLY A;  1KQ0 A;  2WWY A;  1V4R A;  2I5U A;  3VOD A;  3ZXS A;  3FXL A;  3QPH A;  2FBH A;  3OYB A;  2Y48 A;  2JT1 A;  4MEX F;  2ACJ A;  2DYR H;  2IGM A;  2IS4 A;  4F52 A;  1TQI A;  2DMT A;  2OPT A;  2YR2 A;  4IHY A;  1OYI A;  3OYI A;  5LHH A;  1UB9 A;  1ZK8 A;  3TL4 X;  3AL0 B;  3IH2 A;  3CCY A;  2JA7 J;  1SD7 A;  2G7H A;  2EQR A;  3LL7 A;  1VQM I;  1IDY A;  2V1D A;  1Y8R B;  4ZTJ A;  2KPM A;  4AVZ A;  5EGO B;  2DQR A;  2Z99 A;  2P5L C;  3RJP A;  2GXB A;  4L9T A;  2FNA A;  2ZKZ A;  5TGT A;  2F5E A;  3CUQ B;  1K83 J;  1R1U A;  4XOR A;  2JUG A;  2L9S A;  2HOA A;  2XB0 X;  3OYJ A;  3I55 I;  3MN2 A;  3PQJ A;  4DZJ A;  4I0B A;  1A5J A;  4G7O F;  2VE9 A;  2DA7 A;  1ULY A;  1TP4 A;  2QUF A;  2E2H J;  5FLX Z;  3EUH C;  4Z2Y A;  5EG0 B;  5HDN A;  3S2H J;  4R79 A;  1N75 A;  3E1S A;  5HNF A;  4XN0 A;  1FOK A;  1L0O C;  2ESN A;  2LP0 A;  4B43 A;  1HOM A;  2JPC A;  2M0M A;  3W2W A;  3GEZ A;  4PZJ A;  4Y7N J;  2P81 A;  3W6V A;  5C4J J;  1OCZ H;  3BR0 A;  4DYQ A;  2W57 A;  1VQN I;  2VBW A;  2VB6 A;  3G71 I;  4G7H F;  2W24 A;  4QSH A;  5CVJ A;  1DQU A;  5D4R A;  2VKE A;  4LOC A;  5J1Y A;  3A0H C;  3WTY C;  3G2B A;  3GZ5 A;  1OPC A;  2PMH A;  2X4H A;  2O7O A;  4CCJ A;  5D5W B;  2JMW A;  4EM0 B;  1VQ8 I;  1D1B A;  2XAG A;  3HOU J;  3HPG A;  2R5Z B;  2WAQ N;  5J47 A;  2QA4 I;  1AKH A;  3GTL J;  4KN7 X;  2HPM A;  4N9H A;  4P55 A;  3QYE A;  3K4C A;  3PSF A;  5IYD J;  2STT A;  4WK8 F;  2VQG A;  1U5T B;  2CFX A;  3ZMV A;  5K5R A;  1WPK A;  2ELK A;  3KE2 A;  2ZME B;  2M9H A;  4CCO A;  1XC5 A;  3S1Q J;  1BOB A;  5GTI C;  2OD5 A;  3FMR A;  4W1U A;  2EIK H;  1IN8 A;  2XRN A;  4HG2 A;  3N05 A;  4MGR A;  2F5D A;  1N25 A;  3EYI A;  1FOX A;  3DBR B;  5FFX A;  5L3C A;  1F4K A;  1PUE E;  4NUB A;  4QWQ A;  2H27 A;  3DQV C;  2IRF G;  5TRD A;  2IP2 A;  2DW4 A;  3ZQQ A;  1HKS A;  3TKY A;  2LOO A;  1P92 A;  2ID6 A;  1ENH A;  2QKL B;  2X1E A;  1VQ4 I;  2QGU A;  1JUS A;  3H9Q A;  3PQK A;  2ZJQ F;  1MBE A;  2CW0 F;  3KP2 A;  2JWT A;  1YW7 A;  2JRT A;  5FO5 A;  3DTE A;  3WHC A;  5IT9 Z;  2P6T A;  4NNJ A;  1MBF A;  3E6M A;  2R0Q C;  2HQA A;  4D9J A;  3OIP A;  1J9I A;  2M8E A;  3DTK A;  1EH7 A;  1XG1 A;  4EJU A;  3IHU A;  5KHD A;  2EA2 A;  1Z6R A;  4ZH4 F;  2E1O A;  3HYI A;  3LFK A;  2YX4 A;  2BXZ A;  4OIN F;  4FQG A;  4BEH A;  1YHQ I;  2Q2E A;  4NC6 A;  1G59 A;  1DU0 A;  1FBS A;  1BI0 A;  1MJ9 A;  3IAS 2;  5E3N A;  1MMS A;  3KIO A;  3OYM A;  4ENN A;  2QBY B;  2R4G A;  2V26 A;  3SEZ A;  2PMZ A;  3K2A A;  2XRO A;  1GVJ A;  1E2X A;  4QPQ A;  3JRE A;  3HPH A;  1WJ5 A;  5BQT A;  2NVQ J;  3K4L A;  5DUK A;  3RKW A;  4CYD A;  3FHZ A;  1REP C;  3Q0U A;  2VL8 A;  2DJN A;  5KCM A;  3T1B A;  1X19 A;  3LST A;  1ETW A;  3OS1 A;  3H3U A;  4OIO F;  2ZXH A;  1G6N A;  2VOO A;  4HLY A;  2PJP A;  2DI3 A;  2VKV A;  2F5C A;  3ZR8 X;  5ILS A;  1R00 A;  1LFB A;  2ZFU A;  3BG9 A;  4QLC U;  5B1A H;  2XPV A;  2IA0 A;  2EJR A;  4LIU A;  5GAG J;  1CQT A;  4OOI A;  4AIK A;  1R9T J;  2L9R A;  4MFE A;  1SAX A;  2IXS A;  4AVP A;  2WV0 A;  5EF6 A;  2HQN A;  2M5W A;  1I6X A;  4L9J A;  4XNF A;  1IN7 A;  3AKZ A;  3OSG A;  2HR3 A;  1X1C A;  1BIB A;  5JFR A;  3CCM I;  1I3Q J;  1YLF A;  1FOW A;  2EFQ A;  4E7H A;  2RKH A;  2FBK A;  2R7U A;  4HQE A;  5L3E A;  4L9V A;  5EGO A;  2E2I J;  3BR6 A;  3SJM A;  1YX3 A;  2UUZ A;  4RLF A;  1XX5 A;  2M7B A;  2X6W A;  3CUQ A;  1F43 A;  4P9U A;  4HOB A;  4GCV A;  2IS1 A;  2HNH A;  3J7A O;  2M3A A;  2BY2 A;  3JAM Z;  5LFA A;  2OTJ I;  1TLH B;  2X6Y A;  1P7I A;  2FA5 A;  4M6X A;  5LLQ A;  5FLX K;  3EET A;  5HS9 A;  5EG0 A;  5IP6 A;  2OCC H;  4I09 A;  4RBO A;  4XLE A;  3WE3 A;  5BNG A;  3RTR A;  3C2G A;  2GLO A;  