2ODIA

Restriction endonuclease bcni-cognate dna substrate complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
b'MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENNITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPSSRNPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNLSKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMDLCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*CP*CP*CP*GP*GP*AP*GP*AP*C)-3'
publication title Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
pubmed doi rcsb
source organism Brevibacillus centrosporus
molecule tags Hydrolase/dna
total genus 64
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2odiA02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2odiA01
2OA9A 3IMBA 2Q10A 2OAAA 2ODIA 2ODHA
chains in the Genus database with same CATH superfamily
3VGBA 3TF7C 4JHZA 4ZZKA 4ODXA 4F58H 5GS0L 3OZ9L 4PVNA 5FYLD 3GXMA 3VFOA 4EN3C 4X6CE 3MRDA 4NKMA 1QBAA 4PJIE 3V4PA 1ILSA 1YSOA 3NRQA 3WO3B 3MUGB 3TIEA 3FT1A 2ZXQA 4U1JA 2D7MA 2PYED 4CMHC 2TRHA 4PD4J 5DRWA 3VFWB 3KYOA 4OD1L 3NABH 3FMGL 3OG6B 1EHLL 1WSST 1T2JA 3W5NA 3JWNH 2DJ4A 5I1LA 4JFFA 4AL8H 4PP1D 2W9EL 1UB6A 3GMMA 4GQ9L 5ESQA 4ZS6C 3RPBA 3CVIL 4B3VA 1P2CB 3OPZL 2X2IA 5AG8A 1MFCL 3GZQA 5KS9E 4XPAH 2LU4A 1FFOB 3Q6GL 4FQLH 1L9RA 4XVUC 5FYLH 3OZKA 2BINA 5LBVA 2D3JA 3HNTL 3O3AB 3ARBD 4G9FE 4S1DC 3U4KA 4I48A 3X13A 3JWOL 1ZTXL 2P80A 2D0FA 4PJGE 4Y9GA 4NWTH 4YXLH 5D55A 5E9NA 2MQ0A 1IGCH 2ZWYA 3E8UL 3QJSB 4JFHD 3NVQA 5HDLA 1F97A 2J4WH 1FG9C 4TVPL 2YGVA 3BLKA 2FECL 4QJ4B 3QJXA 2PPCA 4LSQL 3QUYC 2E86A 5C07B 4LPXA 4PGEB 4ZD3L 4DZBB 5CWSA 1FN4B 2CO7B 2JELL 4A63A 4PW9A 5C08D 1YQ2A 4K3JL 5DK0B 5AB2A 1MREH 3LRLA 1KCSH 3D4GA 4XVTL 3KPSD 1A21A 2N7BA 4Z7QE 1SDDB 3LD8C 4KH9A 3VI4B 2V3FA 4JRYD 4XP6H 3HPJA 3MBEC 4HWEL 5BZWB 1IZKA 3SY0B 1GGCH 1UEMA 3C5JB 2BXZA 3HJEA 4HXAL 4TSBH 2K45A 5E1GA 2P8PA 4UF7C 2Y23A 4OLXL 3MYJA 3TT3H 5K59F 2OP4L 4R0LB 4WUKH 3ALWA 1V55B 5J0BA 2RIKA 4ONFL 1DVFC 4F7PA 5CEXB 1KTBA 4AYFA 1LWRA 4IBQA 5HPMB 2DYRB 5BVPL 1EERB 4K9EH 1KTLB 2X28A 3QH3B 2GTQA 4YPGA 4DP2X 1Y18A 4JS7A 4EDXA 5JNYA 4S1DD 2V3DA 3DX2A 4HLZG 2Z93A 1MXGA 2W9DL 4OCLC 3MRGA 3MNVA 1MWAB 3GINA 3REVA 1ZHLB 4IMKC 5F97E 2VLRB 3QIWD 1SBSL 3D85B 4E9LA 1OOWA 4HJ1A 2Z8VC 4OI8A 3UPRB 4GP8B 4RBPH 2P42B 4ORZC 4WSKA 5E99L 3U46A 1DCLA 5C7ZA 4JFOB 3GSVA 5ITFA 4HWNA 4YXHL 4RX4D 1UG9A 3RBSA 3DDFA 2AXFB 1O9WA 2XPGA 1NDMB 3IJSB 3LKSA 1ZK5A 4XVOA 5BS0B 5B3JE 1AQDB 1ONQA 2AV1A 3SD2A 1AIFA 2ZKMX 3L16A 4U7KA 2JH2A 3KPOA 4A2HA 1CDUA 4XNUL 2WN2A 4QRTB 3R4RA 2QVIA 4N1CA 2LU7A 2F1AA 5E00A 3QUXC 3V5HA 5F1NB 2D7OA 4ONGL 1NZRA 2PW1A 1SMAA 4TULL 3ZKNC 1XH3A 2OQJA 1CDGA 2AQ1A 2YPVH 4UZUA 5I1IH 5CEZL 5JHMA 3Q43A 1R4XA 2YLKA 3G08B 1QFWL 3EDEA 2J88L 4PJEF 4S1SL 5AOZA 4HJGB 3T2QA 1DBKH 4GXVL 2BVEA 3R19A 4AXWA 3FONB 1WZ1H 1OQOA 1FFTB 1E5BA 4NPYB 4R83A 2AC0A 3C8KB 4X5RA 1FYHB 5BXFB 1X4XA 4IRSD 1FYTE 3QG7L 4WGKA 4FABL 3CCHB 2QPDB 1BM3H 6TAAA 4ESJA 3V4LA 2UUDK 3P2BA 2ICEA 1BPVA 4QHKJ 2D03L 3IMTA 2RB8A 4BFIB 1J0HA 3IKCB 1DUZA 2BY1A 1O7VA 4AUYA 2DQMA 2NY3B 3G5YB 3WTUA 2PP8A 2XACC 3ILPB 5TK4A 3T08A 3UG5A 3HHSB 3ZOAA 5ADOH 5GGUB 2QBWA 4I0PC 4Q56A 2WKGA 1J05A 2WLIB 3FXIC 4GI8A 2DY2A 5D2NC 3RGVB 3GF8A 5IJDC 2OMXB 4KROB 1KYOJ 3WLBB 2BC4B 2ESVB 1EAOA 5I26A 4G72B 4I89A 3NTCH 1R3JA 2AW2A 3VMOA 1AHWC 5HHVL 1L6PA 4JHUA 4A7GA 2R0ZH 4DP5X 5GS1A 4U31A 1J9QA 4WI7A 3TN0C 3QUZC 1XSKA 4BQBA 3V5DB 2ARJA 3A47A 3BO8B 4NKOA 2A4CA 4YS4A 4PB9H 4YFEA 3QW9A 4RFOL 2LV4A 2W0FB 3FO9B 1RZQA 1ULVA 15C8L 4LLDA 3N91A 4G9DA 1IC5H 4J3OG 4JQVC 4X4XB 1G6VK 4L1TA 4NGHH 1OAYL 1EWHA 1WT5C 2XC8A 4X9GA 1A66A 3MRJA 3DUUA 3DGDA 2BY2A 2F53D 2Q0ZX 5E2UH 4Z3JA 4TRPL 5H35A 4FJYA 2A9NL 3V5KB 4I1PA 1PG7H 4QOKE 4PB0H 3QJZA 3DSFH 5FHAH 3BPOC 2VDNB 2ADFL 1BJMA 1GPOH 1D7BA 4PRIB 1F1GA 1DR9A 2H1XA 1DQJA 3IFOA 4BKLA 4G7RB 4EBQL 1KC5H 4XN2A 3EGSA 5TD4A 3K6NA 2O5XL 4K7PX 4MAYD 5HVWA 1F4WH 2FBOJ 2GTZA 1V05A 4PV8B 3RFZB 4KX9A 3UTQB 3LEYH 2D7PA 4JFQA 3QUZD 1RZ7H 2CRZA 4IRZH 3L3HA 1AD9B 1F2XK 2KBGA 5AVUB 3GMRB 1XR9B 3FFOA 4ODVL 4OLWH 5DR5H 3QDGE 5LGHL 5DZLA 5C0BB 3D0LA 4LCWA 4XCCH 12E8L 5F0LB 1TTFA 3WIAA 5E6YA 1UXWB 2NRDA 3E1ZA 4MDIB 4ZMNA 1NLDL 1DQML 3MRKB 4LLWB 4R9HA 5HDBF 5JXEC 1U2HA 4TUJA 2XG5A 3GNML 3SBWA 3E7JA 3V6OA 3MJ7A 4OQTL 4J39A 1FE8L 1XSIA 2XWRA 5JPNA 2LLNA 2IDUA 3FHAA 3GTNA 3PWUB 4ALAC 3V0DA 4MJID 1RK0A 4JL1A 2D3VA 1XGUB 1Z32X 3N3EA 4WCYH 1FRGL 3RAJL 1G1KA 4G1MB 1CGSL 1SY6H 4Q2ZA 3FQYA 5EEZA 5J6GA 1HOEA 5IT2H 3BQUA 1TZIB 1T4KA 1GIGH 3VG9B 2WQRA 1FGNH 1WH0A 4RGMC 2FUQA 4U05A 2NY0B 2XTLA 1TZAA 4Y4HB 4ETYA 2UZXA 1G9NC 1L9TA 3CXDL 1SVCP 1AR1D 3HPLA 4AITA 4E0RB 3C6EA 1CLZH 2EIDA 4PWJA 1G7IA 2PP9A 3Q7JA 2DJMA 4PBWD 5I1GL 3EFOA 5KVGL 5HYSA 3ESUF 1GZQB 3NZ8A 1M3IA 1SHWA 5FO9A 4YL9A 1I8IB 1UJTA 3Q5YA 4PY7A 2ZSWB 1JDDA 3FPXA 3TNNA 4DTGL 4KI5E 1A6VH 1JWUB 2JKRM 5HJ3A 1HK6A 3L08A 3OR6A 3ZZQA 5J4MA 3FB7B 1QSFE 3OKYA 2F7OA 3MU3A 1ZGLB 1RJLA 5L0QB 3UP1A 4IQHA 2X9YA 5EOQL 3CDYA 2BNUB 4JFDB 1E3XA 1FG2B 3VFMB 4AYBA 2OTWA 1G1YA 4GG6B 5KSAA 1HINL 4HALA 3ROOA 3QNYB 3VE0A 4JM2F 3VXRA 