2ODGA

Complex of barrier-to-autointegration factor and lem-domain of emerin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Barrier-to-autointegration factor
publication title Solution NMR Structure of the Barrier-to-Autointegration Factor-Emerin Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, protein binding
total genus 28
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2odgA00
1QCKA 2EZYA 2EZZA 2ODGA 2EZXA 2BZFA 1CI4A
chains in the Genus database with same CATH superfamily
2HVIA 3GV5B 4R8UA 4EYHB 4JB3A 1S8OA 9ICQA 4RPZA 1PUZA 3MR2A 2KFZA 4BDPA 2RDIA 3C1ZA 5D46A 5J0YA 1TK8A 7ICNA 1D9FA 1JMSA 5IINA 4KMUA 3WK4A 1QQ6A 4C8KA 2DF4B 2RRDA 2W8LA 2BZFA 2JZBB 3KOOA 5J2IA 2HHQA 3OJUA 3NVVA 4O5CA 5AICA 4J9KA 4BUGA 9ICEA 2HBKA 3VC8A 2KVCA 3V6HA 5J2KA 4C8LA 4F91B 2ZUDA 3PVXA 4DSJA 4AP9A 2MSNA 4FBTA 4K4IA 1L7MA 2WTFA 1KFTA 5KFJA 3BZKA 3PZPA 5ALXA 2VANA 4F4WA 1F0MA 1RXWA 4O3PA 4NLKA 5AKEA 3SENA 4QWDA 4KLSA 4FZNA 2F1JA 9ICAA 4DL2A 4UBBA 4BGDA 3N7RC 4QZDA 2FI1A 4EENA 2JGAA 5KFAA 4IC9A 3QU5A 2QB0A 2OCEA 1V38A 2EAOA 2ES6A 2KV2A 5GTHU 1RYUA 2BKEA 2OWOA 3NUQA 2AXTU 3ONNA 3VCBA 1L7OA 2H5XA 5KT7A 5DLFA 5CJ7A 4IQTA 4DQSA 4NM2A 4IQUA 3OTQA 1B43A 1BVSA 4PHDA 3JPSA 5ALJA 1QSSA 4GFJA 1X6IA 4C8MA 1CI4A 2UVUA 1M6YA 2VA3A 5BOLA 1ZQCA 8ICCA 3Q8LA 3AQFA 4F5OA 1T3NA 7ICSA 4JWMA 2EAPA 1URJA 1NK5A 8ICVA 1TVAA 1MA7A 4J9MA 4UASA 3GU3A 1WCLA 3C2LA 2C22A 2R8HA 7ICEA 8ICMA 4ECRA 5AM4A 1JX4A 3CNHA 4G9BA 4F50A 5AIAA 7ICHA 4DCCA 1NK8A 4RQ3A 1X66A 5L1IA 5TISU 3FDSA 2MA1A 5AKKA 5KFKA 1VJ5A 3PW4A 1N5WA 4B9UA 4MFAA 4I2HA 3TACB 2ZTEA 4F93B 2DPJA 3GZFA 3HJEA 7ICMA 2JMGA 4M9HA 2F8KA 3I1YA 2DKZA 1X9XA 5AK4A 3QZ8A 1X9SA 4DO9A 2LBOA 1DGJA 1PZNA 1ED1A 2AQ0A 5KFRA 3GDXA 9ICKA 1WCNA 2ASJA 8ICIA 4ED0A 1UCVA 2KOBA 5AK3A 5HNKA 3PW5A 4G3IA 3K4GA 2XY5A 4PJ0U 2F77X 3PNCA 4O3OA 4RQ5A 5J2BA 1QTMA 3H4DA 4DF8A 1V9PA 2KKPA 5GTIU 3C5FA 9ICNA 4TQSA 1ZRMA 2BR0A 3V72A 2G06A 3MR6A 2IHNA 1NZBA 9ICWA 1MQ2A 1X9MA 4DS5A 3MFHA 1Z4OA 5JTIA 4NL9A 3N7SC 2PFPA 3OHBA 4DQIA 3UMBA 1ZQOA 4Y2VA 1SL2A 3DV9A 2GH1A 1JRPA 5ALPA 4WJ3B 9ICMA 3IP4B 4ECUA 2AGPA 2ESEA 1JI7A 3LYSA 4ED1A 2YMMA 4CF3A 5J2JA 1ZQIA 1S76D 2PXIA 3ZDAA 4J9SA 4I2FA 4ECYA 2FPLA 2KSOA 1FFVA 3RB0A 2KZ3A 5ALSA 5DGBA 3QNMA 1N61A 4P0PB 3A0HU 3HKZF 2HOQA 4GXIA 3Q8PB 4EX6A 4ED3A 1NKCA 4MFFA 1UA1A 4LZGA 2WHEA 3NVZA 2HI0A 2ISPA 1B4FA 3AN1A 4QZ8A 4PPXA 4UBCA 3T5KA 8ICBA 5KT6A 2JH1A 3HPOA 1L7PA 5KTQA 4MF2A 1BPYA 5CA7A 4DSEA 4R65A 1Z19A 3OJSA 2HDOA 4PL2A 2E3TA 1MC8A 5AM5A 2EQYA 4Q8FA 2HMXA 1ZD5A 4EYIB 4O3SA 5AKIA 2PFQA 1GO3F 3U26A 2W9MA 4EZ6A 3MDAA 1JROA 5IIIA 5KAFU 5KFZA 1ZQMA 4DQPA 5KFUA 1ZRNA 1ZD2P 4UW9A 2CRXA 2NYVA 3EYZA 1YZ7A 2BCQA 1LB2B 4NLNA 3IDWA 2K60A 1ZQDA 3N28A 4ECTA 1NZPA 1ZD3A 2G0AA 2A19A 2KHVA 3UXNA 4U7CA 4J9QA 3TADA 2AGQA 5IILA 3QUTA 4BXOB 3F2BA 4M9LA 5KG5A 4EX7A 4ECSA 2EANA 1JN3A 2BPFA 1S10A 4BWMA 1PK1B 2IMWP 3D6JA 4P0QA 2YMQA 4NL9C 3LVVA 1T94A 3SV4A 2E8MA 4C7ZA 4RQ0A 1L3SA 4IRKA 1CRXA 1ZQHA 2W03A 2F1IA 5KL8B 2BDPA 1BPXA 3SAHA 4TUQA 3G6YA 4ED7A 2H3VA 9ICPA 4PGYA 2EZZA 2G09A 5G5GA 3RJIA 3EPGA 5AI6A 3RR8A 4PGQA 1IM4A 3MGHA 4IR1A 3BQ7A 2K8CB 5IIKA 3LWMA 3QEBZ 1ZYQA 1U49A 5EE0A 3Q8SB 4ED8A 2NRTA 1KTQA 3M7DA 1ZQFA 2CPRA 1L6NA 5ALYA 1SKSA 1PVPA 3JPPA 5L1JA 1NNLA 5EE1A 2Y9TA 1NI3A 4TQRA 2WB1F 4AYBC 3KZXA 9ICHA 8ICKA 3WU2U 4FZLA 4DS4A 4B9VA 1SZHA 4GIBA 5B66U 4USAA 3PR4A 3V7KA 8ICTA 5KFQA 2D8CA 4HAIA 1S0VA 4YD2A 4IS7A 4RNNA 3T5HA 2XVTA 2YB1A 3PSTA 4XA5A 2ALZA 1Z1VA 3JPRA 9ICXA 4RUCA 3PO5A 1FIQA 3F2CA 1LKYB 2PMZF 4QWCA 4KLMA 1T3QA 2A3VA 4O5EA 3QUCA 4EEYA 4GLXA 2AJQA 4F5RA 5AKHA 4RZRA 4UB3A 5KFXA 3V6KA 4F2SA 1XWLA 4UB8U 4JUZA 2VA2A 