2ODIA

Restriction endonuclease bcni-cognate dna substrate complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENNITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPSSRNPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNLSKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMDLCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*CP*CP*CP*GP*GP*AP*GP*AP*C)-3'
publication title Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
pubmed doi rcsb
source organism Brevibacillus centrosporus
molecule tags Hydrolase/dna
total genus 64
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15515 MvaI_BcnI MvaI/BcnI restriction endonuclease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2490 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2odiA02
3.40.210.20 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 2odiA01
2ODHA 2Q10A 3IMBA 2OAAA 2OA9A 2ODIA
chains in the Genus database with same CATH superfamily
2CBQA 1ILSA 2XV2A 1MHCB 4JHAL 3L48A 3MKGA 5SWQB 1GKEA 1YPZB 5IB1A 1T0NA 1MI5A 1Z5LA 1JYNA 1K2DA 2KDYA 4S0HA 4XMKL 4NBZB 3A67H 4PJGB 2NZ1A 3MBEB 3VWKB 2P8PB 1SN5A 3MV8E 4E41B 1XHHA 3T65A 4AW4A 1JJUA 1S9XB 5D4JA 4E9RA 3SKUD 3N42F 4QYOB 4P07A 1F1DA 1I1AA 2CBMA 4PJ7F 1NAKL 4QRTB 1GPOL 5C0ND 3LNHA 1AGBA 3GRWH 4NOBA 5CHNA 2R4RL 2ISDA 4ZFGH 3KHQA 3GB7B 1LL1A 1JNLL 3FUNA 3HI6L 2XNAB 2VDPH 1SXBA 4E36A 1C5BH 4JG5A 3G5VB 3MUHL 4NWTL 2CCVA 1JHTB 1JPTL 4JG9A 4FFYA 4PJEA 4Y4KA 3O6FD 5SWZA 3S88L 4JG1L 3NSFA 5CJQH 5FHAH 2H8PA 4K15A 3DXAE 2W8CA 4W9ZA 1D9KB 1NIEA 1ZT7A 2E46A 3DTXA 4MWFB 4EJ1C 4EOWL 4H8QA 3RTQB 2BOLA 1LWRA 3L5XL 3P30H 1KTLB 1OSPL 1YNTB 1ZANL 4C56A 4PTTB 3JWOC 4Z6AT 3TO4D 3WNLA 4BQCA 5D7LD 2AF2A 1IBFA 2CHZA 4WK0B 3CV5A 3CDZB 3RE0A 1BIIA 2UVEA 5TGBB 4NUJB 4L2LA 1HC1A 3WJMB 3ZGHA 3EYOA 3CSGA 5DRNA 4FJ6A 1H6FA 2XZQL 2BFGA 1E9QA 4QHMB 2F7IA 4FXGB 3FSZA 3J8F7 4NN5B 4WLCA 2XRAL 1TU2A 2W88A 3TO2A 5C0GB 5D1ZI 2CXKA 3QIBD 1S7VA 4MNGE 1WAPA 1R1CA 4MXVE 