4B0MM 1PZ2A 4UIKH 1Y1DA 2W9LA 3DVNA 3MLZL 4QPEA 1JZ5A 1G6RL 1TVBA 2J5LC 3GLZA 4ELMA 1EDYA 1CLYL 4KKPA 5FHBH 1AC0A 1OOAA 4Y2DA 1E42A 1BZ7B 2V5YA 1HIMH 3ARYA 5DWPA 4N2FA 2FQFA 4CVZB 1QUPA 1YEKL 1OF2A 3VWJA 4B9GA 3T77B 2Y36L 2ZAHA 4IK6A 1JNNL 3BN3B 4JRFA 4PCTA 3MREB 3I3DA 5IR1A 1K5WA 3VGHA 4FXGA 5F3HB 1UOLA 1BMWA 2O61A 3LQMA 4JY4A 2EC8A 3U0WL 5DI8A 3UGEA 4ALAH 3T3ME 2XWCA 3V4VL 1AFVH 3BSHA 1UM4L 1NEPA 2V2XA 2VE6A 3F12A 4ZX3A 1QSEA 4GAAA 3L6FA 1CXKA 1IBDA 5SWQA 3SN6N 4NOFA 1NIFA 4HVBA 3ETSA 3DJ9A 1M2VA 5TDOA 4XNMB 3H2PA 3SDAB 3ARUA 4WJG3 2YFNA 1F3RB 1TVDA 2JCWA 5PCYA 2HLAB 2APSA 4NKDB 4XE0A 2PPAA 1SOSA 3T09A 3BKMH 2X1XR 1DQTA 3GRWH 3SEPA 4HLZH 1CTOA 2AQQA 4Q6IC 3UTOA 3X14B 3FT3B 2AEPH 1RKRA 4P3DB 4M62L 1QKZH 2X7LA 3EG9A 3VWKD 4N0YH 3OKKA 1LP9F 4R26L 3AM8C 3ZKMC 1OD9A 4BA8A 3G5VB 4UTAA 4UAHA 1I7RB 1IT9H 4EKXA 2XY1A 1KB5B 4PRHB 1BZOA 1CF1A 2YA0A 2X2YA 4GO8A 4M1DH 4Y1AB 5DHVH 1OSZA 3EO1B 5F7DB 3GSUB 5C0JB 2AK4D 2Z31D 2CHZA 1YMMD 1PSKH 5BJTA 4LVNB 2Z92A 4UV7H 5GRVL 4C59B 5ADPH 2PWEA 3BWAB 3L7FB 3VCLB 1AXSB 2IAAC 2FH8A 2IDQA 1IVTA 3B2UC 4NS0A 4Z3IA 1LO5B 3TV3H 3AC0A 4ZW6A 5DSCA 4HS8H 2DW5A 2ZCKL 4N0CD 4MZ3A 4GOSA 1HSAA 5KVFE 1EJOL 1JPEA 1KIRB 4UV4H 1CLOL 2GIMA 4YBLB 2IGLA 2ENPA 2GBAA 2WBJC 4XAKE 3N44B 4X80L 3TYFB 4KJQD 5GZOC 1BIHA 1QMUA 4ORGB 1G7JB 2EYSA 4JDVB 1CDBA 1H5BB 5EC1B 4BZ1L 1YY8B 2IH1B 4HZAA 4IGBC 1ADQH 4U4BA 4MSWA 3OLGA 4NKIH 4WU5A 1XF2A 3UP6A 3WS6C 1FH5H 3EJCA 1FVCB 1FVDA 4N86A 5GGVY 3RDTA 4AEHL 3GMOA 4G6JL 2Z35B 1HX0A 1PD6A 3FTVA 1TENA 2GFBA 2WAQA 3BH9B 2NY4C 3LEVL 4PJCA 2MCG1 3ZKMD 3PQYA 4U33A 3QAZC 4WO4A 1X7TA 4O4YH 3IFLL 1RZJL 3ULUL 2XKNB 1MY5A 3ATFA 3T8MA 4PJXE 4U1SA 4QRPB 4HIHA 3UAFA 2DIJA 5EBMB 3WDJA 4Z7VE 4HP5A 2OJZH 3EBIA 4FTVE 3KYNB 4O58H 4PJ9C 3US9A 1SDYA 4X4KA 5IFAH 4KJWD 3B2UD 2ZP8A 4DGYH 4A55A 1FVEB 5I8CA 1F58L 1RUKL 3I84A 4J3OD 3MV7D 2XETA 5MEND 2ZF9A 2IMNA 3EJZC 3QUGA 3LDBB 3ZE1E 3AMLA 2YK1L 3Q8AA 4NENB 2WBJD 4GQRA 2H1LM 1T4WA 5C09B 3MGAA 5HGBB 2ZONA 2G9HB 4EOWH 4B9IA 1UJ3B 4LHUA 1M3JA 4ZOEA 3V0AC 1GZHC 4IGBD 4LMQE 1X5KA 3L4ZA 1VADB 4JJHA 4U1GB 5I0XA 1IMHC 2WXGA 5AOMA 3WELA 1MW2A 3V0WL 1HXMB 1M7DB 4O2FA 5L2KA 4OCYH 3PWLA 3QO1A 2NLJB 2YPLA 4NO0A 1JZFA 3UACA 3HE7A 1U8LA 4POUB 5EZOH 1AG0A 2QVTA 4WJKB 3QZWA 4UZSA 3EJPA 4XI5C 5ETUB 1KPRA 1D7DA 2A9AA 4J3OH 1JPGB 4XBEL 3BEVB 5I1AA 3HMXA 1FAIH 1CICA 4RZKA 4P23B 4Z7NB 2D7TH 3IDIB 2RR3A 4FG2A 4HUWB 3QXTA 1JMXA 1E0OB 4N8VB 1A7PH 3RZWA 4F7CB 4XOBA 4DO4A 2VSCA 3QYMA 4U1LB 3I2CL 5CAYB 1BVLB 3W82A 3FQTA 1VFMA 1SM3L 5B21A 5IEKB 1KB9J 2N3JA 3WD5H 2WTRA 3AWGA 1DUYB 3C08L 4RA0C 2DD8H 1KCVH 1D7CA 4KVNH 5FOJA 2WUBH 1YECL 4OCSH 4MMXC 4WV1C 3EJZD 4TQPA 4KKAC 3FFCA 3QXAA 2A38A 4J3XA 1UXMA 5GRZA 4XCEB 5MERA 2AJVH 5L88H 3S36X 3CVHH 1GW0A 2HRPL 2W81C 4QY8A 3TU6A 1DSYA 2X0WA 1U8OB 3DHPA 4PV9B 3NBNA 3VD7A 4GRWH 1I8AA 1W72L 3CQQA 2CK2A 5D5ME 3DO7A 2CXGA 2X9XA 4LK4A 4AGQA 5IIEB 3R7QA 2XXCB 1ZLDA 2EDDA 4H8HA 3Q6FA 1L7IH 2EE3A 2WXLA 4AJWA 3RWFA 1D6VH 3UJTH 2Y3NA 4AQEA 43CAA 3GIVA 3DRTB 2C1PB 1JNLL 3BD4A 3W39B 4PTUA 2VXVH 4X5XA 4DVBB 3ZMRA 2NZIA 1KCKA 4G3YH 3QG6A 1Z5HA 4PP2A 3TVMB 4OTXH 5D93B 3TEXA 1O6SB 1K6QH 3C5ZB 3P2DA 3QJFA 3QRGL 4KJYA 1A4AA 2XA8H 4NM4H 2WINA 5DO8A 3SHSA 5KSBF 1BLNA 4GKLA 1UOKA 2NR6D 3U7YL 2CKBH 3KPPA 5DRNB 2NX5E 4J3VA 2YD4A 3FDWA 5E1QA 1NMAL 1J8HA 3IFPA 3VXTB 4NQVA 4ECNA 4DNLA 4NRXA 4QYAA 2E6PA 2HX9A 4NQDE 4EDWL 2QQNL 1I8KA 4DUVA 1JPTH 1T2QL 4YWGL 2VN6A 4ZZFA 4X7EC 2C7UA 4FQ1H 3TFKC 2DV6A 2R1WB 3ZLQC 3HI1B 3S4SA 5B7EA 5LDUA 5CJXC 4DGWC 3V6ZB 2ZOOA 2K4AA 4D0DB 1EHXA 3GXNA 3SBPA 3IDXH 3RE0A 3LMJL 4P5KA 4NXSA 2C3VB 2XIDA 1I7UB 3WY1A 1MWAH 4J2XA 4X6DA 2ZYRA 4G6KH 2J6EL 5IJCC 3PREA 4L5FL 1WITA 4GUPA 5M95B 1AGDB 1MVUA 1ZS8B 5DJZA 2Q3XA 5FR3A 2YAOA 2CHXA 4FEIA 1TQBC 2MPAL 4HHAA 1E8YA 1RPQA 1SYVA 2DQGL 3PHOB 4ODTH 1AR2A 2Y1VA 3V95A 1JERA 2XVGA 4MMZB 3WKNA 3HG4A 1ANUA 1H3VA 1KGXA 1U8JB 3PHAA 2D31B 3MZTA 2H5UA 4PHXA 3RZCB 1NEZA 3MRLB 4LCYB 1A64A 2V2TB 3GYRA 5DMYA 3GBNH 2WP3T 3NJJA 5GJSL 5DT1L 2AQNA 2NT1A 2OTPA 3HRPA 3OKNB 4GBXC 5D2LA 1EO8L 2JWYA 1H0DB 4G7QB 4XPTL 4QJ3B 2BLFA 3IMSA 5KSBE 3QEQE 2A9BA 2LLGA 4URKA 2Q86B 3H7BA 4ZS7H 5LVEA 4Z3GA 4W9KC 2BOLA 4AQ1A 4C4KT 4Z78B 5KYYA 3B2MA 2Q5BA 4LO9A 1A9EB 3O6FB 3U4EA 2F54A 3U36B 2GTWB 3L9EA 4M61B 5DD5L 3RGVD 4ODHH 1NMBL 4ZFZB 4KKNA 1HHHA 2J2ZB 2V2WA 3LKRA 1XIWC 3MNDA 4KROD 5GJTH 1ETJA 1JXGA 5HGHB 2ESVD 4F9PC 1RZKH 2VR3A 2R39A 2HJKB 3OZLA 1KOAA 5LWYL 4J4PA 4EZLA 5BRZD 2ERJB 4N1EA 1BBDH 4KUCF 2IV8A 1I1YB 1LEGB 3GSQB 4JDEA 5KOVC 3EGDA 2HSIA 4FI8A 1HWHB 1JXJA 4FRWA 2C8NA 3BE1L 5LCVA 5C8JA 4XXDB 4APQC 4KH2A 2G5RA 4KK9D 4UILH 1H8LA 4Z7UA 3CWGA 1UD6A 1UUSA 2CIIA 1MCDA 1HYRC 3DURA 3CSPA 5FOBA 1N70A 1NFKA 1S7WB 2UXFA 3LIZL 4FFZA 4JJ5B 1MVYA 1U8IA 1S9VB 2AI0H 5CGYC 1T0NA 5TE6L 4HJIA 2AV7A 4JFXA 1AYOA 3CDZB 3O4LD 2YXVA 4GXUN 4UDTA 2EEBA 3K72A 3S5LB 3L5XH 1UURA 4NM8H 4ZSOA 4ZUSA 3WKMH 4KZ0A 3KJ4B 4QRRE 1HN1A 2H45A 2FNBA 2AHIA 5JW4M 5KSUB 5J8OA 1LO3L 3IDUA 1QPXA 5DQJA 3APMA 3HW7A 3ZYZA 1R3KA 2MRYA 1IEAA 1QW9A 1XF4B 5DZJA 3LKNB 1NOLA 4KQ4L 2GUYA 4L3EB 3HG1B 2FD6H 3HZVB 1P5UC 