1J97A 2GOLA 2C2RA 3NRWA 4RQNA 4B6JA 3L4PA 3MR5A 4QZAA 2OHFA 5DB7A 3PO4A 4DFPA 1FFUA 3B0YA 5KFOA 4RNMA 1KBUA 1T7PA 3RJEA 5A0LA 2ZXIA 4DL6A 2IHMA 3M9MB 2JHDA 3TADC 5L1LA 4ZH4A 3SAGA 1SGGA 2KKVA 4B9TA 3D2SA 1UT8A 1QQ7A 1RDFA 4UAVA 4F5PA 2JEGA 2UVWA 4I27A 2KMDA 3FM9A 2WF7A 3BJYA 1K1SA 2FPKA 5ALMA 2PI5A 1T4GA 3WKEA 3JPNA 1X6JA 4P2HA 4QZCA 3RRGA 1OW5A 2JZBA 4YR2A 4DFJA 1SXDA 3KFUF 3NTUA 4QZEA 4TUSA 2WF5A 4CF5A 1S9FA 4KMOB 9ICIA 4F71A 5ALGA 4IL6U 2JEIA 4YVZA 4PGXA 5DG7A 2HHVA 4GC6A 3LK9A 5JUMA 3H8WA 4C80A 5KFSA 2H3ZA 3IM1A 3HKZC 2LI6A 5KG1A 1BNOA 1WYGA 2IOFK 4FZMA 5ALKA 4FO6A 1OUQA 1RM6C 3PSFA 9ICCA 4ELUA 2W54A 2B6GA 2VIXA 1RYSA 3ZDCA 2CN1A 2ASDA 1O08A 1F5SA 3G6XA 2AU0A 2C2EA 1V97A 4DQRA 2XICA 3TANA 1ZQQA 2G08A 5J0XA 3PY8A 5KG7A 4OJ6A 4DFMA 3T3FA 2MAXA 3UQ0A 4B9SA 4K4GA 1U47A 4M2YA 3MC1A 2LYAA 3F5EA 5KG6A 4R63A 3C2KA 5HR7A 5AKLA 4EELA 2G5IB 2W7PA 4NLCA 4FE3A 4Y2SA 4UAWA 1U45A 3QE9Y 4GXJA 2F1HA 5T14A 2PFOA 5F9LA 4Z6EA 4F2RA 2K4HA 2F2AB 3CP8A 2BQRA 3WK8A 2BCRA 1N2XA 3QUQA 3WK9A 4I2BA 1A77A 3HRDD 3ORYA 4ZOHC 2OEHA 2RHFA 1X40A 3HT3A 3HP6A 1JXEA 4M04A 5DKWA 2R8KA 1ZQKA 2EH9A 4JMUA 4EBDA 4C0ZA 5KG2A 5AM1A 3SV3A 4QZFA 8ICQA 3PX4A 3ZDBA 4M0AA 3J81j 8ICEA 5EE9A 2KJ5A 3KKAA 1U48A 2DGZA 4M47A 9ICLA 4Z6DA 1S0OA 1RPLA 9ICTA 2KZZA 2Z7JA 5ALDA 2JR5A 2HHXA 3BDPA 4QZ9A 1L5UA 3RB3A 1NOMA 1C20A 3H8SA 4Z6CA 4O5KA 2PI4A 4M9JA 4YCXA 3LWLA 4ECVA 1QSYA 2KFNA 1J2NA 3WK5A 5DQGA 4P4MA 5KFGA 5IIMA 3OGUA 2HVHA 4J9NA 3KZIU 4NLGA 5HP4A 4QWEA 7ICLA 3H40A 2WB1C 9ICOA 3ETRA 5KFNA 4PHAA 1D9DA 2DQNB 2A1JB 2ISOA 4E0DA 5HR6A 4Q44A 2RLTA 4C4RA 2MUTB 1IV8A 1L3UA 2VKQA 4RQ8A 5KL1B 2HHUA 1ZQEA 5ALTA 1ZJMA 3NVWA 5ALIA 1YT3A 2HCFA 1ZOLA 2JRZA 4RQ2A 1KFDA 4KN4A 2BDUA 1XSPA 3PSIA 1SWWA 3RBEA 2H3IA 3KHLA 3WKBA 5DB6A 1BPZA 4ELTA 2GWSA 3I76A 5KNIA 2B21A 1ZQXA 4C7YA 3B0XA 1SV4A 3TARA 5AKGA 4KLIA 1N56A 5AI9A 2ZIWB 2R8IA 4M6WB 2BGWA 2KIWA 2NRWA 5HHIA 2QARB 4P0PA 1SV0A 1B0XA 2YMPA 1CEZA 4RPYA 1L3TA 5KFMA 1COOA 5DBBA 3PSPA 1VDVA 3KD3A 4DOCA 4X5VA 5KFDA 4OJOA 4DEZA 3LDAA 2JXJA 8ICWA 1UT5A 3BQ2A 8ICXA 1SIJA 3OPXA 5J2FA 5HHHA 3UMCA 1CUKA 3H0LB 4QNLA 2ZIVB 3RBDA 2ZJ5A 2FLPA 3SMVA 4O3RA 4CDGA 5AKJA 3KKAC 2ZJ8A 3ZD8A 5FP0A 2AH5A 3TQ1A 3KHHA 1TAQA 1DGSA 3CYMA 1ZQYA 5K4LA 1SL0A 4NY8A 4CCHA 1L7NA 4UB1A 4OO1J 3AM9A 5ALWA 1MSWD 4UB5A 1P7DA 3SAFA 1MQ3A 5KT5A 4QZIA 1Q8KA 5J29A 3T5JA 2KN7A 1ZQRA 1OXJA 2KJ9A 5C5JA 4F5NA 3I28A 2HBLA 2BCVA 4UARA 1DRGA 8ICFA 2NRXA 1N60A 1FEZA 1SL1A 5CHGA 1S77D 1TKDA 5J0PA 4GC7A 1PVQA 4B9LA 2XC9A 2ZIUB 3SR6A 4QJFB 2Y1JA 4F4ZA 4Y2TA 3QU9A 4ED6A 2JV3A 4OJ5A 5KG4A 2K4IA 4F8RA 4YQWA 1U4BA 4Q8EA 4F5QA 1BPDA 1NJZA 2FMQA 4Q43A 4F72A 2YX8A 3JPOA 2XY7A 3ICXA 1MN8A 4BXOA 1ZQLA 4QZHA 3UMGA 1KKXA 4B9NA 1TE2A 2OXOA 7ICGA 5AM2A 2H3FA 5BPCA 4EZ9A 1PK1A 8ICZA 1V85A 3MGVA 3IG8A 1UHUA 3SI8A 5AKZA 1ZJNA 1FO4A 3H0MB 4Z6FA 5L9XA 3OSPA 2MRLA 4DLEA 2WFAA 4NLZA 4MHVA 3C28A 1A76A 4F4YA 4PHPA 3BQ0A 3K1RB 3Q8KA 2BPGA 2HBJA 1KFSA 2Y9UA 4YFKA 3GIMA 2P66A 4PHEA 1XC9A 3ZDDA 1HUZA 1H38A 3FYHA 5KFCA 1SV0C 2YB4A 3MBYA 5J8YA 2I6XA 3RF9A 5J2DA 1ZQTA 1BPBA 2F76X 2OM6A 2M9NA 2W9BB 2BCUA 3EWAA 3M8RA 4RQMA 3EZ5A 9ICSA 4J9PA 2J6SA 3OHAA 1JXLA 4KLFA 5KFWA 5CB1A 3E0FA 2KSOB 3R9KA 1N62A 4UB2A 1SB3C 4K4HA 3BS5A 3UPQA 2VJ4A 5CEHA 2J6TA 2XGPA 3AEVA 9ICBA 4DOBA 2E1EA 3GILA 1S5LU 4KLGA 4YMMA 2C28A 1Q3VA 2KICA 1LKYA 1B22A 3N4MB 1K5OA 2IOHA 5AM0A 7ICKA 1S0NA 5G5HA 3H7IA 2QB1A 3MR3A 4J9LA 1IXRA 3HWTA 4DFDA 2ODGA 3E58A 2V4QA 3UM9A 4R66A 3DDHA 3NASA 2ZIXB 3QX7A 1COKA 4C4SA 2HHWA 2RDJA 2R8GA 3K1ZA 3RH6A 2B0CA 2HOIA 1WG8A 4M9NA 2JEJA 4ELVA 1XNSA 5DB8A 3TAPA 4CNQA 2CXYA 3G6VA 1Z3EB 2RQ5A 4CF4A 4I29A 1QSLA 4YMOA 4TURA 