2OD5A

Crystal structure of a putative nucleic acid binding protein (jcvi_pep_1096688149193) from uncultured marine organism at 1.79 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
b'ETESMKTVRIREKIKKFLGDRPRNTAEILEHINSTMRHGTTSQQLGNVLSKDKDIVKVGYIKRSGILSGGYDICEWATRNWVAEHCPEWTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of hypothetical protein (JCVI_PEP_1096688149193) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 1.79 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Dna binding protein
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2od5A00
2W85A 1V4RA 3GFIA 2HS5A 3SZPA 3KP4A 2LDUA 3DEUA 4ENMA 4KUMA 1USTA 2P5LC 4YIFA 1B1BA 5J8CA 1IN8A 4UUVA 2G7UA 3KP3A 4I02A 3GZ5A 4CO8A 1AOYA 1ZLJA 1MD0A 3WU1B 3WTVC 4KYWA 1LB2A 4LK0F 3J7AO 1YW8A 4EVIA 3KP7A 2NNYA 1JE8A 1LDDA 4KFCA 1SD6A 5H6RA 1BI3A 4P9UA 2XAGA 1W4MA 1T6SA 3BPXA 2ESHA 1C0WA 3K2ZA 2ZJ2A 3GZ6A 5ICFA 2P5KA 3RI4A 2VC0A 3HRTA 3K9TA 4G6QA 3M8FA 3FMRA 2H94A 1IXRC 1HW2A 3DQVC 5LRSA 2VOOA 1SMTA 3V7CA 1WWXA 2PI0A 3WTYC 5CJ9A 3F8NA 5BMZA 1TQPA 4ZZLA 2F5CA 2K27A 4DNCA 2JPCA 1J0RA 3QP6A 3Q5FA 4FX4A 4XLNF 3N97A 4HV6A 2L3DA 3KCCA 2YU3A 5H20A 2FMYA 1ZRDA 1GVJA 2AXLA 4I0AA 4R79A 4YIIA 5L3EA 4MGRA 2V1UA 5A2QZ 3FZVA 3RKYA 3RTRA 2R3SA 2L4MA 2YX7A 2FF4A 4L0ZB 3C3WA 1ZYRF 2V1XA 3RYRA 4A0YA 3ZQ7A 3WG9A 1RUOA 4Q4ZF 3CO6C 3GF2A 2NAZA 2VODA 1RUNA 4OU0A 2E1CA 4G94A 1R23A 2DT5A 4HF2A 1ZGAA 2A5YB 3HHHA 3I4PA 1UHWA 2EK5A 3TDUC 3QRFF 2BEOA 1LQ1A 1TTYA 3ELKA 3LWFA 2CQKA 2HEOA 1R5GA 3IWZA 4IVNA 1MKMA 1XD7A 4XLPF 4XSXF 2A3SA 3NRVA 3J81K 1T98A 2QVOA 2H27A 1R58A 3E6CC 1I27A 3D0SA 1TW2A 1EH6A 3I71A 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 4U0YA 2HKOA 3H3UA 1OMIA 2LNBA 5EEHA 2VT2A 2BV6A 4LG0A 2MLGA 3JTHA 1TLHB 4O6JA 1IF1A 3WTTC 4LGWA 3KEOA 2EV5A 1T0FA 3ZMUA 3IHUA 4UXNA 4IHSA 4LFUA 5D4RA 1SFXA 3PFIA 3NQOA 2NYXA 4GCVA 2BYVE 2DK8A 1BIBA 4YG2F 3T8TA 1J59A 1YS7A 1IRFA 4LLNA 3P9KA 1G3SA 1XN7A 5KK1A 2MLKA 2F5FA 2OZ6A 1TNTA 1D3YA 5DD4A 5D5UB 2QQ9A 4RB2C 1KQ8A 2QBYA 1GXPA 4UVBA 3WTXC 5FB2A 4PGGA 3WU0A 4A0ZA 5AIPA 4MHGA 4DQ2A 2P5VA 3I58A 3ISPA 3HSRA 1B9NA 3V7RA 5E8IA 1ZGJA 3KP2A 3EETA 2RC4A 4M74A 4L5JA 3IC7A 3GYHX 2O0YA 3OOPA 3U1DA 3ZMTA 2ZXJA 1WSUA 1S3JA 3KE2A 3VB2A 2XAFA 4ZZDA 5ICEA 2WC2A 4A0XA 3DFGA 3TGNA 3L2CA 1R1TA 2OBPA 5LGUA 3JAMK 1ZG3A 4S05A 2GXGA 2PEXA 4LMYA 2VC1A 5DEQA 1O3RA 2HTJA 2A61A 2IA1A 3DPTA 2FBHA 4MNUA 3HRMA 2E7XA 2RNJA 2HFHA 1SD5A 1XGNA 4CXFA 1KA8A 1R7JA 2B0LA 1EV7A 4I98B 5L3FA 4XRFA 1B9MA 3CUQC 3O3KA 2EV0A 5K5OA 3HRSA 4NHJA 1YW9A 1T39A 1R36A 3FF5A 2DQRA 2DBBA 3GUDA 2D45A 4HW0A 3WGIA 1F4KA 4E70A 1Z1DA 3F8BA 4N9IA 2BE5F 2HWVA 2KKOA 4G7OF 5DCMB 3IWFA 2L4AA 1ZLKA 3QP5A 4IRHA 4HAMA 2CSOA 3HIFA 3DPLC 5ILVA 5LEJA 3QAHA 1HSTA 2YSRA 2ISZA 1MJ9A 4KN7X 2BBYA 2FU4A 4U7DA 5TJJA 2F5EA 4UNOA 4A6EA 1BI0A 2DFIA 4A5NA 4G6DA 3GVAA 2L54A 3ERED 2PLYA 3U2RA 3CLOA 3M9AA 4EM0B 4LD5A 2OQRA 3MFKA 2XRNA 4Y13A 2RKHA 2IRFG 5HLGA 3TDZC 5LRRA 4M9ZA 5DCFA 4UHTA 1J75A 1SD4A 4CGZA 3HUGA 3T1BA 5L3DA 3DP7A 3CDHA 1ZG1A 5CVUA 2M5WA 2K4JA 4A2UA 3P9CA 3HSFA 4HDUA 2HOEA 3K1MA 1U8RA 5BS6A 2CGPA 1STZA 4KIFA 2Q8KA 1TQIA 5DDGA 1IZ1A 2QLZA 2KIUA 4BH9A 4CDGA 4KN4X 2GWRA 4I2OA 1U5TC 4AVPA 1OPCA 4TV7A 2Y48A 4P5OA 1QBJA 4LJZF 2Z3YA 3ULQB 2D1VA 4MTEA 3RKXA 3K0LA 5K1YA 2Z99A 3HTUA 2K7LA 1W7PB 3P7NA 3E5UA 3HOTA 4IHTA 2A68F 1G4DA 1E2XA 3ZN0A 2YX4A 3PQJA 3BP8A 4JK1X 5IT9K 1FBUA 5ICCA 2F2EA 3ZPLA 2QQAA 2QYOA 3HRUA 4EGZA 1YFHA 1IN5A 2MD5A 3BJ6A 4RB3C 5K5RA 3WTSC 2OQGA 4Q48A 2Q2EA 2EFWA 1GHCA 4IJAA 4ESFA 3L7WA 3F23A 3LFKA 4UV9A 4B8XA 4QWQA 4HX8A 4CYDA 2GA2A 1T2KA 1F5TA 3ECHA 1FT9A 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 3SQNA 1TW3A 1FZPB 2MA3A 1ODDA 3EYIA 1DDNA 1KYZA 2HZTA 5DCMA 3LSTA 2FSWA 3CTAA 4ZH4F 1U3EM 5HDNA 5D6EA 1W7PD 1KU2A 2DW4A 5DUIA 3B73A 1IUYA 4P9FA 1P2FA 1W5SA 4MQ9F 4CICA 2DI3A 3F72A 4PDKA 2Y75A 4JBAA 1KQ9A 3ZMSA 1YO5C 1IXSB 3V8LA 3COAC 3VEPA 4AIJA 2IW5A 4UV8A 5FO5A 4PZJA 2IVMA 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 5BOXA 1WI9A 1IRGA 4WCGA 5BPDA 1ZH5A 3LA2A 1P4XA 1FOKA 5DUKA 5HS8A 3ZP5A 3ABUA 2MC3A 2FA5A 5ILUA 3E5XA 2IA2A 2P8TA 1XDSA 4O3MA 1Z9CA 2KRFA 4EGYA 3JSOA 1QZZA 3H92A 2P7CB 3TQNA 4WK8F 3EQLF 3JTGA 5E8GA 4R8HA 4BYYA 1Y0UA 2COMA 3GFLA 3R60A 1FC3A 1L3LA 1ZARA 2JZYA 3WTZA 5F1RA 2H6BA 3TOBA 2M45A 3JSPA 1OYIA 5D8KB 2GZWA 2ESNA 2PMUA 4YFNF 5LLQA 1HKSA 1LEAA 2OAZA 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 4OINF 4L9JA 3TKYA 1HBXG 3R6SA 4ZYDA 1BC7C 4KMFA 3D5LA 4U88A 1B6AA 5E20A 1H0MA 2UZKA 1VTNC 1S7OA 2JRTA 3K69A 3M7GA 1WRJA 2HR3A 2IPQX 1FNNA 1LVAA 4M6YA 1O57A 1YS6A 2LSOA 1ZG5A 4YFXF 4U7BA 1F1ZA 5D4SA 4NB5A 4ZYEA 1FSEA 1XSXA 1HXDA 3FMSA 2XKPA 3FXRA 1MDMA 4RS8A 4I01A 3REOA 3T8RA 4A5MA 2VONA 4BHBA 1KU3A 3L9FA 3NEUA 2FE3A 3J80K 2QWWA 2Y0MA 1HQCA 3PQKA 4KIBA 4RGSA 5FLXK 5AONA 4N0BA 4HYEA 2RV8A 3FM5A 4EV0A 5HLHA 5LGTA 1TQMA 1MJBA 5LGNA 5FD5A 1IW7F 1OYYA 1ZRFA 3GW2A 4WWCA 5JFRA 1BJAA 2W24A 2DAOA 1HW1A 2FRHA 2OU2A 2EFPA 1FYMA 1FP1D 1I5ZA 4RAZA 3GWZA 4IPAA 2DPDA 2E1NA 5CVRA 5CVJA 2ZFWA 5L3BA 3WGHA 1KQ0A 3R4KA 4M71A 2P7VB 1U78A 5FD6A 5ICGA 2KJCA 3S2WA 1QNTA 4F7ZA 2EA2A 4OIOF 4U0VA 2O6GE 1LNWA 3HTSB 5D5VB 3GFMA 5E1XA 5LBQA 2P4WA 2OD5A 2M87A 4ESBA 3J81Z 3O2PE 1XSDA 2D1HA 4HF1A 2FBKA 2NRAC 5TRDA 1YG2A 3BROA 3QPHA 1XCBA 1P4AA 2HGCA 4L5IA 1ZAOA 5JR3A 1LDJA 1HSJA 2ZNYA 3LQRA 4EJTA 2R7DA 4GYIA 4MQVA 4OMYA 2CO5A 3T0YA 4YFKF 1CGPA 4R1HA 2EFNA 4IRIA 5HVQC 1QPMA 2MH9A 3E5QA 3CJNA 2GAUA 2PN6A 3J80Z 3E6BA 1XMKA 4HZFA 2AS5F 4WF2A 3ROUA 4D0PA 1ON2A 1F9NA 4L9VA 1B4AA 4HF0A 3RPUA 3U9GA 3BDDA 3R0AA 2PFBA 1XCVA 1FBSA 5LHGA 1IAWA 3T5XA 2K86A 1O7FA 3I0TA 3QOPA 4RB1A 3ECOA 3KLNA 2M1BA 2EFQA 6PAXA 2XASA 4L9NA 4BAYA 3BY6A 4HX7A 4CHUA 4KIGA 3V8JA 5D8LB 1IN4A 3G73A 2LKPA 4KNYA 3WE3A 4HQEA 3LAJA 1UFMA 4AIHA 3LA7A 2XAQA 2XGXA 5IT3A 1HKQA 2STWA 2DK5A 3SHFA 1CF7B 1REPC 3P9IA 3C18A 3BJAA 4UVCA 4OOIA 4PCQA 3JAMZ 2L01A 1KU9A 2FQ3A 2A69F 3VODA 1SD7A 5BPIA 5F6FA 5D5XB 2DTRA 1FBQA 1YYVA 2G9WA 1TNSA 4HQMA 2L02A 4G7HF 2G7HA 2ELHA 5DV5A 4M9XA 1RIOH 4EJOA 2LF8A 3VOEA 2VBYA 1BOAA 3GFJA 1USSA 1LJ9A 4ENNA 3V7SA 3LAPA 2V6CA 2O8XA 4GGGA 5FFXA 4KT5C 3KP6A 5CVVA 3EYYA 2OZUA 4A6DA 1PP8F 3GEZA 1J7KA 1D8JA 1B59A 2D2WA 5A2QK 1PP7U 1FYKA 4AIKA 2DO7A 1SAXA 1BI1A 3I54A 4IF4A 2PBIA 4CZZA 1O7LA 3F21A 1Z6TA 2ISYA 2WTEA 2V9VA 4LLLA 1KGSA 2FOKA 3CUOA 1ZHFA 2DPUA 3MEXA 3F3XA 1S7AA 4L18B 1H9TA 3CUQB 1G3WA 1IN6A 3W6KB 2FMLA 3HSEA 5HDGA 2HQNA 4UVAA 4NQWA 4HDVA 5JHUA 4BHCA 1FPQA 1XGOA 1BI2A 3BJOA 1XGSA 3WODF 1L0OC 3BWGA 2STTA 2ZNZA 2HKXA 5J6XA 1WKMA 1I1GA 1XB4A 1NHAA 1EH8A 2WWYA 5LHHA 3M8EA 4BXUA 2GA1A 1S8NA 3IRQA 2YR2A 5F64A 1I1SA 4FHTA 3KLOA 2ZBKA 3ZMVA 1R1VA 3R61A 2IP2A 2QBYB 4XSZF 5H6QA 2GXBA 2O61A 1PUEE 1Z91A 3TOAA 2ZMEB 3K1PA 4EM2A 3HHGA 4M9SA 2VT3A 3DV8A 2CG4A 3F8FA 1XDUA 2VBZA 1XSVA 3W6JB 1DUXC 3WTWC 5AIQA 5E18F 4MEXF 3DKWA 1OKRA 3QU6A 1BN5A 3FM3A 3N4MA 5J8FA 3IRRA 2JPBA 1RZ4A 1UCRA 3LA3A 2P6TA 1K79A 2HYFA 4RGUA 3BZ6A 1IXCA 4K2EA 4RB0A 4XBFA 5D5WB 4G9YA 5JVTA 4N9HA 1CF7A 3RYPA 3OV8A 3GX4X 2WV0A 1K6OA 5L3CA 1OYWA 1FWZA 5IT9Z 2QQBA 2R7FA 1FYLA 3CO7C 1P92A 4AD9A 1LDKB 3HOSA 1SMYF 4FT8A 3KZZA 4ZYGA 2O3FA 4OIPF 1U5TB 1S29A 2PMHA 3F6VA 2EB7A 2KIMA 1J2XA 2OA4A 2KJBA 4HX4A 2VXZA 4H0EA 4RGXA 2VBXA 5ERIA 3E97A 3ZMDA 1W7PA 4PGHA 1ZRCA 2P6SA 1O3QA 4Q5SF 1D8KA 4G7ZF 2HTSA 1G3YA 5ED4A 2FNAA 1XMAA 4FX0A 2PJPA 2NS0A 2K02A 2CWEA 4Q47A 4HOBA 3QU3A 1MJAA 2VE9A 4M72A 1YTYA 3I64A 2VN2A 1I6XA 2FXAA 1Z05A 2QZ8A 4G8XA 2A6EF 2W84A 4IXAA 3GXOA 2RGVA 1ONVA 2GQQA 3CUQA 4OIRF 2UXXA 4WXHA 1SFUA 2JSCA 4B09A 2M30A 4GXOA 3K1NA 4KICA 5D6FA 2W25A 2J5PA 3BPVA 3RKWA 4BNCA 5CLSA 1BBYA 2BGCA 3Q9VA 4GYGA 5E1WA 3GLXA 1KU7A 1QGPA 1JHFA 4LLGF 4LB5A 2UXNA 3I59B 1R5HA 4KA4A 2VE8A 3C1DA 1G6NA 3ABTA 2F5DA 1J5YA 2ZKZA 1AWCA 1FY7A 4U0WA 4RGRA 2ZMEA 2FEZA 1SFEA 1ULYA 3BOQA 1W5TA 2Z5UA 3R0JA 3SFZA 2ZCWA 1ON1A 4HV5A 3G3ZA 1K78B 2ADUA 2V79A 1U6GA 2UWMA 1D5VA 1J9IA 2W57A 4ENJA 2K4BA 3ML6A 1G3TA 3MAJA 3MQ0A 5EEGA 3HYIA 5HDKA 4MTDA 4WXCA 2C6YA 3MWMA 1RNLA 3KZYA 2M8EA 2ETHA 1FSHA 4I0BA 3MCZA 2A6HF 2XKOA 4WXDA 1O3TA 2CFXA 2ACJA 4ETSA 2YPRA 4LB6B 4LK1F 4P55A 3M1EA 1FP2A 2PQ8A 3DXJF 1O3SA 3ZMZA 4EQQA 3C7JA 3E6DA 3E6MA 2A07F 2HDCA 1JHHA 3KFWX 2HYGD 4WX9A 3F6OA 1U5TA 3KP5A 4L9TA 1YIOA 4Z2YA 1FX7A 2QM3A 2MBFA 4ZYHA 5E17F 3WTUC 3O6BB 5FLXZ 2RQPA 4EMSA 2LF7A 4ESJA 2XIGA 3WE2A 4O5VA 4ASNA 1T38A 3WGGA 2Z9OA 4HBLA 1QQIA 2DLLA 1H9GA 5HS7A 1WQ2A 2TDXA 1S6LA 3B02A 2H09A 2X4HA 2RVCA 2RDPA 1JGSA 3EUHA 2EFOA 1DPRA 1R22A 3F8CA 3RDIA 2CYYA 3V8KA 2IT0A 3FWEA 4S04A 1R1UA 5CVIA 2XUBA 2X0LA 5LHIA 3JW4A 2FBIA 4Y17A 3IKVA 2EA4A 2XHKA 2RN7A 1ZREA 2Q0OA 2XROA 1TBXA 4A12A 2Z33A 3L00A 1YQAA 5BQTA 4OIQF 4ON0A 2EJRA 1KYWA 1QZYA 5JI6A 4GO1A 1R00A 3ZN1A 2H6CA 2XAHA 1ZN2A 3FHZA 2QENA 1U2WA 3DF8A 3MZYA 4EJUA 3AAFA 1BC8C 2FNPA 2EV6A 1DP7P 1FLIA 2IJLA 5FFZA 2XAJA 1Q1HA 2MH2A 1DPUA 5K5QA 4MEYF 3I59A 4HLXA 4I7HA 4HLYA 4AWXB 4I09A 1IN7A 1BIAA 1HKTA 4M73A 4L0YB 5FGMA 3FX3A 2XVCA 4EJVA 1LEBA 2VBWA 2CW0F 5E1ZB 3IL2A 1Z7UA 2VOPA 1UHMA 2EWNA 3E3VA 1PDNC 5ILSA 1BM9A 3LQQA 2JTVA 3FXQA 1YLFA 1P6RA 3IKTA 3RPQA 2E7WA 4M6XA 3SXYA 2J5OA 3TO7A 3Q9SA 1A04A 1V3FA 1K78A 2QUFA 5DYMA 4Y15A 1YW7A 1XGMA 2JT1A 5HS9A 2O03A 2DU9A 1P4WA 4RAYA 3L09A 3RJPA 3FXUA 5HOOA 4BQAA 5KVRA 4EJWA 3H3ZA 5L3GA 1EH7A 1JXSA 2KIFA 3V4GA 3KETA 4BHPA 3F8MA 4ENKA 1QO0D 2PG4A 1HW5A 3QPTA 1OR7A 3EDPA 4IRGA 4QLCU 1K7AA 2NNNA 4LG0B 3SZTA 5HLIA 2V1DA 3I5UA 4OMZA 3TO9A 2GIVA 2ZO4A 1MDMB 1E17A 1X3UA 1Z6RA 3FMQA 1MZBA 2XV4S 3TO6A 5CYVA
chains in the Genus database with same CATH superfamily
2W85A 1V4RA 2EZIA 3GFIA 4BXFA 1VQ5I 2HS5A 1I3AA 2HOSA 1RKTA 3SZPA 3KP4A 2KQRA 1OCZH 2LDUA 3GTKJ 2HNHA 3DEUA 2LD5A 2M34A 3S93A 3DU5A 4ENMA 4KUMA 1USTA 2EPFA 3Q0UA 2P5LC 4YIFA 4RM3A 1B1BA 2X1DA 5J8CA 1IN8A 4UUVA 2G7UA 2X51A 3KP3A 4I02A 3GZ5A 3PL8A 3LSPA 4CO8A 4D1QA 4OAYA 1AOYA 3BZKA 1ZLJA 1MD0A 2DMPA 3WU1B 1NG6A 3WTVC 4KYWA 3FIWA 2WAQA 2VQCA 1LB2A 4BE1A 4LK0F 3J7AO 1YW8A 4EVIA 3KP7A 2L7ZA 1MBFA 2NNYA 2CW8A 1JE8A 1LDDA 2VI6A 1SD6A 4KFCA 5H6RA 1BI3A 4PFOA 4P9UA 3S3OA 2XAGA 1W4MA 2Y69H 3KZIC 3DKXA 4Y33A 1T6SA 3BPXA 2ESHA 4NNJA 1C0WA 5FRMA 3K2ZA 2ZJ2A 3GZ6A 1G8XA 5ICFA 2X1CA 2P5KA 3RI4A 3IH3A 2VC0A 2BXYA 3ABLH 3HRTA 1KONA 3K9TA 2K9LA 4G6QA 2DMQA 3ABKH 3M8FA 2WAEA 3FMRA 2H94A 1IXRC 2HPIA 1HW2A 1Y6IA 3DQVC 5GAHJ 5LRSA 1WZ2A 4MO7A 2VOOA 1SMTA 3OYLA 3V7CA 1WWXA 2PI0A 4NUBA 3WTYC 5CJ9A 2BHYA 4ZYAA 3F8NA 5BMZA 4AU7A 1TQPA 4ZZLA 2F5CA 2DA7A 2K27A 4DNCA 2JPCA 4A3IJ 1J0RA 3QP6A 3Q5FA 3FDYA 1OISA 4NDLA 3CMEI 4XLNF 4FX4A 4PJNA 3N97A 3BR3A 4HV6A 3H5NA 3IAM2 2UUZA 3HKZN 2L3DA 1FTTA 4XICA 3G1OA 2LLKA 2YU3A 3KCCA 2LY2A 4BKXA 2E36A 1JI8A 4JX4A 5H20A 1LE8A 2JJ7A 2FMYA 1ZRDA 1GVJA 3ZQIA 2AXLA 4ZTJA 4BY7J 4I0AA 4CSWA 1VQKI 4R79A 3G2BA 2VKDA 3JREA 4YIIA 5L3EA 4MGRA 2V1UA 4LIVA 5A2QZ 1MIJA 2BY2A 2CH0A 3FZVA 3RKYA 3RTRA 3CD6I 2R3SA 2L4MA 2YX7A 2FF4A 4L0ZB 3C3WA 1ZYRF 5TISC 2V1XA 3RYRA 1OR7C 4A0YA 3ZQ7A 2R5ZA 2RREA 3WG9A 1RUOA 1VQ7I 2GOXB 2WADA 2WAQN 4Q4ZF 3CO6C 5M5WJ 3GF2A 2NAZA 2VODA 3S1QJ 4D5FA 4EATA 2K3FA 1RUNA 3HGYA 3JRGA 2QEXI 4OU0A 2E1CA 2FX0A 1GV5A 4G94A 1DGWY 2B7EA 1R23A 2DT5A 1YX3A 4HF2A 1ENHA 2R7RA 1UAAA 1YX5A 1ZGAA 1LFUP 2A5YB 3HHHA 4IHWA 3I4PA 5FRNA 1UHWA 2EK5A 3TDUC 3QRFF 2BEOA 2QF7A 3K2AA 2Y9ZA 1LQ1A 1TTYA 3ELKA 2ZFUA 2NVTJ 3B6CA 3LWFA 4D5CA 5EGOA 2JA6J 2CQKA 2HEOA 2O9LA 3DEEA 1R5GA 3IWZA 4IVNA 5EDNA 3CC4I 1MKMA 1XD7A 4XLPF 1T95A 4XSXF 2A3SA 2KRHA 5E3MA 3NRVA 3J81K 1T98A 2QVOA 2TRTA 2H27A 2L7KA 1R58A 3E6CC 4PUSA 2QA4I 1I27A 1JTXA 3FXKA 3D0SA 1TW2A 4B48A 1EH6A 4AM3A 3DTKA 1QA6A 1QVTA 1AA7A 1AHDP 3I71A 2ZJPF 