1D9KC 4TVUA 3GZPA 4KTEL 5TF0A 2NY1C 4ZW7A 2RD0A 1CGVA 1T83C 1IEHA 1BOGB 1WO2A 2PN5A 4JM4L 4AJYV 1D5BA 4LAQH 1DANU 3JYBA 4JPVH 5IMKA 1I8MA 4JKPH 4AJ0A 4CGTA 5DEFA 5AAWA 5T5FA 1AE6H 5C0BD 1FNHA 3EO9H 4JQIH 3LHPL 1GW6A 3RNKA 3B7TA 3GSRB 4Y9FA 5IVOA 3T6ZA 3V6OE 4X8JA 4ELMF 2VDNH 5KAQF 3N43F 3MMEA 4G5ZH 1IB5A 4U3SB 1XL6A 2F7IA 4AT6A 1SMOA 2VSDA 1IRAY 2XTSA 4XNDA 3PXJA 1FZJB 3SBQA 4XPBL 5AVYB 2O6EA 1XB8A 5D2NE 2ZOUA 1IM3A 2DQEL 4XCNA 2GSMB 4NOBA 2ZKHL 4X50A 1IQDA 3ZDYE 1OCZB 3L4YA 4HW6A 4RNRB 5AW9B 5C0AB 3GXIA 2EDLA 4AH2B 5L7XL 2BVTA 1FL3A 2HT4C 3DTXA 5HHPB 2NY7L 2YEZA 3QZPA 2R4RH 1MLCB 4OJYA 2APVA 4OIIL 1GGIL 1DHKA 2HT3D 3POCA 3ZQ9A 4AQ8C 2BIMA 2COVD 4DKTA 1W6WA 2WB7A 3LZRA 5HYIA 4OZHE 4XCFH 4OIFA 1Z3RA 4NC0B 2NY1D 4JFZH 4RGNB 2IOIA 1OSPH 4JNXA 1TYEB 1UZ8B 1QFHA 1RIUL 4UDUB 4Y4HD 4YIQB 3RTQB 5I2IA 1TCRB 4U49A 3TGXA 1VCBC 1L9NA 3TIDA 1F3JB 1MFNA 3BKCH 1I8LC 3QJRB 4UU9B 1DJYA 5A43C 1DL7L 1R5IA 5CD5D 1O9ZA 3T6XA 1U8MB 4LCUA 3A6BL 3OKMA 2QPEB 1B9ZA 4HLEA 4HH9B 1W8OA 3VXRE 4JFDD 3CXHJ 3A5VA 2OXGA 3FQXB 4L1HA 5C0CD 1JPST 4FTDA 5JHLL 5KTEL 2DQJL 4QRUA 4P3CH 3EYSL 1ZTXE 3BZDA 4H5SA 8CGTA 4ZNCD 1E4HA 1RK1A 4F27A 4LARL 2HT4D 4JPIB 4MZRA 1MCWW 2FQGA 3DVGB 4AZ8A 4DOHB 1ZT1B 3TTYA 3LVEA 4ZFFB 2E76C 2G2NA 2NY2D 1FL6B 1QLFA 3CXFA 1BGXL 3EIFA 4JRXD 5TJWK 5IFHH 2CA4A 2IGTA 3QEHB 9PCYA 1MVFA 5JIDA 1A6UL 4OI9A 2ZUVA 3ES6B 3UIYA 2VXQA 3P30H 1UXSA 4JZOB 4AGLA 5IF0A 4L8SB 2OMYA 1DJSA 2R2CA 1K72A 5FB8A 4JZNA 1NPNA 3GJEB 1JVLA 4FLSA 1W72A 3OJ2C 3BP6A 1S6NA 4EIZC 2DQCL 1VZHA 1XGQB 2F58H 3QARA 1TSHA 2QADD 4PG9B 3NABL 2WXJA 2LE9A 4PJ7A 2LT9A 5LG6A 4N26A 5DGQA 2BNRD 5FA4A 3HVNA 2HFGH 1NMCC 3D18A 4AL8L 3QIUC 4NQEA 4JZJC 4PJCF 4TNEA 3BW9A 4TQHA 1JTPA 1JVKA 4PJ5D 2UWEA 3BPNB 4IBZA 1BAWA 3GXTA 3KWWA 2OL3A 3IXAA 1PFCA 5FFGA 3OXSB 4PY8J 4XPAL 2X1QA 1ORSB 4XC3H 1P5VA 3CZKA 3EYFA 1R5WA 4FQLL 4KKBC 5KBLA 2EUVA 4FS0A 5DJXB 3VDCA 4N5EC 3K5SA 3SKJH 5JOFA 4ONHA 3PWPA 5T5NF 1DVYA 5M7QA 5FW8A 1PD0A 5EUOE 2LR4A 2ZD0A 3KDMA 2IIJA 3UG3A 1MCCA 1MLBA 2J4WL 1YN6B 2KLRA 1OARH 3BVNB 3LTVA 1U58A 1A9VA 4XHJC 3HZ3A 2WOBA 2Q3AA 1I3RB 2NYYC 4NCDA 3KLHD 2FO1A 4PRHD 2KZWA 3I6KA 5DEGA 1FFNA 4G8EB 4XP1H 3TJEL 3F58H 4XB8A 3JTTB 5KJ4A 1A6TA 3QFJE 3UAAA 3I02A 3R7RA 1BQHA 4TUOA 1KCSL 4YK4B 5DZAA 1HDMA 3H4FA 1SF5A 2VQUA 5I24A 4PJEB 2YOCA 4OFIA 2OMTA 5J1TC 2X89D 4XP6L 4KKLC 4AI7A 1WFNA 1SZNA 1IBBA 1GGCL 4M8UA 5IW6B 2AK1H 4UOZA 4DETA 1RPUA 2XQBH 5I9QC 2V3EA 3OG4B 1TTAA 3ZIYA 1PCXA 1Z9NA 2CE6A 4AVJA 2QSTA 4X7FC 4FX5A 4K9EL 4YHYB 4RZCB 1HL4A 3IFNH 3HUJB 3I6GB 1KB5H 2Q76B 4JG1H 4ONOA 4GAFB 1NBZA 3D39E 3SPJA 3WAJA 2E8ZA 4FL4B 4YHKL 3HZKB 3QJHB 4H0HB 4XWOD 1JZHA 4DKFL 2HKHH 4WLCA 1DO5A 1WFIA 1KJ2B 1JGUH 2X4RA 3CFCH 3PYCA 4AJVA 1BEXA 3PGDB 2QHRL 1BFVL 5HHXH 5F88A 4D0BA 2K0RA 4PJFB 2CHWA 2V7NB 5SV3A 3QGVA 4XHJD 1X5IA 3CFJA 2GK0A 3K74B 3TFBA 1PKQA 1A65A 4F1SA 1E4XL 2WXOA 4P4KD 2FWOB 2JB5H 4QRPD 1K2DB 4G8IA 1CT8B 4X4ZA 5HI3C 4FOMA 4H7VA 4FFVC 1QYGH 3KLSA 5K1VA 5E6UB 1N0XH 1S9KC 3HCVA 4X6BA 5D7JA 3UC2A 4HWZB 1Q9WB 2PO6B 4ZI8A 2BJML 4HOWA 3WTSA 1G7QA 1B4JH 1C5DA 2WQXA 4JR9H 5HYJE 3QS3A 2HLFD 3LEXB 4BSVB 2QTEA 1YEJH 2BP0A 5LGJB 1FV1B 4GY4A 1MHHB 3AFLA 1KGIA 3LYRA 3BP7B 2ICWJ 5I28A 1JXKA 4GAYA 3PHQB 4LDCA 2HRGA 2X4UA 4P9MH 3SCMA 4AENA 1NH6A 4KNTA 1UM6H 2YPVL 5I1IL 4FNTA 2BHFA 4RIRA 4NKQB 5JOEA 3D3VA 1JV5B 3NG5A 4GFXA 5EU5A 1DBKL 4M7LT 4E42A 5D7IA 4DN3H 1QHOA 5MEQA 3VH8B 1EEYA 4GRLB 3LIZA 1SLUA 1ZHNB 2A99A 4FKHA 3VYPA 4B9ZA 3TCXA 3AY4A 3ZL4H 3HAEG 1WVZA 2NTSP 4L4TD 1XO8A 3A3YB 5ELIA 5ID1B 2KZBA 1EANA 1D5MA 4WIQA 3NJLA 5HI3D 2W60B 4YHNA 5GGSB 5GQBA 2FSDA 4GS7B 3EFFB 2BCKA 3W9EA 5ADOL 5E56A 5FLVA 5FPIA 3GI8L 3MOBH 2NZ9D 1HI6B 5FCSH 2K8MA 5DJ2B 3H9HB 4MQSB 4AIZA 1XVSA 4L2YA 2DM4A 1TLMA 3FRPB 1HTYA 1N6VA 2H26A 4X9BA 2FL5B 5KBPA 3T0BA 4X6DF 4YDVA 1KELH 5ACZA 2XWJA 3T8VA 2TSAA 1W16A 4WJ5A 4E5XA 1XF5A 2Z8RA 3APFA 3CQPA 3IN0A 4YLBA 1VJSA 5DFAA 3SODB 3VD5A 4N8CH 3K46A 3QEUB 5CHNB 5J12C 2BS8A 4ZYKA 5F3BB 2VQTA 1HH9B 5FGCE 5F9WB 4EUPA 3CBKB 3QCTH 1QBBA 3SE4A 3SYAA 3UTTE 3MA7B 3U6RB 4JE0A 3MJ9A 4YZFF 1EAPA 1QBLH 1OGTA 1YDPA 4KQ0A 2XNAB 4HJSA 4MYWB 5IFJB 3MV8E 1ZT4B 2KI6A 2Z9TA 4IBSA 4LEOA 3QYCA 1IM9A 4NGHL 4JY6B 2GITB 2RH0A 5D2LF 5IVZB 2J44A 2QPFA 2CO1A 5E9DB 2CDFB 4PLJD 4G80B 1MDTA 5HJBA 4OV5A 5BMFL 1X3DA 3TVMD 1PG7L 3GDCA 4YGVB 1XAKA 2VITB 2CDGB 3C5ZD 1A7OH 2VABA 1Z9MA 5FAAA 5DLMH 3EH4B 1J8HE 4NQSB 2R59A 5EO1A 5MEOB 4FYTA 4HPHA 1JZDC 1RZ8A 3C6LB 1KC5L 5CCGE 1Z5LB 1I9IH 4IS6B 3V0VA 4WFEE 2CMRH 5CINH 1J87A 3BH8B 5F96H 3V6FB 5SWSA 3UAEA 3CDCA 4P2RE 1URIA 4I88A 4GW4A 1E90A 4N2NA 5KVGE 3CX5K 4F2MA 2FIKA 4MD5B 3UH8A 4OGZA 4DO6A 4MQ7B 1O9VA 3KD4A 4IRZL 4TLSA 4X99B 4CU7A 4ZPVA 3CFUA 5ID0B 1U6AH 1S7TA 5CJOH 3PDOA 4Z7UF 2E7HA 4OLWL 5K1NA 2NY5C 4PTTB 1OPGH 4N2KA 3BSZH 4XCCL 4S1QL 1OIOA 1XHHA 1MUJB 4JFEA 4FULA 4B3EA 5KN5B 1FNEA 5FO8A 2NNAA 5DA4A 2OMNA 4P46A 5BQ7A 5MP6L 4GQZA 4JO8A 1TNMA 1E7UA 4WI9A 1T3FB 4O5LH 3D69A 4ZAKB 2J73A 4J23A 3OAUH 2X4OA 3ARDC 4UNUA 2P3YA 4Q4IA 5GGTA 1AD0A 2C9UA 4XR8C 2F5BH 2Z4QB 1F3DJ 5I17B 5EG6C 5B38B 2P46B 2F7RA 2Y24A 2HTLC 