5ESVB 4YR6A 5I0XA 3S4SA 3QDME 4QRPB 3OMAB 1UACH 3MLZL 2J57A 1JPST 1KCSH 2I9LA 1CFQA 4YC2B 4EDWH 5I0WA 3KPSA 3U2SA 2AJUL 2Q5BA 4PREA 4M48H 5F97E 5I0YA 1I31A 4P4KD 4PJ7A 1U8HA 4KXZI 3VRIA 2OSLB 4NJAH 4HCRL 3ZDYF 4ELKB 4ZMZA 3IFPB 1MFEL 3UGEA 1HESA 1ODUA 3IETB 1PY4A 1OPGL 3EGXB 4J3OC 5DD3H 3NCJH 4FULA 4V1DA 3KPRD 3P9MA 2YKLL 4YSAA 5BVJA 3P54A 4HZLB 4PY7B 4I5BB 3LEVL 1A7QL 3LKSA 5K39A 3QUKB 1TTFA 4Q97A 2I26N 2RB8A 2VDML 3C09B 3F8UB 1ZGLB 4ZMYA 5KYXA 3HMWH 4LLQB 1MLBB 4YHIA 2GCYB 3JXAA 5AKRA 5DQ9A 4ZO9A 1OW0A 3HA0A 1CZ8H 1PZBA 1WDAA 5BXFA 5GSRA 1O7SA 3CIAA 2VLKD 3HI1B 5FAAA 4GAGH 3BZFB 5BUAA 1GHFL 3U25A 5BS0A 2DLHA 3P4MA 2D9CA 5E4EC 2ARWA 4TKWA 5B1JA 4HUWB 4TXVB 2ZCHH 4XBMA 3RNKA 3D4YA 2MCPL 1M42A 2YZ8A 2B4CH 3I3EA 4OFKA 4XPTL 4AM0Q 3PJNA 1INDH 4WKZB 3MA7B 3O3AB 4DOHB 2K7QA 4M43L 4K2UL 3N04A 1W6WA 5DZNA 2YUXA 1K4CA 1S46A 3H7LA 5C0FA 3GLDA 2N7SA 4TULL 1EIBA 2YJQA 5AYUH 2XN1A 1BLNB 1ETA1 3BVXA 3EXLA 1CCZA 3M7FB 3NDYE 4FNUA 3BUBA 4HALA 4OQ1A 3UGXA 3LD8B 3ATBA 4GKOA 2YKKA 3SE8L 5FKAB 5E08L 5ADPL 4F15B 5IB3A 5AB0A 2P24B 4KYWA 5EU6B 4NRYA 1LNUA 4Q9QH 5E8OB 5EZOH 5HSFA 4URKA 4ESJA 2WN2A 3BQUA 1BQHG 1EGJL 3RGVB 5DI8B 1U3HC 3FU9A 2ZF9A 3BPLB 2AFNA 5C0RH 1SXNA 3WO3B 4JO4L 3WUZA 5D7SL 3L95A 2MKWA 4K71B 4P3CH 2B39A 2YFNA 4X5QA 2ED8A 2XTSA 5F8RC 4DIXA 3RVWD 4AK1A 5FYJU 4YHNA 2IF7A 1B4TA 4PJCB 2CJUL 1RZPA 4YDVB 1TTRA 3DI3B 5DHVH 2ADGB 2DN7A 4IM8A 4OIBA 3JYBA 5EC1A 4WWKD 5JLZA 2YGNA 3MLYH 4M7KH 1AIFA 4PTUB 1XB8A 2XBZA 2J6EH 4K3EL 4UAOB 5KUKA 3PHQA 3DBXB 5IOPB 2LU5A 4M3JA 5TFSH 3OZKA 3T0VA 3EOBB 4PJBF 3KYKH 4N87A 3X12A 1WA1X 4PJIE 3RVTC 1OGAD 1UD5A 3VX1A 4JQVC 3MR9A 4GNKB 4C83A 3RWHA 2B2XL 4PVBA 5AW6B 2NQCA 5HXMA 3RIKA 2ADFH 4OFYA 5FR3A 4OLWH 1QTSA 3UCRA 4JM2F 3HS0B 2BW5A 4KJWC 4Q0XL 4F37K 5I18H 3VU1A 1EHNA 4W9HC 4QI3A 4AKPA 1WSST 2M83A 2G2NA 2NXYB 2E9WA 2A1WL 3RG1C 2F9BT 4G6JH 3CG8A 4HIXH 1UA6L 5EFIB 1TMCB 2EJ1A 5B7EA 3T5WA 1QNZH 1PVUA 1VFMA 3Q5OA 1IGCL 1N59A 4YNYB 2WK2A 2QL1A 2Q76A 2HSIA 