4HEA2 2M9HA 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 1OCTC 4U0YA 3GTLJ 2MC4A 4HNUA 1MBGA 1LUJB 2HKOA 3H3UA 1OMIA 2MYSA 4V19K 2ZC2A 5H2FC 2LNBA 5EEHA 2VT2A 2BV6A 2QCOA 3Q0WA 3WG7H 3LSMA 4LG0A 1S72I 2MLGA 5J1YA 3JTHA 1TLHB 4M3EA 4O6JA 2EIJH 3WTTC 1IF1A 1IDZA 5FKLA 4LGWA 3KEOA 2EV5A 1T0FA 3ZMUA 1BR1A 4E7ZA 3IHUA 4UXNA 4IHSA 4LFUA 5D4RA 1SFXA 3PFIA 5JLWA 3OYKA 3NQOA 2NYXA 4UUSB 1XX5A 3SFIA 4GCVA 2BYVE 1LFBA 1E3PA 1D1CA 2DK8A 1BIBA 4YG2F 3T8TA 3BR0A 1WCMJ 1J59A 1YS7A 3CCUI 1IRFA 4LLNA 2R7VA 3BR5A 3P9KA 1G3SA 2VKEA 2R5YB 1XN7A 5FJ8J 3HUGB 2W48A 5KK1A 2MLKA 2LKSA 4BY1J 4DJAA 4EEFG 4CCMA 2F5FA 2HPMA 3ZQGA 1LVKA 2XGCA 2OZ6A 4XL9A 1TNTA 2Y2ZA 1D3YA 2MD0A 1FTZA 1K61A 5DD4A 5D5UB 1ZELA 3BCAA 4XONA 2QQ9A 2LMDA 1IJWC 4RB2C 5J4YA 1KQ8A 4IQ4A 2QBYA 1GXPA 4UVBA 2Z2SB 2BOLA 3WTXC 3S1MJ 3LNQA 5FB2A 4BBSJ 4PGGA 5IOYA 3WU0A 1N75A 4A0ZA 5DS9A 5EEAA 2K9MA 4LIUA 1RPWA 2DJIA 5AIPA 2I10A 4MHGA 1U8BA 4DQ2A 2P5VA 1MW7A 2WBMA 3OYNA 3I58A 2CUZA 3RPUD 2R7OA 3HSRA 1B9NA 3ISPA 3OWTA 3RQIA 3IH2A 3V7RA 1ZGJA 5E8IA 1E3HA 3KP2A 3EETA 2LVSA 1APLC 2RC4A 3BTLA 3DTEA 2LTPA 3TL4X 4BQNA 1TWCJ 3VYTB 3ZGKA 5F27A 4M74A 1R9TJ 1WJFA 4L5JA 2LG4A 3IC7A 3SEQA 4ZDPA 3GYHX 2O0YA 3OOPA 2DA4A 1EKEA 3U1DA 3ZMTA 2ZXJA 3PIOF 1WSUA 1S3JA 3KE2A 2HI3A 3VB2A 3VYUB 2XAFA 4ZZDA 2X6YA 5ICEA 2WC2A 5KAFC 4A0XA 3DFGA 3TGNA 2BY1A 3SJMA 2E71A 2XF6A 3L2CA 1R1TA 2OBPA 5LGUA 3JAMK 4FTHA 1ZG3A 4S05A 3SZGA 2GXGA 2ECCA 2PEXA 4LMYA 2DFHA 2VC1A 5DEQA 4RLQA 2IXSA 5C3EJ 1O3RA 2HTJA 2A61A 4BEHB 1RR8C 2IA1A 1SEUA 5CKTA 3DPTA 2EIMH 2H8RA 2FBHA 4MNUA 3HRMA 2E7XA 2RNJA 2HFHA 3QYBA 1X1CA 1MNEA 1SD5A 3CCMI 1U9NA 1MBKA 4BXXJ 1XGNA 4JOMA 3QYFA 4PSWA 1KA8A 4CXFA 1IRZA 2QSHX 1R7JA 4OAZA 2B0LA 2Q2EB 1EV7A 4I98B 5L3FA 4XRFA 2VLAA 3AFHA 1B9MA 2QKLB 1HCRA 3HOVJ 1EF4A 3CUQC 3O3KA 2EV0A 2WY7Q 2LFBA 2O8KA 3D5SC 3OOUA 1T0FC 2AQFA 5K5OA 4I99C 4A3CJ 3HRSA 4NHJA 1YW9A 2DJNA 1T39A 2DA1A 1YRNB 3BR6A 1R36A 3FF5A 3DKYA 2DQRA 2DBBA 3GUDA 2D45A 4HW0A 5FLVA 5TGTA 4DIQA 3WGIA 2K5CA 1F4KA 4E70A 3OYDA 1Z1DA 4XRSG 2M7AA 3F8BA 2GBYA 4B44A 4N9IA 3ZRGA 2BE5F 2HWVA 4B47A 3MKLA 3HC7A 2KKOA 2GLOA 5DCMB 4G7OF 5IYCJ 2E2HJ 3IWFA 2ZJRF 5EZGA 5BNGA 2L4AA 4B3XA 3PFYA 1ZLKA 4ABZA 3J7YJ 3QP5A 4IRHA 4HAMA 1FOWA 3OYJA 1PJRA 2CSOA 1AU7A 3HIFA 2L2OA 3ASNH 3DPLC 2ZJQF 5ILVA 1OCRH 2V4JC 5LEJA 4D7NA 3QAHA 1HSTA 3SYTA 1UMQA 4LITA 2YSRA 1FOXA 4B3AA 1HF0A 1V55H 2ISZA 3S1NJ 1MJ9A 4AYBN 4QIWN 2ZMEC 2IEKA 4KN7X 4QTRA 2BBYA 2FU4A 4U7DA 5TJJA 3HOWJ 2F5EA 2HZDA 4UNOA 4A6EA 1BR2A 1D1AA 3OL4A 4XIDA 1BI0A 2DFIA 4A5NA 1ZGWA 1LPQA 4G6DA 3MVPA 4DZJA 4IHXA 4QSHA 3GVAA 5GADJ 2KISA 2XPUA 2L54A 3OIPA 1K6YA 3ERED 2K40A 2PLYA 3U2RA 3CLOA 1Y1WJ 3M9AA 3ERMA 4EM0B 4LD5A 4CCJA 2OQRA 3RCOA 5B3SH 3MFKA 2CRGA 4BS9A 4PJJA 2XRNA 1JUSA 3QPSA 4Y13A 4UUSA 5E3LA 2RKHA 2HDWA 5GAGJ 2IRFG 4BE0A 5HLGA 1GV2A 3TDZC 5LRRA 3M8JA 4M9ZA 5DCFA 1K4SA 4UB6C 2L9VA 1RR7A 4UHTA 1J75A 1SD4A 2R5YA 4CGZA 2ZXWH 3HUGA 3T1BA 3QQAA 5L3DA 3DP7A 1B72B 3K70C 3CDHA 1ZG1A 3CCLI 1OCOH 5CVUA 2M5WA 1FMVA 2K4JA 4A2UA 3P9CA 3HSFA 2LYCA 1VQ6I 4W1UA 4HDUA 2HOEA 3K1MA 2DA6A 1U8RA 5BS6A 2CGPA 1STZA 3F9KA 4KIFA 2Q8KA 1TQIA 2BY3A 2EQRA 2M0MA 5DDGA 1IZ1A 2QLZA 2KIUA 3JRBA 4BH9A 4CDGA 4KN4X 2GWRA 2W4SA 4I2OA 1U5TC 4AVPA 1A31A 1OPCA 3GLLA 4TV7A 3OMYA 1S5LC 2Y48A 1HC8A 3KPHA 2H8WA 4P5OA 1QBJA 4LJZF 3CC7I 3CZ6A 2Z3YA 1RRJA 3ULQB 2D1VA 4MTEA 3VSKA 1K83J 3RKXA 3HOZJ 2MSYA 3K0LA 5K1YA 1X2MA 2WB1N 4KJZA 1N25A 5C4XJ 2CMPA 2Z99A 2HQ5A 3HTUA 4B4CA 4XM3A 2K7LA 3N05A 1W7PB 3HG9A 3P7NA 2LKXA 3E5UA 3RZOJ 3HOTA 1W36D 2JA5J 2A68F 5EZHA 4IHTA 4M6VA 2CUEA 5B1AH 3S3NA 1G4DA 5FLMJ 1E2XA 4UUTA 3ZN0A 2YX4A 3PQJA 3BP8A 4JK1X 3Q3SA 2CUJA 4XLHA 5IT9K 1FBUA 1XPXA 5ICCA 3GCMA 2F2EA 4E4HA 3HKZA 3ZPLA 2QQAA 3KYDB 3H9GA 2QYOA 3HRUA 4BGDA 4EGZA 1YFHA 2LR8A 5KNLA 2OJED 2NOGA 1IN5A 1V5FA 2IS1A 3ZQHA 2MD5A 2X1EA 2V9KA 3BT9A 3BJ6A 4FETA 4RB3C 4IKFA 3KYCB 4XLFA 4E7HA 5K5RA 3WTSC 3L2UA 5K7HA 2OQGA 4Q48A 2Q2EA 3AG3H 2EFWA 1GHCA 4BACA 2P81A 4IJAA 2R7TA 3HPHA 2FJ1A 4ESFA 3L7WA 3F23A 3LFKA 4UV9A 4A3BJ 4B8XA 4QWQA 4HX8A 4M3DA 4CYDA 1YRNA 1OJLA 2GA2A 1VFCA 4BDZA 2FUG2 1T2KA 3FK7A 1F5TA 3ECHA 1FT9A 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 2QSFX 1E0EA 3SQNA 1TW3A 3I55I 1FZPB 2MA3A 2E34A 1ODDA 3EYIA 1D5YA 1DDNA 2K9SA 1KYZA 3K4JA 1BR4A 3I9V2 2OPTA 2HZTA 5DCMA 1NK2P 3LSTA 2HVSA 5J1RA 2FSWA 3KEYA 5CPRB 4A3KJ 4FE7A 3CTAA 4ZH4F 2MG4A 1U3EM 4MLOA 5HDNA 2UV1A 2XPVA 5D6EA 3U1KA 2EILH 3ONQA 1W7PD 4BE2A 2LREA 1KU2A 2DW4A 1KZHA 5DUIA 1PVEA 2BW3B 1VQNI 3B73A 2FQ4A 3PNYA 1IUYA 2DOAA 3FKIJ 3K4KA 1M1EB 4P9FA 4RAGA 1YI2I 1P2FA 1W5SA 4MQ9F 4CICA 2DI3A 2NXNB 3F72A 5J1UA 4PDKA 3E7LA 2Y75A 4JBAA 1KQ9A 3ZMSA 1YO5C 1IXSB 4CUGA 1HDPA 1FIPA 3V8LA 5M3FJ 2VQLA 1TT0A 2DT6A 1WJ5A 2VJ5A 3COAC 2O5RA 5FKNA 3VEPA 4AIJA 1WJAA 3FHNA 2MGQA 2MFZA 2IW5A 4UV8A 1JT0A 5FO5A 4PZJA 2M7BA 2CV2A 2IVMA 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 1I3QJ 4KITB 5BOXA 3PO2J 1WVRA 5IP7J 1WI9A 1IRGA 2XSDC 1VQ4I 2NVQJ 4WCGA 5BPDA 1WPKA 2DT7B 2M4KA 1ZH5A 3LA2A 2F4MB 4BU2A 2BY0A 1P4XA 1FOKA 5DUKA 4A69C 2TCTA 5J4VA 5HS8A 3ZP5A 3L2WA 2Y0SN 3ABUA 2MC3A 2FA5A 5ILUA 3E5XA 3HBLA 1T33A 2IA2A 2P8TA 1XDSA 4O3MA 1Z9CA 2KRFA 4EGYA 3JSOA 1QZZA 1A6IA 2E1MC 2E5NA 2W82A 3H92A 3LSGA 1F43A 2P7CB 3TQNA 3OL3A 3K4MA 2R7XA 4BJ5C 4WK8F 1N77A 3HDDA 3EQLF 3JTGA 5E8GA 1B72A 3CESA 2XAUA 4R8HA 1YJ9I 2LH9A 4BYYA 2LK2A 2IGOA 3TP3A 1Y0UA 5F04A 1VQ9I 4FQGA 2COMA 2FOWA 3GFLA 1MBHA 1SVMA 3CQZJ 3R60A 3FK6A 4XKBA 3TW6A 1R6RA 1FEXA 1FC3A 2RQQA 3PIPF 2WY8Q 1L3LA 3H9QA 2JA7J 4V2FA 1ZARA 2JZYA 3VPRA 3WTZA 5F1RA 2H6BA 3TOBA 2JUGA 2M45A 3JSPA 2JQ7A 1OYIA 5D8KB 2F4IA 3OYCA 2DOFA 3QYEA 3O8HA 2KZVA 4II2A 2GZWA 3AKZA 2ESNA 4IEJA 2DMTA 2PMUA 3HZJA 2Y31A 1ZTRA 4YFNF 5LLQA 3L2RA 5K7ZA 1HKSA 1LEAA 2OAZA 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 1XMXA 5K7FA 4C2UA 4OINF 4L9JA 4D9JA 4W97A 3BQZA 3TKYA 4PJ0C 3K4LA 4XORA 1HBXG 3R6SA 1YHQI 4ZYDA 1BC7C 4KMFA 3D5LA 1X3WB 4U88A 1QHHD 1B6AA 1Z0XA 5E20A 1H0MA 5KHDA 2UZKA 4RA2A 1VTNC 1S7OA 2JRTA 3K69A 3OS0A 2E2JJ 2W1OA 3M7GA 4I76A 1WRJA 2HR3A 3S2DJ 2IPQX 3GTQJ 1FNNA 1LVAA 1NG7A 4M6YA 1O57A 4C30A 1R5ID 1YS6A 4IL6C 4IZZA 2LSOA 2K85A 1ZG5A 4C2TA 4YFXF 4U7BA 1Z77A 2L7MP 4F52A 1F1ZA 5D4SA 3GMEA 4NB5A 4DZPA 5GAEJ 2MW8A 4YELA 4XOTA 4ZYEA 4A3MJ 1UELB 1FSEA 2RAEA 3K6GA 1XSXA 3K4CA 1HXDA 3FMSA 2E5ZA 2HVQA 2OTLI 1D0XA 1MMGA 2XKPA 4IX7A 3FXRA 4M3FA 1MDMA 4RS8A 4I01A 3REOA 1XG1A 3T8RA 4DYCA 1VQPI 4A5MA 1TZLA 3JRAA 5B5EC 3AL0C 2VONA 4BHBA 2JVGA 2NVYJ 1KU3A 2VASA 3PSFA 3L9FA 5E79C 1ZK8A 1Y39A 3WHCA 4RDUA 3NEUA 4E7KA 1WJBA 2FE3A 3J80K 2QWWA 2Y0MA 3VYRB 3M4OJ 1HQCA 3PQKA 4KIBA 4RGSA 1R49A 5FLXK 5AONA 1MSEC 4N0BA 4HYEA 2ZXIA 4DBRA 2RV8A 3AG2H 3CCEI 3FM5A 2P0WA 4EV0A 1JTYA 4IHVA 5HLHA 5LGTA 5IP9J 1TQMA 1MJBA 5LGNA 5FD5A 2NS8A 3I4NJ 3CJTB 5CQGA 1OCCH 1TWGJ 4NC7A 3ESWB 1IW7F 1OYYA 1TL8A 1WJDA 5DM7F 2VQHA 2PX9A 5F0FA 1IUFA 4M3BA 2KZGA 3HM5A 1ZRFA 3GW2A 4WWCA 1I6HJ 2OF7A 1FJLA 5JFRA 1BJAA 2XRLA 2W24A 2DAOA 1A5JA 4BUPA 1HW1A 2FRHA 2OU2A 2EFPA 1YJWI 1FYMA 1FP1D 1I5ZA 2BW3A 2OC6A 3NARA 1EA3A 3GWZA 4RAZA 5GPCA 4IPAA 3SDGA 2DPDA 2VB6A 2CS3A 2E1NA 1UG2A 2LY1A 5CVRA 2A6TA 1X19A 2R7QA 2ZFWA 5CVJA 3WGHA 5L3BA 3C2GA 1KQ0A 1H89C 4JP0A 3R4KA 5FKMA 3OYBA 4M71A 1JKQC 4A3DJ 2P7VB 1TT5B 1U78A 4E6KG 3LFUA 5FD6A 5ICGA 3H0GJ 2KJCA 1POGA 3S2WA 5IYDJ 3SEZA 1QNTA 1X2NA 3NWSA 5GP9A 4AYBA 3EPZA 5EYRA 1OCPA 2H1KA 2ID3A 4U87A 3ABMH 3S32A 2AXTC 1HDDC 3M07A 1QU3A 2IS2A 2KDOA 4XN0A 2CU7A 4F7ZA 3IV5A 2EA2A 4OIOF 1G2HA 4NC8A 4U0VA 1BA5A 3OYMA 4YRVA 1YJNI 2O6GE 5J3LA 1LNWA 2BHZA 3U21A 2E35A 4GDFA 4A93J 4FASD 3HTSB 5D5VB 3GFMA 5E1XA 3L2QA 2VL8A 3PNVA 5LBQA 2P4WA 2OD5A 2M87A 1DGRM 1Z3YA 1RC9A 4AC0A 4ESBA 3J81Z 3MD2A 4RMNA 3E1SA 2VPRA 3O2PE 1XSDA 2D1HA 4HF1A 2FBKA 4GRIA 2NRAC 1YOVB 1IV6A 2M4GA 4CYCB 5TRDA 1YG2A 3BROA 3QPHA 3JCUC 1XCBA 1WFXA 1P4AA 2HGCA 4L5IA 1MH3A 5EG0B 3NAUA 1ZAOA 5JR3A 1LDJA 1HSJA 2VXDA 1A35A 2ZNYA 3CMYA 2HDDA 4NQWB 1RKWA 1MMAA 2QQ8A 4HNTA 2KT0A 2KP6A 1J09A 1WJCA 1T56A 1X1BA 3LQRA 4EJTA 1Y1VJ 5HNHA 2R7DA 3JRIA 3S16J 4GYIA 4MQVA 4XR6A 3BG3A 1MMNA 3CCYA 4OMYA 2IS6A 1WHUA 2CO5A 3T0YA 4YFKF 1CGPA 4PSXA 1GLNA 4R1HA 2R7SA 2EFNA 4IRIA 2LBFB 3UR3C 5HVQC 1QPMA 2MH9A 1T08B 4ZC3A 3E5QA 2CJJA 3H9JA 3AG1H 3CJNA 2CFOA 2GAUA 3CJQB 2PN6A 3J80Z 3TBIA 4QPOA 4DGWB 1F36A 3E6BA 4F93B 3OYEA 2KMUA 1GT0C 2DYSH 1XMKA 4HZFA 1P7JA 3OSFA 3S3MA 2AS5F 3B6AA 3BTCA 1D0ZA 3H1CA 2ZB9A 4WF2A 4XKVA 3ROUA 4D0PA 1ON2A 1F9NA 2VKVA 1K4TA 1WH5A 4L9VA 2DCEA 1B4AA 4C9YA 4HF0A 4PJMA 4N4NB 3RPUA 3U9GA 3KX2A 4CH7A 3BDDA 3R0AA 2K3PA 2PFBA 3GBGA 1XCVA 4AIDA 2AHQA 5FKOA 1DU0A 2WB1A 1FBSA 2BXZA 3BR1A 5LHGA 3T5XA 4FCYA 2K86A 3FXLA 1IAWA 2V6EA 1O7FA 1SVLA 4ANJA 3I0TA 2OUMA 1ETQA 3QOPA 3BCBA 4RB1A 3BR2A 4RLFA 3ECOA 3F0CA 3KLNA 3IP4B 1R71A 3RZDJ 2ME6A 1GDTA 3G6EI 3DLAA 3LOCA 2M1BA 2EFQA 6PAXA 2XASA 1ZR2A 3NWTA 3HGGA 4L9NA 3HEFA 3IH4A 4BAYA 3BY6A 4HX7A 4CHUA 1V5GA 4KIGA 3A01B 3WHBA 3PJRA 3V8JA 3K4BA 5D8LB 5EF6A 1IN4A 1VQLI 3OIQA 3G73A 2LKPA 4KNYA 3WE3A 1CQTA 3H3VK 4HQEA 4HG2A 3LAJA 1UFMA 3BG7A 4AIHA 3LA7A 2XAQA 1X4OA 1MSFC 1ORKA 2XGXA 2E2IJ 5IT3A 1HKQA 1UG0A 1MMDA 2DK5A 2STWA 3VWBA 3SHFA 1CF7B 1REPC 3OR1C 3P9IA 2I8DA 3V42A 2A5WA 3C18A 2CQNA 3BJAA 4UVCA 2V1NA 4OOIA 5EJCA 4RBOA 4PCQA 3JAMZ 2CQQA 1QZEA 2L01A 1KU9A 1RETA 3HOUJ 2FQ3A 2A69F 3VODA 1SD7A 5BPIA 5F6FA 5D5XB 5B66C 2DTRA 3LSIA 2M2EA 1FBQA 2LP0A 3FXOA 2XF7A 1YYVA 2M8GX 2G9WA 3JRHA 4HSTA 3BG6A 2X85A 2JA8J 1TNSA 4HQMA 1IRXA 2L02A 4G7HF 2G7HA 1R4MB 3PUBA 5FROA 2BZTA 3HXLA 2ELHA 4XLEA 5DV5A 4XOPA 4M9XA 1X4PA 1ETYA 2QGUA 2Z1DA 2L7FP 3CCVI 1RIOH 3SDBA 3TEDA 3E0JB 4JX6A 4EJOA 5F08A 1ETXA 2LF8A 1TWFJ 2HYJA 2PMZN 3OY9A 2HQAA 3VOEA 2OTJI 1MH4A 5IY5H 2VBYA 1BOAA 5JLXA 4A3FJ 1V5EA 3GFJA 3K7AJ 1USSA 1LJ9A 4ENNA 3CF5F 3V7SA 3LAPA 2AO9A 4MFEA 2DA2A 2V6CA 2O8XA 1VI0A 2K9QA 4GGGA 5FFXA 3JRDA 1MNDA 4KT5C 3KP6A 3QWLA 5CVVA 3A1YA 3EYYA 2OZUA 4A6DA 3I56I 5GTHC 1PP8F 3GEZA 1J7KA 1HA8A 1IV8A 3IUOA 4Y3OA 1D8JA 1B59A 4B43A 5LFAA 4IHYA 2R4GA 2D2WA 2R7ZJ 3H36A 4BQQA 5A2QK 1PP7U 1FYKA 3BTIA 4AIKA 1G59A 2DO7A 3D1NI 3TMOA 3CLQA 2L9RA 2X6WA 1SAXA 1BI1A 3G1LA 3BG5A 3I54A 4IF4A 2PBIA 4BEHA 5HODA 4CCNA 4JYKA 4CZZA 4C3JJ 1O7LA 5C44J 3F21A 1Z6TA 2CUFA 3I4MJ 2ISYA 2WTEA 2VJIA 2V9VA 1V54H 2OV7A 3PO3J 4LLLA 5DM6F 3CP2A 3MMYB 1ACIA 1KGSA 1OLTA 4OWRB 4F3QA 2FOKA 3CUOA 4GFBA 1IO2A 1ZHFA 2N8GA 1JGGA 2DPUA 3MEXA 2V7FA 2Y0SA 3F3XA 1S7AA 4L18B 3ZCOA 1H9TA 4J01A 3CUQB 1G3WA 1YITI 1IN6A 3W6KB 2FMLA 1E3OC 3HSEA 4A3JJ 5EG0A 3GTMJ 1H88C 5HDGA 2HQNA 4J19A 4UVAA 4NQWA 4HDVA 1TC3C 2YU9J 5JHUA 4BHCA 1FPQA 2IGMA 1XGOA 1BI2A 3ZQLA 3DCFA 2JMWA 3BJOA 3OYIA 1IG7A 1XGSA 3D5RC 3WODF 3H0DA 2W7NA 1L0OC 3BWGA 3LSJA 2STTA 3CCRI 2ZNZA 2HKXA 2HOAA 5J6XA 2R93J 2EZLA 2DN0A 3FISA 1WKMA 1I1GA 1XB4A 2DOEA 2LBFA 4CCOA 1NHAA 2VQGA 1EH8A 2WWYA 4A3GJ 5LHHA 1MMSA 3LSKA 3M8EA 4BXUA 3GTGJ 3PNTA 2GA1A 4HNVA 1S8NA 3IRQA 2YR2A 5F64A 2F48A 1I1SA 4FHTA 2ID6A 3KLOA 2PJRB 2ZBKA 3QPLA 3ZMVA 1R1VA 3R61A 2IP2A 3H5AA 2KIQA 3ZR8X 2QBYB 4XSZF 4C3IJ 3HL2A 5H6QA 3O8GA 2ELKA 2GXBA 4E7JA 2O61A 1PUEE 1Z91A 5GPAA 3TOAA 1VQOI 3KIOA 2NS7A 2VIXA 2NVUB 2ZMEB 3PUFA 3K1PA 2M3AA 2DFFA 1Y8RB 3LL7A 4EM2A 4HRIA 4KT6A 3HHGA 4M9SA 2VT3A 1X58A 3DV8A 5IP6A 4E7LA 2CG4A 4M3GA 3F8FA 1XDUA 2VBZA 1XSVA 3RSNA 3W6JB 2YS9A 1DUXC 3WTWC 5AIQA 5E18F 2BVMA 4MEXF 1ERDA 3DU6A 2ELJA 3DKWA 2JA2A 1OKRA 5HLTA 2IGKA 3QU6A 4XKCA 1BN5A 3FM3A 3W2AA 2JPBA 5J8FA 3IRRA 1RZ4A 1UCRA 3LA3A 3N4MA 4L5EA 3JRCA 1X3ZB 3K10A 2P6TA 3A01A 5J40A 3GTPJ 1H8AC 1BW5A 3L1PA 3MKZA 1K79A 3HB9A 2HYFA 4RGUA 5F0CA 1FOYA 3TP0A 3I3LA 3BZ6A 2HXOA 1IXCA 5FKKA 1W0TA 4K2EA 4RB0A 4XBFA 