4LZKA 4UT9H 5EZLB 4F9LA 2GJ6E 1BD2E 3MCKA 3MRBA 3BD3A 1QPKA 2BS71 5F6HI 1Z9LA 4A2GA 1SY6L 4YSSA 2A6KB 5CN3A 4NNXA 3TA3C 4D7BA 1J9SA 2UYLB 5IT2L 3DECA 4JHWH 3E0GA 3LXUX 4WNQB 4YX2H 3SO3B 1GIGL 3NIGF 1IU1A 3S3CB 2NSQA 3RBGA 4EI5A 3V0IA 4UQ2A 3OMAB 3JV6A 3TBVB 2W8CA 4HLJA 1VCAA 3EJJX 4YBQD 3ARRA 3ETBJ 1VZIA 3Q0HA 5EF1A 4MCZB 4QTHB 3VVWA 1MRCL 1CLZL 3GMPA 2DICA 2H2PD 4DCQA 5B3NA 4WUUB 3RFRA 3IVKA 2DB8A 1S3RA 1N10A 4Z76A 2YN3A 1BX2A 1XF3A 2ZXGA 4EQ3A 4BKSC 3DO4A 3MRQB 1A02N 5B8CB 1XH0A 5EBGA 2CCWA 5EU6E 1JFQH 4NYLB 1I82A 4GT0A 5FO2A 2B77A 3GMNA 4KBPA 5CMAA 3S2CA 3TZVA 1UT2A 4BJLA 5D7LE 3HR5B 3SGDI 2AMGA 3H56A 4XO9A 3UIZA 3SDDA 5J6HB 1FC1A 5DRXA 1J88A 2EUXA 4UIKL 2VRQA 4UOJA 5I6OA 3U25A 4ODXB 4D94A 4R8WL 3BIBX 3Q2VA 3DGGA 3VFOB 1AKJD 2AJSH 4M9OA 3MRDB 4BM7A 1IZJA 4NKMB 5BRPA 3TIEB 1BVKA 1PLCA 2E4TA 2PYEA 5H37H 1OP3H 1E65A 4U1JB 4Z6AT 1HIML 3FC8A 4TN9A 5DRWB 1C08B 4FNSA 5B1JC 3KYOB 3JUZA 1EDHA 4ANVA 5IMLA 1MJ7H 4XNXH 4W9GC 1CDJA 4JFFB 1OGAE 3L5HA 5INDA 1E3ZA 1NKGA 5EU7E 3J27A 2FYVA 1OLZA 3GMMB 5ESQB 1TQTA 4C56E 1KBVA 2VDRB 4F20A 3ZDZF 1RURH 1JJUA 4OW6A 1PCSA 3ISWA 1UWGH 1USQA 2EDYA 4GSRA 4BCXA 2OSXA 1AFVL 2AJYH 3WY3A 4ERSH 2OCCB 1QA9B 3MCYA 5ANHA 3RL2B 1ZPLA 4KXDA 4L3ED 1CIDA 3HG1D 5HVHC 3JVFC 3X13B 2I85A 3MSPA 4JVWA 3KPNA 3D9AH 1NCDL 3BXNB 2OX5A 3BYYA 3QXVA 1FLTX 4HEME 3VA6A 2O1AA 1A3QA 2GQHA 5J1AA 3W1ZA 3HNVL 1YEHH 4XXCC 4WGWB 1N8ZA 3BKML 2W65A 3VFRA 1PF3A 4N2HA 3J07A 1CZ8L 1QRND 5C08A 3EJRA 1JRHH 3RVWD 2OSLA 4GP5B 1ZOXA 4J6RL 5EZIL 2AEPL 3L1GA 5C71A 4OGXL 1QKZL 3ZDWA 1IAKA 3ULUE 3KPSA 2ZXDA 1KMGA 4UT7H 1I7TA 2YIHA 3D52A 4N0YL 1SEBA 3JYCA 4FQ2H 2COQA 4JRYA 4XE5B 5JHDB 4G8FB 3U48A 3FU7B 4ANKA 3HPJB 3BOVA 1SJEA 2YJLA 2H6PA 2P8PB 5E4IA 2RQ8A 4FP8H 3FT4B 5E6IB 2A73B 4YHZH 4C83A 1PSKL 4WSJA 5IESL 5C0AD 3BGMA 3BN9D 4I2XE 2VDOH 3E9TA 4WAFA 2OKMA 4CU6A 4DGVL 4UV7L 4AYFB 4F7PB 5JXAH 2WTOA 5ADPL 1TPXB 2UV3A 3HFML 1PW3A 1G9MH 2ED7A 4YPGB 4J2QA 2IH3A 1RJYA 4AV4A 3WG7B 1IFRA 4P57A 3TV3L 5JNYB 2AVGA 1DN0B 1HU8A 4OFPA 2Z93B 1I53A 3MRGB 3MNVB 3SGEH 4M6NL 4UV4L 3IRZA 5SWZD 4PJ7F 3REVB 5KVMC 3QIWA 3ZDZE 5JA8B 1AP2B 3WIFA 2W80C 3BDBA 4UNTA 2IANA 2X44D 2YPVA 4Y88A 4UAOB 1VDGA 2UWEF 4ZO8A 3U46B 4AZUA 1ZLSH 4N2GA 5I5MA 2PCYA 4RMUA 2D4DA 4XODA 3OQRA 3N85L 3DGCR 2XPGB 3LKSB 3LZFH 1UKSA 3GMLB 3M17B 3DX8B 1KTCA 1D5ZA 1ONQB 3L4UA 5F1OB 2AV1B 3LXCA 3OJDA 1AIFB 4KJPD 4P9HC 5AZEL 1HH6A 3KPOB 4XN9A 1WS7A 3HAEH 4O4YL 1VFBA 4JREB 1KXQE 2EEFA 1KWGA 1AIZA 4XGZA 3QUKB 5E00B 2UZIH 2K7QA 1KFAH 1KBGH 1TKWA 3VTTA 3VSTA 4CVXA 4YXKH 5EF0A 1XD0A 2Q7AA 5T1DH 2P8LA 2OJZL 4HYTB 3W0WD 3PP4H 3OQ3B 1XH3B 2OQJB 2J1WA 3OWRA 4O58L 3QEGH 3HC4H 1QNZH 4MNQD 4OM0H 4DERA 3O8XC 5IFAL 4KUZH 5TH2A 1HQ4A 3GDBA 2Y6SC 1DLHA 2OS7A 1NCTA 3PE9A 4M4RB 4UYQA 1RZIB 2R51A 1GKOA 1VESA 1XXDC 1IEBA 4NI6A 4G8GB 5GRYA 3WHE1 3QK0A 4WI0A 2N1TE 3O4OB 4G42B 1B0RA 1U93B 3LS5H 4AXWB 5DC4B 1DSFH 4IRSA 4ZW8A 5CJQH 1EUUA 3TNMA 1E6JH 3GT6A 4LSTH 1SOKA 1MJJB 3NFNA 3WE6A 4A7QA 2ICEB 3DVIA 5AYUH 2L7QA 1EZUA 4YFLF 1A7QH 3BP4A 5E1AB 4WW1A 3SE8L 1DUZB 5EMYA 4A2LA 2GJZB 2GSIA 3E3QC 1M56B 1QQDB 2TRYA 2FK9A 3WN5C 4NQEE 1M6OB 5HHME 3ZGHA 3ZHNA 4W6WB 2HPTA 4ZO7A 4YUEH 4L2LA 5L4IA 2XZAH 1V27A 2D7TL 5E8PB 1FAKT 2NNXA 4HU2A 4XP9H 4YQXL 1R3JB 1FGVH 5I75C 1F4YL 1A7PL 1O6TA 4QTIH 4NP4L 3G5XA 5F89B 3SDXA 3QWRA 4LLAA 5CSZA 4M6OH 1I3GH 5GS1B 4V2BA 5FDWA 4KVNL 3UYPA 4WF7A 4TLUA 1ZLVK 1KTJA 2X53A 4NKOB 1RJZA 4LLVA 2CPCA 4K71C 2WQSA 3L3JA 4ZXBC 3WEXA 2AJVL 3AZUA 5L88L 3CVHL 1KBWA 4G9DB 3RPIB 1NGWA 2YXMA 2EDJA 1KGYE 3UTSE 5E6ZA 2MHAA 2Z64C 4F7TA 4IRZA 5AKRA 2F53A 3MRJB 4S11A 3F7PC 1E9OA 1K4DA 3WKYA 1E28A 1UKQA 3FQNA 4FFYH 1XSOA 2A4ZA 2KHAA 3KPLB 5D7IF 4L5FE 5K1JA 4W4OC 3B6SA 6PAZA 4Z7OF 3LV3B 1L7IL 2XWTB 3CLFL 3OL2A 1W6LA 4FEMA 4P3WA 1BIIA 4WK4B 5JQ6H 3GKZA 1NM9A 3JVGA 4B27A 3UJTL 2XQYA 3NSFA 1DQJB 5JR1L 3IFOB 1JZ6A 4WZ9A 4DHLA 1AHWA 4JVPA 3W9DB 4CC0A 4JBSA 4MAYA 4EE2A 2VH5H 2Y5TB 1COBA 3LKQA 4KX8A 1L9SA 2P43B 4TL5A 3X3GH 3FQUB 2Y2YA 4QHNB 2ICCA 3QB7C 2WLHA 4HUUB 4CMMA 1K6QL 2FHCA 5CUSH 3GXFA 3QUZA 4NM4L 2YD7A 3B2DC 4U6HA 4JFQB 5HI5C 1SY6A 3RYMA 3JV4A 4MJ5A 4U6VH 2OMUB 3ARGD 3BGFB 2BWDA 2BCMA 3D0LB 4LCWB 2MNJB 1KBKA 2VNCA 3KCPA 4CDHA 4MCMA 2A9ML 3EZJB 4U2YA 5FKAA 4L3CB 3NPSC 4MXQC 3WNJA 2QT6A 1F90L 1J18A 1JPTL 2P5WD 4Y9EA 4TUJB 4WDIA 2X38A 4FQ1L 2JJVA 5DQ9A 3STLB 2RCSL 2YKKA 2YJQA 1CL7I 4JANA 3IDXL 4MJIA 2DBLH 3RY5A 3RP1A 1M71A 1MWAL 1DEEA 1KJ2H 4G6KL 5E2TL 1SQMA 1KV3A 3DYMA 4Q2ZB 1HNGA 5J6GB 5IQLA 3BQUB 5E5RB 2AITA 3VTAA 5E2JA 3DXAB 4IBLT 5HJDA 3V55A 3CZSA 1A0QH 4YHOL 1JWSA 3MUHL 1DZBA 1EMTL 2ZX6A 5IEHA 2WWNA 4JDZA 3CIAA 1UD4A 2V8LA 1R75A 1SVZA 3HPLB 4GRLD 3CDGB 4U1NB 3WUWG 3F5WA 1TU2A 2J1YA 1HS6A 1ZPUA 4PIRF 4YR6A 4TQIA 3WL9B 3ZTJH 1U8KA 2ZX7A 4JAMA 3BPCA 5JW4R 5L2JB 5FO9B 5F44A 5F9JA 4NCC1 1NAKH 5I19L 1YY9C 3BAWA 4OLUH 4PY7B 4PJ6A 5H2BA 3U6XS 3TNNB 1WAAE 3KGTA 1ID2A 5HJ3B 2WVSA 2IO5A 3OR6B 3P9MB 3OD3A 1A1NB 1UZ6E 2BVPA 3MLSH 1N19A 1RJLB 5IHBA 1TQSA 1QABA 2JKWA 2FZ3B 4BWWA 1NUDA 3NIDB 1CD1B 5DO2D 5KSAB 3ECQA 3ROOB 1LWJA 4ODHL 4P2OB 4R3SA 2YQGA 1WEJH 2AJUH 