2NVT J;  2H6C A;  2BE5 F;  1G3S A;  4IXA A;  4IOA F;  3D5R C;  1V3F A;  1UST A;  3HBL A;  2VBZ A;  3SZP A;  2QLZ A;  2E5N A;  1SAU A;  1VI0 A;  2F4M B;  1RC9 A;  3E7L A;  3GUD A;  2E36 A;  2JRM A;  3HEF A;  3GZN B;  4G7Z F;  1ZLK A;  4QTR A;  5JR3 A;  4G12 A;  2XB5 A;  4MHG A;  3IWZ A;  2A68 F;  1R7J A;  2QM3 A;  2W25 A;  1SFU A;  1MSE C;  4A3I J;  3PO2 J;  3OS2 A;  2L54 A;  4F93 B;  4XID A;  2M2E A;  2AXL A;  1BN5 A;  3I9V 2;  2IBD A;  3SQN A;  4IZZ A;  4HV5 A;  1O3R A;  1U9O A;  5H6R A;  2R5Z A;  1UJ8 A;  1UMQ A;  1KU7 A;  1W7P D;  2WA0 A;  4B48 A;  1AHD P;  1ON2 A;  4J01 A;  1T98 A;  1XGO A;  3GBG A;  3ZCO A;  2MG4 A;  4NC7 A;  2EZH A;  5EJC A;  3RIR A;  1YIJ I;  2ZME A;  2DK5 A;  2PFB A;  1BJZ A;  3O6B B;  1U2W A;  5HDK A;  1WI3 A;  2BZT A;  1IXR C;  3J81 Z;  3ECH A;  3NEU A;  3K70 C;  4IRI A;  3QPT A;  5ICF A;  2VPL A;  5EZH A;  3G1M A;  3ZQH A;  2GA2 A;  4IHV A;  4J00 A;  5EEH A;  3CC7 I;  5E1Z B;  3KP6 A;  4YG2 F;  1EJ9 A;  4HQM A;  1LE8 B;  2B7E A;  4BHC A;  3JSP A;  2MLG A;  4JQF A;  1H89 C;  3H9G A;  5HNH A;  4OWR B;  5D5V B;  3BR3 A;  4A3M J;  4E7J A;  1T2K A;  3IRR A;  3NWT A;  3JTH A;  2EFO A;  1EH8 A;  4UVB A;  2COM A;  1WJA A;  2KZV A;  1MBG A;  3ZRG A;  4OIR F;  2MLK A;  5H6Q A;  2UWM A;  1X3U A;  3FKJ A;  3K4J A;  2HGC A;  4UB6 C;  2X6X A;  3QRF F;  3MZY A;  5BMZ A;  1PYV A;  4Y3O A;  2YU9 J;  3HSF A;  1W5S A;  3LSH A;  2F4I A;  5J4Y A;  2QSG X;  3LOC A;  1B6A A;  2MH2 A;  2M8G X;  3ZQI A;  1D3Y A;  2WAD A;  4MFD A;  3ML6 A;  4LGW A;  3WTX C;  1XDU A;  3HOV J;  4LJZ F;  2WAF A;  3RZD J;  1VQ9 I;  4JYK A;  2ZFW A;  3ELK A;  2QBY A;  3HL2 A;  3I4N J;  2AS5 F;  1FWZ A;  4JK1 X;  2AXT C;  3VDX A;  2KRH A;  4EGY A;  4ZYH A;  3PUF A;  4PGH A;  5L3D A;  1ON1 A;  3BRO A;  1ZQ3 P;  3P9K A;  4BNC A;  1J09 A;  3L9F A;  1NH3 A;  1RET A;  1L3L A;  1ZRC A;  4HBL A;  4MQV A;  4C2U A;  2VUM J;  1GLN A;  4RM2 A;  2GIV A;  3BG5 A;  4XK4 A;  3FXQ A;  2NYX A;  1Y1V J;  2R5Y B;  3FXM A;  5HVQ C;  1Z6T A;  3QYB A;  2L01 A;  1X1B A;  2L7Z A;  1DGW Y;  3A03 A;  5EZG A;  2O8K A;  3OYD A;  4A3B J;  1TW3 A;  5LBQ A;  2MAB A;  2V6C A;  4AU7 A;  3L1P A;  1UHS A;  1JKP C;  2TCT A;  3F8N A;  2B63 J;  2JZY A;  2GA1 A;  3ERM A;  4A3L J;  2ISZ A;  3NQO A;  3FXO A;  3AL0 C;  5JLX A;  4YFN F;  4D7M A;  1R23 A;  4A5N A;  4R1H A;  2QWW A;  2FNP A;  1W7P A;  1K61 A;  1G3Y A;  1F9N A;  2YU3 A;  2XHK A;  3JRH A;  4MO7 A;  2BHZ A;  3DV8 A;  4P5O A;  4YFX F;  2E7W A;  1J0R A;  1FNN A;  1FSH A;  1OYY A;  3RYR A;  5L3G A;  1YYV A;  4LLG F;  3S1M J;  4L0Z B;  2WB1 N;  3H0D A;  3BDD A;  2OV7 A;  2DTZ A;  1K4T A;  2ZSI B;  4RB2 C;  1W0T A;  1HKQ A;  1J7K A;  5GTH C;  2CV1 A;  3D5L A;  2H8R A;  2LY9 A;  3PM1 A;  2HTJ A;  2QQB A;  3S17 J;  5DTD A;  3JAM K;  3EUK L;  2EIM H;  5M3F J;  1JT6 A;  3DFG A;  4KT6 A;  1ETV A;  5CYV A;  2L7K A;  4EJW A;  2E7X A;  4BS9 A;  1G3W A;  5IPA A;  3SDG A;  3GTO J;  2DMQ A;  4HF2 A;  2ZJ2 A;  3Q5F A;  4HNU A;  2EA4 A;  1B1B A;  1YS6 A;  2AQF A;  3BCA A;  2HQ5 A;  3OYE A;  4E7I A;  4RGS A;  4B44 A;  4HX4 A;  1A6I A;  2DT6 A;  2F6C A;  4XRF A;  4NQW B;  5D5U B;  3RCO A;  3S3M A;  2XAF A;  3ESW B;  4CZZ A;  3L2Q A;  3E6B A;  3BZK A;  5GP9 A;  2A3S A;  1ZKG A;  2Y9Z A;  5TJJ A;  4DNC A;  4KIG A;  2ELH A;  1T08 B;  3BQZ A;  2IVM A;  3RQ4 A;  2DFH A;  3GWZ A;  2A6T A;  2K9S A;  3BJ6 A;  2E5Z A;  2X85 A;  1AU7 A;  4A3D J;  1BR1 A;  2KIQ A;  1U5T C;  2LRD A;  3ECO A;  3QPL A;  3TP0 A;  2CV0 A;  4HLX A;  5HLH A;  1BJA A;  1WJB A;  3HRU A;  4HF1 A;  1SFK A;  3HKZ A;  1IO2 A;  3MZH A;  3W3C A;  1GUU A;  3SDB A;  2HQR A;  3DBH B;  1IW7 F;  3A4C A;  3CCV I;  1ZTR A;  4CDG