3A0HC 4G9YA 5D5WB 5JVTA 4N9HA 1I39A 1Y0NA 1CF7A 1U9OA 2KHMA 3RYPA 1D1BA 3FXMA 4UY8I 3H5RA 1QHGA 3OV8A 1B8IB 4BL0B 1UJ8A 2XDVA 2VJJA 1Y56A 2DFEA 3GX4X 1NH3A 2O7OA 2WV0A 1K6OA 5L3CA 1SFKA 3MN2A 1VQMI 3KYLA 1OYWA 1FWZA 5IT9Z 2F6CA 3A2KA 2QQBA 2R7FA 4X6AJ 1FYLA 5JHFA 3Q0VA 3CO7C 1ZKGA 3TW7A 1IC8A 1P92A 4AD9A 2GIZA 5E3OA 1LDKB 1ETWA 4XMYA 4CCKA 5B1BH 4CZCA 3HOSA 1ITYA 2HU9A 2DA5A 1SMYF 4FT8A 3W2WA 3KZZA 1IDYA 3LMMA 4ZYGA 4G12A 2O3FA 4OIPF 3BQYA 1U5TB 1S29A 2ME0A 3ZQFA 2PMHA 4IQJA 3X2QH 4MFDA 2X9DA 3F6VA 2EB7A 5JVGF 2KIMA 5LD2C 1J2XA 4LOCA 2OA4A 1QRYA 2KJBA 1VF9A 4HX4A 2VXZA 4H0EA 1QVUA 2GXAA 4RGXA 2DTZA 2VBXA 1GVDA 1VQ8I 5ERIA 2G0EA 3E97A 3OS1A 2VUMJ 3ZMDA 2DDAA 3G1MA 1SANA 1W7PA 4PGHA 1SFOJ 2R0QC 1ZRCA 2P6SA 3S17J 1WH7A 1O3QA 4Q5SF 1D8KA 3W2VA 4G7ZF 2HTSA 1G3YA 5ED4A 2FNAA 3CP8A 1XMAA 1UHSA 3ZQQA 4FX0A 1ZR4A 2PJPA 1OQYA 2NS0A 3VDXA 3HPGA 3CCQI 2CV1A 3QOEA 2K02A 2CWEA 4Q47A 4PJLA 4RAFA 3ZXSA 4HOBA 3QU3A 1MJAA 3DBHB 2F5VA 1W0UA 4AVZA 2VE9A 4II3A 4C2MJ 4M72A 4XKWA 1YTYA 3I64A 2IBDA 3JR9A 2LOOA 2X48A 2VN2A 3G71I 2WA0A 2JVHA 3K70D 1I6XA 2FXAA 3VSLA 1Z05A 2QZ8A 4G8XA 4NC6A 2A6EF 2VKHA 3HOXJ 1TWAJ 2KDZA 2W84A 4IXAA 3GXOA 4E7SA 2RGVA 4YEJA 1ONVA 4LG3A 2GQQA 2XC7A 3CUQA 4OIRF 1P9QC 2KRCA 2UXXA 4WXHA 1YE9A 1W36C 2X6XA 1SFUA 1RESA 2JSCA 1SVOA 2AQEA 2E19A 4B09A 2M30A 3GTOJ 4GXOA 4YIRX 3BTJA 3K1NA 4KICA 5D6FA 1XS9A 2W25A 2XB0X 1MNMC 1S7EA 2LRDA 2J5PA 2FD5A 3A0BC 3BPVA 3GZNB 2KFDA 3RKWA 4BNCA 2LY9A 2JWTA 2LC2A 1HOMA 4V2GA 5CLSA 3BLYA 1BBYA 2BGCA 3Q9VA 4GYGA 5E1WA 3GLXA 1KU7A 4X1EA 2QKMB 1NTCA 1QGPA 1JHFA 2OCCH 5F0HA 1BJZA 3OYAA 3P5JA 4LLGF 4LB5A 2UXNA 3I59B 3W3CA 2HVRA 1R5HA 3C2BA 4KA4A 1VNDA 2VE8A 3VYSB 3C1DA 4D7MA 2PJRA 1G6NA 2DMUA 3ABTA 4XLAA 2EINH 5IOZA 2F5DA 1J5YA 1MBJA 1XTAA 2ZKZA 1AWCA 1WGXA 3K4NA 1Z21A 1FY7A 4Y52J 1D0YA 4U0WA 1A6QA 4RGRA 2ZSIB 2ZMEA 2FEZA 1ETKA 1SFEA 1ULYA 2V26A 3BOQA 1W5TA 2Z5UA 3R0JA 3SFZA 4BJTA 2CQXA 2ZCWA 1AKHB 2DXIA 1TWHJ 1ON1A 1JKRC 4XRSA 4HV5A 3G3ZA 2WV1A 1K78B 2ADUA 2V79A 5KCMA 1DU6A 1U6GA 3S14J 2UWMA 2HXIA 2KLOA 1D5VA 1J9IA 2JN6A 2W57A 2L5QA 4ENJA 1JUPA 2VJ4A 3OYFA 2ZXHA 2K4BA 4ITVA 2JK3A 5KAIC 2E60A 3ML6A 1G3TA 4G6TB 3MAJA 3MQ0A 1IGNA 5EEGA 3GTJJ 3CMAI 2IS4A 3HYIA 5HDKA 3PM1A 3OS2A 2ECBA 4MTDA 1N78A 4WXCA 2C6YA 1S9HA 3DWLE 3MWMA 1RNLA 3A02A 3KZYA 1DP3A 1PUFB 1PYVA 3A4CA 3CF2A 2M8EA 4FISA 2ETHA 3OYGA 1FSHA 2XF5A 4I0BA 4XN3A 4DYQA 1JJ8C 3MCZA 2E1MB 3FKJA 2A6HF 1Z3XA 2XKOA 4WXDA 1Q1VA 1O3TA 2CFXA 4UB8C 4KISA 2ACJA 4ETSA 1BL0A 2YPRA 2E1OA 1B8IA 4LB6B 4LK1F 3IAS2 4P55A 3LSRA 4BJ6C 2Q1ZB 3M1EA 3S8PA 1FP2A 1T8IA 3AG4H 1WI3A 3RQ4A 2F4OB 1JT6A 3ZOBA 2EH3A 2PQ8A 3BZCA 2DA3A 3DXJF 1O3SA 3ZMZA 4NBQA 3EUKL 3FXJA 3CJRB 2JUCA 4ZDLA 4EQQA 4IO9F 1W5CC 3C7JA 3E6DA 1P7IA 3E6MA 2A07F 2DODA 2HDCA 1JHHA 2CQ7A 3KFWX 2HYGD 2EZKA 3F6OA 4CA0A 4WX9A 2HOTA 2Y30A 1U5TA 3KP5A 4L9TA 3LSHA 1YIOA 3EUAA 4Z2YA 2R7UA 1FX7A 2QM3A 2MBFA 2WAFA 2CV0A 4ZYHA 5DTDA 5E17F 3WTUC 2R7WA 3O6BB 5FLXZ 2RQPA 4EMSA 3M3YJ 2LF7A 4ESJA 5J47A 1OFCX 2XIGA 1UZCA 3CMMA 4O5VA 3WE2A 4ASNA 3WGGA 3CCSI 1T38A 3J7AY 4H4KC 3M1CA 5M5XJ 4XRMA 2Z9OA 4HBLA 2EBIA 2EZHA 1QQIA 2DLLA 3ASOH 1H9GA 2MABA 5HS7A 3OYHA 1WQ2A 2TDXA 1S6LA 3B02A 2PMZA 1O4XA 2H09A 2X4HA 2RVCA 2OCEA 2L9SA 2RDPA 1JGSA 4E7IA 4JX5A 1HLVA 3EUHA 2EFOA 1A36A 1DPRA 3CDIA 4IOCF 1R22A 3F8CA 3RDIA 4F92B 2CYYA 3PSIA 3V8KA 2IAIA 2IT0A 4B1RA 3FWEA 1YIJI 4S04A 1W1WE 3L2VA 1R1UA 5CVIA 2XUBA 4A3EJ 2X0LA 3MZ8A 5LHIA 4F91B 2B63J 3JW4A 2FBIA 1MBEA 4Y17A 3IKVA 3OR2C 2EA4A 2XHKA 4DBQA 2XB5A 2RN7A 5HNFA 4I6ZA 4J00A 2CW7A 2RNGA 3S1RJ 1ZREA 1FMWA 4DW6A 3DPUA 2Q0OA 4BBRJ 2QSGX 2XROA 2YUSA 2ZSHB 1TBXA 4A12A 4P1WA 2Z33A 2XGDA 3FBNB 2COBA 2EIKH 1LKXA 4F55A 3AL0B 3L00A 2GM4A 1YQAA 4XK4A 1X1DA 5BQTA 4OIQF 1QPIA 4ON0A 1SC7A 4ZDOA 3DTIA 3FBIB 3DBLB 2EJRA 2L9NA 1KYWA 1DQUA 1QZYA 4BQOA 5JI6A 3A03A 1LE8B 4GO1A 4Z6YA 1R00A 3ZN1A 2NVXJ 2H6CA 4PFPA 3S2HJ 2XAHA 1ZN2A 5F1JA 3FHZA 1Y8QB 4DOZA 2M0CA 2QENA 4DYRA 2GOMA 1U2WA 2H1LA 4X0GA 1ETOA 3DF8A 3DLLF 3CDLA 3MZYA 4EJUA 3AAFA 1LFPA 3RKQA 1BC8C 4RM2A 2FNPA 2EV6A 1DP7P 4FE4A 3HOYJ 1FLIA 2IJLA 2W00A 4XLCA 5FFZA 2XAJA 3S15J 1Q1HA 2R5ZB 2MH2A 4QPQA 2B9SA 1Z7LA 1DPUA 1BOBA 2NOJB 4MIMA 2K9NA 3MKYB 3WU2C 4MEYF 5K5QA 2D5VA 3I59A 4HLXA 4I7HA 5M3MJ 4HLYA 4AWXB 3CC2I 4I09A 1IN7A 1BIAA 4XNFA 1HKTA 4M73A 4L0YB 9ANTA 5GTIC 2KL4A 5M5YJ 2XSJC 5FGMA 1FIAA 2XVCA 3FX3A 4EJVA 3BG9A 2VPLA 2BVLA 2ICWG 1LEBA 2Y9YA 1JKPC 2DDBA 2VBWA 2CW0F 5E1ZB 3IL2A 1JJ6C 4ZTFA 1Z7UA 3BC8A 2VOPA 1UHMA 2EWNA 3C2HA 3E3VA 1PDNC 4A3LJ 1SAUA 5ILSA 1JUMA 1BM9A 1U0JA 3LQQA 1ZQ3P 2JTVA 1AKHA 3FXQA 1YLFA 1P6RA 3IKTA 1WJEA 3DEWA 3QODA 2E7WA 3RPQA 4M6XA 2J5OA 3Q9SA 3SXYA 1V3FA 1A04A 3TO7A 4C3HJ 1I50J 1K78A 2QUFA 4CCLA 5DYMA 4Y15A 4Y4RA 1YW7A 3JRFA 1XGMA 2JT1A 5EGOB 1X1AA 3CCJI 4IOAF 1BW6A 5HS9A 3HJEA 5IYBJ 2V9PA 3H35A 2X6OA 4N4OB 2JSPA 2DU9A 2O03A 4XQFA 1P4WA 1NK3P 5CQEA 4RAYA 3J7ZI 3L09A 2R92J 4AUXA 3RJPA 3W6VA 4Y7NJ 3FXUA 5HOOA 4BQAA 5KVRA 4HPQA 3G4SI 4EJWA 3H3ZA 5L3GA 3MKWB 1EH7A 2DMNA 2IGNA 1JXSA 3UNGC 3OSGA 1ETVA 1X1PA 1Z67A 1XC5A 2KIFA 2KPMA 3EUHC 3V4GA 3KETA 1PUFA 4BHPA 2XGEA 2I5UA 3F8MA 4ZJZA 1JKOC 4ENKA 1R4NB 3UKGA 1QO0D 3OIOA 2PG4A 1HW5A 3QPTA 2JRMA 1TP4A 1OR7A 3EDPA 4IRGA 5E3NA 4QLCU 1K7AA 4CYCA 2NNNA 4LG0B 1EJ9A 2DYRH 1VZ0A 2Z16A 3SZTA 2V1DA 5HLIA 5IPAA 3I5UA 4OMZA 3TO9A 2GIVA 2XPWA 3ZQCA 2ZO4A 1MDMB 1E17A 2L0KA 1X3UA 1Z6RA 3FMQA 1GUUA 4PK4A 1MZBA 4HSRA 4S0HB 4BDYA 2A05A 3DBRB 2XV4S 3TO6A 5C4JJ 5CYVA
chains in the Genus database with same CATH topology
2W85A 1V4RA 3GFIA 2HS5A 3SZPA 3KP4A 2LDUA 3DEUA 4ENMA 4KUMA 1USTA 2P5LC 4YIFA 1B1BA 5J8CA 1IN8A 4UUVA 2G7UA 3KP3A 4I02A 3GZ5A 4CO8A 1AOYA 1ZLJA 1MD0A 3WU1B 3WTVC 4KYWA 1LB2A 4LK0F 3J7AO 1YW8A 4EVIA 3KP7A 2NNYA 1JE8A 1LDDA 4KFCA 1SD6A 5H6RA 1BI3A 4P9UA 2XAGA 1W4MA 1T6SA 3BPXA 2ESHA 1C0WA 3K2ZA 2ZJ2A 3GZ6A 5ICFA 2P5KA 3RI4A 2VC0A 3HRTA 3K9TA 4G6QA 3M8FA 3FMRA 2H94A 1IXRC 1HW2A 3DQVC 5LRSA 2VOOA 1SMTA 3V7CA 1WWXA 2PI0A 3WTYC 5CJ9A 3F8NA 5BMZA 1TQPA 4ZZLA 2F5CA 2K27A 4DNCA 2JPCA 1J0RA 3QP6A 3Q5FA 4FX4A 4XLNF 3N97A 4HV6A 2L3DA 3KCCA 2YU3A 5H20A 2FMYA 1ZRDA 1GVJA 2AXLA 4I0AA 4R79A 4YIIA 5L3EA 4MGRA 2V1UA 5A2QZ 3FZVA 3RKYA 3RTRA 2R3SA 2L4MA 2YX7A 2FF4A 4L0ZB 3C3WA 1ZYRF 2V1XA 3RYRA 4A0YA 3ZQ7A 3WG9A 1RUOA 4Q4ZF 3CO6C 3GF2A 2NAZA 2VODA 1RUNA 4OU0A 2E1CA 4G94A 1R23A 2DT5A 4HF2A 1ZGAA 2A5YB 3HHHA 3I4PA 1UHWA 2EK5A 3TDUC 3QRFF 2BEOA 1LQ1A 1TTYA 3ELKA 3LWFA 2CQKA 2HEOA 1R5GA 3IWZA 4IVNA 1MKMA 1XD7A 4XLPF 4XSXF 2A3SA 3NRVA 3J81K 1T98A 2QVOA 2H27A 1R58A 3E6CC 1I27A 3D0SA 1TW2A 1EH6A 3I71A 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 4U0YA 2HKOA 3H3UA 1OMIA 2LNBA 5EEHA 2VT2A 2BV6A 4LG0A 2MLGA 3JTHA 1TLHB 4O6JA 1IF1A 3WTTC 4LGWA 3KEOA 2EV5A 1T0FA 3ZMUA 3IHUA 4UXNA 4IHSA 4LFUA 5D4RA 1SFXA 3PFIA 3NQOA 2NYXA 4GCVA 2BYVE 2DK8A 1BIBA 4YG2F 3T8TA 1J59A 1YS7A 1IRFA 4LLNA 3P9KA 1G3SA 1XN7A 5KK1A 2MLKA 2F5FA 2OZ6A 1TNTA 1D3YA 5DD4A 5D5UB 2QQ9A 4RB2C 1KQ8A 2QBYA 1GXPA 4UVBA 3WTXC 5FB2A 4PGGA 3WU0A 4A0ZA 5AIPA 4MHGA 4DQ2A 2P5VA 3I58A 3ISPA 3HSRA 1B9NA 3V7RA 5E8IA 1ZGJA 3KP2A 3EETA 2RC4A 4M74A 4L5JA 3IC7A 3GYHX 2O0YA 3OOPA 3U1DA 3ZMTA 2ZXJA 1WSUA 1S3JA 3KE2A 3VB2A 2XAFA 4ZZDA 5ICEA 2WC2A 4A0XA 3DFGA 3TGNA 3L2CA 1R1TA 2OBPA 5LGUA 3JAMK 1ZG3A 4S05A 2GXGA 2PEXA 4LMYA 2VC1A 5DEQA 1O3RA 2HTJA 2A61A 2IA1A 3DPTA 2FBHA 4MNUA 3HRMA 2E7XA 2RNJA 2HFHA 1SD5A 1XGNA 4CXFA 1KA8A 1R7JA 2B0LA 1EV7A 4I98B 5L3FA 4XRFA 1B9MA 3CUQC 3O3KA 2EV0A 5K5OA 3HRSA 4NHJA 1YW9A 1T39A 1R36A 3FF5A 2DQRA 2DBBA 3GUDA 2D45A 4HW0A 3WGIA 1F4KA 4E70A 1Z1DA 3F8BA 4N9IA 2BE5F 2HWVA 2KKOA 4G7OF 5DCMB 3IWFA 2L4AA 1ZLKA 3QP5A 4IRHA 4HAMA 2CSOA 3HIFA 3DPLC 5ILVA 5LEJA 3QAHA 1HSTA 2YSRA 2ISZA 1MJ9A 4KN7X 2BBYA 2FU4A 4U7DA 5TJJA 2F5EA 4UNOA 4A6EA 1BI0A 2DFIA 4A5NA 4G6DA 3GVAA 2L54A 3ERED 2PLYA 3U2RA 3CLOA 3M9AA 4EM0B 4LD5A 2OQRA 3MFKA 2XRNA 4Y13A 2RKHA 2IRFG 5HLGA 3TDZC 5LRRA 4M9ZA 5DCFA 4UHTA 1J75A 1SD4A 4CGZA 3HUGA 3T1BA 5L3DA 3DP7A 3CDHA 1ZG1A 5CVUA 2M5WA 2K4JA 4A2UA 3P9CA 3HSFA 4HDUA 2HOEA 3K1MA 1U8RA 5BS6A 2CGPA 1STZA 4KIFA 2Q8KA 1TQIA 5DDGA 1IZ1A 2QLZA 2KIUA 4BH9A 4CDGA 4KN4X 2GWRA 4I2OA 1U5TC 4AVPA 1OPCA 4TV7A 2Y48A 4P5OA 1QBJA 4LJZF 2Z3YA 3ULQB 2D1VA 4MTEA 3RKXA 3K0LA 5K1YA 2Z99A 3HTUA 2K7LA 1W7PB 3P7NA 3E5UA 3HOTA 4IHTA 2A68F 1G4DA 1E2XA 3ZN0A 2YX4A 3PQJA 3BP8A 4JK1X 5IT9K 1FBUA 5ICCA 2F2EA 3ZPLA 2QQAA 2QYOA 3HRUA 4EGZA 1YFHA 1IN5A 2MD5A 3BJ6A 4RB3C 5K5RA 3WTSC 2OQGA 4Q48A 2Q2EA 2EFWA 1GHCA 4IJAA 4ESFA 3L7WA 3F23A 3LFKA 4UV9A 4B8XA 4QWQA 4HX8A 4CYDA 2GA2A 1T2KA 1F5TA 3ECHA 1FT9A 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 3SQNA 1TW3A 1FZPB 2MA3A 1ODDA 3EYIA 1DDNA 1KYZA 2HZTA 5DCMA 3LSTA 2FSWA 3CTAA 4ZH4F 1U3EM 5HDNA 5D6EA 1W7PD 1KU2A 2DW4A 5DUIA 3B73A 1IUYA 4P9FA 1P2FA 1W5SA 4MQ9F 4CICA 2DI3A 3F72A 4PDKA 2Y75A 4JBAA 1KQ9A 3ZMSA 1YO5C 1IXSB 3V8LA 3COAC 3VEPA 4AIJA 2IW5A 4UV8A 5FO5A 4PZJA 2IVMA 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 5BOXA 1WI9A 1IRGA 4WCGA 5BPDA 1ZH5A 3LA2A 1P4XA 1FOKA 5DUKA 5HS8A 3ZP5A 3ABUA 2MC3A 2FA5A 5ILUA 3E5XA 2IA2A 2P8TA 1XDSA 4O3MA 1Z9CA 2KRFA 4EGYA 3JSOA 1QZZA 3H92A 2P7CB 3TQNA 4WK8F 3EQLF 3JTGA 5E8GA 4R8HA 4BYYA 1Y0UA 2COMA 3GFLA 3R60A 1FC3A 1L3LA 1ZARA 2JZYA 3WTZA 5F1RA 2H6BA 3TOBA 2M45A 3JSPA 1OYIA 5D8KB 2GZWA 2ESNA 2PMUA 4YFNF 5LLQA 1HKSA 1LEAA 2OAZA 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 4OINF 4L9JA 3TKYA 1HBXG 3R6SA 4ZYDA 1BC7C 4KMFA 3D5LA 4U88A 1B6AA 5E20A 1H0MA 2UZKA 1VTNC 1S7OA 2JRTA 3K69A 3M7GA 1WRJA 2HR3A 2IPQX 1FNNA 1LVAA 4M6YA 1O57A 1YS6A 2LSOA 1ZG5A 4YFXF 4U7BA 1F1ZA 5D4SA 4NB5A 4ZYEA 1FSEA 1XSXA 1HXDA 3FMSA 2XKPA 3FXRA 1MDMA 4RS8A 4I01A 3REOA 3T8RA 4A5MA 2VONA 4BHBA 1KU3A 3L9FA 3NEUA 2FE3A 3J80K 2QWWA 2Y0MA 1HQCA 3PQKA 4KIBA 4RGSA 5FLXK 5AONA 4N0BA 4HYEA 2RV8A 3FM5A 4EV0A 5HLHA 5LGTA 1TQMA 1MJBA 5LGNA 5FD5A 1IW7F 1OYYA 1ZRFA 3GW2A 4WWCA 5JFRA 1BJAA 2W24A 2DAOA 1HW1A 2FRHA 2OU2A 2EFPA 1FYMA 1FP1D 1I5ZA 4RAZA 3GWZA 4IPAA 2DPDA 2E1NA 5CVRA 5CVJA 2ZFWA 5L3BA 3WGHA 1KQ0A 3R4KA 4M71A 2P7VB 1U78A 5FD6A 5ICGA 2KJCA 3S2WA 1QNTA 4F7ZA 2EA2A 4OIOF 4U0VA 2O6GE 1LNWA 3HTSB 5D5VB 3GFMA 5E1XA 5LBQA 2P4WA 2OD5A 2M87A 4ESBA 3J81Z 3O2PE 1XSDA 2D1HA 4HF1A 2FBKA 2NRAC 5TRDA 1YG2A 3BROA 3QPHA 1XCBA 1P4AA 2HGCA 4L5IA 1ZAOA 5JR3A 1LDJA 1HSJA 2ZNYA 3LQRA 4EJTA 2R7DA 4GYIA 4MQVA 4OMYA 2CO5A 3T0YA 4YFKF 1CGPA 4R1HA 2EFNA 4IRIA 5HVQC 1QPMA 2MH9A 3E5QA 3CJNA 2GAUA 2PN6A 3J80Z 3E6BA 1XMKA 4HZFA 2AS5F 4WF2A 3ROUA 4D0PA 1ON2A 1F9NA 4L9VA 1B4AA 4HF0A 3RPUA 3U9GA 3BDDA 3R0AA 2PFBA 1XCVA 1FBSA 5LHGA 1IAWA 3T5XA 2K86A 1O7FA 3I0TA 3QOPA 4RB1A 3ECOA 3KLNA 2M1BA 2EFQA 6PAXA 2XASA 4L9NA 4BAYA 3BY6A 4HX7A 4CHUA 4KIGA 3V8JA 5D8LB 1IN4A 3G73A 2LKPA 4KNYA 3WE3A 4HQEA 3LAJA 1UFMA 4AIHA 3LA7A 2XAQA 2XGXA 5IT3A 1HKQA 2STWA 2DK5A 3SHFA 1CF7B 1REPC 3P9IA 3C18A 3BJAA 4UVCA 4OOIA 4PCQA 3JAMZ 2L01A 1KU9A 2FQ3A 2A69F 3VODA 1SD7A 5BPIA 5F6FA 5D5XB 2DTRA 1FBQA 1YYVA 2G9WA 1TNSA 4HQMA 2L02A 4G7HF 2G7HA 2ELHA 5DV5A 4M9XA 1RIOH 4EJOA 2LF8A 3VOEA 2VBYA 1BOAA 3GFJA 1USSA 1LJ9A 4ENNA 3V7SA 3LAPA 2V6CA 2O8XA 4GGGA 5FFXA 4KT5C 3KP6A 5CVVA 3EYYA 2OZUA 4A6DA 1PP8F 3GEZA 1J7KA 1D8JA 1B59A 2D2WA 5A2QK 1PP7U 1FYKA 4AIKA 2DO7A 1SAXA 1BI1A 3I54A 4IF4A 2PBIA 4CZZA 1O7LA 3F21A 1Z6TA 2ISYA 2WTEA 2V9VA 4LLLA 1KGSA 2FOKA 3CUOA 1ZHFA 2DPUA 3MEXA 3F3XA 1S7AA 4L18B 1H9TA 3CUQB 1G3WA 1IN6A 3W6KB 2FMLA 3HSEA 5HDGA 2HQNA 4UVAA 4NQWA 4HDVA 5JHUA 4BHCA 1FPQA 1XGOA 1BI2A 3BJOA 1XGSA 3WODF 1L0OC 3BWGA 2STTA 2ZNZA 2HKXA 5J6XA 1WKMA 1I1GA 1XB4A 1NHAA 1EH8A 2WWYA 5LHHA 3M8EA 4BXUA 2GA1A 1S8NA 3IRQA 2YR2A 5F64A 1I1SA 4FHTA 3KLOA 2ZBKA 3ZMVA 1R1VA 3R61A 