5GJTL 3S88H 3QVAA 1U2YA 5FGRA 1RZKL 3KWXA 4DPBX 1D5IH 1TVBB 3KEDA 5FO7B 1F02I 1FF5A 4M1GH 3N43B 4D2NA 3KXFA 3VRIA 1PX4A 2O6DA 3G04A 3KE0A 4JGMA 2DEYX 1LJMA 4V1DE 2HFTA 1JNHA 3DX9A 2FO4B 3SDCC 1OF2B 2NXYB 4OF8A 3VWJB 3FF8A 3GRWA 4HXBH 3E38A 3Q2CA 4WVRA 4ZQTA 1PX8A 5IR1B 2M83A 4AMKH 5EWIH 2CGYA 4Y16B 4FXGB 2AS5M 4NP9A 2DJUA 2VDPH 3CHOA 4JY4B 4LHJB 2AI0L 4N2AA 1XGRA 4HV8A 5DHDA 5DI8B 1N59B 2MOGA 1NAMB 3PL6C 3MR9A 3N40P 1MIMH 3DARA 2V2XB 2WJ7A 3K8LA 2VE6B 3F12B 5I6PA 4PI0A 4PS3A 4U3XA 5HHNA 3L5XL 1OAXL 1PJ9A 4LOEA 1HYSC 5DHVA 1BZ9A 1S7UB 5TDOB 2CBTA 3HS0A 2E9GA 5E08L 1HHKA 2C3GA 2HJFB 1UWEH 2JKTM 3D51A 1H3XA 3D5OF 4LPYA 4PJAB 4AK1A 1J1PH 2ZUUA 3MNWB 1TJHH 5MHSD 4PJ8C 5DA0B 3GI9H 5DYOB 4I8DA 3AREB 1QWHA 3D0VB 5F70A 3QQNA 3C6LD 2K8QA 1T5KA 4EVNB 1MI5E 3UZQB 4RISL 1N2RA 3VWKA 5L9DH 2GSGA 4MBOA 5GRWA 3EG9B 2VAAB 4K5NA 5IMMA 2A77L 4OZIB 1YMHA 2J3SA 3D50A 2WLZA 1Z3GH 4W9JC 1XWVA 4NQCD 1VGEH 4LAQL 1ADQA 2W38A 4BEIA 1NUNB 4JKPL 2R8SH 5EORL 2AK4A 2Z31A 1OSZB 4MX7B 1AE6L 2LU5A 3EO9L 2JKXA 4JQIL 4ZMOA 5I23A 1YC7A 2Y7MA 1K0ZA 2VDMB 4A67A 3BJ91 4P4RA 2EO1A 1A3RL 2VDNL 5HVFB 3CZFA 2H1PL 3FN0H 5F7WC 2P26A 2VR8A 3PL6D 4K07A 4IKLA 1WRFA 4KI1A 1QATA 3ZHKA 5DSCB 1OB1A 2FX8H 3ARZA 4PRPD 1T20B 2UUDH 4ATWA 5FYKD 3Q8EA 1A8ZA 3V9CA 2R2BA 3VI3A 4B6ZA 3LH9A 3CHQA 1HJBC 1IAOA 3OGOE 3BDYH 2KZKA 1LEIA 5EO9A 4FLOA 1M7XA 2FEDC 2E27L 2R4RL 1P6FA 4PJ8D 2A4EA 4CUCA 1MFUA 4WU5B 2R15A 4BDVA 1VA9A 4G1EA 4HIPA 2W92A 4P06A 1A2YA 1NCBH 4JHVA 1ES0B 3RDTB 2ED8A 1IGIH 4JFZL 1AY1H 2CH8A 1ZE3C 3UTZA 2R29H 1OSPL 2X87A 4FF9A 4OZGA 2GFBB 3DJZA 4HETA 4M5SA 4R0LC 2FT6A 4YHML 3PQYB 2VR7A 4WO4B 4KRNA 5IB4A 3TPKA 1JZGA 4FQPA 1VB9A 1T7YA 3BKCL 4TUKH 4WUUD 3EHBC 5FYKH 3IDGB 3CN2A 8FABB 5BZDA 2CIKA 3T4AC 4E68A 4KMTL 3OWEA 4JGNA 2BY3A 1YJDC 4KMLB 3RPKA 5I73B 1EXUB 3IDYB 4I3GA 3FSZA 3FQWA 2YA2A 5AG9A 5DFVD 5JORA 1I1AC 5I8CB 4YC2B 3MV7A 2R56L 5MENA 1C12A 3KPRE 4D9LH 4E41E 4HGMA 2WBJA 3L3GB 3QXDA 4P3CL 2WOYA 4UZGA 4B9KC 1IBZA 2HYMA 4MDJB 4WHDA 2VLJB 4QTFA 2FEDD 4LCCB 1BQLH 4OGAD 4IGBA 1PZ5A 4E9YA 1CD9B 4RDBA 3ARTA 4L4VB 1Q0EA 1MFDH 4HEPG 5D7KD 4KRPB 3H9SD 2ZG2A 1SJHB 3R8BB 5IB5A 1UA6L 4OAWB 5EN2B 1ET8A 4O2FB 3VFWA 4AKOA 4NFBA 4TS6A 1E8ZA 2CPUA 3PWLB 3QO1B 1GL4B 2N7SA 2YPLB 4WI3A 3EGXB 1AZNA 3HE7B 5EU4B 1EK3A 4C58B 4DVRL 1U8LB 3CVHA 1IC1A 2O6PA 1SJVA 4FJZA 4GNKB 3QZWB 3U2SB 3JZYA 1AOHA 1KPRB 1REIA 1W0VA 4HUNB 1OM3H 5HHQA 4UB0H 2R4SH 2WQUA 3H6JA 2CUHA 3AU1A 4IOFC 4BUHA 2YQ2A 2JKJA 3H85A 5E2VL 1RHFA 1FFOA 1KN2H 3IJEB 3GQFA 2F58L 3AS3A 3O3AA 3FQTB 1JZ2A 4NX0A 3GM0A 3P02A 2E7LC 1I1AD 5H94B 5BOPA 2HFGL 2FJSA 3IAPA 1O6VA 4RRPM 2VSMB 1JF1B 1TYJA 3F83A 3MV01 3FFCB 5AKSA 1RMFH 3QXAB 5FUZL 1TJGH 2WKLA 1CI3M 1KZQA 1FPTH 4S0SD 4OD2A 2YD8A 4HGWB 3TT1H 2CU9A 5BV7C 1PAMA 1X5FA 5I74B 1FN4A 5A3IC 2XJKA 2YBRB 3F7VB 1MFVA 3L54A 2EDMA 3B9VA 4XMWA 3SKJL 3UJJL 3ZQXA 2VDRH 2DQIH 1OLLA 5KVDH 4BK5A 2CKBA 1XZ0B 3BWUC 1YJDH 5DUMH 3HN5A 5D8JH 5JHDD 1FFQA 1OARL 5BZWA 3C5JA 3CFKB 4XCYB 5KUKA 5F7EH 1P7QB 1DQIA 1V54B 3Q6FB 4NWUL 4XP1L 1N4XH 2WHVA 3EH5B 3F58L 4NN7B 4P0DA 5HPMA 1A4BA 1KXVC 1J86A 2KUTA 3GIVB 1OXYA 1YO4A 43CAB 1TG8A 1KTLA 1N8OE 3QH3A 3ZKXB 5T3XD 4PTUB 2ZWKA 4X5XB 3QDJD 2C9SA 3QCVH 4AK2A 5ANMA 1J8SA 2F7PA 2Q2LA 2FWUA 3EKCA 2AK1L 5JHAA 1MWAA 5DS2A 2XQBL 2IANE 1ZXQA 2NR6A 3MRFB 4MMXA 5EZJB 5GGQH 1BLNB 4LOVA 5K9QG 2WYZA 3B8SA 3KPPB 4Q0XL 3KAAA 1X9RA 2BRRH 5LXVA 3FYIB 3IFNL 1QRNE 4JFOA 1KB5L 1OWWA 1I3VA 4WFGD 1ACYL 3H3BC 3LN9A 2AXFA 2GI0A 3PDDA 5A3ID 3A67H 3RVXD 1I8KB 3CU1A 2RACA 3SDXF 2WV3A 5BRQA 1AQDA 2HKHL 4WTZG 4XMKH 4BGDA 3CFCL 5HHXL 1HEZB 5T3XH 3PABA 4FQIH 2BVUA 2MQ3A 5F7HA 5IG7A 1F4XL 4PCKA 1XSJA 1KJVB 5C2UB 1W15A 2ARWA 3NEOA 3QQDA 4QRTA 3UMNA 2V9UA 4P5KB 5DHMC 3ZT6A 3C5XA 1GYCA 4X6DB 1OO2A 1TZGH 3BWZA 1TTUA 2JB5L 5EN3A 5J9PB 2VYRE 1ZVYA 3KYKH 3P11H 5E8OA 1QYGL 1WFUA 4GUPB 4GEJA 3RY6C 1N0XL 4HK0A 3RFZC 2ICWI 1NCCH 5D1QC 3OHMB 4HJGA 3WO4C 1H6UA 4G8GD 4XP4L 2XXFA 3FONA 1EQWA 3C8KA 5BXFA 3Q5TA 3SQBB 4DP8X 1DFBL 1K8DB 4DUXA 2IPKA 4EQ2A 1NEZB 4QWWC 3VGFA 5GHWL 2K70A 1MJUH 3AS2A 4PJIB 3S3BB 4PLKD 1MSPA 5D96B 2JXMA 3T0EE 3LQAH 2G0KA 5D2LB 4BFIA 4GAGH 3UBXB 4WI2A 5CILH 1JXDA 2WXFA 1C8PA 3G5YA 3ILPA 2J8UE 2VGLM 3ETTA 1V7NH 4DN3L 3HHSA 1U92A 2O5ZH 3H7BB 2CGRL 5GGUA 5CJXA 3ESOA 4AQ1B 3MJ8B 5CM1A 2HKFH 5KYYB 5ERWA 1MN4A 1TF4A 3RGVA 4MXVE 3U4EB 2R83A 2OMXA 1AQMA 2IDTA 1HHHB 4RMRA 4JEGB 2ESVA 3HI6H 4XPFH 3ZL4L 3Q44A 5KYXB 3VG9C 3K6SA 5BRZA 3SDXE 2AZUA 4G9FB 4JDEB 4Z0XA 1U21A 3P1VA 1MFAH 3OKDA 2W07B 1MRFH 5D1QD 5TE4H 3L3OC 2WXHA 1INDH 2K4WA 5C8JB 2IFFH 1FNSH 1Q1JH 1VPOH 3H3PH 2OMZA 4Z7UB 3BO8A 5JYMA 1FO0B 2MCAA 2CIIB 1MCNA 3RX5A 3DV6A 4GT7A 1F56A 2FHBA 2H3XC 2XWXA 3DURB 1ASQA 1P0SE 2W0FA 1DVXA 3FO9A 4H2AA 4OB5H 2I24N 1RUQL 5JIQA 4Y0GA 1KELL 3JTSB 2A6IA 1CC3A 5DUJA 1U3HC 4WENB 1T0NB 2IEPA 3O4LA 1SXZA 3E2HB 4GKSA 3HI5H 4X4XA 5L0QC 3ZE2E 2XLLA 1DVZA 1RULL 4PHZA 4UDTB 4N8CL 1AZZC 4YHLH 3DSNB 3CN3A 4ZUSB 4LGPB 3E6FA 4M7ZB 1WF5A 5AVRB 3V5KA 1CFQB 3QCTL 1UQSA 4JQIA 2BFVL 4ZMXA 3DO3A 5IV2B 3RJOA 1BQUA 1QBLL 4NN6B 2MWCA 5DQJB 4IK7A 2C9RA 4F9PA 5G4MA 5AW1B 