8ICJA 2ZJAA 2E8PA 8ICPA 2G5HB 3F5AA 5KFEA 4RQ7A 3M6KA 3QU4A 7ICRA 3THVA 2QKQA 8ICUA 1HIWA 3RRHA 3ALRA 4OCZA 4RNOA 5KFPA 2DL0A 1J2MA 4F92B 4YD1A 2XCAA 5J8YC 2R8JA 4DSLA 2W55A 4UAUA 2IOFA 2EAMA 4BJQA 4GXKA 3KTQA 2D3DA 5J0WA 2LHTA 5ALFA 2DKXA 3ISDA 4J9OA 5HMMA 3LVWA 4UATA 2NV3A 2FMPA 5AK6A 4LJXA 4QIWF 2LM1A 3AMZA 2F44A 1ZQWA 4KX3A 5L1MA 5F9NA 4QZGA 5ALNA 5CR0A 5KFTA 1SKRA 3IG5A 4M9GA 4ECWA 3UXPA 2LMRA 3IRUA 3HW8A 1N63A 2HBMA 2HW3A 4IRCA 5J0OA 3Q8QB 1SWVA 9ICFA 1VLBA 4C8NA 1BGXT 7ICIA 5EWFA 3BQ1A 4PZNA 7ICQA 3V6JA 2LM4A 4Y2PA 1ZQ1C 5KG3A 3WKCA 3WKAA 4Y2RA 4RPXA 1K1QA 2Y0SF 2RP5A 3A0BU 4OJPA 5ALQA 2W3RA 1D8YA 4B9MA 5DG9A 4NM1A 5J2AA 7ICOA 3TI0A 4DSKA 4YXMA 4US9A 5L1KA 8ICRA 1TAMA 2E1FA 4I2IA 2LKYA 4RT2A 4YR3A 4XQ8A 3L3FX 3TKAA 5ALEA 1NK6A 4CGZA 2E8OA 2FE9A 5DLGA 3RR7A 2DWQA 3RH5A 1Q3UA 4UAYA 1NJYA 4I2CA 1Z00B 3AQEA 3WK6A 3C2MA 4ED2A 2W43A 5AKYA 3TFRA 1JUDA 4KLDA 4PZOA 1HEKA 4ACOA 1LVHA 2AQ4A 2A1AA 2G07A 1UA0A 1ZQAA 4A8EA 2H3QA 4US8A 2FLNA 7ICFA 5ALUA 1S97A 5EWEA 1HUOA 4JV0A 3ZI4A 3QU2A 3GIJA 2KIVA 3EW9A 3K75D 4F3OA 4EBCA 1LV5A 4EEKA 1QLNA 3HILA 2W7OA 4RQ6A 2P35A 2W9CB 1XO0A 3PW0A 1QH9A 2I5HA 2R18A 3KHRA 4O3MA 4KN7A 5DGAA 3WK7A 5EWGA 1ECWA 2IA6A 5AKXA 2DFLA 3ZDEA 2W04A 2A1JA 4UQGA 5EE3A 1KSPA 4KTQA 5DDMA 2MUTA 4CRXA 5DBCA 4MF8A 1TK0A 3N7PD 3V7JA 2LYHA 3C29A 4ECZA 3F53A 1T8EA 4DL5A 3C21A 4R8UB 4QZBA 4Q45A 2M0NA 1KEJA 1AROP 9ICGA 5AI5A 3GIKA 2F3NA 1NK7A 5BOMA 2W11A 2L5YA 4FS1A 3PMLA 8ICYA 1Z4NA 2HOFA 1KN5A 3GIIA 8ICSA 5AIBA 2KP7A 2PFNA 4YG2A 2WF8A 1ZQBA 1UPHA 4I2AA 3PX6A 2ZIWA 7ICVA 4M6WA 1X2IA 2QARA 1L8OA 5KFVA 4EBEA 1ZQUA 2JEFA 2K4PA 2XGQA 2K4EA 4I2JA 3RAQA 1Q46A 4NWIA 2EZXA 1TFRA 3SYZA 2DPIA 4TUPA 3RJFA 5B5EU 4OJLA 5KT3A 2ZUCA 2WAQF 1DK2A 1SZPA 2IBKA 4RUAA 5AHXA 4NV0A 7ICUA 2ZIVA 4O9MA 3MFIA 5D49A 2W3SA 3CW2C 4AYBF 4Y2JA 3ZD9A 2PMZC 4HYKA 2QLTA 1TAUA 4O3NA 5CP2A 2W8KA 5ALVA 2KG5A 3O0FA 1KL9A 1NK0A 2HHSA 2NO5A 9ICUA 4UB6U 1L3VA 5ALRA 2QB0B 1XU4A 1X42A 5JU5A 4JWNA 5ALZA 3MDCA 4QIWC 3NRZA 3HX0A 5J0UA 5KAIU 2Y1IA 3SEIA 5J2HA 2NRZA 1JALA 4P4OA 2ZIUA 1XO1A 4P4PA 3RTVA 2NO4A 3QYPA 4KLOA 1KW4A 3RFAA 2YN4A 2KHQA 4KX5A 4JV1A 4KLUA 1NJWA 2LYBA 1SXEA 2BQUA 3RB6A 2ZUBA 4MEYA 3MGIA 3BS7A 3ISBA 5J0QA 1A6SA 5AI8A 2UVRA 2GLEA 3TFSA 3PW7A 5J0TA 5HMLA 1ZETA 2Q4TA 9ICJA 4DWIA 5AK5A 3PX0A 2Y0SC 2YMLA 7ICJA 1X9WA 1F44A 2V9WA 4RQ1A 4J03A 2YQEA 5AM3A 1PVRA 1BNPA 3PMNA 2HSZA 4ECXA 3JPTA 2VA8A 4QW9A 3ED5A 2KJ8A 3D2NA 5CRXA 2I9GA 5DBAA 5F3XB 3N97B 2FLLA 2P6UA 1NKBA 1S0MA 2ZXHA 2W9BA 2UVVA 1RZTA 5IIJA 4YN4A 1UQVA 3DEEA 5KFLA 5DB9A 2V4RA 4OD0A 5DG8A 3OSNA 4U6PA 8ICHA 4RT3A 5KT2A 2C2DA 7ICTA 2J6UA 2PKEA 2YY6A 1AQ6A 3H8JA 3IV6A 4KITB 3T79A 2F8LA 1NK9A 4DQQA 2FDRA 5KFHA 8ICGA 5J0SA 5KFYA 3RB4A 1WWVA 4IRDA 4O0IA 2AGOA 3C5GA 3AU6A 5AI0A 1Z1BA 3NVYA 1ZXIA 3BQTA 4PH5A 3QZ7A 1ZQPA 1A0PA 5TZVA 3T5LA 1TK5A 3SQIA 2AHOB 3TAQA 3SD7A 3H8MA 4DL4A 1RQNA 4DL3A 1ZQNA 3E2EA 2ZIXA 5KFBA 1KQQA 2D6FC 1ZQVA 4NLBA 4UAZA 2W9AA 3GV8B 4ECQA 4KLLA 2KK0A 1NK4A 2YTUA 3KBBA 4I2DA 1NKEA 4Y2YA 2EDUA 4DFKA 1PK3A 1WUDA 3Q8RB 3CRXA 4CE6A 1QQ5A 5DDYA 3M6ZA 4DSIA 1O03A 4F4XA 2ZTCA 3RJKA 5DQIA 3NS1A 3FAHA 3Q8MA 4IR9A 1RYRA 3WKDA 3B9JA 1ZD4A 1DXSA 3QU7A 4NJ8A 1QCKA 5H2FU 2MU2A 4KLJA 1IIPA 4BWJA 3RH4A 1RG6A 5CWRA 4I2GA 2E8NA 8ICOA 1TV9A 4XUSA 1ZQSA 1N5XA 4KLHA 5KG0A 1BPEA 5C0YA 3H4BA 3NGDA 2ATLA 3RJJA 4JK1A 9ICRA 4I28A 1KLNA 2KNJA 3L5KA 3JPQA 5J2GA 2JH7A 2ZTDA 2XCPA 3RJHA 4LVSA 4Y2QA 3BZCA 2K8AA 1ZQZA 3ETLA 2DBYA 4DSFA 1D8LA 3QEAZ 5ALHA 2N1RA 2BCSA 1EXNA 4YP3A 1DK3A 4Y2XA 3ISCA 4J9RA 1XSNA 4LZDA 2WAQC 4DL7A 4QWBA 3QXGA 3UQ2A 3AL0B 2KVSA 2XI9A 3F2DA 2LPEA 1KRPA 3GFKB 5E79U 1KDHA 1SKWA 3UXOA 