2IP2A 2QBYB 4XSZF 5H6QA 2GXBA 2O61A 1PUEE 1Z91A 3TOAA 2ZMEB 3K1PA 4EM2A 3HHGA 4M9SA 2VT3A 3DV8A 2CG4A 3F8FA 1XDUA 2VBZA 1XSVA 3W6JB 1DUXC 3WTWC 5AIQA 5E18F 4MEXF 3DKWA 1OKRA 3QU6A 1BN5A 3FM3A 3N4MA 5J8FA 3IRRA 2JPBA 1RZ4A 1UCRA 3LA3A 2P6TA 1K79A 2HYFA 4RGUA 3BZ6A 1IXCA 4K2EA 4RB0A 4XBFA 5D5WB 4G9YA 5JVTA 4N9HA 1CF7A 3RYPA 3OV8A 3GX4X 2WV0A 1K6OA 5L3CA 1OYWA 1FWZA 5IT9Z 2QQBA 2R7FA 1FYLA 3CO7C 1P92A 4AD9A 1LDKB 3HOSA 1SMYF 4FT8A 3KZZA 4ZYGA 2O3FA 4OIPF 1U5TB 1S29A 2PMHA 3F6VA 2EB7A 2KIMA 1J2XA 2OA4A 2KJBA 4HX4A 2VXZA 4H0EA 4RGXA 2VBXA 5ERIA 3E97A 3ZMDA 1W7PA 4PGHA 1ZRCA 2P6SA 1O3QA 4Q5SF 1D8KA 4G7ZF 2HTSA 1G3YA 5ED4A 2FNAA 1XMAA 4FX0A 2PJPA 2NS0A 2K02A 2CWEA 4Q47A 4HOBA 3QU3A 1MJAA 2VE9A 4M72A 1YTYA 3I64A 2VN2A 1I6XA 2FXAA 1Z05A 2QZ8A 4G8XA 2A6EF 2W84A 4IXAA 3GXOA 2RGVA 1ONVA 2GQQA 3CUQA 4OIRF 2UXXA 4WXHA 1SFUA 2JSCA 4B09A 2M30A 4GXOA 3K1NA 4KICA 5D6FA 2W25A 2J5PA 3BPVA 3RKWA 4BNCA 5CLSA 1BBYA 2BGCA 3Q9VA 4GYGA 5E1WA 3GLXA 1KU7A 1QGPA 1JHFA 4LLGF 4LB5A 2UXNA 3I59B 1R5HA 4KA4A 2VE8A 3C1DA 1G6NA 3ABTA 2F5DA 1J5YA 2ZKZA 1AWCA 1FY7A 4U0WA 4RGRA 2ZMEA 2FEZA 1SFEA 1ULYA 3BOQA 1W5TA 2Z5UA 3R0JA 3SFZA 2ZCWA 1ON1A 4HV5A 3G3ZA 1K78B 2ADUA 2V79A 1U6GA 2UWMA 1D5VA 1J9IA 2W57A 4ENJA 2K4BA 3ML6A 1G3TA 3MAJA 3MQ0A 5EEGA 3HYIA 5HDKA 4MTDA 4WXCA 2C6YA 3MWMA 1RNLA 3KZYA 2M8EA 2ETHA 1FSHA 4I0BA 3MCZA 2A6HF 2XKOA 4WXDA 1O3TA 2CFXA 2ACJA 4ETSA 2YPRA 4LB6B 4LK1F 4P55A 3M1EA 1FP2A 2PQ8A 3DXJF 1O3SA 3ZMZA 4EQQA 3C7JA 3E6DA 3E6MA 2A07F 2HDCA 1JHHA 3KFWX 2HYGD 4WX9A 3F6OA 1U5TA 3KP5A 4L9TA 1YIOA 4Z2YA 1FX7A 2QM3A 2MBFA 4ZYHA 5E17F 3WTUC 3O6BB 5FLXZ 2RQPA 4EMSA 2LF7A 4ESJA 2XIGA 3WE2A 4O5VA 4ASNA 1T38A 3WGGA 2Z9OA 4HBLA 1QQIA 2DLLA 1H9GA 5HS7A 1WQ2A 2TDXA 1S6LA 3B02A 2H09A 2X4HA 2RVCA 2RDPA 1JGSA 3EUHA 2EFOA 1DPRA 1R22A 3F8CA 3RDIA 2CYYA 3V8KA 2IT0A 3FWEA 4S04A 1R1UA 5CVIA 2XUBA 2X0LA 5LHIA 3JW4A 2FBIA 4Y17A 3IKVA 2EA4A 2XHKA 2RN7A 1ZREA 2Q0OA 2XROA 1TBXA 4A12A 2Z33A 3L00A 1YQAA 5BQTA 4OIQF 4ON0A 2EJRA 1KYWA 1QZYA 5JI6A 4GO1A 1R00A 3ZN1A 2H6CA 2XAHA 1ZN2A 3FHZA 2QENA 1U2WA 3DF8A 3MZYA 4EJUA 3AAFA 1BC8C 2FNPA 2EV6A 1DP7P 1FLIA 2IJLA 5FFZA 2XAJA 1Q1HA 2MH2A 1DPUA 5K5QA 4MEYF 3I59A 4HLXA 4I7HA 4HLYA 4AWXB 4I09A 1IN7A 1BIAA 1HKTA 4M73A 4L0YB 5FGMA 3FX3A 2XVCA 4EJVA 1LEBA 2VBWA 2CW0F 5E1ZB 3IL2A 1Z7UA 2VOPA 1UHMA 2EWNA 3E3VA 1PDNC 5ILSA 1BM9A 3LQQA 2JTVA 3FXQA 1YLFA 1P6RA 3IKTA 3RPQA 2E7WA 4M6XA 3SXYA 2J5OA 3TO7A 3Q9SA 1A04A 1V3FA 1K78A 2QUFA 5DYMA 4Y15A 1YW7A 1XGMA 2JT1A 5HS9A 2O03A 2DU9A 1P4WA 4RAYA 3L09A 3RJPA 3FXUA 5HOOA 4BQAA 5KVRA 4EJWA 3H3ZA 5L3GA 1EH7A 1JXSA 2KIFA 3V4GA 3KETA 4BHPA 3F8MA 4ENKA 1QO0D 2PG4A 1HW5A 3QPTA 1OR7A 3EDPA 4IRGA 4QLCU 1K7AA 2NNNA 4LG0B 3SZTA 5HLIA 2V1DA 3I5UA 4OMZA 3TO9A 2GIVA 2ZO4A 1MDMB 1E17A 1X3UA 1Z6RA 3FMQA 1MZBA 2XV4S 3TO6A 5CYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W85 A;  1V4R A;  3GFI A;  2HS5 A;  3SZP A;  3KP4 A;  2LDU A;  3DEU A;  4ENM A;  4KUM A;  1UST A;  2P5L C;  4YIF A;  1B1B A;  5J8C A;  1IN8 A;  4UUV A;  2G7U A;  3KP3 A;  4I02 A;  3GZ5 A;  4CO8 A;  1AOY A;  1ZLJ A;  1MD0 A;  3WU1 B;  3WTV C;  4KYW A;  1LB2 A;  4LK0 F;  3J7A O;  1YW8 A;  4EVI A;  3KP7 A;  2NNY A;  1JE8 A;  1LDD A;  4KFC A;  1SD6 A;  5H6R A;  1BI3 A;  4P9U A;  2XAG A;  1W4M A;  1T6S A;  3BPX A;  2ESH A;  1C0W A;  3K2Z A;  2ZJ2 A;  3GZ6 A;  5ICF A;  2P5K A;  3RI4 A;  2VC0 A;  3HRT A;  3K9T A;  4G6Q A;  3M8F A;  3FMR A;  2H94 A;  1IXR C;  1HW2 A;  3DQV C;  5LRS A;  2VOO A;  1SMT A;  3V7C A;  1WWX A;  2PI0 A;  3WTY C;  5CJ9 A;  3F8N A;  5BMZ A;  1TQP A;  4ZZL A;  2F5C A;  2K27 A;  4DNC A;  2JPC A;  1J0R A;  3QP6 A;  3Q5F A;  4FX4 A;  4XLN F;  3N97 A;  4HV6 A;  2L3D A;  3KCC A;  2YU3 A;  5H20 A;  2FMY A;  1ZRD A;  1GVJ A;  2AXL A;  4I0A A;  4R79 A;  4YII A;  5L3E A;  4MGR A;  2V1U A;  5A2Q Z;  3FZV A;  3RKY A;  3RTR A;  2R3S A;  2L4M A;  2YX7 A;  2FF4 A;  4L0Z B;  3C3W A;  1ZYR F;  2V1X A;  3RYR A;  4A0Y A;  3ZQ7 A;  3WG9 A;  1RUO A;  4Q4Z F;  3CO6 C;  3GF2 A;  2NAZ A;  2VOD A;  1RUN A;  4OU0 A;  2E1C A;  4G94 A;  1R23 A;  2DT5 A;  4HF2 A;  1ZGA A;  2A5Y B;  3HHH A;  3I4P A;  1UHW A;  2EK5 A;  3TDU C;  3QRF F;  2BEO A;  1LQ1 A;  1TTY A;  3ELK A;  3LWF A;  2CQK A;  2HEO A;  1R5G A;  3IWZ A;  4IVN A;  1MKM A;  1XD7 A;  4XLP F;  4XSX F;  2A3S A;  3NRV A;  3J81 K;  1T98 A;  2QVO A;  2H27 A;  1R58 A;  3E6C C;  1I27 A;  3D0S A;  1TW2 A;  1EH6 A;  3I71 A;  3KEQ A;  3MZH A;  3VFZ A;  2DQL A;  3RIR A;  4U0Y A;  2HKO A;  3H3U A;  1OMI A;  2LNB A;  5EEH A;  2VT2 A;  2BV6 A;  4LG0 A;  2MLG A;  3JTH A;  1TLH B;  4O6J A;  1IF1 A;  3WTT C;  4LGW A;  3KEO A;  2EV5 A;  1T0F A;  3ZMU A;  3IHU A;  4UXN A;  4IHS A;  4LFU A;  5D4R A;  1SFX A;  3PFI A;  3NQO A;  2NYX A;  4GCV A;  2BYV E;  2DK8 A;  1BIB A;  4YG2 F;  3T8T A;  1J59 A;  1YS7 A;  1IRF A;  4LLN A;  3P9K A;  1G3S A;  1XN7 A;  5KK1 A;  2MLK A;  2F5F A;  2OZ6 A;  1TNT A;  1D3Y A;  5DD4 A;  5D5U B;  2QQ9 A;  4RB2 C;  1KQ8 A;  2QBY A;  1GXP A;  4UVB A;  3WTX C;  5FB2 A;  4PGG A;  3WU0 A;  4A0Z A;  5AIP A;  4MHG A;  4DQ2 A;  2P5V A;  3I58 A;  3ISP A;  3HSR A;  1B9N A;  3V7R A;  5E8I A;  1ZGJ A;  3KP2 A;  3EET A;  2RC4 A;  4M74 A;  4L5J A;  3IC7 A;  3GYH X;  2O0Y A;  3OOP A;  3U1D A;  3ZMT A;  2ZXJ A;  1WSU A;  1S3J A;  3KE2 A;  3VB2 A;  2XAF A;  4ZZD A;  5ICE A;  2WC2 A;  4A0X A;  3DFG A;  3TGN A;  3L2C A;  1R1T A;  2OBP A;  5LGU A;  3JAM K;  1ZG3 A;  4S05 A;  2GXG A;  2PEX A;  4LMY A;  2VC1 A;  5DEQ A;  1O3R A;  2HTJ A;  2A61 A;  2IA1 A;  3DPT A;  2FBH A;  4MNU A;  3HRM A;  2E7X A;  2RNJ A;  2HFH A;  1SD5 A;  1XGN A;  4CXF A;  1KA8 A;  1R7J A;  2B0L A;  1EV7 A;  4I98 B;  5L3F A;  4XRF A;  1B9M A;  3CUQ C;  3O3K A;  2EV0 A;  5K5O A;  3HRS A;  4NHJ A;  1YW9 A;  1T39 A;  1R36 A;  3FF5 A;  2DQR A;  2DBB A;  3GUD A;  2D45 A;  4HW0 A;  3WGI A;  1F4K A;  4E70 A;  1Z1D A;  3F8B A;  4N9I A;  2BE5 F;  2HWV A;  2KKO A;  4G7O F;  5DCM B;  3IWF A;  2L4A A;  1ZLK A;  3QP5 A;  4IRH A;  4HAM A;  2CSO A;  3HIF A;  3DPL C;  5ILV A;  5LEJ A;  3QAH A;  1HST A;  2YSR A;  2ISZ A;  1MJ9 A;  4KN7 X;  2BBY A;  2FU4 A;  4U7D A;  5TJJ A;  2F5E A;  4UNO A;  4A6E A;  1BI0 A;  2DFI A;  4A5N A;  4G6D A;  3GVA A;  2L54 A;  3ERE D;  2PLY A;  3U2R A;  3CLO A;  3M9A A;  4EM0 B;  4LD5 A;  2OQR A;  3MFK A;  2XRN A;  4Y13 A;  2RKH A;  2IRF G;  5HLG A;  3TDZ C;  5LRR A;  4M9Z A;  5DCF A;  4UHT A;  1J75 A;  1SD4 A;  4CGZ A;  3HUG A;  3T1B A;  5L3D A;  3DP7 A;  3CDH A;  1ZG1 A;  5CVU A;  2M5W A;  2K4J A;  4A2U A;  3P9C A;  3HSF A;  4HDU A;  2HOE A;  3K1M A;  1U8R A;  5BS6 A;  2CGP A;  1STZ A;  4KIF A;  2Q8K A;  1TQI A;  5DDG A;  1IZ1 A;  2QLZ A;  2KIU A;  4BH9 A;  4CDG A;  4KN4 X;  2GWR A;  4I2O A;  1U5T C;  4AVP A;  1OPC A;  4TV7 A;  2Y48 A;  4P5O A;  1QBJ A;  4LJZ F;  2Z3Y A;  3ULQ B;  2D1V A;  4MTE A;  3RKX A;  3K0L A;  5K1Y A;  2Z99 A;  3HTU A;  2K7L A;  1W7P B;  3P7N A;  3E5U A;  3HOT A;  4IHT A;  2A68 F;  1G4D A;  1E2X A;  3ZN0 A;  2YX4 A;  3PQJ A;  3BP8 A;  4JK1 X;  5IT9 K;  1FBU A;  5ICC A;  2F2E A;  3ZPL A;  2QQA A;  2QYO A;  3HRU A;  4EGZ A;  1YFH A;  1IN5 A;  2MD5 A;  3BJ6 A;  4RB3 C;  5K5R A;  3WTS C;  2OQG A;  4Q48 A;  2Q2E A;  2EFW A;  1GHC A;  4IJA A;  4ESF A;  3L7W A;  3F23 A;  3LFK A;  4UV9 A;  4B8X A;  4QWQ A;  4HX8 A;  4CYD A;  2GA2 A;  1T2K A;  1F5T A;  3ECH A;  1FT9 A;  4KDP A;  3GO5 A;  5LEK A;  2IA0 A;  4EM1 A;  2HQR A;  3SQN A;  1TW3 A;  1FZP B;  2MA3 A;  1ODD A;  3EYI A;  1DDN A;  1KYZ A;  2HZT A;  5DCM A;  3LST A;  2FSW A;  3CTA A;  4ZH4 F;  1U3E M;  5HDN A;  5D6E A;  1W7P D;  1KU2 A;  2DW4 A;  5DUI A;  3B73 A;  1IUY A;  4P9F A;  1P2F A;  1W5S A;  4MQ9 F;  4CIC A;  2DI3 A;  3F72 A;  4PDK A;  2Y75 A;  4JBA A;  1KQ9 A;  3ZMS A;  1YO5 C;  1IXS B;  3V8L A;  3COA C;  3VEP A;  4AIJ A;  2IW5 A;  4UV8 A;  5FO5 A;  4PZJ A;  2IVM A;  1RI7 A;  3F22 A;  3I53 A;  1GXQ A;  5DD8 A;  4JQF A;  5BOX A;  1WI9 A;  1IRG A;  4WCG A;  5BPD A;  1ZH5 A;  3LA2 A;  1P4X A;  1FOK A;  5DUK A;  5HS8 A;  3ZP5 A;  3ABU A;  2MC3 A;  2FA5 A;  5ILU A;  3E5X A;  2IA2 A;  2P8T A;  1XDS A;  4O3M A;  1Z9C A;  2KRF A;  4EGY A;  3JSO A;  1QZZ A;  3H92 A;  2P7C B;  3TQN A;  4WK8 F;  3EQL F;  3JTG A;  5E8G A;  4R8H A;  4BYY A;  1Y0U A;  2COM A;  3GFL A;  3R60 A;  1FC3 A;  1L3L A;  1ZAR A;  2JZY A;  3WTZ A;  5F1R A;  2H6B A;  3TOB A;  2M45 A;  3JSP A;  1OYI A;  5D8K B;  2GZW A;  2ESN A;  2PMU A;  4YFN F;  5LLQ A;  1HKS A;  1LEA A;  2OAZ A;  1UB9 A;  4HA8 A;  4KMU X;  4P96 A;  1MGT A;  4OIN F;  4L9J A;  3TKY A;  1HBX G;  3R6S A;  4ZYD A;  1BC7 C;  4KMF A;  3D5L A;  4U88 A;  1B6A A;  5E20 A;  1H0M A;  2UZK A;  1VTN C;  1S7O A;  2JRT A;  3K69 A;  3M7G A;  1WRJ A;  2HR3 A;  2IPQ X;  1FNN A;  1LVA A;  4M6Y A;  1O57 A;  1YS6 A;  2LSO A;  1ZG5 A;  4YFX F;  4U7B A;  1F1Z A;  5D4S A;  4NB5 A;  4ZYE A;  1FSE A;  1XSX A;  1HXD A;  3FMS A;  2XKP A;  3FXR A;  1MDM A;  4RS8 A;  4I01 A;  3REO A;  3T8R A;  4A5M A;  2VON A;  4BHB A;  1KU3 A;  3L9F A;  3NEU A;  2FE3 A;  3J80 K;  2QWW A;  2Y0M A;  1HQC A;  3PQK A;  4KIB A;  4RGS A;  5FLX K;  5AON A;  4N0B A;  4HYE A;  2RV8 A;  3FM5 A;  4EV0 A;  5HLH A;  5LGT A;  1TQM A;  1MJB A;  5LGN A;  5FD5 A;  1IW7 F;  1OYY A;  1ZRF A;  3GW2 A;  4WWC A;  5JFR A;  1BJA A;  2W24 A;  2DAO A;  1HW1 A;  2FRH A;  2OU2 A;  2EFP A;  1FYM A;  1FP1 D;  1I5Z A;  4RAZ A;  3GWZ A;  4IPA A;  2DPD A;  2E1N A;  5CVR A;  5CVJ A;  2ZFW A;  5L3B A;  3WGH A;  1KQ0 A;  3R4K A;  4M71 A;  2P7V B;  1U78 A;  5FD6 A;  5ICG A;  2KJC A;  3S2W A;  1QNT A;  4F7Z A;  2EA2 A;  4OIO F;  4U0V A;  2O6G E;  1LNW A;  3HTS B;  5D5V B;  3GFM A;  5E1X A;  5LBQ A;  2P4W A;  2OD5 A;  2M87 A;  4ESB A;  3J81 Z;  3O2P E;  1XSD A;  2D1H A;  4HF1 A;  2FBK A;  2NRA C;  5TRD A;  1YG2 A;  3BRO A;  3QPH A;  1XCB A;  1P4A A;  2HGC A;  4L5I A;  1ZAO A;  5JR3 A;  1LDJ A;  1HSJ A;  2ZNY A;  3LQR A;  4EJT A;  2R7D A;  4GYI A;  4MQV A;  4OMY A;  2CO5 A;  3T0Y A;  4YFK F;  1CGP A;  4R1H A;  2EFN A;  4IRI A;  5HVQ C;  1QPM A;  2MH9 A;  3E5Q A;  3CJN A;  2GAU A;  2PN6 A;  3J80 Z;  3E6B A;  1XMK A;  4HZF A;  2AS5 F;  4WF2 A;  3ROU A;  4D0P A;  1ON2 A;  1F9N A;  4L9V A;  1B4A A;  4HF0 A;  3RPU A;  3U9G A;  3BDD A;  3R0A A;  2PFB A;  1XCV A;  1FBS A;  5LHG A;  1IAW A;  3T5X A;  2K86 A;  1O7F A;  3I0T A;  3QOP A;  4RB1 A;  3ECO A;  3KLN A;  2M1B A;  2EFQ A;  6PAX A;  2XAS A;  4L9N A;  4BAY A;  3BY6 A;  4HX7 A;  4CHU A;  4KIG A;  3V8J A;  5D8L B;  1IN4 A;  3G73 A;  2LKP A;  4KNY A;  3WE3 A;  4HQE A;  3LAJ A;  1UFM A;  4AIH A;  3LA7 A;  2XAQ A;  2XGX A;  5IT3 A;  1HKQ A;  2STW A;  2DK5 A;  3SHF A;  1CF7 B;  1REP C;  3P9I A;  3C18 A;  3BJA A;  4UVC A;  4OOI A;  4PCQ A;  3JAM Z;  2L01 A;  1KU9 A;  2FQ3 A;  2A69 F;  3VOD A;  1SD7 A;  5BPI A;  5F6F A;  5D5X B;  2DTR A;  1FBQ A;  1YYV A;  2G9W A;  1TNS A;  4HQM A;  2L02 A;  4G7H F;  2G7H A;  2ELH A;  5DV5 A;  4M9X A;  1RIO H;  4EJO A;  2LF8 A;  3VOE A;  2VBY A;  1BOA A;  3GFJ A;  1USS A;  1LJ9 A;  4ENN A;  3V7S A;  3LAP A;  2V6C A;  2O8X A;  4GGG A;  5FFX A;  4KT5 C;  3KP6 A;  5CVV A;  3EYY A;  2OZU A;  4A6D A;  1PP8 F;  3GEZ A;  1J7K A;  1D8J A;  1B59 A;  2D2W A;  5A2Q K;  1PP7 U;  1FYK A;  4AIK A;  2DO7 A;  1SAX A;  1BI1 A;  3I54 A;  4IF4 A;  2PBI A;  4CZZ A;  1O7L A;  3F21 A;  1Z6T A;  2ISY A;  2WTE A;  2V9V A;  4LLL A;  1KGS A;  2FOK A;  3CUO A;  1ZHF A;  2DPU A;  3MEX A;  3F3X A;  1S7A A;  4L18 B;  1H9T A;  3CUQ B;  1G3W A;  1IN6 A;  3W6K B;  2FML A;  3HSE A;  5HDG A;  2HQN A;  4UVA A;  4NQW A;  4HDV A;  5JHU A;  4BHC A;  1FPQ A;  1XGO A;  1BI2 A;  