A;  1BR2 A;  3CJR B;  3BR2 A;  4C3H J;  3LSM A;  3V4G A;  1B72 B;  1RKW A;  3HC7 A;  4ENK A;  2MC4 A;  1HF0 A;  4FE4 A;  3TP3 A;  2IW5 A;  4OU0 A;  1VQP I;  2KHM A;  2XGE A;  1ODD A;  3GCM A;  3IP4 B;  1I6H J;  2G7U A;  5J8C A;  1QPI A;  3MEX A;  2EZL A;  1P9Q C;  1W36 C;  3GFJ A;  4BJ6 C;  4KIC A;  2DOF A;  4KMU X;  1ZRE A;  4RM3 A;  2HYG D;  3BR1 A;  3BWG A;  4XON A;  4JOM A;  3S3N A;  1IUF A;  4XLP F;  2CUF A;  1IF1 A;  3COA C;  4U87 A;  4O5V A;  1QU3 A;  4ZDL A;  2HOE A;  1HC8 A;  3VWB A;  3OL4 A;  2K7L A;  1VQ5 I;  2DOD A;  1R1V A;  2CRG A;  5KK1 A;  3LSI A;  3WOD F;  3LA2 A;  4ZJZ A;  2E71 A;  2BY0 A;  2QYO A;  1B9M A;  2M4K A;  3DKX A;  5LGU A;  2R7V A;  1MSF C;  3JRF A;  3DP7 A;  3C7J A;  2CUE A;  3LMM A;  2R3S A;  4RLQ A;  3HSR A;  1U6G A;  2L7F P;  5BPD A;  3DKW A;  1CF7 B;  4HZF A;  3WG9 A;  5FD5 A;  1Z21 A;  1Z77 A;  3L7W A;  5FJ8 J;  4JX6 A;  3A01 B;  3OS0 A;  2EH3 A;  4LG0 A;  5DDG A;  5K5Q A;  4A0Z A;  1YFH A;  3SEQ A;  3UR3 C;  2V6E A;  4G9Y A;  5DM6 F;  2NOG A;  4JX5 A;  1ETY A;  2FSW A;  4W97 A;  1N77 A;  3T8T A;  1HA8 A;  3QPS A;  2CUZ A;  2PX9 A;  3FK6 A;  1BIA A;  5LHI A;  4IX7 A;  2JA8 J;  4RAZ A;  2RC4 A;  1E0E A;  2LR8 A;  1YIO A;  1FX7 A;  1YE9 A;  1OCC H;  3NAR A;  2PQ8 A;  4XLF A;  2R5Y A;  2W4S A;  5IP9 J;  3G3Z A;  1WWX A;  4CCK A;  5ED4 A;  1HSJ A;  2IAI A;  3PSI A;  3C1D A;  5JHU A;  3UKG A;  4ANJ A;  5F27 A;  3HRM A;  2YX7 A;  1S72 I;  1JXS A;  3CCE I;  2Y0S N;  1HW5 A;  1LB2 A;  4I99 C;  1JKO C;  4FIS A;  2W85 A;  1TTY A;  2EB7 A;  2MD5 A;  1LVA A;  3E3V A;  1VQL I;  2XF7 A;  2JPB A;  2D1V A;  1V5E A;  4PSW A;  1ETQ A;  2CG4 A;  2P7C B;  2VT3 A;  2R7F A;  5ICE A;  4KJZ A;  2K02 A;  4ETS A;  2ZXW H;  1I1S A;  4E6K G;  3HRT A;  4G6D A;  1MJA A;  5LGT A;  2FML A;  2ZNZ A;  2JSP A;  4EM2 A;  3FBI B;  1MNM C;  4IL6 C;  1H9T A;  3QU6 A;  3TGN A;  1YX5 A;  2LBF B;  2QKM B;  1IN5 A;  2STW A;  1TQM A;  4N4O B;  3FDY A;  4I02 A;  2P6S A;  3DEE A;  4IRH A;  1LEA A;  2OAZ A;  4CIC A;  3F23 A;  1JKQ C;  1YI2 I;  2PN6 A;  5F0C A;  1T8I A;  1OLT A;  1KU3 A;  3I54 A;  3OL3 A;  2LD5 A;  4AYB A;  3Q0W A;  2BVM A;  5JI6 A;  2D5V A;  3VPR A;  3LSJ A;  3CMA I;  4S0H B;  1J2X A;  4G6T B;  1Z7L A;  2ESH A;  3PNV A;  1BW5 A;  2JTV A;  2YS9 A;  1LDD A;  1XS9 A;  2RQP A;  3H5A A;  1Z67 A;  2ZBK A;  2VON A;  2R7X A;  2Q8K A;  3HOT A;  2MGQ A;  4YEL A;  2GAU A;  4U0W A;  4YEJ A;  3R6S A;  3WG7 H;  1UHW A;  1AOY A;  4G6Q A;  3IUO A;  5B3S H;  5GAD J;  4PDK A;  4XLN F;  2BYV E;  3KZY A;  5LHG A;  3ZQG A;  2K86 A;  1OMI A;  4E7Z A;  1RIO H;  2JSC A;  5DUI A;  4NQW A;  3DEU A;  3JRG A;  2L7M P;  3F72 A;  2A5Y B;  3V8L A;  2HTS A;  3RQI A;  1NTC A;  5GAH J;  2MH9 A;  4LFU A;  2DK8 A;  1AWC A;  2DFI A;  3GME A;  1MD0 A;  5L3F A;  4LD5 A;  1FEX A;  1I27 A;  4C3I J;  5ICC A;  2DAO A;  4ENJ A;  1MMA A;  3PL8 A;  1LDK B;  2JJ7 A;  3CP2 A;  4BYY A;  5GAE J;  1JT0 A;  2KIU A;  1FZP B;  3VEP A;  3S14 J;  1YJW I;  4KDP A;  3M8J A;  3RSN A;  4HSR A;  1QPM A;  1BC7 C;  3TO6 A;  5FFZ A;  1IZ1 A;  4HW0 A;  2V1U A;  5J8F A;  5JVT A;  1T38 A;  2IA2 A;  1IRZ A;  2E34 A;  2DN0 A;  2XUB A;  2CV2 A;  3L00 A;  2K9M A;  4PJ0 C;  1B72 A;  1W5C C;  2XF6 A;  4WX9 A;  3I4P A;  1LFU P;  2LKP A;  2DT5 A;  1S29 A;  3OY9 A;  2CS3 A;  3GLX A;  1ONV A;  5IYB J;  2BGC A;  4K2E A;  4CO8 A;  2VLA A;  2GBY A;  3KCC A;  1D1A A;  2L4M A;  3K4K A;  4S05 A;  1LFP A;  1Y56 A;  2KRF A;  2FUG 2;  4HX8 A;  3HIF A;  2R7Z J;  3S3O A;  1DU6 A;  2A5W A;  2NNN A;  3KP4 A;  2XAH A;  3WHB A;  4A93 J;  1OCT C;  2XKO A;  2DT7 B;  3CC2 I;  2X6O A;  1HDP A;  4MQ9 F;  4CYC B;  2EIN H;  2DCE A;  1W4M A;  3A02 A;  