2KE7A 3V7LA 4RQ4A 2ZG6A 2P6RA 2XY6A 3SZ2A 1N48A 2BPCA 3BS5B 2XO7A 4DOAA 2WF6A 5J2CA 3PR5B 7ICPA 2FPMA 2GO7A 3MABA 1ZQGA 2KZMA 3PV8A 4ICAA 4P0QB 2Q0ZX 4YXJA 4R64A 4MEXA 1ZQJA 4FS2A 9ICVA 2FJ6A 3AU2A 3D2QA 3C1YA 3QUBA 4KLTA 5JRTA 4IQWA 4F4KA 4JV2A 2ASLA 3RJGA 2XIDA 5IIOA 1DOQA 2DUYA 4C8OA 8ICNA 1NJXA 5KFIA 2HHTA 5AI4A 2BHNA 3RAXA 2NRVA 5KT4A 4QW8A 4YMNA 3C23A 2OYYA 1Y88A 2K8BB 4I2EA 5KFFA 4FFDA 3AUOA 1RXVA 2OH2A 2KD1A 4XRHA 1Z00A 5D4BA 1L8LA 2O6KA 3M9NB 3IHQB 4KLQA 3M8SA 2KTQA 4DLGA 4NXZA 1XSLA 4FBUA 5ALLA 4YR0A 2BQ3A 3M1YA 4BX9C 1HJPA 2WF9A 4IQVA 5J0RA 5J2EA 2VJ5A 5ALOA 8ICLA 3GQCA 1U9LA 8ICAA 4KLEA 4PL1A 4RU9A 5DQHA 4MFCA 4DF4A 4UB4A 1IG6A 4QWAA 1JIHA 1C7YA 2KEYA 2W9CA 1D8BA 4Y2UA 3M9OB 3H0RB 3KHGA 3PW2A 3FC4A 3GV7B 1YZ6A 3S6JA 1WWUA 3IN5A 4O3QA 3EUB2 4C4TA 2EZYA 5EOZA 1XS9D 2K89A 2I1QA 3EPIA 1RQLA 2FMSA 2E5SA
chains in the Genus database with same CATH topology
1QCKA 2EZYA 2EZZA 2ODGA 2EZXA 2BZFA 1CI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCK A;  2EZY A;  2EZZ A;  2ODG A;  2EZX A;  2BZF A;  1CI4 A; 
#chains in the Genus database with same CATH topology
 2HVI A;  3GV5 B;  4R8U A;  4EYH B;  4JB3 A;  1S8O A;  9ICQ A;  4RPZ A;  1PUZ A;  3MR2 A;  2KFZ A;  4BDP A;  2RDI A;  3C1Z A;  5D46 A;  5J0Y A;  1TK8 A;  7ICN A;  1D9F A;  1JMS A;  5IIN A;  4KMU A;  3WK4 A;  1QQ6 A;  4C8K A;  2DF4 B;  2RRD A;  2W8L A;  2BZF A;  2JZB B;  3KOO A;  5J2I A;  2HHQ A;  3OJU A;  3NVV A;  4O5C A;  5AIC A;  4J9K A;  4BUG A;  9ICE A;  2HBK A;  3VC8 A;  2KVC A;  3V6H A;  5J2K A;  4C8L A;  4F91 B;  2ZUD A;  3PVX A;  4DSJ A;  4AP9 A;  2MSN A;  4FBT A;  4K4I A;  1L7M A;  2WTF A;  1KFT A;  5KFJ A;  3BZK A;  3PZP A;  5ALX A;  2VAN A;  4F4W A;  1F0M A;  1RXW A;  4O3P A;  4NLK A;  5AKE A;  3SEN A;  4QWD A;  4KLS A;  4FZN A;  2F1J A;  9ICA A;  4DL2 A;  4UBB A;  4BGD A;  3N7R C;  4QZD A;  2FI1 A;  4EEN A;  2JGA A;  5KFA A;  4IC9 A;  3QU5 A;  2QB0 A;  2OCE A;  1V38 A;  2EAO A;  2ES6 A;  2KV2 A;  5GTH U;  1RYU A;  2BKE A;  2OWO A;  3NUQ A;  2AXT U;  3ONN A;  3VCB A;  1L7O A;  2H5X A;  5KT7 A;  5DLF A;  5CJ7 A;  4IQT A;  4DQS A;  4NM2 A;  4IQU A;  3OTQ A;  1B43 A;  1BVS A;  4PHD A;  3JPS A;  5ALJ A;  1QSS A;  4GFJ A;  1X6I A;  4C8M A;  1CI4 A;  2UVU A;  1M6Y A;  2VA3 A;  5BOL A;  1ZQC A;  8ICC A;  3Q8L A;  3AQF A;  4F5O A;  1T3N A;  7ICS A;  4JWM A;  2EAP A;  1URJ A;  1NK5 A;  8ICV A;  1TVA A;  1MA7 A;  4J9M A;  4UAS A;  3GU3 A;  1WCL A;  3C2L A;  2C22 A;  2R8H A;  7ICE A;  8ICM A;  4ECR A;  5AM4 A;  1JX4 A;  3CNH A;  4G9B A;  4F50 A;  5AIA A;  7ICH A;  4DCC A;  1NK8 A;  4RQ3 A;  1X66 A;  5L1I A;  5TIS U;  3FDS A;  2MA1 A;  5AKK A;  5KFK A;  1VJ5 A;  3PW4 A;  1N5W A;  4B9U A;  4MFA A;  4I2H A;  3TAC B;  2ZTE A;  4F93 B;  2DPJ A;  3GZF A;  3HJE A;  7ICM A;  2JMG A;  4M9H A;  2F8K A;  3I1Y A;  2DKZ A;  1X9X A;  5AK4 A;  3QZ8 A;  1X9S A;  4DO9 A;  2LBO A;  1DGJ A;  1PZN A;  1ED1 A;  2AQ0 A;  5KFR A;  3GDX A;  9ICK A;  1WCN A;  2ASJ A;  8ICI A;  4ED0 A;  1UCV A;  2KOB A;  5AK3 A;  5HNK A;  3PW5 A;  4G3I A;  3K4G A;  2XY5 A;  4PJ0 U;  2F77 X;  3PNC A;  4O3O A;  4RQ5 A;  5J2B A;  1QTM A;  3H4D A;  4DF8 A;  1V9P A;  2KKP A;  5GTI U;  3C5F A;  9ICN A;  4TQS A;  1ZRM A;  2BR0 A;  3V72 A;  2G06 A;  3MR6 A;  2IHN A;  1NZB A;  9ICW A;  1MQ2 A;  1X9M A;  4DS5 A;  3MFH A;  1Z4O A;  5JTI A;  4NL9 A;  3N7S C;  2PFP A;  3OHB A;  4DQI A;  3UMB A;  1ZQO A;  4Y2V A;  1SL2 A;  3DV9 A;  2GH1 A;  1JRP A;  5ALP A;  4WJ3 B;  9ICM A;  3IP4 B;  4ECU A;  2AGP A;  2ESE A;  1JI7 A;  3LYS A;  4ED1 A;  2YMM A;  4CF3 A;  5J2J A;  1ZQI A;  1S76 D;  2PXI A;  3ZDA A;  4J9S A;  4I2F