3BJO A;  1XGS A;  3WOD F;  1L0O C;  3BWG A;  2STT A;  2ZNZ A;  2HKX A;  5J6X A;  1WKM A;  1I1G A;  1XB4 A;  1NHA A;  1EH8 A;  2WWY A;  5LHH A;  3M8E A;  4BXU A;  2GA1 A;  1S8N A;  3IRQ A;  2YR2 A;  5F64 A;  1I1S A;  4FHT A;  3KLO A;  2ZBK A;  3ZMV A;  1R1V A;  3R61 A;  2IP2 A;  2QBY B;  4XSZ F;  5H6Q A;  2GXB A;  2O61 A;  1PUE E;  1Z91 A;  3TOA A;  2ZME B;  3K1P A;  4EM2 A;  3HHG A;  4M9S A;  2VT3 A;  3DV8 A;  2CG4 A;  3F8F A;  1XDU A;  2VBZ A;  1XSV A;  3W6J B;  1DUX C;  3WTW C;  5AIQ A;  5E18 F;  4MEX F;  3DKW A;  1OKR A;  3QU6 A;  1BN5 A;  3FM3 A;  3N4M A;  5J8F A;  3IRR A;  2JPB A;  1RZ4 A;  1UCR A;  3LA3 A;  2P6T A;  1K79 A;  2HYF A;  4RGU A;  3BZ6 A;  1IXC A;  4K2E A;  4RB0 A;  4XBF A;  5D5W B;  4G9Y A;  5JVT A;  4N9H A;  1CF7 A;  3RYP A;  3OV8 A;  3GX4 X;  2WV0 A;  1K6O A;  5L3C A;  1OYW A;  1FWZ A;  5IT9 Z;  2QQB A;  2R7F A;  1FYL A;  3CO7 C;  1P92 A;  4AD9 A;  1LDK B;  3HOS A;  1SMY F;  4FT8 A;  3KZZ A;  4ZYG A;  2O3F A;  4OIP F;  1U5T B;  1S29 A;  2PMH A;  3F6V A;  2EB7 A;  2KIM A;  1J2X A;  2OA4 A;  2KJB A;  4HX4 A;  2VXZ A;  4H0E A;  4RGX A;  2VBX A;  5ERI A;  3E97 A;  3ZMD A;  1W7P A;  4PGH A;  1ZRC A;  2P6S A;  1O3Q A;  4Q5S F;  1D8K A;  4G7Z F;  2HTS A;  1G3Y A;  5ED4 A;  2FNA A;  1XMA A;  4FX0 A;  2PJP A;  2NS0 A;  2K02 A;  2CWE A;  4Q47 A;  4HOB A;  3QU3 A;  1MJA A;  2VE9 A;  4M72 A;  1YTY A;  3I64 A;  2VN2 A;  1I6X A;  2FXA A;  1Z05 A;  2QZ8 A;  4G8X A;  2A6E F;  2W84 A;  4IXA A;  3GXO A;  2RGV A;  1ONV A;  2GQQ A;  3CUQ A;  4OIR F;  2UXX A;  4WXH A;  1SFU A;  2JSC A;  4B09 A;  2M30 A;  4GXO A;  3K1N A;  4KIC A;  5D6F A;  2W25 A;  2J5P A;  3BPV A;  3RKW A;  4BNC A;  5CLS A;  1BBY A;  2BGC A;  3Q9V A;  4GYG A;  5E1W A;  3GLX A;  1KU7 A;  1QGP A;  1JHF A;  4LLG F;  4LB5 A;  2UXN A;  3I59 B;  1R5H A;  4KA4 A;  2VE8 A;  3C1D A;  1G6N A;  3ABT A;  2F5D A;  1J5Y A;  2ZKZ A;  1AWC A;  1FY7 A;  4U0W A;  4RGR A;  2ZME A;  2FEZ A;  1SFE A;  1ULY A;  3BOQ A;  1W5T A;  2Z5U A;  3R0J A;  3SFZ A;  2ZCW A;  1ON1 A;  4HV5 A;  3G3Z A;  1K78 B;  2ADU A;  2V79 A;  1U6G A;  2UWM A;  1D5V A;  1J9I A;  2W57 A;  4ENJ A;  2K4B A;  3ML6 A;  1G3T A;  3MAJ A;  3MQ0 A;  5EEG A;  3HYI A;  5HDK A;  4MTD A;  4WXC A;  2C6Y A;  3MWM A;  1RNL A;  3KZY A;  2M8E A;  2ETH A;  1FSH A;  4I0B A;  3MCZ A;  2A6H F;  2XKO A;  4WXD A;  1O3T A;  2CFX A;  2ACJ A;  4ETS A;  2YPR A;  4LB6 B;  4LK1 F;  4P55 A;  3M1E A;  1FP2 A;  2PQ8 A;  3DXJ F;  1O3S A;  3ZMZ A;  4EQQ A;  3C7J A;  3E6D A;  3E6M A;  2A07 F;  2HDC A;  1JHH A;  3KFW X;  2HYG D;  4WX9 A;  3F6O A;  1U5T A;  3KP5 A;  4L9T A;  1YIO A;  4Z2Y A;  1FX7 A;  2QM3 A;  2MBF A;  4ZYH A;  5E17 F;  3WTU C;  3O6B B;  5FLX Z;  2RQP A;  4EMS A;  2LF7 A;  4ESJ A;  2XIG A;  3WE2 A;  4O5V A;  4ASN A;  1T38 A;  3WGG A;  2Z9O A;  4HBL A;  1QQI A;  2DLL A;  1H9G A;  5HS7 A;  1WQ2 A;  2TDX A;  1S6L A;  3B02 A;  2H09 A;  2X4H A;  2RVC A;  2RDP A;  1JGS A;  3EUH A;  2EFO A;  1DPR A;  1R22 A;  3F8C A;  3RDI A;  2CYY A;  3V8K A;  2IT0 A;  3FWE A;  4S04 A;  1R1U A;  5CVI A;  2XUB A;  2X0L A;  5LHI A;  3JW4 A;  2FBI A;  4Y17 A;  3IKV A;  2EA4 A;  2XHK A;  2RN7 A;  1ZRE A;  2Q0O A;  2XRO A;  1TBX A;  4A12 A;  2Z33 A;  3L00 A;  1YQA A;  5BQT A;  4OIQ F;  4ON0 A;  2EJR A;  1KYW A;  1QZY A;  5JI6 A;  4GO1 A;  1R00 A;  3ZN1 A;  2H6C A;  2XAH A;  1ZN2 A;  3FHZ A;  2QEN A;  1U2W A;  3DF8 A;  3MZY A;  4EJU A;  3AAF A;  1BC8 C;  2FNP A;  2EV6 A;  1DP7 P;  1FLI A;  2IJL A;  5FFZ A;  2XAJ A;  1Q1H A;  2MH2 A;  1DPU A;  5K5Q A;  4MEY F;  3I59 A;  4HLX A;  4I7H A;  4HLY A;  4AWX B;  4I09 A;  1IN7 A;  1BIA A;  1HKT A;  4M73 A;  4L0Y B;  5FGM A;  3FX3 A;  2XVC A;  4EJV A;  1LEB A;  2VBW A;  2CW0 F;  5E1Z B;  3IL2 A;  1Z7U A;  2VOP A;  1UHM A;  2EWN A;  3E3V A;  1PDN C;  5ILS A;  1BM9 A;  3LQQ A;  2JTV A;  3FXQ A;  1YLF A;  1P6R A;  3IKT A;  3RPQ A;  2E7W A;  4M6X A;  3SXY A;  2J5O A;  3TO7 A;  3Q9S A;  1A04 A;  1V3F A;  1K78 A;  2QUF A;  5DYM A;  4Y15 A;  1YW7 A;  1XGM A;  2JT1 A;  5HS9 A;  2O03 A;  2DU9 A;  1P4W A;  4RAY A;  3L09 A;  3RJP A;  3FXU A;  5HOO A;  4BQA A;  5KVR A;  4EJW A;  3H3Z A;  5L3G A;  1EH7 A;  1JXS A;  2KIF A;  3V4G A;  3KET A;  4BHP A;  3F8M A;  4ENK A;  1QO0 D;  2PG4 A;  1HW5 A;  3QPT A;  1OR7 A;  3EDP A;  4IRG A;  4QLC U;  1K7A A;  2NNN A;  4LG0 B;  3SZT A;  5HLI A;  2V1D A;  3I5U A;  4OMZ A;  3TO9 A;  2GIV A;  2ZO4 A;  1MDM B;  1E17 A;  1X3U A;  1Z6R A;  3FMQ A;  1MZB A;  2XV4 S;  3TO6 A;  5CYV A; 
#chains in the Genus database with same CATH topology
 2W85 A;  1V4R A;  2EZI A;  3GFI A;  4BXF A;  1VQ5 I;  2HS5 A;  1I3A A;  2HOS A;  1RKT A;  3SZP A;  3KP4 A;  2KQR A;  1OCZ H;  2LDU A;  3GTK J;  2HNH A;  3DEU A;  2LD5 A;  2M34 A;  3S93 A;  3DU5 A;  4ENM A;  4KUM A;  1UST A;  2EPF A;  3Q0U A;  2P5L C;  4YIF A;  4RM3 A;  1B1B A;  2X1D A;  5J8C A;  1IN8 A;  4UUV A;  2G7U A;  2X51 A;  3KP3 A;  4I02 A;  3GZ5 A;  3PL8 A;  3LSP A;  4CO8 A;  4D1Q A;  4OAY A;  1AOY A;  3BZK A;  1ZLJ A;  1MD0 A;  2DMP A;  3WU1 B;  1NG6 A;  3WTV C;  4KYW A;  3FIW A;  2WAQ A;  2VQC A;  1LB2 A;  4BE1 A;  4LK0 F;  3J7A O;  1YW8 A;  4EVI A;  3KP7 A;  2L7Z A;  1MBF A;  2NNY A;  2CW8 A;  1JE8 A;  1LDD A;  2VI6 A;  1SD6 A;  4KFC A;  5H6R A;  1BI3 A;  4PFO A;  4P9U A;  3S3O A;  2XAG A;  1W4M A;  2Y69 H;  3KZI C;  3DKX A;  4Y33 A;  1T6S A;  3BPX A;  2ESH A;  4NNJ A;  1C0W A;  5FRM A;  3K2Z A;  2ZJ2 A;  3GZ6 A;  1G8X A;  5ICF A;  2X1C A;  2P5K A;  3RI4 A;  3IH3 A;  2VC0 A;  2BXY A;  3ABL H;  3HRT A;  1KON A;  3K9T A;  2K9L A;  4G6Q A;  2DMQ A;  3ABK H;  3M8F A;  2WAE A;  3FMR A;  2H94 A;  1IXR C;  2HPI A;  1HW2 A;  1Y6I A;  3DQV C;  5GAH J;  5LRS A;  1WZ2 A;  4MO7 A;  2VOO A;  1SMT A;  3OYL A;  3V7C A;  1WWX A;  2PI0 A;  4NUB A;  3WTY C;  5CJ9 A;  2BHY A;  4ZYA A;  3F8N A;  5BMZ A;  4AU7 A;  1TQP A;  4ZZL A;  2F5C A;  2DA7 A;  2K27 A;  4DNC A;  2JPC A;  4A3I J;  1J0R A;  3QP6 A;  3Q5F A;  3FDY A;  1OIS A;  4NDL A;  3CME I;  4XLN F;  4FX4 A;  4PJN A;  3N97 A;  3BR3 A;  4HV6 A;  3H5N A;  3IAM 2;  2UUZ A;  3HKZ N;  2L3D A;  1FTT A;  4XIC A;  3G1O A;  2LLK A;  2YU3 A;  3KCC A;  2LY2 A;  4BKX A;  2E36 A;  1JI8 A;  4JX4 A;  5H20 A;  1LE8 A;  2JJ7 A;  2FMY A;  1ZRD A;  1GVJ A;  3ZQI A;  2AXL A;  4ZTJ A;  4BY7 J;  4I0A A;  4CSW A;  1VQK I;  4R79 A;  3G2B A;  2VKD A;  3JRE A;  4YII A;  5L3E A;  4MGR A;  2V1U A;  4LIV A;  5A2Q Z;  1MIJ A;  2BY2 A;  2CH0 A;  3FZV A;  3RKY A;  3RTR A;  3CD6 I;  2R3S A;  2L4M A;  2YX7 A;  2FF4 A;  4L0Z B;  3C3W A;  1ZYR F;  5TIS C;  2V1X A;  3RYR A;  1OR7 C;  4A0Y A;  3ZQ7 A;  2R5Z A;  2RRE A;  3WG9 A;  1RUO A;  1VQ7 I;  2GOX B;  2WAD A;  2WAQ N;  4Q4Z F;  3CO6 C;  5M5W J;  3GF2 A;  2NAZ A;  2VOD A;  3S1Q J;  4D5F A;  4EAT A;  2K3F A;  1RUN A;  3HGY A;  3JRG A;  2QEX I;  4OU0 A;  2E1C A;  2FX0 A;  1GV5 A;  4G94 A;  1DGW Y;  2B7E A;  1R23 A;  2DT5 A;  1YX3 A;  4HF2 A;  1ENH A;  2R7R A;  1UAA A;  1YX5 A;  1ZGA A;  1LFU P;  2A5Y B;  3HHH A;  4IHW A;  3I4P A;  5FRN A;  1UHW A;  2EK5 A;  3TDU C;  3QRF F;  2BEO A;  2QF7 A;  3K2A A;  2Y9Z A;  1LQ1 A;  1TTY A;  3ELK A;  2ZFU A;  2NVT J;  3B6C A;  3LWF A;  4D5C A;  5EGO A;  2JA6 J;  2CQK A;  2HEO A;  2O9L A;  3DEE A;  1R5G A;  3IWZ A;  4IVN A;  5EDN A;  3CC4 I;  1MKM A;  1XD7 A;  4XLP F;  1T95 A;  4XSX F;  2A3S A;  2KRH A;  5E3M A;  3NRV A;  3J81 K;  1T98 A;  2QVO A;  2TRT A;  2H27 A;  2L7K A;  1R58 A;  3E6C C;  4PUS A;  2QA4 I;  1I27 A;  1JTX A;  3FXK A;  3D0S A;  1TW2 A;  4B48 A;  1EH6 A;  4AM3 A;  3DTK A;  1QA6 A;  1QVT A;  1AA7 A;  1AHD P;  3I71 A;  2ZJP F;  4HEA 2;  2M9H A;  3KEQ A;  3MZH A;  3VFZ A;  2DQL A;  3RIR A;  1OCT C;  4U0Y A;  3GTL J;  2MC4 A;  4HNU A;  1MBG A;  1LUJ B;  2HKO A;  3H3U A;  1OMI A;  2MYS A;  4V19 K;  2ZC2 A;  5H2F C;  2LNB A;  5EEH A;  2VT2 A;  2BV6 A;  2QCO A;  3Q0W A;  3WG7 H;  3LSM A;  4LG0 A;  1S72 I;  2MLG A;  5J1Y A;  3JTH A;  1TLH B;  4M3E A;  4O6J A;  2EIJ H;  3WTT C;  1IF1 A;  1IDZ A;  5FKL A;  4LGW A;  3KEO A;  2EV5 A;  1T0F A;  3ZMU A;  1BR1 A;  4E7Z A;  3IHU A;  4UXN A;  4IHS A;  4LFU A;  5D4R A;  1SFX A;  3PFI A;  5JLW A;  3OYK A;  3NQO A;  2NYX A;  4UUS B;  1XX5 A;  3SFI A;  4GCV A;  2BYV E;  1LFB A;  1E3P A;  1D1C A;  2DK8 A;  1BIB A;  4YG2 F;  3T8T A;  3BR0 A;  1WCM J;  1J59 A;  1YS7 A;  3CCU I;  1IRF A;  4LLN A;  2R7V A;  3BR5 A;  3P9K A;  1G3S A;  2VKE A;  2R5Y B;  1XN7 A;  5FJ8 J;  3HUG B;  2W48 A;  5KK1 A;  2MLK A;  2LKS A;  4BY1 J;  4DJA A;  4EEF G;  4CCM A;  2F5F A;  2HPM A;  3ZQG A;  1LVK A;  2XGC A;  2OZ6 A;  4XL9 A;  1TNT A;  2Y2Z A;  1D3Y A;  2MD0 A;  1FTZ A;  1K61 A;  5DD4 A;  5D5U B;  1ZEL A;  3BCA A;  4XON A;  2QQ9 A;  2LMD A;  1IJW C;  4RB2 C;  5J4Y A;  1KQ8 A;  4IQ4 A;  2QBY A;  1GXP A;  4UVB A;  2Z2S B;  2BOL A;  3WTX C;  3S1M J;  3LNQ A;  5FB2 A;  4BBS J;  4PGG A;  5IOY A;  3WU0 A;  1N75 A;  4A0Z A;  5DS9 A;  5EEA A;  2K9M A;  4LIU A;  1RPW A;  2DJI A;  5AIP A;  2I10 A;  4MHG A;  1U8B A;  4DQ2 A;  2P5V A;  1MW7 A;  2WBM A;  3OYN A;  3I58 A;  2CUZ A;  3RPU D;  2R7O A;  3HSR A;  1B9N A;  3ISP A;  3OWT A;  3RQI A;  3IH2 A;  3V7R A;  1ZGJ A;  5E8I A;  1E3H A;  3KP2 A;  3EET A;  2LVS A;  1APL C;  2RC4 A;  3BTL A;  3DTE A;  2LTP A;  3TL4 X;  4BQN A;  1TWC J;  3VYT B;  3ZGK A;  5F27 A;  4M74 A;  1R9T J;  1WJF A;  4L5J A;  2LG4 A;  3IC7 A;  3SEQ A;  4ZDP A;  3GYH X;  2O0Y A;  3OOP A;  2DA4 A;  1EKE A;  3U1D A;  3ZMT A;  2ZXJ A;  3PIO F;  1WSU A;  1S3J A;  3KE2 A;  2HI3 A;  3VB2 A;  3VYU B;  2XAF A;  4ZZD A;  2X6Y A;  5ICE A;  2WC2 A;  5KAF C;  4A0X A;  3DFG A;  3TGN A;  2BY1 A;  3SJM A;  2E71 A;  2XF6 A;  3L2C A;  1R1T A;  2OBP A;  5LGU A;  3JAM K;  4FTH A;  1ZG3 A;  4S05 A;  3SZG A;  2GXG A;  2ECC A;  2PEX A;  4LMY A;  2DFH A;  2VC1 A;  5DEQ A;  4RLQ A;  2IXS A;  5C3E J;  1O3R A;  2HTJ A;  2A61 A;  4BEH B;  1RR8 C;  2IA1 A;  1SEU A;  5CKT A;  3DPT A;  2EIM H;  2H8R A;  2FBH A;  4MNU A;  3HRM A;  2E7X A;  2RNJ A;  2HFH A;  3QYB A;  1X1C A;  1MNE A;  1SD5 A;  3CCM I;  1U9N A;  1MBK A;  4BXX J;  1XGN A;  4JOM A;  3QYF A;  4PSW A;  1KA8 A;  4CXF A;  1IRZ A;  2QSH X;  1R7J A;  4OAZ A;  2B0L A;  2Q2E B;  1EV7 A;  4I98 B;  5L3F A;  4XRF A;  2VLA A;  3AFH A;  1B9M A;  2QKL B;  1HCR A;  3HOV J;  1EF4 A;  3CUQ C;  3O3K A;  2EV0 A;  2WY7 Q;  2LFB A;  2O8K A;  3D5S C;  3OOU A;  1T0F C;  2AQF A;  5K5O A;  4I99 C;  4A3C J;  3HRS A;  4NHJ A;  1YW9 A;  2DJN A;  1T39 A;  2DA1 A;  1YRN B;  3BR6 A;  1R36 A;  3FF5 A;  3DKY A;  2DQR A;  2DBB A;  3GUD A;  2D45 A;  4HW0 A;  5FLV A;  5TGT A;  4DIQ A;  3WGI A;  2K5C A;  1F4K A;  4E70 A;  3OYD A;  1Z1D A;  4XRS G;  2M7A A;  3F8B A;  2GBY A;  4B44 A;  4N9I A;  3ZRG A;  2BE5 F;  2HWV A;  4B47 A;  3MKL A;  3HC7 A;  2KKO A;  2GLO A;  5DCM B;  4G7O F;  5IYC J;  2E2H J;  3IWF A;  2ZJR F;  5EZG A;  5BNG A;  2L4A A;  4B3X A;  3PFY A;  1ZLK A;  4ABZ A;  3J7Y J;  3QP5 A;  4IRH A;  4HAM A;  1FOW A;  3OYJ A;  1PJR A;  2CSO A;  1AU7 A;  3HIF A;  2L2O A;  3ASN H;  3DPL C;  2ZJQ F;  5ILV A;  1OCR H;  2V4J C;  5LEJ A;  4D7N A;  3QAH A;  1HST A;  3SYT A;  1UMQ A;  4LIT A;  2YSR A;  1FOX A;  4B3A A;  1HF0 A;  1V55 H;  2ISZ A;  3S1N J;  1MJ9 A;  4AYB N;  4QIW N;  2ZME C;  2IEK A;  4KN7 X;  4QTR A;  2BBY A;  2FU4 A;  4U7D A;  5TJJ A;  3HOW J;  2F5E A;  2HZD A;  4UNO A;  4A6E A;  1BR2 A;  1D1A A;  3OL4 A;  4XID A;  1BI0 A;  2DFI A;  4A5N A;  1ZGW A;  1LPQ A;  4G6D A;  3MVP A;  4DZJ A;  4IHX A;  4QSH A;  3GVA A;  5GAD J;  2KIS A;  2XPU A;  2L54 A;  3OIP A;  1K6Y A;  3ERE D;  2K40 A;  2PLY A;  3U2R A;  3CLO A;  1Y1W J;  3M9A