3OIQ A;  3H1C A;  3PFI A;  4UY8 I;  3LNQ A;  2VQL A;  4GDF A;  3DU5 A;  5FD6 A;  2CQK A;  2HS5 A;  3JCU C;  2FQ4 A;  2XRL A;  3F6V A;  3NRV A;  3VSL A;  1IAW A;  4M6Y A;  1LUJ B;  3G1L A;  2IT0 A;  4OMZ A;  5J40 A;  1IRF A;  2X0L A;  2L4A A;  3QOE A;  4YIF A;  3OOU A;  2BEO A;  3BCB A;  3M9A A;  1XB4 A;  2F2E A;  3HM5 A;  5EEA A;  1ZAR A;  1UHM A;  2GOM A;  3DXJ F;  4A69 C;  3H3Z A;  1S6L A;  1DUX C;  2E1M B;  1YQA A;  3H35 A;  4A0Y A;  4F55 A;  3CCJ I;  1J59 A;  2XGX A;  2VI6 A;  1CF7 A;  2KRC A;  3DPL C;  4O6J A;  3A01 A;  1STZ A;  2QQ9 A;  1NG6 A;  3E97 A;  3M7G A;  1IXC A;  4MEY F;  1QVU A;  4DIQ A;  5HLI A;  3KEO A;  1ZG1 A;  1I5Z A;  1ZHF A;  1J5Y A;  2EZI A;  5GPA A;  3LSP A;  6PAX A;  2BBY A;  2LNB A;  3QP5 A;  4I6Z A;  3CF2 A;  3K10 A;  1LVK A;  3ERE D;  2DLL A;  2Z9O A;  1C0W A;  2M87 A;  1EH6 A;  3G73 A;  1P6R A;  2JUC A;  3BQY A;  3FX3 A;  3LA3 A;  3S93 A;  2HU9 A;  3VYS B;  3MD2 A;  2ID3 A;  1D8K A;  3V8K A;  3JRB A;  4CSW A;  2H1K A;  2O6G E;  5CKT A;  2F5F A;  2LDU A;  2PBI A;  2Q0O A;  2D2W A;  3H36 A;  5IOY A;  4QIW N;  2PJR B;  5B66 C;  2YUS A;  2RGV A;  2VT2 A;  4MIM A;  4A3F J;  3ZMS A;  3WGH A;  4RGU A;  5K7H A;  3LQQ A;  2AHQ A;  1A31 A;  2HOT A;  5AON A;  3DPU A;  1GDT A;  4KFC A;  3ZQ7 A;  3S16 J;  1FP1 D;  4M3F A;  1X1P A;  2XAJ A;  4BE2 A;  2TRT A;  3J7A Y;  1FTT A;  3ABL H;  2K40 A;  1JJ6 C;  2VQH A;  1HXD A;  1DPR A;  4NB5 A;  2P0W A;  4BQN A;  1GT0 C;  1R36 A;  3OIO A;  3J7Z I;  3CDI A;  3F8B A;  1MBH A;  4UVA A;  3ASN H;  2HFH A;  1P7J A;  3BG7 A;  3E6D A;  2LBF A;  4F7Z A;  1LNW A;  3QU3 A;  4LK1 F;  1W7P B;  1OR7 A;  1U9N A;  5F0F A;  2R7O A;  4KIS A;  3DF8 A;  5IP7 J;  4RS8 A;  1ZR4 A;  4M71 A;  4XN3 A;  1TW2 A;  1V55 H;  4L0Y B;  3GX4 X;  1IV8 A;  5CVR A;  1SFE A;  2JVH A;  4CXF A;  3DCF A;  3PO3 J;  1Y0N A;  3BZC A;  4WWC A;  1R4N B;  1VND A;  5HLT A;  4A5M A;  1ORK A;  3TW6 A;  3AAF A;  2EK5 A;  3V7S A;  3OYG A;  2ZSH B;  4KNY A;  2DMN A;  1ZAO A;  2IGN A;  1U3E M;  2RVC A;  1Z1D A;  1PJR A;  2V9V A;  3IRQ A;  1UG2 A;  2RDP A;  4BJT A;  3QOD A;  1WFX A;  2FBI A;  4M73 A;  1FMV A;  3ZMD A;  3B6A A;  3IKT A;  3DBL B;  2Y9Y A;  1SMY F;  2EIL H;  4ITV A;  5HS8 A;  2K3F A;  5DCF A;  1KZH A;  2JA5 J;  1ZLJ A;  3N4M A;  4L5E A;  5ERI A;  3BTC A;  5D8K B;  5FGM A;  4BAC A;  4BHP A;  1N78 A;  5EDN A;  2LC2 A;  3KX2 A;  1XD7 A;  4BUP A;  2QVO A;  1MBK A;  3KP3 A;  2GWR A;  2LH9 A;  2NXN B;  5D5X B;  2K4B A;  3O8G A;  5KAI C;  5H2F C;  2L3D A;  5JVG F;  2OCE A;  2W84 A;  2VJ4 A;  4IOC F;  1QZZ A;  2H94 A;  1KQ9 A;  1KA8 A;  1MBJ A;  3BG3 A;  3GW2 A;  4XOP A;  3CME I;  1JJ8 C;  3P9C A;  4GRI A;  4GXO A;  4HDU A;  4IHW A;  3E5U A;  1DDN A;  5IOZ A;  1FC3 A;  3V8J A;  3ZQF A;  3CJN A;  5M5X J;  3D1N I;  1WQ2 A;  5FB2 A;  1X2M A;  2Z5U A;  5CLS A;  3CJT B;  4XRS G;  2KJC A;  3U21 A;  1TWC J;  4U7D A;  1LDJ A;  3I0T A;  4EJV A;  4BE1 A;  1BA5 A;  4M9S A;  3WU1 B;  3FWE A;  2Z16 A;  2KIF A;  1FBQ A;  2ETH A;  1UAA A;  5LEK A;  2WAE A;  2AO9 A;  1IXS B;  1EF4 A;  1RRJ A;  3B6C A;  4CYC A;  4ZZL A;  4ZTF A;  2R7T A;  1WJE A;  1CGP A;  2XPU A;  2XVC A;  2HDW A;  3OR1 C;  3CCQ I;  3NAU A;  4V19 K;  2G9W A;  4Y15 A;  4IQJ A;  2HDC A;  1USS A;  2B0L A;  2CH0 A;  1DGR M;  5CVV A;  2CQ7 A;  2X1D A;  4DBR A;  3S2W A;  3GTM J;  2EZK A;  4P96 A;  1Q1V A;  4M3D A;  1K7A A;  1X58 A;  2ZJR F;  4Y52 J;  3BG6 A;  3VB2 A;  5KAF C;  3LQR A;  1WI9 A;  3AFH A;  4MNU A;  5E8I A;  1XDS A;  3RPQ A;  3CQZ J;  1Z9C A;  1T0F A;  2HZD A;  2OF7 A;  1W0U A;  4BKX A;  4BBS J;  3VSK A;  4XKC A;  2V1X A;  1JI8 A;  4XSZ F;  2M30 A;  1IC8 A;  3RDI A;  4A6E A;  3D5S C;  5E1X A;  