A;  4ECY A;  2FPL A;  2KSO A;  1FFV A;  3RB0 A;  2KZ3 A;  5ALS A;  5DGB A;  3QNM A;  1N61 A;  4P0P B;  3A0H U;  3HKZ F;  2HOQ A;  4GXI A;  3Q8P B;  4EX6 A;  4ED3 A;  1NKC A;  4MFF A;  1UA1 A;  4LZG A;  2WHE A;  3NVZ A;  2HI0 A;  2ISP A;  1B4F A;  3AN1 A;  4QZ8 A;  4PPX A;  4UBC A;  3T5K A;  8ICB A;  5KT6 A;  2JH1 A;  3HPO A;  1L7P A;  5KTQ A;  4MF2 A;  1BPY A;  5CA7 A;  4DSE A;  4R65 A;  1Z19 A;  3OJS A;  2HDO A;  4PL2 A;  2E3T A;  1MC8 A;  5AM5 A;  2EQY A;  4Q8F A;  2HMX A;  1ZD5 A;  4EYI B;  4O3S A;  5AKI A;  2PFQ A;  1GO3 F;  3U26 A;  2W9M A;  4EZ6 A;  3MDA A;  1JRO A;  5III A;  5KAF U;  5KFZ A;  1ZQM A;  4DQP A;  5KFU A;  1ZRN A;  1ZD2 P;  4UW9 A;  2CRX A;  2NYV A;  3EYZ A;  1YZ7 A;  2BCQ A;  1LB2 B;  4NLN A;  3IDW A;  2K60 A;  1ZQD A;  3N28 A;  4ECT A;  1NZP A;  1ZD3 A;  2G0A A;  2A19 A;  2KHV A;  3UXN A;  4U7C A;  4J9Q A;  3TAD A;  2AGQ A;  5IIL A;  3QUT A;  4BXO B;  3F2B A;  4M9L A;  5KG5 A;  4EX7 A;  4ECS A;  2EAN A;  1JN3 A;  2BPF A;  1S10 A;  4BWM A;  1PK1 B;  2IMW P;  3D6J A;  4P0Q A;  2YMQ A;  4NL9 C;  3LVV A;  1T94 A;  3SV4 A;  2E8M A;  4C7Z A;  4RQ0 A;  1L3S A;  4IRK A;  1CRX A;  1ZQH A;  2W03 A;  2F1I A;  5KL8 B;  2BDP A;  1BPX A;  3SAH A;  4TUQ A;  3G6Y A;  4ED7 A;  2H3V A;  9ICP A;  4PGY A;  2EZZ A;  2G09 A;  5G5G A;  3RJI A;  3EPG A;  5AI6 A;  3RR8 A;  4PGQ A;  1IM4 A;  3MGH A;  4IR1 A;  3BQ7 A;  2K8C B;  5IIK A;  3LWM A;  3QEB Z;  1ZYQ A;  1U49 A;  5EE0 A;  3Q8S B;  4ED8 A;  2NRT A;  1KTQ A;  3M7D A;  1ZQF A;  2CPR A;  1L6N A;  5ALY A;  1SKS A;  1PVP A;  3JPP A;  5L1J A;  1NNL A;  5EE1 A;  2Y9T A;  1NI3 A;  4TQR A;  2WB1 F;  4AYB C;  3KZX A;  9ICH A;  8ICK A;  3WU2 U;  4FZL A;  4DS4 A;  4B9V A;  1SZH A;  4GIB A;  5B66 U;  4USA A;  3PR4 A;  3V7K A;  8ICT A;  5KFQ A;  2D8C A;  4HAI A;  1S0V A;  4YD2 A;  4IS7 A;  4RNN A;  3T5H A;  2XVT A;  2YB1 A;  3PST A;  4XA5 A;  2ALZ A;  1Z1V A;  3JPR A;  9ICX A;  4RUC A;  3PO5 A;  1FIQ A;  3F2C A;  1LKY B;  2PMZ F;  4QWC A;  4KLM A;  1T3Q A;  2A3V A;  4O5E A;  3QUC A;  4EEY A;  4GLX A;  2AJQ A;  4F5R A;  5AKH A;  4RZR A;  4UB3 A;  5KFX A;  3V6K A;  4F2S A;  1XWL A;  4UB8 U;  4JUZ A;  2VA2 A;  1J97 A;  2GOL A;  2C2R A;  3NRW A;  4RQN A;  4B6J A;  3L4P A;  3MR5 A;  4QZA A;  2OHF A;  5DB7 A;  3PO4 A;  4DFP A;  1FFU A;  3B0Y A;  5KFO A;  4RNM A;  1KBU A;  1T7P A;  3RJE A;  5A0L A;  2ZXI A;  4DL6 A;  2IHM A;  3M9M B;  2JHD A;  3TAD C;  5L1L A;  4ZH4 A;  3SAG A;  1SGG A;  2KKV A;  4B9T A;  3D2S A;  1UT8 A;  1QQ7 A;  1RDF A;  4UAV A;  4F5P A;  2JEG A;  2UVW A;  4I27 A;  2KMD A;  3FM9 A;  2WF7 A;  3BJY A;  1K1S A;  2FPK A;  5ALM A;  2PI5 A;  1T4G A;  3WKE A;  3JPN A;  1X6J A;  4P2H A;  4QZC A;  3RRG A;  1OW5 A;  2JZB A;  4YR2 A;  4DFJ A;  1SXD A;  3KFU F;  3NTU A;  4QZE A;  4TUS A;  2WF5 A;  4CF5 A;  1S9F A;  4KMO B;  9ICI A;  4F71 A;  5ALG A;  4IL6 U;  2JEI A;  4YVZ A;  4PGX A;  5DG7 A;  2HHV A;  4GC6 A;  3LK9 A;  5JUM A;  3H8W A;  4C80 A;  5KFS A;  2H3Z A;  3IM1 A;  3HKZ C;  2LI6 A;  5KG1 A;  1BNO A;  1WYG A;  2IOF K;  4FZM A;  5ALK A;  4FO6 A;  1OUQ A;  1RM6 C;  3PSF A;  9ICC A;  4ELU A;  2W54 A;  2B6G A;  2VIX A;  1RYS A;  3ZDC A;  2CN1 A;  2ASD A;  1O08 A;  1F5S A;  3G6X A;  2AU0 A;  2C2E A;  1V97 A;  4DQR A;  2XIC A;  3TAN A;  1ZQQ A;  2G08 A;  5J0X A;  3PY8 A;  5KG7 A;  4OJ6 A;  4DFM A;  3T3F A;  2MAX A;  3UQ0 A;  4B9S A;  4K4G A;  1U47 A;  4M2Y A;  3MC1 A;  2LYA A;  3F5E A;  5KG6 A;  4R63 A;  3C2K A;  5HR7 A;  5AKL A;  4EEL A;  2G5I B;  2W7P A;  4NLC A;  4FE3 A;  4Y2S A;  4UAW A;  1U45 A;  3QE9 Y;  4GXJ A;  2F1H A;  5T14 A;  2PFO A;  5F9L A;  4Z6E A;  4F2R A;  