1IEAB 1SN0A 4FNLH 1GY1A 2V0AA 3NIGB 1FL5B 3GC3A 3PP3K 4QIRA 4D3CL 2XVBA 3QRFM 3QPKA 2WWMC 3FTSA 5ECGA 4YDLC 3WLWC 3G5WA 2UZYB 1E5AA 3ILQD 4FQCL 3RWCB 4LOUC 3NFSL 3E9UA 3LB6C 3UTQA 3NJXA 5FYJD 3DUHA 2AJ3B 2KMWA 3FAXA 1AD9A 1D5BB 1L9QA 1S5HA 2KT6A 3NEXA 1I8MB 2YAQA 5C0BA 3QORB 1GY2A 2L0DA 2W95A 1I9IL 3RNKB 1JF5A 4MDIA 4N25A 2KPWA 2Y0SA 5FUCE 4X8JB 1MCPH 1OAZH 1U3HD 3ELQA 3MRKA 5E2WL 5AZ2H 3IU4H 1RJCA 3OKEB 1P84K 1OP9A 4X7SH 1JBJA 5CJOL 3VVVA 3TH3T 1MQ8A 5DMJB 1IM3B 4XCNB 1IQDB 1OPGL 4U2ZA 2EVIA 2WUCH 4WW2C 1PLBA 1UENA 5FYJH 1XX9C 5DHYA 1LXMA 1I9RH 3VXME 4LSVH 5HP5A 4Y7OC 5JIKA 2VWEC 5KJRH 1TZIA 2BSTB 3D0AA 1K5NA 3DXAD 1A14H 3TPUB 1KDIA 2BWIA 1D5XB 3CLEH 5CLWA 2R7EA 3HMWL 4UQDA 3LB6D 2FE0A 4Y4HA 1T83A 2F5BL 4Q97A 4DQOH 4RQQB 2ZX9A 1FYTB 3BMVA 4UT9L 4E0RA 2CG9X 3NJFA 1MAKA 1NBCA 3RL1A 3TIDB 5EIQA 4X9FA 3ZBMA 5I0DA 1GZQA 1T80A 2WYHA 4OCWH 4JHWL 4N90D 1I8IA 2WLYA 4LGSB 4YX2L 4I18C 1R5IB 2ZSWA 1CGWA 4UTBH 4L8DA 2FGWH 4UCFA 3VA2C 1JWUA 4LCUB 4N8PA 4PJHE 4JHAH 1FZOB 2IPUG 1HNFA 2VLKE 4NZUH 4DO5A 4CW1A 1ZCRA 3FCTA 1J48A 1SN2A 2BSSB 5IUCA 2FEJA 4JFDA 4MJ4A 3VFMA 1FG2A 5C0CA 2HT2C 4MA8L 2OXGB 1W8EA 2MJWA 3CFDA 3U9PH 2ZCHH 1H5BC 1P4IH 5EU3A 1G1OA 3LSOA 2PW2A 1FCGA 5DFWH 1KCLA 4F24A 4P2OD 1MFBH 4H5SB 4KZEL 3H0TA 4JY5H 1RK1B 3KXFE 1TSRA 1J11A 2XWBB 1PD1A 4AQ8A 3FHQA 3VG0H 2VO8A 2BWQA 3GEFA 1QLEH 4LF3B 5I1HH 4JRXA 4Y19E 1X9UA 1KLUB 1JAEA 3H42L 2RMNA 5JO5B 3ZMNA 4CVZA 4P5TC 3IJYA 2XOTA 1DCEA 4ODUA 3DOSB 3EFDH 2MNUA 1DBMH 2Q6WB 3RY4A 3VI3F 3C60D 1JOIA 2JSFA 3NAAH 2OMYB 5BOZG 3VFNA 2NT0A 4Y16D 2AJSL 1V3LA 2IWKA 2LTQC 5L6YH 1QFPA 5F1SA 1WGVA 3BP6B 4CKQA 4LSSH 5MI0C 2BSDA 3C09C 2E9JA 4J3SA 3QJVB 2XN1A 3BDXA 4FERA 5LO7A 4PJ7B 1BQRA 2BNRA 2F19H 4XNXL 4OZGF 3EXLA 5EDSA 1RD6A 4N1HB 5DJCA 3SGKA 4M6AA 4PJ5A 2HLAA 1EEUA 2OV0A 4XO5A 4DKEH 4NKDA 2VM9A 2HFFB 5F7NC 4OFDA 3B9KB 2OL3B 2F0CA 3IXAB 2BM3A 1WTLA 1PY4A 3GHPA 3UBXG 1P7BA 1HESA 3ARED 4FC3E 1P5VB 3EYFB 1R5WB 1LILA 4MS6A 4RRPG 3X14A 4KVPA 5JOFB 3FSVA 3FOLA 1J0YA 1VKXA 2PPDA 3PWPB 3B3IA 3D9AL 2WXNA 2ZX8A 3PU7A 1C7SA 1T7VA 3ULVC 1NAMH 4J3OF 3KDMB 1A8JH 2H9GA 2ITDA 2XBZA 1R0AH 4P5TD 5K33A 4DP1X 4EIGB 1IFHH 1U58B 1YEHL 3LPOA 4POYA 1KB5A 1N12A 4PRHA 3ZE0E 3HRZB 5F7DA 3EO1A 3I9GH 3GSUA 4YGAB 1A1OA 5DEGB 3WENA 5C9KA 2R1YB 5KZCB 1JRHL 4GP4B 5DF0A 5DC2A 2VMJA 3HBPA 2XX0A 1AXSA 3I02B 4LASL 1BQHB 4QHMB 4TUOB 3BKJL 5CU9A 4HOMA 1HDMB 2FUTA 3TP4A 5I6KA 1LE9B 3FTGA 3JZ7A 2X89A 4FQ2L 1LO5A 2OMTB 5AVZB 1AGFA 1F5WA 1GHFL 5FYKU 2I27N 1PZUB 3GFUA 4JZJA 4PJDE 4FP8L 3SDYH 4YHZL 2XTJD 4ORGA 2VDOL 4HJ0C 1JCKA 3O9WC 3Q9PA 5JXAL 4JDVA 5GZND 1G9ML 4GRWF 3NCWA 3HHRB 1MF2H 3AMKA 3ZL2A 3CFTA 4ICXA 4NZRL 4JK0D 2IBGA 4JCWA 2VDMH 4XNZC 3HA0A 2R69H 2X4RB 3ULVD 2VUYA 5F88B 1LK3L 4D0BB 3ALPA 4ZTEA 1KGCD 1ITBB 3COOA 3CFJB 2GK0B 2YMXH 1PKQB 1I85A 2ADJA 3QQ4B 4P4KA 4QHLA 5DWUH 4QRPA 2EZ0C 3K8KA 4I3RH 3LZFL 5D4JA 5D93C 2NY6B 3KYNA 4RGOH 1CL7H 1S7QA 1JG9A 3HCVB 4MBRA 2IDSA 4J3TA 4I1RA 5D7JB 2EXWC 1N7MH 1AS7A 1WCBA 1G7QB 3KGUA 3WTYA 2AJZA 1Z1WA 4G83A 1MIEH 4XMUA 5I15L 2UZIL 1KFAL 1KBGL 4NENA 1AQHA 3BPLB 4LMQI 5C09A 3CX5J 3ULVH 3HFFA 3LS4H 1X5MA 5ITBH 4LGRB 4YXKL 3CX2A 1QG3A 4GAYB 4XMPH 1X5HA 3O9WD 4Y5VC 5T1DL 2X4UB 1QLRA 5FKPA 4AENB 3Q8BA 4PGCA 4OM0L 3HC4L 1QNZL 4L4VD 4KUZL 2YXWA 3KS0H 4LPTA 1ZLEA 4K8RD 4Y5YB 3T5WA 5LAPA 4AYID 4QHUB 1E30A 3C5SA 2NLJA 5EU5B 4E42B 5D7IB 3P9WB 3ZTNH 2JLPA 3WTWA 3GPSA 3LS5L 4GLRI 5BVJB 5MEQB 4Z7OB 1Q0YH 1PY9A 5HBBA 1EEYB 3QR0A 4LSTL 3RG1C 4M43H 1JPGA 2C3XA 3GWJA 4YSRA 3DX1A 2WLNA 3EUDA 2MQCA 1OAKH 2OBGA 4L4TA 3AXLA 1NFDB 2C1OB 3DYOA 3GD1C 3IDIA 5DJAB 4N8VA 5CFAA 4BIKA 4FQXD 4N2DA 4U1LA 1BVLA 1CDYA 1MKFA 2BCKB 3W9EB 5IEKA 1CK0H 1TQCB 1FSKB 3VD4A 3A23A 4YUEL 4K8RH 3MXWH 2VDLB 4AIZB 2OZ4H 2DI8A 5ISZD 5C07E 1DEDA 1ZGLP 5A6MA 3IRCA 5FC9A 1KENH 2XZAL 4ZMLA 5G5DB 3UPCA 4XP9L 2H26B 1NPUA 1FGVL 1U36A 2XWJB 3I75A 1BYNA 2UXTA 3D34A 1EPFA 1U8OA 4PV9A 3HMXH 4WJ5B 3VI4E 4AGOA 4E5XB 1XF5B 2BIPA 2FEEL 2WNWA 4M6OL 1I3GL 4HIIA 2EDKA 1DZ0A 1SOQA 3O6FC 5BZXA 4HAKA 4P2QD 5CGBA 1DQVA 4RAVA 2WLJA 4W9LC 5JPMB 2H0PA 4U3CA 3CSTA 2ENQA 5GGRY 5TTRA 4EUPB 1NGQH 4UMGA 4MA1B 4FYQA 1EAPB 1P7QD 2ERJC 5DXWA 4K3DL 1OGTB 2VR5A 3MJGX 1H19A 1YDPB 3RJDA 2P5ED 2EDEA 4OT1L 4B50A 1LDPL 3KLLA 3DRTA 4P99A 4XMXA 2ZCLH 3HIZA 5JOPD 4LEOB 2EIEA 3W39A 1ZLWK 4DVBA 1ETA1 1X6NA 5D71L 4FFYL 3JQOB 4W6XB 1DQLL 2Q20A 2VLRE 3TVMA 4OGYH 3KLAA 4Q6KA 3BSZA 1P4UA 2VJ0A 2BSBA 3C5ZA 1RSYA 2XN9D 5AW7B 2DWSA 1G7LA 2WW8A 4QT5B 4R5VA 5JQ6L 2XV6B 4DWHA 4E9VA 3KR3H 5HI4D 3QJOA 3QAQA 5EO1B 1GGBH 4TNFA 4AQAB 3KMDA 3WIIL 1RZ8B 2XKUA 3NCCB 3VXTA 2DYPB 4Z77B 3BCFA 3NJKA 5BS0E 1QZ1A 2VH5L 3BAXA 3HE6B 4MNGE 5SWSB 4YDZA 3MO1B 4NC2B 5CUSL 2R1WA 1GR7A 2JJTC 3HI1A 4DF9A 5GISH 3P2TA 1YN7B 4ZPVB 4D0DA 1S7TB 4QXTA 3PDOB 1XH1A 3U83A 4YLCA 4ABQA 1S7SB 1VHPA 3NSJA 2C3VA 2LFGA 4PJXB 1J5OL 2FAUA 3R18A 3OLIA 4NHCH 4HZLA 1BYPA 5I71C 1KF9B 4Z7VB 5FO8B 1OSEA 3T6QC 1X5XA 2NNAB 2BW5A 4K94H 4FTVB 4P46B 4TOYL 5BQ7B 2EVJA 4DUWA 1AGDA 1ZS8A 2JVUA 2K3HA 4H1LB 4OSUH 3O0LA 1HILB 2VW6A 3EOTH 4UQ9A 3VXUD 3E8VA 5E7BA 4UOW0 4CAGA 1SEQL 