3Q9S A;  3HSE A;  2I10 A;  4WF2 A;  5F08 A;  2CGP A;  2XC7 A;  3IC7 A;  4LK0 F;  1M1E B;  2RQQ A;  2VAS A;  2XF5 A;  2XGC A;  5CPR B;  3E0J B;  4CCN A;  2VOD A;  3LFU A;  4PJJ A;  2K85 A;  2N8G A;  3MWM A;  3I56 I;  3K4M A;  4LG0 B;  2FMY A;  3KPH A;  2CSO A;  3GZ6 A;  1FYM A;  4Q47 A;  4I98 B;  3GF2 A;  3KYL A;  2XPW A;  4BXU A;  3HTU A;  1H9G A;  4HPQ A;  1LKX A;  1Z7U A;  1GVD A;  4UNO A;  2RAE A;  3GYH X;  1KQ8 A;  1IRX A;  4B8X A;  2PJR A;  4V2G A;  5D6E A;  3WTT C;  2NVX J;  3HJE A;  5CQG A;  4IVN A;  3KEY A;  4FT8 A;  1MMG A;  2R7W A;  3I4M J;  4DYR A;  4GGG A;  5F64 A;  3O2P E;  4XOT A;  2LLK A;  4KIB A;  4OAZ A;  3SHF A;  2L9N A;  4WXC A;  4ZYE A;  4WXH A;  1JE8 A;  3KEQ A;  4Y4R A;  2OZ6 A;  4BY7 J;  2RN7 A;  5TIS C;  1IGN A;  1S8N A;  4BDY A;  2BOL A;  3OOP A;  4EGZ A;  4M9X A;  3TQN A;  1SVM A;  2LTP A;  3BC8 A;  1ZGW A;  2ME6 A;  3QQA A;  4HEA 2;  5HLG A;  3CMY A;  2OUM A;  1IDZ A;  4C30 A;  4MTE A;  4BQA A;  3DEW A;  2VIX A;  3JRI A;  1QVT A;  4XLH A;  2HKO A;  1NG7 A;  2PMZ N;  4Q4Z F;  3SZT A;  1JGS A;  2BY1 A;  4CH7 A;  3S1R J;  2BV6 A;  4C2M J;  2XAS A;  5C4X J;  4C3J J;  3MQ0 A;  3CUQ C;  2CYY A;  5K7F A;  2WBM A;  3E5Q A;  3OV8 A;  4EJO A;  2HVR A;  2EFW A;  3DU6 A;  3E5X A;  3K6G A;  4NBQ A;  3MCZ A;  1X4P A;  2JA6 J;  2FD5 A;  3M3Y J;  2VBY A;  3GVA A;  3T0Y A;  2X1C A;  3J80 K;  1SEU A;  3RYP A;  1FBU A;  1BI3 A;  3QP6 A;  1R71 A;  2LF8 A;  4XKW A;  4LIT A; 
#chains in the Genus database with same CATH homology
 4L5I A;  1O3S A;  3ZN0 A;  3TO7 A;  1I1G A;  4DQ2 A;  2UXX A;  4ON0 A;  4S04 A;  1KYW A;  3IKV A;  1Y0U A;  3FZV A;  3I59 B;  1QGP A;  3TOB A;  3M8F A;  4UHT A;  1GXQ A;  4U0Y A;  1MGT A;  3KZZ A;  2GQQ A;  1KYZ A;  3LA7 A;  5CJ9 A;  3L2C A;  2CWE A;  1XMA A;  3V7R A;  2K4J A;  4ESJ A;  2GZW A;  2A69 F;  4UXN A;  3W6J B;  2XIG A;  3H92 A;  1F1Z A;  2V79 A;  4ESF A;  3GXO A;  4G94 A;  1S3J A;  4RAY A;  5D6F A;  1RZ4 A;  4L9N A;  3WE2 A;  1K78 A;  3KET A;  1YTY A;  1SMT A;  1XSV A;  1GHC A;  2E1C A;  1B59 A;  3WTV C;  5L3B A;  3VOE A;  2VN2 A;  1SD6 A;  4B09 A;  3BZ6 A;  3TDZ C;  3W6K B;  1MZB A;  1R58 A;  2FXA A;  3DPT A;  2IJL A;  2P5K A;  2OQR A;  5A2Q K;  3R0J A;  4I01 A;  2PMU A;  1KGS A;  3I64 A;  4KMF A;  2DU9 A;  2QZ8 A;  1D5V A;  4G8X A;  4HAM A;  4RGX A;  3ABU A;  4PCQ A;  1SD5 A;  5AIP A;  2ISY A;  3CDH A;  1NHA A;  3F8F A;  2P7V B;  3HHG A;  3ULQ B;  1HQC A;  5DCM B;  2O3F A;  1FPQ A;  3VFZ A;  2FRH A;  2R7D A;  1FLI A;  3HRS A;  3TDU C;  2MA3 A;  2VXZ A;  4O3M A;  5DD4 A;  4HYE A;  1PDN C;  3HOS A;  3QOP A;  1TNT A;  1YS7 A;  1HW1 A;  5AIQ A;  3TO9 A;  2DPU A;  3WGG A;  1RI7 A;  4IF4 A;  1HW2 A;  1T6S A;  4ZZD A;  1U8R A;  2H6B A;  3F21 A;  1JHF A;  1ZGA A;  4WCG A;  2VC1 A;  2FF4 A;  3RI4 A;  4I7H A;  2OZU A;  1ZRF A;  5K5O A;  2WTE A;  1XSD A;  4XSX F;  2KJB A;  5J6X A;  3ZP5 A;  2OA4 A;  3LAJ A;  2UZK A;  2VBX A;  4HA8 A;  2FOK A;  3KLN A;  2ADU A;  4GYI A;  2C6Y A;  5CVI A;  3ZMZ A;  3QAH A;  1K6O A;  3JW4 A;  1IN6 A;  4UV9 A;  4XBF A;  4OIP F;  1R22 A;  3HHH A;  2ZXJ A;  3F22 A;  1JHH A;  2P4W A;  1KU9 A;  4M9Z A;  4BH9 A;  4ZYG A;  2OBP A;  3SFZ A;  3EQL F;  3B73 A;  3CO7 C;  3FXR A;  3I59 A;  4Q5S F;  4GO1 A;  4U0V A;  3L09 A;  1IRG A;  1RUO A;  1HST A;  3O3K A;  1TQP A;  1VTN C;  2VOP A;  3GFM A;  3D0S A;  5F6F A;  4HF0 A;  3T8R A;  1ZYR F;  4LLL A;  1WRJ A;  4U7B A;  3B02 A;  2FU4 A;  1RNL A;  3R4K A;  1G4D A;  4FHT A;  4L18 B;  4R8H A;  4WXD A;  1H0M A;  1QZY A;  1OYW A;  3K0L A;  2Y75 A;  3V7C A;  2NNY A;  1QQI A;  4RB1 A;  4ASN A;  2EFN A;  4N9I A;  5BOX A;  3C18 A;  1YW9 A;  5IT3 A;  3BY6 A;  2EWN A;  3R0A