2K4H A;  2F2A B;  3CP8 A;  2BQR A;  3WK8 A;  2BCR A;  1N2X A;  3QUQ A;  3WK9 A;  4I2B A;  1A77 A;  3HRD D;  3ORY A;  4ZOH C;  2OEH A;  2RHF A;  1X40 A;  3HT3 A;  3HP6 A;  1JXE A;  4M04 A;  5DKW A;  2R8K A;  1ZQK A;  2EH9 A;  4JMU A;  4EBD A;  4C0Z A;  5KG2 A;  5AM1 A;  3SV3 A;  4QZF A;  8ICQ A;  3PX4 A;  3ZDB A;  4M0A A;  3J81 j;  8ICE A;  5EE9 A;  2KJ5 A;  3KKA A;  1U48 A;  2DGZ A;  4M47 A;  9ICL A;  4Z6D A;  1S0O A;  1RPL A;  9ICT A;  2KZZ A;  2Z7J A;  5ALD A;  2JR5 A;  2HHX A;  3BDP A;  4QZ9 A;  1L5U A;  3RB3 A;  1NOM A;  1C20 A;  3H8S A;  4Z6C A;  4O5K A;  2PI4 A;  4M9J A;  4YCX A;  3LWL A;  4ECV A;  1QSY A;  2KFN A;  1J2N A;  3WK5 A;  5DQG A;  4P4M A;  5KFG A;  5IIM A;  3OGU A;  2HVH A;  4J9N A;  3KZI U;  4NLG A;  5HP4 A;  4QWE A;  7ICL A;  3H40 A;  2WB1 C;  9ICO A;  3ETR A;  5KFN A;  4PHA A;  1D9D A;  2DQN B;  2A1J B;  2ISO A;  4E0D A;  5HR6 A;  4Q44 A;  2RLT A;  4C4R A;  2MUT B;  1IV8 A;  1L3U A;  2VKQ A;  4RQ8 A;  5KL1 B;  2HHU A;  1ZQE A;  5ALT A;  1ZJM A;  3NVW A;  5ALI A;  1YT3 A;  2HCF A;  1ZOL A;  2JRZ A;  4RQ2 A;  1KFD A;  4KN4 A;  2BDU A;  1XSP A;  3PSI A;  1SWW A;  3RBE A;  2H3I A;  3KHL A;  3WKB A;  5DB6 A;  1BPZ A;  4ELT A;  2GWS A;  3I76 A;  5KNI A;  2B21 A;  1ZQX A;  4C7Y A;  3B0X A;  1SV4 A;  3TAR A;  5AKG A;  4KLI A;  1N56 A;  5AI9 A;  2ZIW B;  2R8I A;  4M6W B;  2BGW A;  2KIW A;  2NRW A;  5HHI A;  2QAR B;  4P0P A;  1SV0 A;  1B0X A;  2YMP A;  1CEZ A;  4RPY A;  1L3T A;  5KFM A;  1COO A;  5DBB A;  3PSP A;  1VDV A;  3KD3 A;  4DOC A;  4X5V A;  5KFD A;  4OJO A;  4DEZ A;  3LDA A;  2JXJ A;  8ICW A;  1UT5 A;  3BQ2 A;  8ICX A;  1SIJ A;  3OPX A;  5J2F A;  5HHH A;  3UMC A;  1CUK A;  3H0L B;  4QNL A;  2ZIV B;  3RBD A;  2ZJ5 A;  2FLP A;  3SMV A;  4O3R A;  4CDG A;  5AKJ A;  3KKA C;  2ZJ8 A;  3ZD8 A;  5FP0 A;  2AH5 A;  3TQ1 A;  3KHH A;  1TAQ A;  1DGS A;  3CYM A;  1ZQY A;  5K4L A;  1SL0 A;  4NY8 A;  4CCH A;  1L7N A;  4UB1 A;  4OO1 J;  3AM9 A;  5ALW A;  1MSW D;  4UB5 A;  1P7D A;  3SAF A;  1MQ3 A;  5KT5 A;  4QZI A;  1Q8K A;  5J29 A;  3T5J A;  2KN7 A;  1ZQR A;  1OXJ A;  2KJ9 A;  5C5J A;  4F5N A;  3I28 A;  2HBL A;  2BCV A;  4UAR A;  1DRG A;  8ICF A;  2NRX A;  1N60 A;  1FEZ A;  1SL1 A;  5CHG A;  1S77 D;  1TKD A;  5J0P A;  4GC7 A;  1PVQ A;  4B9L A;  2XC9 A;  2ZIU B;  3SR6 A;  4QJF B;  2Y1J A;  4F4Z A;  4Y2T A;  3QU9 A;  4ED6 A;  2JV3 A;  4OJ5 A;  5KG4 A;  2K4I A;  4F8R A;  4YQW A;  1U4B A;  4Q8E A;  4F5Q A;  1BPD A;  1NJZ A;  2FMQ A;  4Q43 A;  4F72 A;  2YX8 A;  3JPO A;  2XY7 A;  3ICX A;  1MN8 A;  4BXO A;  1ZQL A;  4QZH A;  3UMG A;  1KKX A;  4B9N A;  1TE2 A;  2OXO A;  7ICG A;  5AM2 A;  2H3F A;  5BPC A;  4EZ9 A;  1PK1 A;  8ICZ A;  1V85 A;  3MGV A;  3IG8 A;  1UHU A;  3SI8 A;  5AKZ A;  1ZJN A;  1FO4 A;  3H0M B;  4Z6F A;  5L9X A;  3OSP A;  2MRL A;  4DLE A;  2WFA A;  4NLZ A;  4MHV A;  3C28 A;  1A76 A;  4F4Y A;  4PHP A;  3BQ0 A;  3K1R B;  3Q8K A;  2BPG A;  2HBJ A;  1KFS A;  2Y9U A;  4YFK A;  3GIM A;  2P66 A;  4PHE A;  1XC9 A;  3ZDD A;  1HUZ A;  1H38 A;  3FYH A;  5KFC A;  1SV0 C;  2YB4 A;  3MBY A;  5J8Y A;  2I6X A;  3RF9 A;  5J2D A;  1ZQT A;  1BPB A;  2F76 X;  2OM6 A;  2M9N A;  2W9B B;  2BCU A;  3EWA A;  3M8R A;  4RQM A;  3EZ5 A;  9ICS A;  4J9P A;  2J6S A;  3OHA A;  1JXL A;  4KLF A;  5KFW A;  5CB1 A;  3E0F A;  2KSO B;  3R9K A;  1N62 A;  4UB2 A;  1SB3 C;  4K4H A;  3BS5 A;  3UPQ A;  2VJ4 A;  5CEH A;  2J6T A;  2XGP A;  3AEV A;  9ICB A;  4DOB A;  2E1E A;  3GIL A;  1S5L U;  4KLG A;  4YMM A;  2C28 A;  1Q3V A;  2KIC A;  1LKY A;  1B22 A;  3N4M B;  1K5O A;  2IOH A;  5AM0 A;  7ICK A;  1S0N A;  5G5H A;  3H7I A;  2QB1 A;  3MR3 A;  4J9L A;  