3D9AH 4TUOB 3OKKA 2WLKA 2JJWA 4DUXA 1RPQA 2VDLL 3QWRD 4P5KA 5KS9E 4DKFH 1BAWA 4UNUA 3Q5YA 1F58H 4UT9L 3WEOA 1P9MA 4UM8A 1ZHLB 1FL5B 2F8IA 1XXFC 3EO9H 4U1KB 3KYMA 3QUXA 4UTAA 3UPRB 2ALWA 2AANA 3U83A 1BA9A 1D6VL 2F15A 4OLXL 4TNVF 4D9QD 3FBQA 2ZXQA 1LEGB 4I77H 4QGTA 4G9FA 3REVB 3RILA 5HHQA 3Q13A 4HWBL 4PRIB 2ZICA 5CGTA 5A6IA 1GXEA 1SJHB 4RH4A 3U0PA 1X5KA 2IH1B 2XQBL 3HZVA 4KKBC 4PJBA 1CYXA 3HFFA 3Q3GA 5LGHH 3ZIYA 2PYED 2PXYD 3SD2A 3HB3B 4OZHE 5AOLA 2OJZH 4HOMA 4QHPA 1FLRL 4J6IA 3UBXG 5J7CC 3B34A 2P5WD 1JERA 3V5DA 2CM6A 5H37H 3KPTA 4JM2A 4J2QA 5KSBE 2FLRT 4QO1A 5GISH 4PRPB 2N59A 2VSDA 4MJ6B 3Q5TA 3M86A 3QW9A 5I19L 3DV6B 3MVSA 3OPZL 3DPBA 4H1LA 1CK0H 2IDQA 4X8CA 1KACB 5DK2A 1S5IL 4N5ED 3BN3B 2Y7NA 1Y1DA 2DEXX 4IGBC 4XNZC 5EIIA 1DJSA 2XN9D 3C60B 4KQ3H 3IAPA 1JPEA 3UG3A 5DA0B 5KAQG 4PJ8D 4KKZA 5AVZB 5D2NE 2J7LA 5JQHC 4WFFE 4RQQA 1Q9LA 2R0LH 1OE2A 2GJ6E 2NX5A 4WUUD 4MJIE 1BX2A 4U0QB 5F9WB 2QDVA 3V6ZB 5L2KD 1JXDA 1MEXH 1RK0A 1U8MA 1KV7A 2X4RB 5HYSG 4B60A 1MPAH 1DBJH 4IQHA 1KV3A 2BVOB 4XRCA 2YEVB 1QLEB 4IBTA 1RI8A 2GUYA 2C9QA 2DOCA 3RDTA 5BZDB 4X6DE 1U6AH 5CFHA 4JFSA 3O4LD 1MCBA 4K8RD 1MRCL 3DX2A 1F4WL 1Z3GH 4YFLI 2BNRA 1NGYA 2EDMA 1UJTA 1N5AB 1UWGL 4IRZH 4TNWF 4BFIB 4CMHC 2VOTA 3ZRCC 1JZDC 1KIPB 1RUPH 4AYMC 2QEJA 1AGDB 2NY4C 4YHYC 2AS5M 2ESVB 4AT6A 2A6IB 1MJJB 2Y23A 4X7TB 1P4BL 4JZOB 2OV0A 4KRMB 1FZMB 3QR1A 4GBXC 4XAWL 1HDMB 2BVPA 1J48A 2YAQA 4NO3B 1MREH 4J3BA 4FTVB 1ODAA 8PAZA 4M02A 4B97A 4Q58C 5FGSA 2IAMD 3VXRE 1OP3K 2ENJA 4MCYA 1DE4B 3AU1A 4ZUVB 5SWSD 3FAXA 2EXYC 1S7TA 2R69L 2QTEA 2EEXA 3M6DA 3U1QA 3T0EE 4CDHA 1NANI 4ZQKA 2Q3AA 1IJNA 1AI1H 3T0XA 1SDDA 4N2MA 5IROA 3ARGC 1WWWX 4M56A 3FTYA 3WDIA 5LNGA 5J1SC 1XDTT 2G2RB 3MGOB 3QHFL 4OZIB 2VL4A 4KJQC 5I74B 2AQQA 3D2UB 1QABA 3BIKB 1N64H 2Q6WA 2OMUA 1XO8A 1QEXA 4CVZB 2F54A 3RVUC 4P57A 2FWSA 1XGUB 3F00A 1LILA 1EV2E 3OAZK 1PFOA 3LZFH 2O5ZH 4JZJB 3T8VA 1OTSD 4OU3A 2IBGA 3AQDA 1QUNA 2O61B 4XO8A 1NAMA 3AUVA 3CIQA 1FFQA 3GMPA 3QDJE 