A;  2NAZ A;  2L02 A;  1PP7 U;  5ILU A;  2LF7 A;  4LMY A;  2FEZ A;  2A07 F;  4I0A A;  3F6O A;  4U88 A;  1P4W A;  1QNT A;  1P4X A;  3KFW X;  4EMS A;  3C3W A;  3LAP A;  5DCM A;  1FP2 A;  1ZG3 A;  5EEG A;  1MDM A;  2VC0 A;  5ILV A;  1XGN A;  1O7F A;  1U78 A;  3GFL A;  3FMS A;  4FX4 A;  4I2O A;  5BPI A;  1LJ9 A;  4LB5 A;  4ZYD A;  2RV8 A;  4EVI A;  1FSE A;  2RNJ A;  1XCB A;  1W5T A;  3WTZ A;  5F1R A;  2PG4 A;  1ZRD A;  3JSO A;  4IHS A;  3CO6 C;  3CUO A;  4BAY A;  2D1H A;  2O61 A;  3R60 A;  1GXP A;  2P5V A;  3KLO A;  2UXN A;  2DTR A;  3M1E A;  1BBY A;  5E8G A;  4MTD A;  1WKM A;  3BPX A;  2D45 A;  2P8T A;  1A04 A;  3J80 Z;  2DBB A;  4IPA A;  5E20 A;  4EQQ A;  3BOQ A;  2ZO4 A;  2PI0 A;  2A6H F;  3F8M A;  4M72 A;  4AWX B;  3FMQ A;  1SD4 A;  2M1B A;  3ZMT A;  2QQA A;  3ZPL A;  4CGZ A;  1J75 A;  5LGN A;  3EYY A;  1F5T A;  2PLY A;  3M8E A;  4A0X A;  4M74 A;  4E70 A;  5LRS A;  5DYM A;  4IRG A;  2GXG A;  4CHU A;  3FM5 A;  3BJO A;  3E6C C;  3ROU A;  2A6E F;  3U1D A;  4LB6 B;  3WTS C;  4EJT A;  2O8X A;  5LEJ A;  5ICG A;  3ZMU A;  1PP8 F;  1ZG5 A;  1LEB A;  4KYW A;  1DPU A;  1O57 A;  1FY7 A;  2NRA C;  1K78 B;  3WTW C;  1FT9 A;  2EV5 A;  2IA1 A;  4KA4 A;  4BHB A;  1O3Q A;  4ESB A;  1B9N A;  2KKO A;  1U5T A;  1O3T A;  3K9T A;  1RUN A;  3U2R A;  5D4S A;  3N97 A;  5HOO A;  2HKX A;  4A2U A;  2CO5 A;  5A2Q Z;  1TBX A;  1IN4 A;  2EV6 A;  2MC3 A;  2FQ3 A;  4UVC A;  4IJA A;  2YPR A;  2OU2 A;  1ZH5 A;  4AIJ A;  3HUG A;  3I53 A;  2J5P A;  3TOA A;  2OQG A;  1QO0 D;  2NS0 A;  5IT9 K;  3LWF A;  2KIM A;  3CLO A;  2LSO A;  5DD8 A;  3I5U A;  2HEO A;  2O0Y A;  4RB0 A;  4IHT A;  1QBJ A;  1HBX G;  2IPQ X;  4OMY A;  2DPD A;  3F8C A;  3HTS B;  4L5J A;  5E1W A;  3K1P A;  3ABT A;  2ZCW A;  2HZT A;  4TV7 A;  5H20 A;  1XMK A;  4A6D A;  1B4A A;  1BI2 A;  3Q9V A;  5HS7 A;  4EM1 A;  5CVU A;  1BOA A;  1MKM A;  2PEX A;  2QEN A;  2YSR A;  1R5H A;  3RPU A;  2Y0M A;  1UFM A;  3KP7 A;  4N0B A;  1TNS A;  3FM3 A;  1DP7 P;  3GFI A;  4AIH A;  3BJA A;  1Q1H A;  4HX7 A;  4YII A;  5LRR A;  4HV6 A;  1YW8 A;  1OKR A;  5BS6 A;  3IL2 A;  1BC8 C;  3P9I A;  4NHJ A;  1ZGJ A;  2A61 A;  1XN7 A;  3P7N A;  2DQL A;  5KVR A;  3MFK A;  1XGS A;  3R61 A;  3REO A;  3U9G A;  3GO5 A;  1WSU A;  4EV0 A;  1IUY A;  1FYL A;  2XV4 S;  3K69 A;  1HKT A;  2HYF A;  4Q48 A;  1SFX A;  2M45 A;  4LLN A;  3MAJ A;  1G3T A;  1R1T A;  3CTA A;  2FE3 A;  3EUH A;  1FYK A;  3RKY A;  5DEQ A;  1P4A A;  1YG2 A;  2HWV A;  5D8L B;  1P2F A;  1S7A A;  5HDG A;  2XAQ A;  3F3X A;  1BM9 A;  2H09 A;  1T39 A;  1KU2 A;  1Z05 A;  2MBF A;  2VE8 A;  4KIF A;  3FXU A;  3I71 A;  3I58 A;  4A12 A;  4H0E A;  3KP5 A;  2WC2 A;  3SXY A;  4AD9 A;  4HDV A;  2XKP A;  1K79 A;  2Z3Y A;  3J81 K;  1Z91 A;  4FX0 A;  3WGI A;  3BP8 A;  4OIQ F;  1MJB A;  5K1Y A;  4PGG A;  2DO7 A;  4KN4 X;  4D0P A;  1YO5 C;  4YFK F;  3RKX A;  1E17 A;  3BPV A;  1MDM B;  4Y17 A;  3FF5 A;  1EV7 A;  2K27 A;  2Z33 A;  3K2Z A;  4JBA A;  4KUM A;  1R5G A;  4ENM A;  2EFP A;  4UUV A;  4P9F A;  5E17 F;  4KT5 C;  5E18 F;  1XCV A;  4GYG A;  3WU0 A;  2J5O A;  2TDX A;  2EV0 A;  3T5X A;  2ZNY A;  1XSX A;  3JTG A;  3WTU C;  3ZN1 A;  1LQ1 A;  3EDP A;  3IWF A;  4RB3 C;  4RGR A;  4Y13 A;  1ZN2 A;  1XGM A;  1O7L A;  3K1M A;  1D8J A;  1UCR A;  1BI1 A;  2E1N A;  5DV5 A;  1S7O A;  2O03 A;  3K1N A;  3ISP A;  4UV8 A;  2WWY A;  1KQ0 A;  1V4R A;  3VOD A;  3QPH A;  2FBH A;  2Y48 A;  2JT1 A;  4MEX F;  2ACJ A;  1TQI A;  2YR2 A;  1OYI A;  5LHH A;  1UB9 A;  1SD7 A;  2G7H A;  2V1D A;  2P5L C;  2DQR A;  2Z99 A;  3RJP A;  2GXB A;  4L9T A;  2FNA A;  2ZKZ A;  2F5E A;  3CUQ B;  1R1U A;  3PQJ A;  4I0B A;  4G7O F;  2VE9 A;  1ULY A;  2QUF A;  5FLX Z;  