1IXR A;  3HWT A;  4DFD A;  2ODG A;  3E58 A;  2V4Q A;  3UM9 A;  4R66 A;  3DDH A;  3NAS A;  2ZIX B;  3QX7 A;  1COK A;  4C4S A;  2HHW A;  2RDJ A;  2R8G A;  3K1Z A;  3RH6 A;  2B0C A;  2HOI A;  1WG8 A;  4M9N A;  2JEJ A;  4ELV A;  1XNS A;  5DB8 A;  3TAP A;  4CNQ A;  2CXY A;  3G6V A;  1Z3E B;  2RQ5 A;  4CF4 A;  4I29 A;  1QSL A;  4YMO A;  4TUR A;  8ICJ A;  2ZJA A;  2E8P A;  8ICP A;  2G5H B;  3F5A A;  5KFE A;  4RQ7 A;  3M6K A;  3QU4 A;  7ICR A;  3THV A;  2QKQ A;  8ICU A;  1HIW A;  3RRH A;  3ALR A;  4OCZ A;  4RNO A;  5KFP A;  2DL0 A;  1J2M A;  4F92 B;  4YD1 A;  2XCA A;  5J8Y C;  2R8J A;  4DSL A;  2W55 A;  4UAU A;  2IOF A;  2EAM A;  4BJQ A;  4GXK A;  3KTQ A;  2D3D A;  5J0W A;  2LHT A;  5ALF A;  2DKX A;  3ISD A;  4J9O A;  5HMM A;  3LVW A;  4UAT A;  2NV3 A;  2FMP A;  5AK6 A;  4LJX A;  4QIW F;  2LM1 A;  3AMZ A;  2F44 A;  1ZQW A;  4KX3 A;  5L1M A;  5F9N A;  4QZG A;  5ALN A;  5CR0 A;  5KFT A;  1SKR A;  3IG5 A;  4M9G A;  4ECW A;  3UXP A;  2LMR A;  3IRU A;  3HW8 A;  1N63 A;  2HBM A;  2HW3 A;  4IRC A;  5J0O A;  3Q8Q B;  1SWV A;  9ICF A;  1VLB A;  4C8N A;  1BGX T;  7ICI A;  5EWF A;  3BQ1 A;  4PZN A;  7ICQ A;  3V6J A;  2LM4 A;  4Y2P A;  1ZQ1 C;  5KG3 A;  3WKC A;  3WKA A;  4Y2R A;  4RPX A;  1K1Q A;  2Y0S F;  2RP5 A;  3A0B U;  4OJP A;  5ALQ A;  2W3R A;  1D8Y A;  4B9M A;  5DG9 A;  4NM1 A;  5J2A A;  7ICO A;  3TI0 A;  4DSK A;  4YXM A;  4US9 A;  5L1K A;  8ICR A;  1TAM A;  2E1F A;  4I2I A;  2LKY A;  4RT2 A;  4YR3 A;  4XQ8 A;  3L3F X;  3TKA A;  5ALE A;  1NK6 A;  4CGZ A;  2E8O A;  2FE9 A;  5DLG A;  3RR7 A;  2DWQ A;  3RH5 A;  1Q3U A;  4UAY A;  1NJY A;  4I2C A;  1Z00 B;  3AQE A;  3WK6 A;  3C2M A;  4ED2 A;  2W43 A;  5AKY A;  3TFR A;  1JUD A;  4KLD A;  4PZO A;  1HEK A;  4ACO A;  1LVH A;  2AQ4 A;  2A1A A;  2G07 A;  1UA0 A;  1ZQA A;  4A8E A;  2H3Q A;  4US8 A;  2FLN A;  7ICF A;  5ALU A;  1S97 A;  5EWE A;  1HUO A;  4JV0 A;  3ZI4 A;  3QU2 A;  3GIJ A;  2KIV A;  3EW9 A;  3K75 D;  4F3O A;  4EBC A;  1LV5 A;  4EEK A;  1QLN A;  3HIL A;  2W7O A;  4RQ6 A;  2P35 A;  2W9C B;  1XO0 A;  3PW0 A;  1QH9 A;  2I5H A;  2R18 A;  3KHR A;  4O3M A;  4KN7 A;  5DGA A;  3WK7 A;  5EWG A;  1ECW A;  2IA6 A;  5AKX A;  2DFL A;  3ZDE A;  2W04 A;  2A1J A;  4UQG A;  5EE3 A;  1KSP A;  4KTQ A;  5DDM A;  2MUT A;  4CRX A;  5DBC A;  4MF8 A;  1TK0 A;  3N7P D;  3V7J A;  2LYH A;  3C29 A;  4ECZ A;  3F53 A;  1T8E A;  4DL5 A;  3C21 A;  4R8U B;  4QZB A;  4Q45 A;  2M0N A;  1KEJ A;  1ARO P;  9ICG A;  5AI5 A;  3GIK A;  2F3N A;  1NK7 A;  5BOM A;  2W11 A;  2L5Y A;  4FS1 A;  3PML A;  8ICY A;  1Z4N A;  2HOF A;  1KN5 A;  3GII A;  8ICS A;  5AIB A;  2KP7 A;  2PFN A;  4YG2 A;  2WF8 A;  1ZQB A;  1UPH A;  4I2A A;  3PX6 A;  2ZIW A;  7ICV A;  4M6W A;  1X2I A;  2QAR A;  1L8O A;  5KFV A;  4EBE A;  1ZQU A;  2JEF A;  2K4P A;  2XGQ A;  2K4E A;  4I2J A;  3RAQ A;  1Q46 A;  4NWI A;  2EZX A;  1TFR A;  3SYZ A;  2DPI A;  4TUP A;  3RJF A;  5B5E U;  4OJL A;  5KT3 A;  2ZUC A;  2WAQ F;  1DK2 A;  1SZP A;  2IBK A;  4RUA A;  5AHX A;  4NV0 A;  7ICU A;  2ZIV A;  4O9M A;  3MFI A;  5D49 A;  2W3S A;  3CW2 C;  4AYB F;  4Y2J A;  3ZD9 A;  2PMZ C;  4HYK A;  2QLT A;  1TAU A;  4O3N A;  5CP2 A;  2W8K A;  5ALV A;  2KG5 A;  3O0F A;  1KL9 A;  1NK0 A;  2HHS A;  2NO5 A;  9ICU A;  4UB6 U;  1L3V A;  5ALR A;  2QB0 B;  1XU4 A;  1X42 A;  5JU5 A;  4JWN A;  5ALZ A;  3MDC A;  4QIW C;  3NRZ A;  3HX0 A;  5J0U A;  5KAI U;  2Y1I A;  3SEI A;  5J2H A;  2NRZ A;  1JAL A;  4P4O A;  2ZIU A;  1XO1 A;  4P4P A;  3RTV A;  2NO4 A;  3QYP A;  4KLO A;  1KW4 A;  3RFA A;  2YN4 A;  2KHQ A;  4KX5 A;  4JV1 A;  4KLU A;  1NJW A;  2LYB A;  1SXE A;  2BQU A;  3RB6 A;  2ZUB A;  4MEY A;  