A;  3ERM A;  4EM0 B;  4LD5 A;  4CCJ A;  2OQR A;  3RCO A;  5B3S H;  3MFK A;  2CRG A;  4BS9 A;  4PJJ A;  2XRN A;  1JUS A;  3QPS A;  4Y13 A;  4UUS A;  5E3L A;  2RKH A;  2HDW A;  5GAG J;  2IRF G;  4BE0 A;  5HLG A;  1GV2 A;  3TDZ C;  5LRR A;  3M8J A;  4M9Z A;  5DCF A;  1K4S A;  4UB6 C;  2L9V A;  1RR7 A;  4UHT A;  1J75 A;  1SD4 A;  2R5Y A;  4CGZ A;  2ZXW H;  3HUG A;  3T1B A;  3QQA A;  5L3D A;  3DP7 A;  1B72 B;  3K70 C;  3CDH A;  1ZG1 A;  3CCL I;  1OCO H;  5CVU A;  2M5W A;  1FMV A;  2K4J A;  4A2U A;  3P9C A;  3HSF A;  2LYC A;  1VQ6 I;  4W1U A;  4HDU A;  2HOE A;  3K1M A;  2DA6 A;  1U8R A;  5BS6 A;  2CGP A;  1STZ A;  3F9K A;  4KIF A;  2Q8K A;  1TQI A;  2BY3 A;  2EQR A;  2M0M A;  5DDG A;  1IZ1 A;  2QLZ A;  2KIU A;  3JRB A;  4BH9 A;  4CDG A;  4KN4 X;  2GWR A;  2W4S A;  4I2O A;  1U5T C;  4AVP A;  1A31 A;  1OPC A;  3GLL A;  4TV7 A;  3OMY A;  1S5L C;  2Y48 A;  1HC8 A;  3KPH A;  2H8W A;  4P5O A;  1QBJ A;  4LJZ F;  3CC7 I;  3CZ6 A;  2Z3Y A;  1RRJ A;  3ULQ B;  2D1V A;  4MTE A;  3VSK A;  1K83 J;  3RKX A;  3HOZ J;  2MSY A;  3K0L A;  5K1Y A;  1X2M A;  2WB1 N;  4KJZ A;  1N25 A;  5C4X J;  2CMP A;  2Z99 A;  2HQ5 A;  3HTU A;  4B4C A;  4XM3 A;  2K7L A;  3N05 A;  1W7P B;  3HG9 A;  3P7N A;  2LKX A;  3E5U A;  3RZO J;  3HOT A;  1W36 D;  2JA5 J;  2A68 F;  5EZH A;  4IHT A;  4M6V A;  2CUE A;  5B1A H;  3S3N A;  1G4D A;  5FLM J;  1E2X A;  4UUT A;  3ZN0 A;  2YX4 A;  3PQJ A;  3BP8 A;  4JK1 X;  3Q3S A;  2CUJ A;  4XLH A;  5IT9 K;  1FBU A;  1XPX A;  5ICC A;  3GCM A;  2F2E A;  4E4H A;  3HKZ A;  3ZPL A;  2QQA A;  3KYD B;  3H9G A;  2QYO A;  3HRU A;  4BGD A;  4EGZ A;  1YFH A;  2LR8 A;  5KNL A;  2OJE D;  2NOG A;  1IN5 A;  1V5F A;  2IS1 A;  3ZQH A;  2MD5 A;  2X1E A;  2V9K A;  3BT9 A;  3BJ6 A;  4FET A;  4RB3 C;  4IKF A;  3KYC B;  4XLF A;  4E7H A;  5K5R A;  3WTS C;  3L2U A;  5K7H A;  2OQG A;  4Q48 A;  2Q2E A;  3AG3 H;  2EFW A;  1GHC A;  4BAC A;  2P81 A;  4IJA A;  2R7T A;  3HPH A;  2FJ1 A;  4ESF A;  3L7W A;  3F23 A;  3LFK A;  4UV9 A;  4A3B J;  4B8X A;  4QWQ A;  4HX8 A;  4M3D A;  4CYD A;  1YRN A;  1OJL A;  2GA2 A;  1VFC A;  4BDZ A;  2FUG 2;  1T2K A;  3FK7 A;  1F5T A;  3ECH A;  1FT9 A;  4KDP A;  3GO5 A;  5LEK A;  2IA0 A;  4EM1 A;  2HQR A;  2QSF X;  1E0E A;  3SQN A;  1TW3 A;  3I55 I;  1FZP B;  2MA3 A;  2E34 A;  1ODD A;  3EYI A;  1D5Y A;  1DDN A;  2K9S A;  1KYZ A;  3K4J A;  1BR4 A;  3I9V 2;  2OPT A;  2HZT A;  5DCM A;  1NK2 P;  3LST A;  2HVS A;  5J1R A;  2FSW A;  3KEY A;  5CPR B;  4A3K J;  4FE7 A;  3CTA A;  4ZH4 F;  2MG4 A;  1U3E M;  4MLO A;  5HDN A;  2UV1 A;  2XPV A;  5D6E A;  3U1K A;  2EIL H;  3ONQ A;  1W7P D;  4BE2 A;  2LRE A;  1KU2 A;  2DW4 A;  1KZH A;  5DUI A;  1PVE A;  2BW3 B;  1VQN I;  3B73 A;  2FQ4 A;  3PNY A;  1IUY A;  2DOA A;  3FKI J;  3K4K A;  1M1E B;  4P9F A;  4RAG A;  1YI2 I;  1P2F A;  1W5S A;  4MQ9 F;  4CIC A;  2DI3 A;  2NXN B;  3F72 A;  5J1U A;  4PDK A;  3E7L A;  2Y75 A;  4JBA A;  1KQ9 A;  3ZMS A;  1YO5 C;  1IXS B;  4CUG A;  1HDP A;  1FIP A;  3V8L A;  5M3F J;  2VQL A;  1TT0 A;  2DT6 A;  1WJ5 A;  2VJ5 A;  3COA C;  2O5R A;  5FKN A;  3VEP A;  4AIJ A;  1WJA A;  3FHN A;  2MGQ A;  2MFZ A;  2IW5 A;  4UV8 A;  1JT0 A;  5FO5 A;  4PZJ A;  2M7B A;  2CV2 A;  2IVM A;  1RI7 A;  3F22 A;  3I53 A;  1GXQ A;  5DD8 A;  4JQF A;  1I3Q J;  4KIT B;  5BOX A;  3PO2 J;  1WVR A;  5IP7 J;  1WI9 A;  1IRG A;  2XSD C;  1VQ4 I;  2NVQ J;  4WCG A;  5BPD A;  1WPK A;  2DT7 B;  2M4K A;  1ZH5 A;  3LA2 A;  2F4M B;  4BU2 A;  2BY0 A;  1P4X A;  1FOK A;  5DUK A;  4A69 C;  2TCT A;  5J4V A;  5HS8 A;  3ZP5 A;  3L2W A;  2Y0S N;  3ABU A;  2MC3 A;  2FA5 A;  5ILU A;  3E5X A;  3HBL A;  1T33 A;  2IA2 A;  2P8T A;  1XDS A;  4O3M A;  1Z9C A;  2KRF A;  4EGY A;  3JSO A;  1QZZ A;  1A6I A;  2E1M C;  2E5N A;  2W82 A;  3H92 A;  3LSG A;  1F43 A;  2P7C B;  3TQN A;  3OL3 A;  3K4M A;  2R7X A;  4BJ5 C;  4WK8 F;  1N77 A;  3HDD A;  3EQL F;  3JTG A;  5E8G A;  1B72 A;  3CES A;  2XAU A;  4R8H A;  1YJ9 I;  2LH9 A;  4BYY A;  2LK2 A;  2IGO A;  3TP3 A;  1Y0U A;  5F04 A;  1VQ9 I;  4FQG A;  2COM A;  2FOW A;  3GFL A;  1MBH A;  1SVM A;  3CQZ J;  3R60 A;  3FK6 A;  4XKB A;  3TW6 A;  1R6R A;  1FEX A;  1FC3 A;  2RQQ A;  3PIP F;  2WY8 Q;  1L3L A;  3H9Q A;  2JA7 J;  4V2F A;  1ZAR A;  2JZY A;  3VPR A;  3WTZ A;  5F1R A;  2H6B A;  3TOB A;  2JUG A;  2M45 A;  3JSP A;  2JQ7 A;  1OYI A;  5D8K B;  2F4I A;  3OYC A;  2DOF A;  3QYE A;  3O8H A;  2KZV A;  4II2 A;  2GZW A;  3AKZ A;  2ESN A;  4IEJ A;  2DMT A;  2PMU A;  3HZJ A;  2Y31 A;  1ZTR A;  4YFN F;  5LLQ A;  3L2R A;  5K7Z A;  1HKS A;  1LEA A;  2OAZ A;  1UB9 A;  4HA8 A;  4KMU X;  4P96 A;  1MGT A;  1XMX A;  5K7F A;  4C2U A;  4OIN F;  4L9J A;  4D9J A;  4W97 A;  3BQZ A;  3TKY A;  4PJ0 C;  3K4L A;  4XOR A;  1HBX G;  3R6S A;  1YHQ I;  4ZYD A;  1BC7 C;  4KMF A;  3D5L A;  1X3W B;  4U88 A;  1QHH D;  1B6A A;  1Z0X A;  5E20 A;  1H0M A;  5KHD A;  2UZK A;  4RA2 A;  1VTN C;  1S7O A;  2JRT A;  3K69 A;  3OS0 A;  2E2J J;  2W1O A;  3M7G A;  4I76 A;  1WRJ A;  2HR3 A;  3S2D J;  2IPQ X;  3GTQ J;  1FNN A;  1LVA A;  1NG7 A;  4M6Y A;  1O57 A;  4C30 A;  1R5I D;  1YS6 A;  4IL6 C;  4IZZ A;  2LSO A;  2K85 A;  1ZG5 A;  4C2T A;  4YFX F;  4U7B A;  1Z77 A;  2L7M P;  4F52 A;  1F1Z A;  5D4S A;  3GME A;  4NB5 A;  4DZP A;  5GAE J;  2MW8 A;  4YEL A;  4XOT A;  4ZYE A;  4A3M J;  1UEL B;  1FSE A;  2RAE A;  3K6G A;  1XSX A;  3K4C A;  1HXD A;  3FMS A;  2E5Z A;  2HVQ A;  2OTL I;  1D0X A;  1MMG A;  2XKP A;  4IX7 A;  3FXR A;  4M3F A;  1MDM A;  4RS8 A;  4I01 A;  3REO A;  1XG1 A;  3T8R A;  4DYC A;  1VQP I;  4A5M A;  1TZL A;  3JRA A;  5B5E C;  3AL0 C;  2VON A;  4BHB A;  2JVG A;  2NVY J;  1KU3 A;  2VAS A;  3PSF A;  3L9F A;  5E79 C;  1ZK8 A;  1Y39 A;  3WHC A;  4RDU A;  3NEU A;  4E7K A;  1WJB A;  2FE3 A;  3J80 K;  2QWW A;  2Y0M A;  3VYR B;  3M4O J;  1HQC A;  3PQK A;  4KIB A;  4RGS A;  1R49 A;  5FLX K;  5AON A;  1MSE C;  4N0B A;  4HYE A;  2ZXI A;  4DBR A;  2RV8 A;  3AG2 H;  3CCE I;  3FM5 A;  2P0W A;  4EV0 A;  1JTY A;  4IHV A;  5HLH A;  5LGT A;  5IP9 J;  1TQM A;  1MJB A;  5LGN A;  5FD5 A;  2NS8 A;  3I4N J;  3CJT B;  5CQG A;  1OCC H;  1TWG J;  4NC7 A;  3ESW B;  1IW7 F;  1OYY A;  1TL8 A;  1WJD A;  5DM7 F;  2VQH A;  2PX9 A;  5F0F A;  1IUF A;  4M3B A;  2KZG A;  3HM5 A;  1ZRF A;  3GW2 A;  4WWC A;  1I6H J;  2OF7 A;  1FJL A;  5JFR A;  1BJA A;  2XRL A;  2W24 A;  2DAO A;  1A5J A;  4BUP A;  1HW1 A;  2FRH A;  2OU2 A;  2EFP A;  1YJW I;  1FYM A;  1FP1 D;  1I5Z A;  2BW3 A;  2OC6 A;  3NAR A;  1EA3 A;  3GWZ A;  4RAZ A;  5GPC A;  4IPA A;  3SDG A;  2DPD A;  2VB6 A;  2CS3 A;  2E1N A;  1UG2 A;  2LY1 A;  5CVR A;  2A6T A;  1X19 A;  2R7Q A;  2ZFW A;  5CVJ A;  3WGH A;  5L3B A;  3C2G A;  1KQ0 A;  1H89 C;  4JP0 A;  3R4K A;  5FKM A;  3OYB A;  4M71 A;  1JKQ C;  4A3D J;  2P7V B;  1TT5 B;  1U78 A;  4E6K G;  3LFU A;  5FD6 A;  5ICG A;  3H0G J;  2KJC A;  1POG A;  3S2W A;  5IYD J;  3SEZ A;  1QNT A;  1X2N A;  3NWS A;  5GP9 A;  4AYB A;  3EPZ A;  5EYR A;  1OCP A;  2H1K A;  2ID3 A;  4U87 A;  3ABM H;  3S32 A;  2AXT C;  1HDD C;  3M07 A;  1QU3 A;  2IS2 A;  2KDO A;  4XN0 A;  2CU7 A;  4F7Z A;  3IV5 A;  2EA2 A;  4OIO F;  1G2H A;  4NC8 A;  4U0V A;  1BA5 A;  3OYM A;  4YRV A;  1YJN I;  2O6G E;  5J3L A;  1LNW A;  2BHZ A;  3U21 A;  2E35 A;  4GDF A;  4A93 J;  4FAS D;  3HTS B;  5D5V B;  3GFM A;  5E1X A;  3L2Q A;  2VL8 A;  3PNV A;  5LBQ A;  2P4W A;  2OD5 A;  2M87 A;  1DGR M;  1Z3Y A;  1RC9 A;  4AC0 A;  4ESB A;  3J81 Z;  3MD2 A;  4RMN A;  3E1S A;  2VPR A;  3O2P E;  1XSD A;  2D1H A;  4HF1 A;  2FBK A;  4GRI A;  2NRA C;  1YOV B;  1IV6 A;  2M4G A;  4CYC B;  5TRD A;  1YG2 A;  3BRO A;  3QPH A;  3JCU C;  1XCB A;  1WFX A;  1P4A A;  2HGC A;  4L5I A;  1MH3 A;  5EG0 B;  3NAU A;  1ZAO A;  5JR3 A;  1LDJ A;  1HSJ A;  2VXD A;  1A35 A;  2ZNY A;  3CMY A;  2HDD A;  4NQW B;  1RKW A;  1MMA A;  2QQ8 A;  4HNT A;  2KT0 A;  2KP6 A;  1J09 A;  1WJC A;  1T56 A;  1X1B A;  3LQR A;  4EJT A;  1Y1V J;  5HNH A;  2R7D A;  3JRI A;  3S16 J;  4GYI A;  4MQV A;  4XR6 A;  3BG3 A;  1MMN A;  3CCY A;  4OMY A;  2IS6 A;  1WHU A;  2CO5 A;  3T0Y A;  4YFK F;  1CGP A;  4PSX A;  1GLN A;  4R1H A;  2R7S A;  2EFN A;  4IRI A;  2LBF B;  3UR3 C;  5HVQ C;  1QPM A;  2MH9 A;  1T08 B;  4ZC3 A;  3E5Q A;  2CJJ A;  3H9J A;  3AG1 H;  3CJN A;  2CFO A;  2GAU A;  3CJQ B;  2PN6 A;  3J80 Z;  3TBI A;  4QPO A;  4DGW B;  1F36 A;  3E6B A;  4F93 B;  3OYE A;  2KMU A;  1GT0 C;  2DYS H;  1XMK A;  4HZF A;  1P7J A;  3OSF A;  3S3M A;  2AS5 F;  3B6A A;  3BTC A;  1D0Z A;  3H1C A;  2ZB9 A;  4WF2 A;  4XKV A;  3ROU A;  4D0P A;  1ON2 A;  1F9N A;  2VKV A;  1K4T A;  1WH5 A;  4L9V A;  2DCE A;  1B4A A;  4C9Y A;  4HF0 A;  4PJM A;  4N4N B;  3RPU A;  3U9G A;  3KX2 A;  4CH7 A;  3BDD A;  3R0A A;  2K3P A;  2PFB A;  3GBG A;  1XCV A;  4AID A;  2AHQ A;  5FKO A;  1DU0 A;  2WB1 A;  1FBS A;  2BXZ A;  3BR1 A;  5LHG A;  3T5X A;  4FCY A;  2K86 A;  3FXL A;  1IAW A;  2V6E A;  1O7F A;  1SVL A;  4ANJ A;  3I0T A;  2OUM A;  1ETQ A;  3QOP A;  3BCB A;  4RB1 A;  3BR2 A;  4RLF A;  3ECO A;  3F0C A;  3KLN A;  3IP4 B;  1R71 A;  3RZD J;  2ME6 A;  1GDT A;  3G6E I;  3DLA A;  3LOC A;  2M1B A;  2EFQ A;  6PAX A;  2XAS A;  1ZR2 A;  3NWT A;  3HGG A;  4L9N A;  3HEF A;  3IH4 A;  4BAY A;  3BY6 A;  4HX7 A;  4CHU A;  1V5G A;  4KIG A;  3A01 B;  3WHB A;  3PJR A;  3V8J A;  3K4B A;  5D8L B;  5EF6 A;  1IN4 A;  1VQL I;  3OIQ A;  3G73 A;  2LKP A;  4KNY A;  3WE3 A;  1CQT A;  3H3V K;  4HQE A;  4HG2 A;  3LAJ A;  1UFM A;  3BG7 A;  4AIH A;  3LA7 A;  2XAQ A;  1X4O A;  1MSF C;  1ORK A;  2XGX A;  2E2I J;  5IT3 A;  1HKQ A;  1UG0 A;  1MMD A;  2DK5 A;  2STW A;  3VWB A;  3SHF A;  1CF7 B;  1REP C;  3OR1 C;  3P9I A;  2I8D A;  3V42 A;  2A5W A;  3C18 A;  2CQN A;  3BJA A;  4UVC A;  2V1N A;  4OOI A;  5EJC A;  4RBO A;  4PCQ A;  3JAM Z;  2CQQ A;  1QZE A;  2L01 A;  1KU9 A;  1RET A;  3HOU J;  2FQ3 A;  2A69 F;  3VOD A;  1SD7 A;  5BPI A;  5F6F A;  5D5X B;  5B66 C;  2DTR A;  3LSI A;  2M2E A;  1FBQ A;  2LP0 A;  3FXO A;  2XF7 A;  1YYV A;  2M8G X;  2G9W A;  3JRH A;  4HST A;  3BG6 A;  2X85 A;  2JA8 J;  1TNS A;  4HQM A;  1IRX A;  2L02 A;  4G7H F;  2G7H A;  1R4M B;  3PUB A;  5FRO A;  2BZT A;  3HXL A;  2ELH A;  4XLE A;  5DV5 A;  4XOP A;  4M9X A;  1X4P A;  1ETY A;  2QGU A;  2Z1D A;  2L7F P;  3CCV I;  1RIO H;  3SDB A;  3TED A;  3E0J B;  4JX6 A;  4EJO A;  5F08 A;  1ETX A;  2LF8 A;  1TWF J;  2HYJ A;  2PMZ N;  3OY9 A;  2HQA A;  3VOE A;  2OTJ I;  1MH4 A;  5IY5 H;  2VBY A;  1BOA A;  5JLX A;  4A3F J;  1V5E A;  3GFJ A;  3K7A J;  1USS A;  1LJ9 A;  4ENN A;  3CF5 F;  3V7S A;  3LAP A;  2AO9 A;  4MFE A;  2DA2 A;  2V6C A;  2O8X A;  1VI0 A;  2K9Q A;  4GGG A;  5FFX A;  3JRD A;  1MND A;  4KT5 C;  3KP6 A;  3QWL A;  5CVV A;  3A1Y A;  3EYY A;  2OZU A;  4A6D A;  3I56 I;  5GTH C;  1PP8 F;  3GEZ A;  1J7K A;  1HA8 A;  1IV8 A;  3IUO A;  4Y3O A;  1D8J A;  1B59 A;  4B43 A;  5LFA A;  4IHY A;  2R4G A;  2D2W A;  2R7Z J;  3H36 A;  4BQQ A;  5A2Q K;  1PP7 U;  1FYK A;  3BTI A;  4AIK A;  1G59 A;  2DO7 A;  3D1N I;  3TMO A;  3CLQ A;  2L9R A;  2X6W A;  1SAX A;  1BI1 A;  3G1L A;  3BG5 A;  3I54 A;  4IF4 A;  2PBI A;  4BEH A;  5HOD A;  4CCN A;  4JYK A;  4CZZ A;  4C3J J;  1O7L A;  5C44 J;  3F21 A;  1Z6T A;  2CUF A;  3I4M J;  2ISY A;  2WTE A;  2VJI A;  2V9V A;  1V54 H;  2OV7 A;  3PO3 J;  4LLL A;  5DM6 F;  3CP2 A;  3MMY B;  1ACI A;  1KGS A;  1OLT A;  4OWR B;  4F3Q A;  2FOK A;  3CUO A;  4GFB A;  1IO2 A;  1ZHF A;  2N8G A;  1JGG A;  2DPU A;  3MEX A;  2V7F A;  2Y0S A;  3F3X A;  1S7A A;  4L18 B;  3ZCO A;  1H9T A;  4J01 A;  3CUQ B;  1G3W A;  1YIT I;  1IN6 A;  3W6K B;  2FML A;  1E3O C;  3HSE A;  4A3J J;  5EG0 A;  3GTM J;  1H88 