4F7EA 4JDTH 2R27A 1AD0B 1X5AA 2DBLL 2OM5A 4HC1H 1FDLH 2B0SH 4HSQA 1U8JA 5F1KC 2X3CA 2HP4A 2B16A 1KJ2L 4ABWA 5GRUH 4Q9QH 3MCKB 1DBBH 2YWZA 4KO9A 4LCYA 4MAUH 3OX8B 3N1QC 1V10A 5ILTH 5IM7A 1T0PB 3IBEA 4H8VA 3VXSE 3OKNA 4UOW1 2CLRA 4IHOA 1KTRL 3DROA 1TT6A 1YNKH 1H0DA 5FK9A 4EI5B 2JCCE 4Q89A 2VKWA 4UQ2B 1KT2A 3JV6B 3ISRA 1E4KC 1T66C 1Z9PA 4GSDH 4X6FA 3TWCH 2J1XA 2CR6A 4Z78A 5I6XB 2X6CA 3GHEH 5KW9H 2WCPA 5EO0B 1AAJA 3GBLA 3U36A 2GTWA 4DCQB 5FECA 3S8WA 3TURA 5H37A 4ZFZA 2J2ZA 3T3PF 4XMTA 1MFMA 5HGHA 1PS3A 1LGVA 4PMFA 4APXA 5I1CL 3IVKB 4A6YH 2MCPL 4Z76B 1BX2B 1XF3B 2FJFA 1NAKL 3G6JB 4OLUL 3RKDC 2JNZA 3WJLC 4BH7B 4JFPB 5CKGA 3D12B 3H55A 4RGNC 1LEGA 1VERA 3EDJA 5AWNH 4G9FD 3GMNB 1F18A 1HCVA 1G4RA 1HEJC 3KPTA 1BZEA 1W2KT 4WY7L 3SDDB 1TYRA 4L48A 2WBWB 1GH7A 1VRSA 3S88L 2QKSA 5AZUA 3AQDA 1J1OH 1D5IL 1AKJA 3SE3C 1Q94B 1FFRA 3DGGB 2ZZUT 3CC5B 2QMJA 4NT6A 4JJ5A 5E4AA 3SE6A 1JZ7A 2DLTA 3US1A 1BVKB 2PYEB 2DL2A 5JMRA 2B1HH 43C9B 4OM1H 1CGXA 3F6IA 2Z4TA 3ZO9A 2I9LA 1B4TA 2DQ6A 2HG0A 1TJXA 5SX4I 4NAMA 4AIXA 5DQDH 5INDB 4PRIE 4AMKL 5EZPA 5EWIL 5AW8B 2E59A 2XBDA 2N1KA 3BT0A 3HZMB 5D1XC 1EYUA 1FLRL 2JQZA 1FO0H 1XF4A 3LKNA 1MIML 3VGGA 4L3EA 3HG1A 3ARBB 3HZVA 2G4EA 1NTDA 5AW4B 4FZEL 2AEWA 1TQVA 1WWBX 3M46A 2Y7QA 2IV9A 3GUFA 3KPNB 4Y4KC 5C3TA 5D1QE 5FYJU 1GGUA 1F6AA 5IMOB 2PTTA 2V5TA 3DWTA 1BOGA 4GO6B 1UWEL 3O6KH 1J1PL 3KHQA 4WK2B 3VB8A 3GI9L 3VFRB 3GS4A 4PBVC 4CKVX 1HQRA 4EN3B 5AVQB 5BZZA 2KL6A 4GSUA 3QORD 1AO7E 5C08B 2YPKB 1HXKA 3GSRA 2OSLB 5D9SB 3FNKA 5L9DL 3N41F 1IAKB 4JB9H 3L2NA 3KPSB 3QDMD 4XPHH 3TH4T 1HL5A 1SEBB 3M86A 4G6FD 4JRYB 3KH4A 1AYRA 1CUOA 1Z3GL 1FZJA 1VGEL 4ELKB 4IEFB 2JQAA 2A6JA 5JA9A 4HIXH 5HYEA 3Q01A 4M5YL 2R8SL 4RFNB 1G9HA 4BCZA 4CNIB 5C0AA 4C83B 4AH2A 1V7MH 3RGHA 2P4AB 3QI9C 1MLCA 2VKXA 5D1XD 2B4CC 3FN0L 1HC1A 3VYNA 4PG2C 2EIJB 5HDRA 1RJYB 4E9QA 3HAEA 1NC2D 4Z7WE 4TLKA 5B1KA 3VFPB 3BVDB 2DDQH 2IGFH 5SWZA 2APBA 1A6WH 2CHNA 4E9TA 4Y4KD 3FTWA 5E0QA 3QIWB 1UZ8A 5F7AA 4YIQA 4KO6A 3BDYL 3I50H 1FYTD 4OCRH 2EILB 4WNJA 1F3JA 2WB1A 3STBA 4A7SA 4YK4C 1QX1A 3B83A 2G75A 4OFVA 1TLKA 2JJWA 2ZNXA 2BZCA 1WP6A 1WZLA 4UBDC 1NCBL 2E74C 5FM8A 2AEQL 4NRZA 4LVEA 2VQ1B 4GB9A 4ZOAA 1IGIL 4LU5L 1JYNA 2J71A 3I3BA 3QEQB 1NUFA 3MOAH 5I1EH 5IROD 3BRFA 1D5ZB 4M93C 5E8DH 5IQ7H 4GG6E 3LD8B 4HH9A 2HH0H 3BVVA 1LLAA 1AVAA 2VXUH 2XZQH 4CVUA 1HH6B 5BUGA 1QWNA 5JW5A 2WSPA 1VFBB 4YHYC 1TNNA 2UXVA 4N9GA 4TUKL 5ACMA 5FYKL 2HUHA 5DVMA 5C9JA 2FX7H 4FYRA 1TKWB 4CVXB 2EDNA 4FYSA 3W0WA 3SQOH 2YQ3A 2B9BA 4JPIA 3QI9D 4MNHA 3UYRH 3QIBC 3P4MB 3HNSH 1RFDL 4LRIA 4MNQA 4OJFL 1LYQA 1AXTH 4XB7A 4FQJH 3THMH 5TH2B 1KCUL 4N24A 1ADWA 1DLHB 4AM0B 2EEXA 2P48B 4O02B 2A5UA 2M8XA 4BRVA 4KZDH 2EO9A 1N6QH 4TVSa 2GBUA 4D9LL 1B0RB 1ACCA 1WJ3A 2FIRT 4IRSB 2WNGA 4JE4B 2Y1YA 2N59A 5IB3B 1HWGB 4L8SA 3N44F 1WQVT 4HFWB 3AT8A 1J8RA 3NFNB 4AYGA 1BQLL 3NCXA 3GJEA 3HKZA 4LLYA 3WE6B 4H1LG 2IPTL 4HHGA 1MFDL 2GHZA 4JQXA 4M48H 2PO6C 3L4VA 4UBDD 1JDCA 4WW1B 1ACXA 2O93L 5D7EA 1M53A 2GSIB 2NW2A 4KK6C 3FQ4A 1JHTA 2E9WA 3MJWA 5JIPA 2WVTA 1CFSA 4G7VH 3IPEA 1QASA 1KYFA 5DK2A 4QOKD 3C2SA 4HT1H 5CR8A 1OM3L 1MCLA 2K78A 4UB0L 2R4SL 2R9HC 3QUXB 4DP4X 5CGTA 3VAEA 1U91B 3PXHA 1UH3A 3B9KD 1DBAH 4FFYA 1PZDA 2D9CA 1Y07A 5KVEE 3KCWA 3WFEL 3QIBD 1OHQA 3OLDA 3QQ9C 2V9RA 1WG3A 1HVXA 5CSZB 5LGKA 3NDYE 3FSAA 2AABH 1X5YA 3CUPB 4Y1AE 3F64A 3HBQA 1J12A 2J57A 5C1MB 5I5RA 5B39B 1RMFL 4LLVB 1TJGL 1JI1A 1I3RA 1TOXA 3L3JB 4GQPH 1FPTL 2XPZA 3BIAX 1U9KA 3QDGD 4W4NA 5CF3A 5ECJE 4A2FA 2NNCA 5IBLC 1Q72H 5DVLA 2F1EA 3KL5A 3UC0H 4HBCH 2VDRL 4WFFE 1DBJL 4F7TB 5EH1A 3A21A 2BX5A 3IE4A 4PH8A 1E9OB 3FQNB 1S9YB 4KK6D 5DUML 5F0PB 1OTTD 1JYWA 2FWSA 3H1ZA 4IYKA 1QFWI 2YARA 3REWB 5D2NB 3NA9H 3VX1A 2H4EA 5F7EL 2WXKA 1A3ZA 1WDAA 5DZ9A 1BIIB 2Y69B 3FU0A 1N4XL 4JFYA 5J13C 3VQLA 1PIFA 32C2B 3MBXL 1RUMH 2AQSA 1FBIH 4Z7NF 3HUJA 1AHWB 3TBCA 4OH2A 3LRMA 4NN5B 4OZHB 1C8QA 3QCVL 4OCXH 2V7HA 1RERA 3QQ9D 5F9WC 4WHTA 3HZKA 4BKTC 4CMMB 5B4MC 2FJUB 5JUEL 2OR8A 1KJ2A 3QUZB 4KKCD 1NCIA 3OXRB 2PNDA 1OTSC 2W88A 4PJFA 2A6DA 2V7NA 3JV4B 3ARGA 3C8HA 4GUOA 2VXSH 2ZUXA 4Q7DA 2BRRL 1N64H 1WC7A 1QFWM 3KCPB 1MW0A 3SPVA 1ROCA 3QULA 1NGPH 1K2DA 6FABL 5D6CB 4WI5A 3W3BA 1DVSA 2R0LH 1NFAA 4KI5D 4S1RH 2XV0A 1OANA 4XMKL 1QSFD 2WIIA 5DUBB 1Q9WA 3MTRA 5T3XL 3WJJC 2BIQA 5IW1A 35C8H 3MACH 8PAZA 2ITCA 4B53A 1XXFC 4ZUTA 3C8DA 4IKJA 5C09E 3RVUC 4BH8A 3LEXA 3QUMB 4MJIB 4BSVA 1BF2A 5LGJA 4UIMB 3BUIA 3BPOB 1MHHA 3BLPX 3W2DH 5L4FA 1SPDA 1UYWL 3O6MH 3KYKL 1Q90A 3P11L 1HT6A 3PUUA 1QI4A 5TPWH 1NCCL 1RU9H 1KPUB 1A4KA 1JV5A 3T9WA 1JWSB 4JM2C 1UVQA 4JDZB 1JHKL 4EEEA 5B4MD 4G7YH 4PWKA 1W91A 1X6LA 4GRLA 1VFOA 1YCSA 2CUAA 1Y6NR 3QO0A 1M1SA 1JWMB 2ZPKL 3F5WB 1TU2B 4PRBA 4YR6B 2ZOLB 1MJUL 5LHDA 1UT1A 3BPCB 4JAMB 2BSEA 1CJYA 4J6IA 5F9JB 5HJGA 1KCRH 3LQAL 5CILL 4ZAKC 5H2BB 4MFHA 1S7XB 3R1GH 5GGSA 2ORBH 3EOBA 2ZXWB 3EFFA 1V7NL 2BVPB 2DL9A 3HN8A 2HKFL 4YSAA 5DJ2A 1GS8A 4AMWA 3SYQA 1CS6A 4R3SB 3HI6L 3MUUA 1DJZA 4HUXB 2XFXB 1MPAH 1TETH 1GJUA 3FT0A 3RJQB 4Y8DC 4POZD 4TSCH 1HKLH 4X7CC 2D4FA 2CUIA 2OK0H 2D7QA 3ZPDA 3VRIB 3X1EA 3HC3H 1MFAL 2YAMA 