4Z2Y A;  5HDN A;  4R79 A;  1FOK A;  1L0O C;  2ESN A;  2JPC A;  3GEZ A;  4PZJ A;  2W57 A;  2VBW A;  4G7H F;  2W24 A;  5CVJ A;  5D4R A;  3WTY C;  3GZ5 A;  1OPC A;  2PMH A;  2X4H A;  5D5W B;  4EM0 B;  2XAG A;  4KN7 X;  4N9H A;  4P55 A;  2STT A;  4WK8 F;  1U5T B;  2CFX A;  3ZMV A;  5K5R A;  3KE2 A;  2ZME B;  2OD5 A;  3FMR A;  1IN8 A;  2XRN A;  4MGR A;  2F5D A;  3EYI A;  5FFX A;  5L3C A;  1F4K A;  1PUE E;  4QWQ A;  2H27 A;  3DQV C;  2IRF G;  5TRD A;  2IP2 A;  2DW4 A;  1HKS A;  3TKY A;  1P92 A;  3PQK A;  2CW0 F;  3KP2 A;  1YW7 A;  2JRT A;  5FO5 A;  5IT9 Z;  2P6T A;  3E6M A;  1J9I A;  2M8E A;  1EH7 A;  4EJU A;  3IHU A;  2EA2 A;  1Z6R A;  4ZH4 F;  3HYI A;  3LFK A;  2YX4 A;  4OIN F;  2Q2E A;  1FBS A;  1BI0 A;  1MJ9 A;  4ENN A;  2QBY B;  2XRO A;  1GVJ A;  1E2X A;  5BQT A;  5DUK A;  3RKW A;  4CYD A;  3FHZ A;  1REP C;  3T1B A;  3LST A;  3H3U A;  4OIO F;  1G6N A;  2VOO A;  4HLY A;  2PJP A;  2DI3 A;  2F5C A;  5ILS A;  1R00 A;  4QLC U;  2IA0 A;  2EJR A;  4OOI A;  4AIK A;  1SAX A;  4AVP A;  2WV0 A;  2HQN A;  2M5W A;  1I6X A;  4L9J A;  1IN7 A;  2HR3 A;  1BIB A;  5JFR A;  1YLF A;  2EFQ A;  2RKH A;  2FBK A;  4HQE A;  5L3E A;  4L9V A;  3CUQ A;  4P9U A;  4HOB A;  4GCV A;  3J7A O;  3JAM Z;  1TLH B;  5FLX K;  2FA5 A;  4M6X A;  5LLQ A;  3EET A;  5HS9 A;  4I09 A;  3WE3 A;  3RTR A;  2H6C A;  2BE5 F;  1G3S A;  4IXA A;  1V3F A;  1UST A;  2VBZ A;  3SZP A;  2QLZ A;  3GUD A;  4G7Z F;  1ZLK A;  5JR3 A;  4MHG A;  3IWZ A;  2A68 F;  1R7J A;  2QM3 A;  2W25 A;  1SFU A;  2L54 A;  2AXL A;  1BN5 A;  3SQN A;  4HV5 A;  1O3R A;  5H6R A;  1KU7 A;  1W7P D;  1ON2 A;  1T98 A;  1XGO A;  3RIR A;  2ZME A;  2DK5 A;  2PFB A;  3O6B B;  1U2W A;  5HDK A;  3J81 Z;  1IXR C;  3ECH A;  3NEU A;  4IRI A;  3QPT A;  5ICF A;  2GA2 A;  5EEH A;  5E1Z B;  3KP6 A;  4YG2 F;  4HQM A;  4BHC A;  3JSP A;  2MLG A;  4JQF A;  5D5V B;  1T2K A;  3IRR A;  3JTH A;  2EFO A;  1EH8 A;  4UVB A;  2COM A;  4OIR F;  2MLK A;  5H6Q A;  2UWM A;  1X3U A;  2HGC A;  3QRF F;  3MZY A;  5BMZ A;  3HSF A;  1W5S A;  1B6A A;  2MH2 A;  1D3Y A;  3ML6 A;  4LGW A;  3WTX C;  1XDU A;  4LJZ F;  2ZFW A;  3ELK A;  2QBY A;  2AS5 F;  1FWZ A;  4JK1 X;  4EGY A;  4ZYH A;  4PGH A;  5L3D A;  1ON1 A;  3BRO A;  4BNC A;  3P9K A;  3L9F A;  1L3L A;  1ZRC A;  4HBL A;  4MQV A;  2GIV A;  3FXQ A;  2NYX A;  5HVQ C;  1Z6T A;  2L01 A;  1TW3 A;  5LBQ A;  2V6C A;  3F8N A;  2JZY A;  2GA1 A;  2ISZ A;  3NQO A;  4YFN F;  1R23 A;  4A5N A;  4R1H A;  2QWW A;  2FNP A;  1W7P A;  1G3Y A;  1F9N A;  2YU3 A;  2XHK A;  3DV8 A;  4P5O A;  4YFX F;  2E7W A;  1J0R A;  1FNN A;  1FSH A;  1OYY A;  3RYR A;  5L3G A;  1YYV A;  4LLG F;  4L0Z B;  3BDD A;  4RB2 C;  1HKQ A;  1J7K A;  3D5L A;  2HTJ A;  2QQB A;  3JAM K;  3DFG A;  5CYV A;  4EJW A;  2E7X A;  1G3W A;  4HF2 A;  2ZJ2 A;  3Q5F A;  2EA4 A;  1B1B A;  1YS6 A;  4RGS A;  4HX4 A;  4XRF A;  5D5U B;  2XAF A;  4CZZ A;  3E6B A;  2A3S A;  5TJJ A;  4DNC A;  4KIG A;  2ELH A;  2IVM A;  3GWZ A;  3BJ6 A;  1U5T C;  3ECO A;  4HLX A;  5HLH A;  1BJA A;  3HRU A;  4HF1 A;  3MZH A;  2HQR A;  1IW7 F;  4CDG A;  3V4G A;  4ENK A;  2IW5 A;  4OU0 A;  1ODD A;  2G7U A;  5J8C A;  3MEX A;  3GFJ A;  4KIC A;  4KMU X;  1ZRE A;  2HYG D;  3BWG A;  4XLP F;  1IF1 A;  3COA C;  4O5V A;  2HOE A;  2K7L A;  1R1V A;  5KK1 A;  3WOD F;  3LA2 A;  2QYO A;  1B9M A;  5LGU A;  3DP7 A;  3C7J A;  2R3S A;  3HSR A;  1U6G A;  5BPD A;  3DKW A;  1CF7 B;  4HZF A;  3WG9 A;  5FD5 A;  3L7W A;  4LG0 A;  5DDG A;  5K5Q A;  4A0Z A;  1YFH A;  4G9Y A;  2FSW A;  3T8T A;  1BIA A;  5LHI A;  4RAZ A;  2RC4 A;  1YIO A;  1FX7 A;  2PQ8 A;  3G3Z A;  1WWX A;  5ED4 A;  1HSJ A;  3C1D A;  5JHU A;  3HRM A;  2YX7 A;  1JXS A;  1HW5 A;  1LB2 A;  