C;  5HDG A;  2HQN A;  4J19 A;  4UVA A;  4NQW A;  4HDV A;  1TC3 C;  2YU9 J;  5JHU A;  4BHC A;  1FPQ A;  2IGM A;  1XGO A;  1BI2 A;  3ZQL A;  3DCF A;  2JMW A;  3BJO A;  3OYI A;  1IG7 A;  1XGS A;  3D5R C;  3WOD F;  3H0D A;  2W7N A;  1L0O C;  3BWG A;  3LSJ A;  2STT A;  3CCR I;  2ZNZ A;  2HKX A;  2HOA A;  5J6X A;  2R93 J;  2EZL A;  2DN0 A;  3FIS A;  1WKM A;  1I1G A;  1XB4 A;  2DOE A;  2LBF A;  4CCO A;  1NHA A;  2VQG A;  1EH8 A;  2WWY A;  4A3G J;  5LHH A;  1MMS A;  3LSK A;  3M8E A;  4BXU A;  3GTG J;  3PNT A;  2GA1 A;  4HNV A;  1S8N A;  3IRQ A;  2YR2 A;  5F64 A;  2F48 A;  1I1S A;  4FHT A;  2ID6 A;  3KLO A;  2PJR B;  2ZBK A;  3QPL A;  3ZMV A;  1R1V A;  3R61 A;  2IP2 A;  3H5A A;  2KIQ A;  3ZR8 X;  2QBY B;  4XSZ F;  4C3I J;  3HL2 A;  5H6Q A;  3O8G A;  2ELK A;  2GXB A;  4E7J A;  2O61 A;  1PUE E;  1Z91 A;  5GPA A;  3TOA A;  1VQO I;  3KIO A;  2NS7 A;  2VIX A;  2NVU B;  2ZME B;  3PUF A;  3K1P A;  2M3A A;  2DFF A;  1Y8R B;  3LL7 A;  4EM2 A;  4HRI A;  4KT6 A;  3HHG A;  4M9S A;  2VT3 A;  1X58 A;  3DV8 A;  5IP6 A;  4E7L A;  2CG4 A;  4M3G A;  3F8F A;  1XDU A;  2VBZ A;  1XSV A;  3RSN A;  3W6J B;  2YS9 A;  1DUX C;  3WTW C;  5AIQ A;  5E18 F;  2BVM A;  4MEX F;  1ERD A;  3DU6 A;  2ELJ A;  3DKW A;  2JA2 A;  1OKR A;  5HLT A;  2IGK A;  3QU6 A;  4XKC A;  1BN5 A;  3FM3 A;  3W2A A;  2JPB A;  5J8F A;  3IRR A;  1RZ4 A;  1UCR A;  3LA3 A;  3N4M A;  4L5E A;  3JRC A;  1X3Z B;  3K10 A;  2P6T A;  3A01 A;  5J40 A;  3GTP J;  1H8A C;  1BW5 A;  3L1P A;  3MKZ A;  1K79 A;  3HB9 A;  2HYF A;  4RGU A;  5F0C A;  1FOY A;  3TP0 A;  3I3L A;  3BZ6 A;  2HXO A;  1IXC A;  5FKK A;  1W0T A;  4K2E A;  4RB0 A;  4XBF A;  3A0H C;  4G9Y A;  5D5W B;  5JVT A;  4N9H A;  1I39 A;  1Y0N A;  1CF7 A;  1U9O A;  2KHM A;  3RYP A;  1D1B A;  3FXM A;  4UY8 I;  3H5R A;  1QHG A;  3OV8 A;  1B8I B;  4BL0 B;  1UJ8 A;  2XDV A;  2VJJ A;  1Y56 A;  2DFE A;  3GX4 X;  1NH3 A;  2O7O A;  2WV0 A;  1K6O A;  5L3C A;  1SFK A;  3MN2 A;  1VQM I;  3KYL A;  1OYW A;  1FWZ A;  5IT9 Z;  2F6C A;  3A2K A;  2QQB A;  2R7F A;  4X6A J;  1FYL A;  5JHF A;  3Q0V A;  3CO7 C;  1ZKG A;  3TW7 A;  1IC8 A;  1P92 A;  4AD9 A;  2GIZ A;  5E3O A;  1LDK B;  1ETW A;  4XMY A;  4CCK A;  5B1B H;  4CZC A;  3HOS A;  1ITY A;  2HU9 A;  2DA5 A;  1SMY F;  4FT8 A;  3W2W A;  3KZZ A;  1IDY A;  3LMM A;  4ZYG A;  4G12 A;  2O3F A;  4OIP F;  3BQY A;  1U5T B;  1S29 A;  2ME0 A;  3ZQF A;  2PMH A;  4IQJ A;  3X2Q H;  4MFD A;  2X9D A;  3F6V A;  2EB7 A;  5JVG F;  2KIM A;  5LD2 C;  1J2X A;  4LOC A;  2OA4 A;  1QRY A;  2KJB A;  1VF9 A;  4HX4 A;  2VXZ A;  4H0E A;  1QVU A;  2GXA A;  4RGX A;  2DTZ A;  2VBX A;  1GVD A;  1VQ8 I;  5ERI A;  2G0E A;  3E97 A;  3OS1 A;  2VUM J;  3ZMD A;  2DDA A;  3G1M A;  1SAN A;  1W7P A;  4PGH A;  1SFO J;  2R0Q C;  1ZRC A;  2P6S A;  3S17 J;  1WH7 A;  1O3Q A;  4Q5S F;  1D8K A;  3W2V A;  4G7Z F;  2HTS A;  1G3Y A;  5ED4 A;  2FNA A;  3CP8 A;  1XMA A;  1UHS A;  3ZQQ A;  4FX0 A;  1ZR4 A;  2PJP A;  1OQY A;  2NS0 A;  3VDX A;  3HPG A;  3CCQ I;  2CV1 A;  3QOE A;  2K02 A;  2CWE A;  4Q47 A;  4PJL A;  4RAF A;  3ZXS A;  4HOB A;  3QU3 A;  1MJA A;  3DBH B;  2F5V A;  1W0U A;  4AVZ A;  2VE9 A;  4II3 A;  4C2M J;  4M72 A;  4XKW A;  1YTY A;  3I64 A;  2IBD A;  3JR9 A;  2LOO A;  2X48 A;  2VN2 A;  3G71 I;  2WA0 A;  2JVH A;  3K70 D;  1I6X A;  2FXA A;  3VSL A;  1Z05 A;  2QZ8 A;  4G8X A;  4NC6 A;  2A6E F;  2VKH A;  3HOX J;  1TWA J;  2KDZ A;  2W84 A;  4IXA A;  3GXO A;  4E7S A;  2RGV A;  4YEJ A;  1ONV A;  4LG3 A;  2GQQ A;  2XC7 A;  3CUQ A;  4OIR F;  1P9Q C;  2KRC A;  2UXX A;  4WXH A;  1YE9 A;  1W36 C;  2X6X A;  1SFU A;  1RES A;  2JSC A;  1SVO A;  2AQE A;  2E19 A;  4B09 A;  2M30 A;  3GTO J;  4GXO A;  4YIR X;  3BTJ A;  3K1N A;  4KIC A;  5D6F A;  1XS9 A;  2W25 A;  2XB0 X;  1MNM C;  1S7E A;  2LRD A;  2J5P A;  2FD5 A;  3A0B C;  3BPV A;  3GZN B;  2KFD A;  3RKW A;  4BNC A;  2LY9 A;  2JWT A;  2LC2 A;  1HOM A;  4V2G A;  5CLS A;  3BLY A;  1BBY A;  2BGC A;  3Q9V A;  4GYG A;  5E1W A;  3GLX A;  1KU7 A;  4X1E A;  2QKM B;  1NTC A;  1QGP A;  1JHF A;  2OCC H;  5F0H A;  1BJZ A;  3OYA A;  3P5J A;  4LLG F;  4LB5 A;  2UXN A;  3I59 B;  3W3C A;  2HVR A;  1R5H A;  3C2B A;  4KA4 A;  1VND A;  2VE8 A;  3VYS B;  3C1D A;  4D7M A;  2PJR A;  1G6N A;  2DMU A;  3ABT A;  4XLA A;  2EIN H;  5IOZ A;  2F5D A;  1J5Y A;  1MBJ A;  1XTA A;  2ZKZ A;  1AWC A;  1WGX A;  3K4N A;  1Z21 A;  1FY7 A;  4Y52 J;  1D0Y A;  4U0W A;  1A6Q A;  4RGR A;  2ZSI B;  2ZME A;  2FEZ A;  1ETK A;  1SFE A;  1ULY A;  2V26 A;  3BOQ A;  1W5T A;  2Z5U A;  3R0J A;  3SFZ A;  4BJT A;  2CQX A;  2ZCW A;  1AKH B;  2DXI A;  1TWH J;  1ON1 A;  1JKR C;  4XRS A;  4HV5 A;  3G3Z A;  2WV1 A;  1K78 B;  2ADU A;  2V79 A;  5KCM A;  1DU6 A;  1U6G A;  3S14 J;  2UWM A;  2HXI A;  2KLO A;  1D5V A;  1J9I A;  2JN6 A;  2W57 A;  2L5Q A;  4ENJ A;  1JUP A;  2VJ4 A;  3OYF A;  2ZXH A;  2K4B A;  4ITV A;  2JK3 A;  5KAI C;  2E60 A;  3ML6 A;  1G3T A;  4G6T B;  3MAJ A;  3MQ0 A;  1IGN A;  5EEG A;  3GTJ J;  3CMA I;  2IS4 A;  3HYI A;  5HDK A;  3PM1 A;  3OS2 A;  2ECB A;  4MTD A;  1N78 A;  4WXC A;  2C6Y A;  1S9H A;  3DWL E;  3MWM A;  1RNL A;  3A02 A;  3KZY A;  1DP3 A;  1PUF B;  1PYV A;  3A4C A;  3CF2 A;  2M8E A;  4FIS A;  2ETH A;  3OYG A;  1FSH A;  2XF5 A;  4I0B A;  4XN3 A;  4DYQ A;  1JJ8 C;  3MCZ A;  2E1M B;  3FKJ A;  2A6H F;  1Z3X A;  2XKO A;  4WXD A;  1Q1V A;  1O3T A;  2CFX A;  4UB8 C;  4KIS A;  2ACJ A;  4ETS A;  1BL0 A;  2YPR A;  2E1O A;  1B8I A;  4LB6 B;  4LK1 F;  3IAS 2;  4P55 A;  3LSR A;  4BJ6 C;  2Q1Z B;  3M1E A;  3S8P A;  1FP2 A;  1T8I A;  3AG4 H;  1WI3 A;  3RQ4 A;  2F4O B;  1JT6 A;  3ZOB A;  2EH3 A;  2PQ8 A;  3BZC A;  2DA3 A;  3DXJ F;  1O3S A;  3ZMZ A;  4NBQ A;  3EUK L;  3FXJ A;  3CJR B;  2JUC A;  4ZDL A;  4EQQ A;  4IO9 F;  1W5C C;  3C7J A;  3E6D A;  1P7I A;  3E6M A;  2A07 F;  2DOD A;  2HDC A;  1JHH A;  2CQ7 A;  3KFW X;  2HYG D;  2EZK A;  3F6O A;  4CA0 A;  4WX9 A;  2HOT A;  2Y30 A;  1U5T A;  3KP5 A;  4L9T A;  3LSH A;  1YIO A;  3EUA A;  4Z2Y A;  2R7U A;  1FX7 A;  2QM3 A;  2MBF A;  2WAF A;  2CV0 A;  4ZYH A;  5DTD A;  5E17 F;  3WTU C;  2R7W A;  3O6B B;  5FLX Z;  2RQP A;  4EMS A;  3M3Y J;  2LF7 A;  4ESJ A;  5J47 A;  1OFC X;  2XIG A;  1UZC A;  3CMM A;  4O5V A;  3WE2 A;  4ASN A;  3WGG A;  3CCS I;  1T38 A;  3J7A Y;  4H4K C;  3M1C A;  5M5X J;  4XRM A;  2Z9O A;  4HBL A;  2EBI A;  2EZH A;  1QQI A;  2DLL A;  3ASO H;  1H9G A;  2MAB A;  5HS7 A;  3OYH A;  1WQ2 A;  2TDX A;  1S6L A;  3B02 A;  2PMZ A;  1O4X A;  2H09 A;  2X4H A;  2RVC A;  2OCE A;  2L9S A;  2RDP A;  1JGS A;  4E7I A;  4JX5 A;  1HLV A;  3EUH A;  2EFO A;  1A36 A;  1DPR A;  3CDI A;  4IOC F;  1R22 A;  3F8C A;  3RDI A;  4F92 B;  2CYY A;  3PSI A;  3V8K A;  2IAI A;  2IT0 A;  4B1R A;  3FWE A;  1YIJ I;  4S04 A;  1W1W E;  3L2V A;  1R1U A;  5CVI A;  2XUB A;  4A3E J;  2X0L A;  3MZ8 A;  5LHI A;  4F91 B;  2B63 J;  3JW4 A;  2FBI A;  1MBE A;  4Y17 A;  3IKV A;  3OR2 C;  2EA4 A;  2XHK A;  4DBQ A;  2XB5 A;  2RN7 A;  5HNF A;  4I6Z A;  4J00 A;  2CW7 A;  2RNG A;  3S1R J;  1ZRE A;  1FMW A;  4DW6 A;  3DPU A;  2Q0O A;  4BBR J;  2QSG X;  2XRO A;  2YUS A;  2ZSH B;  1TBX A;  4A12 A;  4P1W A;  2Z33 A;  2XGD A;  3FBN B;  2COB A;  2EIK H;  1LKX A;  4F55 A;  3AL0 B;  3L00 A;  2GM4 A;  1YQA A;  4XK4 A;  1X1D A;  5BQT A;  4OIQ F;  1QPI A;  4ON0 A;  1SC7 A;  4ZDO A;  3DTI A;  3FBI B;  3DBL B;  2EJR A;  2L9N A;  1KYW A;  1DQU A;  1QZY A;  4BQO A;  5JI6 A;  3A03 A;  1LE8 B;  4GO1 A;  4Z6Y A;  1R00 A;  3ZN1 A;  2NVX J;  2H6C A;  4PFP A;  3S2H J;  2XAH A;  1ZN2 A;  5F1J A;  3FHZ A;  1Y8Q B;  4DOZ A;  2M0C A;  2QEN A;  4DYR A;  2GOM A;  1U2W A;  2H1L A;  4X0G A;  1ETO A;  3DF8 A;  3DLL F;  3CDL A;  3MZY A;  4EJU A;  3AAF A;  1LFP A;  3RKQ A;  1BC8 C;  4RM2 A;  2FNP A;  2EV6 A;  1DP7 P;  4FE4 A;  3HOY J;  1FLI A;  2IJL A;  2W00 A;  4XLC A;  5FFZ A;  2XAJ A;  3S15 J;  1Q1H A;  2R5Z B;  2MH2 A;  4QPQ A;  2B9S A;  1Z7L A;  1DPU A;  1BOB A;  2NOJ B;  4MIM A;  2K9N A;  3MKY B;  3WU2 C;  4MEY F;  5K5Q A;  2D5V A;  3I59 A;  4HLX A;  4I7H A;  5M3M J;  4HLY A;  4AWX B;  3CC2 I;  4I09 A;  1IN7 A;  1BIA A;  4XNF A;  1HKT A;  4M73 A;  4L0Y B;  9ANT A;  5GTI C;  2KL4 A;  5M5Y J;  2XSJ C;  5FGM A;  1FIA A;  2XVC A;  3FX3 A;  4EJV A;  3BG9 A;  2VPL A;  2BVL A;  2ICW G;  1LEB A;  2Y9Y A;  1JKP C;  2DDB A;  2VBW A;  2CW0 F;  5E1Z B;  3IL2 A;  1JJ6 C;  4ZTF A;  1Z7U A;  3BC8 A;  2VOP A;  1UHM A;  2EWN A;  3C2H A;  3E3V A;  1PDN C;  4A3L J;  1SAU A;  5ILS A;  1JUM A;  1BM9 A;  1U0J A;  3LQQ A;  1ZQ3 P;  2JTV A;  1AKH A;  3FXQ A;  1YLF A;  1P6R A;  3IKT A;  1WJE A;  3DEW A;  3QOD A;  2E7W A;  3RPQ A;  4M6X A;  2J5O A;  3Q9S A;  3SXY A;  1V3F A;  1A04 A;  3TO7 A;  4C3H J;  1I50 J;  1K78 A;  2QUF A;  4CCL A;  5DYM A;  4Y15 A;  4Y4R A;  1YW7 A;  3JRF A;  1XGM A;  2JT1 A;  5EGO B;  1X1A A;  3CCJ I;  4IOA F;  1BW6 A;  5HS9 A;  3HJE A;  5IYB J;  2V9P A;  3H35 A;  2X6O A;  4N4O B;  2JSP A;  2DU9 A;  2O03 A;  4XQF A;  1P4W A;  1NK3 P;  5CQE A;  4RAY A;  3J7Z I;  3L09 A;  2R92 J;  4AUX A;  3RJP A;  3W6V A;  4Y7N J;  3FXU A;  5HOO A;  4BQA A;  5KVR A;  4HPQ A;  3G4S I;  4EJW A;  3H3Z A;  5L3G A;  3MKW B;  1EH7 A;  2DMN A;  2IGN A;  1JXS A;  3UNG C;  3OSG A;  1ETV A;  1X1P A;  1Z67 A;  1XC5 A;  2KIF A;  2KPM A;  3EUH C;  3V4G A;  3KET A;  1PUF A;  4BHP A;  2XGE A;  2I5U A;  3F8M A;  4ZJZ A;  1JKO C;  4ENK A;  1R4N B;  3UKG A;  1QO0 D;  3OIO A;  2PG4 A;  1HW5 A;  3QPT A;  2JRM A;  1TP4 A;  1OR7 A;  3EDP A;  4IRG A;  5E3N A;  4QLC U;  1K7A A;  4CYC A;  2NNN A;  4LG0 B;  1EJ9 A;  2DYR H;  1VZ0 A;  2Z16 A;  3SZT A;  2V1D A;  5HLI A;  5IPA A;  3I5U A;  4OMZ A;  3TO9 A;  2GIV A;  2XPW A;  3ZQC A;  2ZO4 A;  1MDM B;  1E17 A;  2L0K A;  1X3U A;  1Z6R A;  3FMQ A;  1GUU A;  4PK4 A;  1MZB A;  4HSR A;  4S0H B;  4BDY A;  2A05 A;  3DBR B;  2XV4 S;  3TO6 A;  5C4J J;  5CYV A; 
#chains in the Genus database with same CATH homology