3MGI A;  3BS7 A;  3ISB A;  5J0Q A;  1A6S A;  5AI8 A;  2UVR A;  2GLE A;  3TFS A;  3PW7 A;  5J0T A;  5HML A;  1ZET A;  2Q4T A;  9ICJ A;  4DWI A;  5AK5 A;  3PX0 A;  2Y0S C;  2YML A;  7ICJ A;  1X9W A;  1F44 A;  2V9W A;  4RQ1 A;  4J03 A;  2YQE A;  5AM3 A;  1PVR A;  1BNP A;  3PMN A;  2HSZ A;  4ECX A;  3JPT A;  2VA8 A;  4QW9 A;  3ED5 A;  2KJ8 A;  3D2N A;  5CRX A;  2I9G A;  5DBA A;  5F3X B;  3N97 B;  2FLL A;  2P6U A;  1NKB A;  1S0M A;  2ZXH A;  2W9B A;  2UVV A;  1RZT A;  5IIJ A;  4YN4 A;  1UQV A;  3DEE A;  5KFL A;  5DB9 A;  2V4R A;  4OD0 A;  5DG8 A;  3OSN A;  4U6P A;  8ICH A;  4RT3 A;  5KT2 A;  2C2D A;  7ICT A;  2J6U A;  2PKE A;  2YY6 A;  1AQ6 A;  3H8J A;  3IV6 A;  4KIT B;  3T79 A;  2F8L A;  1NK9 A;  4DQQ A;  2FDR A;  5KFH A;  8ICG A;  5J0S A;  5KFY A;  3RB4 A;  1WWV A;  4IRD A;  4O0I A;  2AGO A;  3C5G A;  3AU6 A;  5AI0 A;  1Z1B A;  3NVY A;  1ZXI A;  3BQT A;  4PH5 A;  3QZ7 A;  1ZQP A;  1A0P A;  5TZV A;  3T5L A;  1TK5 A;  3SQI A;  2AHO B;  3TAQ A;  3SD7 A;  3H8M A;  4DL4 A;  1RQN A;  4DL3 A;  1ZQN A;  3E2E A;  2ZIX A;  5KFB A;  1KQQ A;  2D6F C;  1ZQV A;  4NLB A;  4UAZ A;  2W9A A;  3GV8 B;  4ECQ A;  4KLL A;  2KK0 A;  1NK4 A;  2YTU A;  3KBB A;  4I2D A;  1NKE A;  4Y2Y A;  2EDU A;  4DFK A;  1PK3 A;  1WUD A;  3Q8R B;  3CRX A;  4CE6 A;  1QQ5 A;  5DDY A;  3M6Z A;  4DSI A;  1O03 A;  4F4X A;  2ZTC A;  3RJK A;  5DQI A;  3NS1 A;  3FAH A;  3Q8M A;  4IR9 A;  1RYR A;  3WKD A;  3B9J A;  1ZD4 A;  1DXS A;  3QU7 A;  4NJ8 A;  1QCK A;  5H2F U;  2MU2 A;  4KLJ A;  1IIP A;  4BWJ A;  3RH4 A;  1RG6 A;  5CWR A;  4I2G A;  2E8N A;  8ICO A;  1TV9 A;  4XUS A;  1ZQS A;  1N5X A;  4KLH A;  5KG0 A;  1BPE A;  5C0Y A;  3H4B A;  3NGD A;  2ATL A;  3RJJ A;  4JK1 A;  9ICR A;  4I28 A;  1KLN A;  2KNJ A;  3L5K A;  3JPQ A;  5J2G A;  2JH7 A;  2ZTD A;  2XCP A;  3RJH A;  4LVS A;  4Y2Q A;  3BZC A;  2K8A A;  1ZQZ A;  3ETL A;  2DBY A;  4DSF A;  1D8L A;  3QEA Z;  5ALH A;  2N1R A;  2BCS A;  1EXN A;  4YP3 A;  1DK3 A;  4Y2X A;  3ISC A;  4J9R A;  1XSN A;  4LZD A;  2WAQ C;  4DL7 A;  4QWB A;  3QXG A;  3UQ2 A;  3AL0 B;  2KVS A;  2XI9 A;  3F2D A;  2LPE A;  1KRP A;  3GFK B;  5E79 U;  1KDH A;  1SKW A;  3UXO A;  2KE7 A;  3V7L A;  4RQ4 A;  2ZG6 A;  2P6R A;  2XY6 A;  3SZ2 A;  1N48 A;  2BPC A;  3BS5 B;  2XO7 A;  4DOA A;  2WF6 A;  5J2C A;  3PR5 B;  7ICP A;  2FPM A;  2GO7 A;  3MAB A;  1ZQG A;  2KZM A;  3PV8 A;  4ICA A;  4P0Q B;  2Q0Z X;  4YXJ A;  4R64 A;  4MEX A;  1ZQJ A;  4FS2 A;  9ICV A;  2FJ6 A;  3AU2 A;  3D2Q A;  3C1Y A;  3QUB A;  4KLT A;  5JRT A;  4IQW A;  4F4K A;  4JV2 A;  2ASL A;  3RJG A;  2XID A;  5IIO A;  1DOQ A;  2DUY A;  4C8O A;  8ICN A;  1NJX A;  5KFI A;  2HHT A;  5AI4 A;  2BHN A;  3RAX A;  2NRV A;  5KT4 A;  4QW8 A;  4YMN A;  3C23 A;  2OYY A;  1Y88 A;  2K8B B;  4I2E A;  5KFF A;  4FFD A;  3AUO A;  1RXV A;  2OH2 A;  2KD1 A;  4XRH A;  1Z00 A;  5D4B A;  1L8L A;  2O6K A;  3M9N B;  3IHQ B;  4KLQ A;  3M8S A;  2KTQ A;  4DLG A;  4NXZ A;  1XSL A;  4FBU A;  5ALL A;  4YR0 A;  2BQ3 A;  3M1Y A;  4BX9 C;  1HJP A;  2WF9 A;  4IQV A;  5J0R A;  5J2E A;  2VJ5 A;  5ALO A;  8ICL A;  3GQC A;  1U9L A;  8ICA A;  4KLE A;  4PL1 A;  4RU9 A;  5DQH A;  4MFC A;  4DF4 A;  4UB4 A;  1IG6 A;  4QWA A;  1JIH A;  1C7Y A;  2KEY A;  2W9C A;  1D8B A;  4Y2U A;  3M9O B;  3H0R B;  3KHG A;  3PW2 A;  3FC4 A;  3GV7 B;  1YZ6 A;  3S6J A;  1WWU A;  3IN5 A;  4O3Q A;  3EUB 2;  4C4T A;  2EZY A;  5EOZ A;  1XS9 D;  2K89 A;  2I1Q A;  3EPI A;  1RQL A;  2FMS A;  2E5S A; 
#chains in the Genus database with same CATH homology
 1QCK A;  2EZY A;  2EZZ A;  2ODG A;  2EZX A;  2BZF A;  1CI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...