2W85 A;  1TTY A;  2EB7 A;  2MD5 A;  1LVA A;  3E3V A;  2JPB A;  2D1V A;  2CG4 A;  2P7C B;  2VT3 A;  2R7F A;  5ICE A;  2K02 A;  4ETS A;  1I1S A;  3HRT A;  4G6D A;  1MJA A;  5LGT A;  2FML A;  2ZNZ A;  4EM2 A;  1H9T A;  3QU6 A;  3TGN A;  1IN5 A;  2STW A;  1TQM A;  4I02 A;  2P6S A;  4IRH A;  3F23 A;  1LEA A;  2OAZ A;  4CIC A;  2PN6 A;  1KU3 A;  3I54 A;  5JI6 A;  1J2X A;  2ESH A;  2JTV A;  1LDD A;  2RQP A;  2ZBK A;  2VON A;  2Q8K A;  3HOT A;  2GAU A;  4U0W A;  3R6S A;  1UHW A;  1AOY A;  4G6Q A;  4PDK A;  4XLN F;  2BYV E;  3KZY A;  5LHG A;  1RIO H;  2K86 A;  1OMI A;  2JSC A;  5DUI A;  4NQW A;  3DEU A;  3F72 A;  2A5Y B;  3V8L A;  2HTS A;  2MH9 A;  4LFU A;  2DK8 A;  1AWC A;  2DFI A;  1MD0 A;  5L3F A;  4LD5 A;  1I27 A;  4ENJ A;  5ICC A;  2DAO A;  1LDK B;  4BYY A;  2KIU A;  1FZP B;  3VEP A;  4KDP A;  1QPM A;  1BC7 C;  3TO6 A;  5FFZ A;  1IZ1 A;  4HW0 A;  2V1U A;  5J8F A;  5JVT A;  1T38 A;  2IA2 A;  2XUB A;  3L00 A;  4WX9 A;  3I4P A;  2LKP A;  2DT5 A;  1S29 A;  3GLX A;  1ONV A;  2BGC A;  4K2E A;  4CO8 A;  3KCC A;  2L4M A;  4S05 A;  2KRF A;  4HX8 A;  3HIF A;  2NNN A;  3KP4 A;  2XAH A;  2XKO A;  4MQ9 F;  1W4M A;  3PFI A;  5FD6 A;  2CQK A;  2HS5 A;  3F6V A;  3NRV A;  1IAW A;  4M6Y A;  2IT0 A;  4OMZ A;  1IRF A;  2X0L A;  2L4A A;  4YIF A;  2BEO A;  3M9A A;  1XB4 A;  2F2E A;  1ZAR A;  1UHM A;  3DXJ F;  3H3Z A;  1S6L A;  1DUX C;  4A0Y A;  1YQA A;  1J59 A;  2XGX A;  1CF7 A;  3DPL C;  4O6J A;  1STZ A;  2QQ9 A;  3E97 A;  3M7G A;  1IXC A;  4MEY F;  1ZG1 A;  5HLI A;  3KEO A;  1I5Z A;  1ZHF A;  1J5Y A;  6PAX A;  2BBY A;  2LNB A;  3QP5 A;  3ERE D;  2DLL A;  2Z9O A;  1C0W A;  2M87 A;  1EH6 A;  3G73 A;  1P6R A;  3FX3 A;  3LA3 A;  3V8K A;  1D8K A;  2O6G E;  2F5F A;  2LDU A;  2PBI A;  2Q0O A;  2D2W A;  2RGV A;  2VT2 A;  3ZMS A;  3WGH A;  4RGU A;  3LQQ A;  5AON A;  4KFC A;  3ZQ7 A;  1FP1 D;  2XAJ A;  1HXD A;  1DPR A;  4NB5 A;  1R36 A;  3F8B A;  4UVA A;  2HFH A;  3E6D A;  4F7Z A;  1LNW A;  3QU3 A;  4LK1 F;  1W7P B;  1OR7 A;  3DF8 A;  4RS8 A;  4M71 A;  1TW2 A;  4L0Y B;  3GX4 X;  5CVR A;  1SFE A;  4CXF A;  4WWC A;  4A5M A;  3AAF A;  2EK5 A;  3V7S A;  4KNY A;  1U3E M;  1ZAO A;  2RVC A;  1Z1D A;  2V9V A;  3IRQ A;  2RDP A;  2FBI A;  4M73 A;  3ZMD A;  3IKT A;  1SMY F;  5HS8 A;  5DCF A;  1ZLJ A;  3N4M A;  5ERI A;  5D8K B;  5FGM A;  4BHP A;  1XD7 A;  2QVO A;  3KP3 A;  2GWR A;  5D5X B;  2K4B A;  2L3D A;  2W84 A;  1QZZ A;  2H94 A;  1KQ9 A;  1KA8 A;  3GW2 A;  3P9C A;  4GXO A;  4HDU A;  3E5U A;  1DDN A;  1FC3 A;  3V8J A;  3CJN A;  1WQ2 A;  5FB2 A;  2Z5U A;  5CLS A;  2KJC A;  4U7D A;  1LDJ A;  3I0T A;  4EJV A;  4M9S A;  3WU1 B;  3FWE A;  2KIF A;  1FBQ A;  2ETH A;  5LEK A;  1IXS B;  4ZZL A;  1CGP A;  2XVC A;  2G9W A;  4Y15 A;  2HDC A;  1USS A;  2B0L A;  5CVV A;  3S2W A;  4P96 A;  1K7A A;  3VB2 A;  3LQR A;  1WI9 A;  4MNU A;  5E8I A;  1XDS A;  3RPQ A;  1Z9C A;  1T0F A;  2V1X A;  4XSZ F;  2M30 A;  3RDI A;  4A6E A;  5E1X A;  3Q9S A;  3HSE A;  4WF2 A;  2CGP A;  3IC7 A;  4LK0 F;  2VOD A;  3MWM A;  4LG0 B;  2FMY A;  2CSO A;  3GZ6 A;  1FYM A;  4Q47 A;  4I98 B;  3GF2 A;  4BXU A;  3HTU A;  1H9G A;  1Z7U A;  4UNO A;  3GYH X;  1KQ8 A;  4B8X A;  5D6E A;  3WTT C;  4IVN A;  4FT8 A;  4GGG A;  5F64 A;  3O2P E;  4KIB A;  3SHF A;  4WXC A;  4ZYE A;  4WXH A;  1JE8 A;  3KEQ A;  2OZ6 A;  2RN7 A;  1S8N A;  3OOP A;  4EGZ A;  4M9X A;  3TQN A;  5HLG A;  4BQA A;  4MTE A;  2HKO A;  4Q4Z F;  3SZT A;  1JGS A;  2BV6 A;  2XAS A;  3MQ0 A;  3CUQ C;  2CYY A;  3E5Q A;  3OV8 A;  4EJO A;  2EFW A;  3E5X A;  3MCZ A;  2VBY A;  3GVA A;  3T0Y A;  3J80 K;  3RYP A;  1FBU A;  1BI3 A;  3QP6 A;  2LF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...