4WHCA 5E6RB 1BJ8A 4MQXD 1NDTA 4RGMB 1MRFL 2QFPA 5TE4L 2EH7H 5EUOB 1JNHB 1INDL 4JM2D 2H47C 2IFFL 3OM3B 1FNSL 1LMIA 3H3PL 4WEBH 5CHNA 4DK6A 1HH9A 3IS0X 1KSRA 3U6RA 5CNHA 1TZ8A 3MA7A 4WWOA 4HS6B 1FHNA 1K3IA 4H8WH 3WNIA 1ORQB 1TCMA 3IB4A 3ME0B 2HFEA 2VM3A 3IDJA 2QKIC 2DTML 1XGRB 4DIXA 4L9LC 3RU8H 4PRDA 5F0JB 4JY6A 3TEYA 3FO1A 4FDWA 4Y5XC 5BCAA 3DX0A 5IVZA 3EYUL 2O72A 5HHNB 3DPBB 4M8QB 3K91A 3IGUA 1JIBA 4EPSA 4G80A 1IJNA 3SOBH 1BZ9B 3LXBA 3QNXB 2OULB 4A7VA 4HU8A 3HS0B 1JZEA 3NCMA 4LEXL 4P5MA 4X2UA 4YGVA 3PWNA 1HHKB 3QR2A 1FUNA 4XAKD 5MEOA 2OSYA 2ADIA 2Q7YA 1KCWA 3VD1A 4FNLL 2J5LB 3VGEA 1H9DA 4C47A 3CBJB 3C6LA 4EUPH 1Z5LA 5FGBA 2DYPD 3KBHE 4Z9KB 4ANWA 3V6FA 1N2RB 3F2LA 3VWKB 3GSWA 2V6HA 5E94A 1Z0NA 4FN0A 1YPZA 3ARQA 3T1FA 4XP5H 1HE8A 1NLBH 2MEJB 1MJ8H 4NQCA 3M8OH 2MFNA 5CFHA 4X99A 5I8KH 4IOSA 2VIRA 5JTWA 4LFHG 3S34L 2E9IA 4E9RA 4A38A 1YMMB 5KVFH 5DJDA 4AY0A 5CLZA 2PXYC 2R29A 1BHGA 4KDTA 4P4RB 5AZ2L 1OAZL 2CD0A 3IU4L 2VXTL 2R1XB 4FQHA 4FTVD 4ENED 4F37K 4RA3A 3NH7L 2CR3A 4PRPA 1T1WA 2Z0BA 3L3KB 3Q2WA 1Q0XH 2BNQE 2XXGA 5CS7A 5HY9A 1P4BL 5F0MB 2XIIA 5I17A 5D7SH 2WUCL 3HS8A 3WMQA 2PYFA 5HVGB 5EO9B 2PP7A 3V0FA 2H2SC 1GAFH 4PJ8A 2JMRA 2L4OA 1TJIH 3GXUB 3KW8A 4MA3A 2A6KA 3KL0A 2NXZC 2AQPA 2UYLA 3L5JA 5KJRL 4BDVB 4G1EB 4WNQA 2X0UA 4Q6IB 4K2UH 3O6LL 1KN4L 2L7JA 3I6LE 4JUTA 4QRQB 4B95C 3BZ5A 3APDA 3L9RA 3UTZB 4FAAB 2DPKA 3TBVA 4OZGB 4DGIL 4MDRA 4DQOL 1IE4A 1LO2H 3OLEA 3KJ6H 2IAMC 4EZMA 2N0KA 4H1LH 1I9JH 1Q9KB 2JB6A 3ZN6A 1WAEA 5I1KL 2VISA 4RMBA 4WUUA 4CGUB 3O41A 4OFYD 4OCWL 5FS5A 2CIKB 4PR5B 4RFEA 3IEAA 2PXYD 4ZDHA 4CN1A 2FGWL 2K9UA 2BRQA 3L4WA 4PUBH 2CGZA 4JHAL 5EPMB 1ZLVH 4CRPA 4NZUL 3FQWB 3LXAA 3ATBA 4QJ5B 2FT7A 4HIJB 5I76A 5JORB 5DD3L 4KAQL 3MV7B 3OSVA 5MENB 4NQQA 2VZVA 3MGOA 4NNPL 4QYOA 1C12B 3EOAB 3O3UN 5KUMA 1IKNA 1JHLH 4R90L 3U9PL 5IHLB 4QRFA 2WBJB 3QXDB 1BAGA 1MFBL 5JW4Q 4P5RA 2CRIA 1GC1H 3PV7A 3WXWH 1DDTA 4JY5L 4PGBA 1OAQH 4HPOL 5IVXA 2H2SD 4J27A 3SPIA 2CQVA 5LN4A 4IGBB 1PZ5B 3HB3C 2OMWA 3RWDB 4YZWA 2EACA 2APTA 3IAQA 3AT9A 4GLRH 3H9SA 3VG0L 2CO6B 1M2OA 4IDJH 1J5CA 3QJUB 3RWJA 3V79C 5IB5B 1FIEA 3ZR6A 5I1HL 1C08A 5HHOE 2KQNA 4PN6A 4JREC 1DTUA 2YN5A 1GVIA 2K6WA 3VYOA 5FGCB 2EH8L 4FHJA 2DM7A 2YKLH 2Q1EA 3RVTD 1E6OH 1DJIA 3CVHB 1MCHA 1U3ZA 2IAMD 3N40F 3QAZB 5DLLA 3UTTB 4EXKA 1IAIM 1W0VB 1YZZA 3UZEA 2EYRA 3FUKA 5HHQB 1KGJA 4ZW3A 4N22A 1KFGA 4GRWB 3AU1B 3U7WH 5I6NA 5L6YL 3T4AA 4R84A 5JW4N 5AW0B 1DO6A 5IB1A 4LSSL 3UMTA 1SXNA 3HVDA 3RL2A 1QA9A 1VFUA 4DK5A 3ULSB 4R4FH 3H54A 4IBWA 4TTDD 2F19L 2WXIA 3K6FA 3KWUA 3BXNA 4KGLA 4XN5A 1U41A 4LCIH 3TJHC 2FBJH 5AKTA 1JS4A 2RBLA 4GKZB 4K23H 3BD5A 5C86A 2ZTBA 2MKLC 3PIQA 4DKEL 3D2TA 1YNLH 2WN3A 3GSNA 4G11A 2FB4H 1UACL 1RXLA 2NX5D 1N6UA 2KLSA 4OD2B 2OZNA 4Q14A 5PAZA 1PZAA 2GT9A 4EN3D 4GRMB 3MNZB 3HB3D 2A74A 4YHIA 4NQDD 5DJ8B 3F7QA 3B5HA 3FS9A 3IETA 2XWDA 3MHZA 2EE9A 4LSDA 2BPBA 1Q4NX 5ESAA 2CKBB 3PNRB 3Q2NA 3G7TA 4AE1A 1NAML 5JHDA 4G8FA 1TFHA 3FU7A 5D4HA 1IFHL 1CBVL 5C7XH 4HD5A 1KIQA 5CJ8A 4G70B 1MEXH 3FT4A 1F6LL 4FLQA 5E6IA 2A73A 1ML0A 4YBHA 2IQ9L 4ZS6D 2VERN 4MD4A 3GBMH 5C0FB 4PRAA 2EDWA 3WUWA 1GMEA 1DLFH 1G0XA 2C4FT 1WFTA 3V6BR 3IJHA 4JO4H 4S2SA 2ZF8A 4RGNE 3WEMA 4XVUD 1I8UA 5ANMB 1YEIH 1DN0A 1NPJA 1BMGA 3EYOA 4F37F 4UQBA 1YQVH 1NCAH 2Y7OA 2B2XH 3TJHD 2R0KH 4MMXB 1AP2A 3SDYL 3WE1A 1PX3A 4CSTA 2HVKA 2GJ6B 1BD2B 5I16B 1M05B 3LPGA 3DX3A 1BA9A 4BWUA 3BT2H 4ZBJA 4UTAL 5JMOC 3QUYD 4JUSA 1MWOA 1EEZA 1P1ZA 4D9QE 1CWVA 3GMLA 3M17A 3WUZA 3QDME 1E9PB 3DX8A 3IGFA 2VDML 1ODUA 3QEQD 1GTNA 1A7NH 4ZX6A 2R69L 1WIOA 3PABB 4IJ3C 5IG7B 1EZVY 3MBED 2B1AH 1HXYA 3IPBA 4BK8A 4F5CA 3QQDB 4AG4H 4EIBA 3L48A 4M5ZH 3QUKA 1F0OA 2YMXL 4BHUA 1DDHB 2IG2H 5LBGA 4NHUA 3JWDL 5DWUL 1G43A 1S5IH 4DOHE 1BLIA 5D1XE 1DVFD 1XZWA 2YMOA 3S35H 3A4EA 4J8QA 5E8OB 3JV5A 4RGOL 4LQFL 4HK0B 5TQ0H 3NCYS 3QP3A 2LVCA 5LXGH 2X1WL 3NJMA 1N7ML 4M4RA 5DS1A 1RZIA 4XZUB 1C5BH 4G8GA 2UVEA 5K59E 3VM7A 4G42A 5CCJA 1F41A 1U93A 5G2NA 4PRNA 2I07B 4QF1B 3N1GC 2Z7ZA 1BEYL 4G6ML 3NZHH 3DX4A 1P84J 2IPKB 3LS4L 4HS3A 4OJAA 1MJJA 2FVNA 4S0HA 4HKJA 4XMPL 2ZJSH 4QKTA 2Y22A 1JP5A 1CU4H 3SBWC 3V6OC 2JXMB 1WS8A 4PYHA 3HUJF 5T33L 5E1AA 1MCKA 1GCFA 3SGJC 5JPNC 3K2UH 2GJZA 3LPFA 4U1HB 1H6TA 1CXIA 2QR0B 4LVOC 1QQDA 1ETZA 3QWOB 4MD0A 2PR4H 3EJYC 3LQZB 4ODWB 1M6OA 1U92B 2FJGB 3NACH 3U9WA 1OGAB 4QRRD 3AQZA 2KC0A 3AU0A 4ZO6A 1FWXA 1QP1A 4M7JH 4N3UA 5DMIH 5ERWB 1JZ3A 4PJFF 4TQ8A 4O02H 1QR1B 3SJVE 4XVJH 5AW6B 4F57H 3QUXD 4GIAA 3BQUC 3RDJA 3SE9H 1OAKL 5E8PA 4IOIB 3ZSTA 2WSDA 3K6SB 5BRZB 4LFHD 5L8JB 5KANI 3HG3A 3BKYL 3ZKND 2BIOA 3RGBA 3CFIC 4WKXA 1JPFA 5F89A 4Z0XB 4ZOBA 1PLGL 4IBTA 5GS0C 1NDGA 1CG9A 4TPRH 1UTDA 3S37H 1RZFL 3OKDB 2CLZA 5C0IB 1EO7A 4TUUA 2BK8A 2OZ4L 2OMZB 3O11A 4QLWA 3BH4A 4QKXB 3DV6B 3EYQC 2FQEA 2VOTA 4M8VA 3SO5A 1X9QA 2D9QB 3NESA 4I3SH 3MI6A 4O9HH 1JSYA 2OA9A 5T3ZE 2A6IB 4K55A 3L1OH 4PJEE 5SX4H 1B90A 3RPIA 3OGCB 3LVTA 2BOBB 3HMXL 1OKEA 3O4LB 4GKSB 4BSWB 3ARVA 4JO5A 3R06A 4RMWA 4QAMB 2WO3B 5EIIG 4AEEA 5KSAC 5A6IA 1PEWA 3KPLA 2C3WA 2ZWSA 5I30L 3EJYD 1E27A 3E6FB 1N3NB 3UPAA 5IKCB 1NGQL 1UQSB 4I0PD 4JG5A