 2W85 A;  1V4R A;  3GFI A;  2HS5 A;  3SZP A;  3KP4 A;  2LDU A;  3DEU A;  4ENM A;  4KUM A;  1UST A;  2P5L C;  4YIF A;  1B1B A;  5J8C A;  1IN8 A;  4UUV A;  2G7U A;  3KP3 A;  4I02 A;  3GZ5 A;  4CO8 A;  1AOY A;  1ZLJ A;  1MD0 A;  3WU1 B;  3WTV C;  4KYW A;  1LB2 A;  4LK0 F;  3J7A O;  1YW8 A;  4EVI A;  3KP7 A;  2NNY A;  1JE8 A;  1LDD A;  4KFC A;  1SD6 A;  5H6R A;  1BI3 A;  4P9U A;  2XAG A;  1W4M A;  1T6S A;  3BPX A;  2ESH A;  1C0W A;  3K2Z A;  2ZJ2 A;  3GZ6 A;  5ICF A;  2P5K A;  3RI4 A;  2VC0 A;  3HRT A;  3K9T A;  4G6Q A;  3M8F A;  3FMR A;  2H94 A;  1IXR C;  1HW2 A;  3DQV C;  5LRS A;  2VOO A;  1SMT A;  3V7C A;  1WWX A;  2PI0 A;  3WTY C;  5CJ9 A;  3F8N A;  5BMZ A;  1TQP A;  4ZZL A;  2F5C A;  2K27 A;  4DNC A;  2JPC A;  1J0R A;  3QP6 A;  3Q5F A;  4FX4 A;  4XLN F;  3N97 A;  4HV6 A;  2L3D A;  3KCC A;  2YU3 A;  5H20 A;  2FMY A;  1ZRD A;  1GVJ A;  2AXL A;  4I0A A;  4R79 A;  4YII A;  5L3E A;  4MGR A;  2V1U A;  5A2Q Z;  3FZV A;  3RKY A;  3RTR A;  2R3S A;  2L4M A;  2YX7 A;  2FF4 A;  4L0Z B;  3C3W A;  1ZYR F;  2V1X A;  3RYR A;  4A0Y A;  3ZQ7 A;  3WG9 A;  1RUO A;  4Q4Z F;  3CO6 C;  3GF2 A;  2NAZ A;  2VOD A;  1RUN A;  4OU0 A;  2E1C A;  4G94 A;  1R23 A;  2DT5 A;  4HF2 A;  1ZGA A;  2A5Y B;  3HHH A;  3I4P A;  1UHW A;  2EK5 A;  3TDU C;  3QRF F;  2BEO A;  1LQ1 A;  1TTY A;  3ELK A;  3LWF A;  2CQK A;  2HEO A;  1R5G A;  3IWZ A;  4IVN A;  1MKM A;  1XD7 A;  4XLP F;  4XSX F;  2A3S A;  3NRV A;  3J81 K;  1T98 A;  2QVO A;  2H27 A;  1R58 A;  3E6C C;  1I27 A;  3D0S A;  1TW2 A;  1EH6 A;  3I71 A;  3KEQ A;  3MZH A;  3VFZ A;  2DQL A;  3RIR A;  4U0Y A;  2HKO A;  3H3U A;  1OMI A;  2LNB A;  5EEH A;  2VT2 A;  2BV6 A;  4LG0 A;  2MLG A;  3JTH A;  1TLH B;  4O6J A;  1IF1 A;  3WTT C;  4LGW A;  3KEO A;  2EV5 A;  1T0F A;  3ZMU A;  3IHU A;  4UXN A;  4IHS A;  4LFU A;  5D4R A;  1SFX A;  3PFI A;  3NQO A;  2NYX A;  4GCV A;  2BYV E;  2DK8 A;  1BIB A;  4YG2 F;  3T8T A;  1J59 A;  1YS7 A;  1IRF A;  4LLN A;  3P9K A;  1G3S A;  1XN7 A;  5KK1 A;  2MLK A;  2F5F A;  2OZ6 A;  1TNT A;  1D3Y A;  5DD4 A;  5D5U B;  2QQ9 A;  4RB2 C;  1KQ8 A;  2QBY A;  1GXP A;  4UVB A;  3WTX C;  5FB2 A;  4PGG A;  3WU0 A;  4A0Z A;  5AIP A;  4MHG A;  4DQ2 A;  2P5V A;  3I58 A;  3ISP A;  3HSR A;  1B9N A;  3V7R A;  5E8I A;  1ZGJ A;  3KP2 A;  3EET A;  2RC4 A;  4M74 A;  4L5J A;  3IC7 A;  3GYH X;  2O0Y A;  3OOP A;  3U1D A;  3ZMT A;  2ZXJ A;  1WSU A;  1S3J A;  3KE2 A;  3VB2 A;  2XAF A;  4ZZD A;  5ICE A;  2WC2 A;  4A0X A;  3DFG A;  3TGN A;  3L2C A;  1R1T A;  2OBP A;  5LGU A;  3JAM K;  1ZG3 A;  4S05 A;  2GXG A;  2PEX A;  4LMY A;  2VC1 A;  5DEQ A;  1O3R A;  2HTJ A;  2A61 A;  2IA1 A;  3DPT A;  2FBH A;  4MNU A;  3HRM A;  2E7X A;  2RNJ A;  2HFH A;  1SD5 A;  1XGN A;  4CXF A;  1KA8 A;  1R7J A;  2B0L A;  1EV7 A;  4I98 B;  5L3F A;  4XRF A;  1B9M A;  3CUQ C;  3O3K A;  2EV0 A;  5K5O A;  3HRS A;  4NHJ A;  1YW9 A;  1T39 A;  1R36 A;  3FF5 A;  2DQR A;  2DBB A;  3GUD A;  2D45 A;  4HW0 A;  3WGI A;  1F4K A;  4E70 A;  1Z1D A;  3F8B A;  4N9I A;  2BE5 F;  2HWV A;  2KKO A;  4G7O F;  5DCM B;  3IWF A;  2L4A A;  1ZLK A;  3QP5 A;  4IRH A;  4HAM A;  2CSO A;  3HIF A;  3DPL C;  5ILV A;  5LEJ A;  3QAH A;  1HST A;  2YSR A;  2ISZ A;  1MJ9 A;  4KN7 X;  2BBY A;  2FU4 A;  4U7D A;  5TJJ A;  2F5E A;  4UNO A;  4A6E A;  1BI0 A;  2DFI A;  4A5N A;  4G6D A;  3GVA A;  2L54 A;  3ERE D;  2PLY A;  3U2R A;  3CLO A;  3M9A A;  4EM0 B;  4LD5 A;  2OQR A;  3MFK A;  2XRN A;  4Y13 A;  2RKH A;  2IRF G;  5HLG A;  3TDZ C;  5LRR A;  4M9Z A;  5DCF A;  4UHT A;  1J75 A;  1SD4 A;  4CGZ A;  3HUG A;  3T1B A;  5L3D A;  3DP7 A;  3CDH A;  1ZG1 A;  5CVU A;  2M5W A;  2K4J A;  4A2U A;  3P9C A;  3HSF A;  4HDU A;  2HOE A;  3K1M A;  1U8R A;  5BS6 A;  2CGP A;  1STZ A;  4KIF A;  2Q8K A;  1TQI A;  5DDG A;  1IZ1 A;  2QLZ A;  2KIU A;  4BH9 A;  4CDG A;  4KN4 X;  2GWR A;  4I2O A;  1U5T C;  4AVP A;  1OPC A;  4TV7 A;  2Y48 A;  4P5O A;  1QBJ A;  4LJZ F;  2Z3Y A;  3ULQ B;  2D1V A;  4MTE A;  3RKX A;  3K0L A;  5K1Y A;  2Z99 A;  3HTU A;  2K7L A;  1W7P B;  3P7N A;  3E5U A;  3HOT A;  4IHT A;  2A68 F;  1G4D A;  1E2X A;  3ZN0 A;  2YX4 A;  3PQJ A;  3BP8 A;  4JK1 X;  5IT9 K;  1FBU A;  5ICC A;  2F2E A;  3ZPL A;  2QQA A;  2QYO A;  3HRU A;  4EGZ A;  1YFH A;  1IN5 A;  2MD5 A;  3BJ6 A;  4RB3 C;  5K5R A;  3WTS C;  2OQG A;  4Q48 A;  2Q2E A;  2EFW A;  1GHC A;  4IJA A;  4ESF A;  3L7W A;  3F23 A;  3LFK A;  4UV9 A;  4B8X A;  4QWQ A;  4HX8 A;  4CYD A;  2GA2 A;  1T2K A;  1F5T A;  3ECH A;  1FT9 A;  4KDP A;  3GO5 A;  5LEK A;  2IA0 A;  4EM1 A;  2HQR A;  3SQN A;  1TW3 A;  1FZP B;  2MA3 A;  1ODD A;  3EYI A;  1DDN A;  1KYZ A;  2HZT A;  5DCM A;  3LST A;  2FSW A;  3CTA A;  4ZH4 F;  1U3E M;  5HDN A;  5D6E A;  1W7P D;  1KU2 A;  2DW4 A;  5DUI A;  3B73 A;  1IUY A;  4P9F A;  1P2F A;  1W5S A;  4MQ9 F;  4CIC A;  2DI3 A;  3F72 A;  4PDK A;  2Y75 A;  4JBA A;  1KQ9 A;  3ZMS A;  1YO5 C;  1IXS B;  3V8L A;  3COA C;  3VEP A;  4AIJ A;  2IW5 A;  4UV8 A;  5FO5 A;  4PZJ A;  2IVM A;  1RI7 A;  3F22 A;  3I53 A;  1GXQ A;  5DD8 A;  4JQF A;  5BOX A;  1WI9 A;  1IRG A;  4WCG A;  5BPD A;  1ZH5 A;  3LA2 A;  1P4X A;  1FOK A;  5DUK A;  5HS8 A;  3ZP5 A;  3ABU A;  2MC3 A;  2FA5 A;  5ILU A;  3E5X A;  2IA2 A;  2P8T A;  1XDS A;  4O3M A;  1Z9C A;  2KRF A;  4EGY A;  3JSO A;  1QZZ A;  3H92 A;  2P7C B;  3TQN A;  4WK8 F;  3EQL F;  3JTG A;  5E8G A;  4R8H A;  4BYY A;  1Y0U A;  2COM A;  3GFL A;  3R60 A;  1FC3 A;  1L3L A;  1ZAR A;  2JZY A;  3WTZ A;  5F1R A;  2H6B A;  3TOB A;  2M45 A;  3JSP A;  1OYI A;  5D8K B;  2GZW A;  2ESN A;  2PMU A;  4YFN F;  5LLQ A;  1HKS A;  1LEA A;  2OAZ A;  1UB9 A;  4HA8 A;  4KMU X;  4P96 A;  1MGT A;  4OIN F;  4L9J A;  3TKY A;  1HBX G;  3R6S A;  4ZYD A;  1BC7 C;  4KMF A;  3D5L A;  4U88 A;  1B6A A;  5E20 A;  1H0M A;  2UZK A;  1VTN C;  1S7O A;  2JRT A;  3K69 A;  3M7G A;  1WRJ A;  2HR3 A;  2IPQ X;  1FNN A;  1LVA A;  4M6Y A;  1O57 A;  1YS6 A;  2LSO A;  1ZG5 A;  4YFX F;  4U7B A;  1F1Z A;  5D4S A;  4NB5 A;  4ZYE A;  1FSE A;  1XSX A;  1HXD A;  3FMS A;  2XKP A;  3FXR A;  1MDM A;  4RS8 A;  4I01 A;  3REO A;  3T8R A;  4A5M A;  2VON A;  4BHB A;  1KU3 A;  3L9F A;  3NEU A;  2FE3 A;  3J80 K;  2QWW A;  2Y0M A;  1HQC A;  3PQK A;  4KIB A;  4RGS A;  5FLX K;  5AON A;  4N0B A;  4HYE A;  2RV8 A;  3FM5 A;  4EV0 A;  5HLH A;  5LGT A;  1TQM A;  1MJB A;  5LGN A;  5FD5 A;  1IW7 F;  1OYY A;  1ZRF A;  3GW2 A;  4WWC A;  5JFR A;  1BJA A;  2W24 A;  2DAO A;  1HW1 A;  2FRH A;  2OU2 A;  2EFP A;  1FYM A;  1FP1 D;  1I5Z A;  4RAZ A;  3GWZ A;  4IPA A;  2DPD A;  2E1N A;  5CVR A;  5CVJ A;  2ZFW A;  5L3B A;  3WGH A;  1KQ0 A;  3R4K A;  4M71 A;  2P7V B;  1U78 A;  5FD6 A;  5ICG A;  2KJC A;  3S2W A;  1QNT A;  4F7Z A;  2EA2 A;  4OIO F;  4U0V A;  2O6G E;  1LNW A;  3HTS B;  5D5V B;  3GFM A;  5E1X A;  5LBQ A;  2P4W A;  2OD5 A;  2M87 A;  4ESB A;  3J81 Z;  3O2P E;  1XSD A;  2D1H A;  4HF1 A;  2FBK A;  2NRA C;  5TRD A;  1YG2 A;  3BRO A;  3QPH A;  1XCB A;  1P4A A;  2HGC A;  4L5I A;  1ZAO A;  5JR3 A;  1LDJ A;  1HSJ A;  2ZNY A;  3LQR A;  4EJT A;  2R7D A;  4GYI A;  4MQV A;  4OMY A;  2CO5 A;  3T0Y A;  4YFK F;  1CGP A;  4R1H A;  2EFN A;  4IRI A;  5HVQ C;  1QPM A;  2MH9 A;  3E5Q A;  3CJN A;  2GAU A;  2PN6 A;  3J80 Z;  3E6B A;  1XMK A;  4HZF A;  2AS5 F;  4WF2 A;  3ROU A;  4D0P A;  1ON2 A;  1F9N A;  4L9V A;  1B4A A;  4HF0 A;  3RPU A;  3U9G A;  3BDD A;  3R0A A;  2PFB A;  1XCV A;  1FBS A;  5LHG A;  1IAW A;  3T5X A;  2K86 A;  1O7F A;  3I0T A;  3QOP A;  4RB1 A;  3ECO A;  3KLN A;  2M1B A;  2EFQ A;  6PAX A;  2XAS A;  4L9N A;  4BAY A;  3BY6 A;  4HX7 A;  4CHU A;  4KIG A;  3V8J A;  5D8L B;  1IN4 A;  3G73 A;  2LKP A;  4KNY A;  3WE3 A;  4HQE A;  3LAJ A;  1UFM A;  4AIH A;  3LA7 A;  2XAQ A;  2XGX A;  5IT3 A;  1HKQ A;  2STW A;  2DK5 A;  3SHF A;  1CF7 B;  1REP C;  3P9I A;  3C18 A;  3BJA A;  4UVC A;  4OOI A;  4PCQ A;  3JAM Z;  2L01 A;  1KU9 A;  2FQ3 A;  2A69 F;  3VOD A;  1SD7 A;  5BPI A;  5F6F A;  5D5X B;  2DTR A;  1FBQ A;  1YYV A;  2G9W A;  1TNS A;  4HQM A;  2L02 A;  4G7H F;  2G7H A;  2ELH A;  5DV5 A;  4M9X A;  1RIO H;  4EJO A;  2LF8 A;  3VOE A;  2VBY A;  1BOA A;  3GFJ A;  1USS A;  1LJ9 A;  4ENN A;  3V7S A;  3LAP A;  2V6C A;  2O8X A;  4GGG A;  5FFX A;  4KT5 C;  3KP6 A;  5CVV A;  3EYY A;  2OZU A;  4A6D A;  1PP8 F;  3GEZ A;  1J7K A;  1D8J A;  1B59 A;  2D2W A;  5A2Q K;  1PP7 U;  1FYK A;  4AIK A;  2DO7 A;  1SAX A;  1BI1 A;  3I54 A;  4IF4 A;  2PBI A;  4CZZ A;  1O7L A;  3F21 A;  1Z6T A;  2ISY A;  2WTE A;  2V9V A;  4LLL A;  1KGS A;  2FOK A;  3CUO A;  1ZHF A;  2DPU A;  3MEX A;  3F3X A;  1S7A A;  4L18 B;  1H9T A;  3CUQ B;  1G3W A;  1IN6 A;  3W6K B;  2FML A;  3HSE A;  5HDG A;  2HQN A;  4UVA A;  4NQW A;  4HDV A;  5JHU A;  4BHC A;  1FPQ A;  1XGO A;  1BI2 A;  3BJO A;  1XGS A;  3WOD F;  1L0O C;  3BWG A;  2STT A;  2ZNZ A;  2HKX A;  5J6X A;  1WKM A;  1I1G A;  1XB4 A;  1NHA A;  1EH8 A;  2WWY A;  5LHH A;  3M8E A;  4BXU A;  2GA1 A;  1S8N A;  3IRQ A;  2YR2 A;  5F64 A;  1I1S A;  4FHT A;  3KLO A;  2ZBK A;  3ZMV A;  1R1V A;  3R61 A;  2IP2 A;  2QBY B;  4XSZ F;  5H6Q A;  2GXB A;  2O61 A;  1PUE E;  1Z91 A;  3TOA A;  2ZME B;  3K1P A;  4EM2 A;  3HHG A;  4M9S A;  2VT3 A;  3DV8 A;  2CG4 A;  3F8F A;  1XDU A;  2VBZ A;  1XSV A;  3W6J B;  1DUX C;  3WTW C;  5AIQ A;  5E18 F;  4MEX F;  3DKW A;  1OKR A;  3QU6 A;  1BN5 A;  3FM3 A;  3N4M A;  5J8F A;  3IRR A;  2JPB A;  1RZ4 A;  1UCR A;  3LA3 A;  2P6T A;  1K79 A;  2HYF A;  4RGU A;  3BZ6 A;  1IXC A;  4K2E A;  4RB0 A;  4XBF A;  5D5W B;  4G9Y A;  5JVT A;  4N9H A;  1CF7 A;  3RYP A;  3OV8 A;  3GX4 X;  2WV0 A;  1K6O A;  5L3C A;  1OYW A;  1FWZ A;  5IT9 Z;  2QQB A;  2R7F A;  1FYL A;  3CO7 C;  1P92 A;  4AD9 A;  1LDK B;  3HOS A;  1SMY F;  4FT8 A;  3KZZ A;  4ZYG A;  2O3F A;  4OIP F;  1U5T B;  1S29 A;  2PMH A;  3F6V A;  2EB7 A;  2KIM A;  1J2X A;  2OA4 A;  2KJB A;  4HX4 A;  2VXZ A;  4H0E A;  4RGX A;  2VBX A;  5ERI A;  3E97 A;  3ZMD A;  1W7P A;  4PGH A;  1ZRC A;  2P6S A;  1O3Q A;  4Q5S F;  1D8K A;  4G7Z F;  2HTS A;  1G3Y A;  5ED4 A;  2FNA A;  1XMA A;  4FX0 A;  2PJP A;  2NS0 A;  2K02 A;  2CWE A;  4Q47 A;  4HOB A;  3QU3 A;  1MJA A;  2VE9 A;  4M72 A;  1YTY A;  3I64 A;  2VN2 A;  1I6X A;  2FXA A;  1Z05 A;  2QZ8 A;  4G8X A;  2A6E F;  2W84 A;  4IXA A;  3GXO A;  2RGV A;  1ONV A;  2GQQ A;  3CUQ A;  4OIR F;  2UXX A;  4WXH A;  1SFU A;  2JSC A;  4B09 A;  2M30 A;  4GXO A;  3K1N A;  4KIC A;  5D6F A;  2W25 A;  2J5P A;  3BPV A;  3RKW A;  4BNC A;  5CLS A;  1BBY A;  2BGC A;  3Q9V A;  4GYG A;  5E1W A;  3GLX A;  1KU7 A;  1QGP A;  1JHF A;  4LLG F;  4LB5 A;  2UXN A;  3I59 B;  1R5H A;  4KA4 A;  2VE8 A;  3C1D A;  1G6N A;  3ABT A;  2F5D A;  1J5Y A;  2ZKZ A;  1AWC A;  1FY7 A;  4U0W A;  4RGR A;  2ZME A;  2FEZ A;  1SFE A;  1ULY A;  3BOQ A;  1W5T A;  2Z5U A;  3R0J A;  3SFZ A;  2ZCW A;  1ON1 A;  4HV5 A;  3G3Z A;  1K78 B;  2ADU A;  2V79 A;  1U6G A;  2UWM A;  1D5V A;  1J9I A;  2W57 A;  4ENJ A;  2K4B A;  3ML6 A;  1G3T A;  3MAJ A;  3MQ0 A;  5EEG A;  3HYI A;  5HDK A;  4MTD A;  4WXC A;  2C6Y A;  3MWM A;  1RNL A;  3KZY A;  2M8E A;  2ETH A;  1FSH A;  4I0B A;  3MCZ A;  2A6H F;  2XKO A;  4WXD A;  1O3T A;  2CFX A;  2ACJ A;  4ETS A;  2YPR A;  4LB6 B;  4LK1 F;  4P55 A;  3M1E A;  1FP2 A;  2PQ8 A;  3DXJ F;  1O3S A;  3ZMZ A;  4EQQ A;  3C7J A;  3E6D A;  3E6M A;  2A07 F;  2HDC A;  1JHH A;  3KFW X;  2HYG D;  4WX9 A;  3F6O A;  1U5T A;  3KP5 A;  4L9T A;  1YIO A;  4Z2Y A;  1FX7 A;  2QM3 A;  2MBF A;  4ZYH A;  5E17 F;  3WTU C;  3O6B B;  5FLX Z;  2RQP A;  4EMS A;  2LF7 A;  4ESJ A;  2XIG A;  3WE2 A;  4O5V A;  4ASN A;  1T38 A;  3WGG A;  2Z9O A;  4HBL A;  1QQI A;  2DLL A;  1H9G A;  5HS7 A;  1WQ2 A;  2TDX A;  1S6L A;  3B02 A;  2H09 A;  2X4H A;  2RVC A;  2RDP A;  1JGS A;  3EUH A;  2EFO A;  1DPR A;  1R22 A;  3F8C A;  3RDI A;  2CYY A;  3V8K A;  2IT0 A;  3FWE A;  4S04 A;  1R1U A;  5CVI A;  2XUB A;  2X0L A;  5LHI A;  3JW4 A;  2FBI A;  4Y17 A;  3IKV A;  2EA4 A;  2XHK A;  2RN7 A;  1ZRE A;  2Q0O A;  2XRO A;  1TBX A;  4A12 A;  2Z33 A;  3L00 A;  1YQA A;  5BQT A;  4OIQ F;  4ON0 A;  2EJR A;  1KYW A;  1QZY A;  5JI6 A;  4GO1 A;  1R00 A;  3ZN1 A;  2H6C A;  2XAH A;  1ZN2 A;  3FHZ A;  2QEN A;  1U2W A;  3DF8 A;  3MZY A;  4EJU A;  3AAF A;  1BC8 C;  2FNP A;  2EV6 A;  1DP7 P;  1FLI A;  2IJL A;  5FFZ A;  2XAJ A;  1Q1H A;  2MH2 A;  1DPU A;  5K5Q A;  4MEY F;  3I59 A;  4HLX A;  4I7H A;  4HLY A;  4AWX B;  4I09 A;  1IN7 A;  1BIA A;  1HKT A;  4M73 A;  4L0Y B;  5FGM A;  3FX3 A;  2XVC A;  4EJV A;  1LEB A;  2VBW A;  2CW0 F;  5E1Z B;  3IL2 A;  1Z7U A;  2VOP A;  1UHM A;  2EWN A;  3E3V A;  1PDN C;  5ILS A;  1BM9 A;  3LQQ A;  2JTV A;  3FXQ A;  1YLF A;  1P6R A;  3IKT A;  3RPQ A;  2E7W A;  4M6X A;  3SXY A;  2J5O A;  3TO7 A;  3Q9S A;  1A04 A;  1V3F A;  1K78 A;  2QUF A;  5DYM A;  4Y15 A;  1YW7 A;  1XGM A;  2JT1 A;  5HS9 A;  2O03 A;  2DU9 A;  1P4W A;  4RAY A;  3L09 A;  3RJP A;  3FXU A;  5HOO A;  4BQA A;  5KVR A;  4EJW A;  3H3Z A;  5L3G A;  1EH7 A;  1JXS A;  2KIF A;  3V4G A;  3KET A;  4BHP A;  3F8M A;  4ENK A;  1QO0 D;  2PG4 A;  1HW5 A;  3QPT A;  1OR7 A;  3EDP A;  4IRG A;  4QLC U;  1K7A A;  2NNN A;  4LG0 B;  3SZT A;  5HLI A;  2V1D A;  3I5U A;  4OMZ A;  3TO9 A;  2GIV A;  2ZO4 A;  1MDM B;  1E17 A;  1X3U A;  1Z6R A;  3FMQ A;  1MZB A;  2XV4 S;  3TO6 A;  5CYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...