1SF3A 2QQNL 5HHMB 4KK6C 3TU6A 3WLBA 2HMID 3CHPA 1MW2A 1X7TA 1K8IB 2D03L 3OHXB 4RMWA 3SDXE 2HAZA 5DJDA 3WFBH 2VLJE 4ODSH 3G04A 4CDGC 5D96B 2PETA 2R2EB 1UD4A 4TRPH 4L0PB 5EO1A 1U8KA 3QNXA 4O58L 5DS1A 1I8MA 1GA2A 3NIFF 1U30A 2ORBH 1PX4A 1BD2E 1SLXA 1DJGA 4N9GB 2AJVL 2CRZA 43C9A 4JJ5B 2V7HB 4NDMA 3BXNB 4FQPA 2BHYA 3EH5B 3M46A 3DIVA 3MV8D 4F24A 3P73B 1G9MC 3KPNA 5I71B 3SGDI 2PW2A 4HLJA 3LS4H 2J3SA 3VXQA 2G3XA 2XPGA 4AMXA 2I7SA 5T1DL 4Z7NF 4P2OB 2BPBA 2LAAA 3TBCA 4APQC 1V7NH 2HT4C 4KX9A 1UZGA 3OR7B 1GKOA 5DUJA 4N3TA 1R5VA 3A4DA 4X0KA 3TBSB 5I1KH 4JFHE 3G08B 4XN1A 2NY0C 3WDJA 2OQJB 4WO4D 1XH3A 2MQCA 3CZFA 4WSKA 2K4WA 3ATAA 1FGNL 5FGBC 4DKEL 3LJ3A 2MWCA 4QXTA 4AVIA 3NAAH 3DUUA 3DXAD 1XH2A 1DQDH 3N2JA 5I1HL 3S3CB 1R46A 2ZXBA 4TQ8A 4A7SA 3L16A 4ODTL 3ZTJH 2Z8RA 3OMNB 2BSBA 4WI8A 4YPGA 4HUVA 1VEMA 4KJYA 3NTCH 1WIPA 3T0BA 2GI7A 4EN3B 4WRLA 5FCSH 1U91A 3EBGA 4G8AC 2YD9A 1XVSA 1FNEA 4LAQL 2ZWKA 4GY4A 2NZ9C 5DVLA 3NVQA 2ENQA 3UTQB 3S98A 3KPMB 1F97A 2H6UA 3WO4C 4KGLA 1KIRA 4HAFA 4OQTH 3EOAA 3BN9D 43CAB 3ARDC 1BOYA 5IW1A 1TENA 2WVVB 3FO9A 4F2FA 4UANA 2CQVA 2XFXA 2Y1AA 4YK4C 2OJ1A 1I8KA 1YECL 1JYWA 4RMUA 5I6LA 2VL5B 3IJSA 2CPUA 3MZGB 4TL4A 4ZK8A 3OGCA 1V8HA 4DN3L 2WPGA 2IBBA 4ORZC 1YA5A 1HHJA 1ZEAH 1PQZA 1UXWB 3HG1A 3MYJB 1JWMA 3NZHH 4HS8L 4HQQH 1TITA 1YEKH 1LWJA 3FUFA 3QDGE 3TN0A 4XCCL 1OTUD 3KPLB 3VQ2C 2XJLA 1AD9A 4N86A 3WMQA 3NIGE 3FSOA 4HBQA 5I2IA 1KG0B 3LX9A 4RDQG 2J88H 2O4EA 1BGXL 4YLQT 3O6ML 3SBQA 3NP3A 1DBAL 3QUZC 2ATPB 3NYKA 4BZ1H 4PW3A 1INQB 4RVBA 4F7EB 4RMRA 2B5IC 1KJVA 3N1MC 3V5HA 1IM9B 2F0CA 5HGAB 5LHDA 1WUZA 4ZI8A 2IGTA 2CHDA 3C5ZA 5HVWA 5GHWH 3SBWC 1CFNB 1K6QL 2VZ1A 2TAAA 2BWQA 2W0FA 5C86A 3W5NA 3O11A 3NCYS 7TAAA 5IK3A 1TOXA 4CNIA 4ERSH 3WTWA 3TPUA 4PJXE 4A2GA 4AXWB 2GSIA 3GI9L 4YWGH 3IU4H 1UJ3A 3TFKD 3H42L 5CD3A 2WBKA 3FSAA 5FA4A 4F2MA 5EU7C 4J39A 2JVUA 3EYFB 3BH9A 3KH4A 3R18A 4I0PC 5LBSL 1JTOA 4QNPF 4JANA 4XN9A 2C4FT 4Y0GA 4G6AD 1S7QA 2UUDH 3CFBA 4LOUC 1RCYA 3WUWB 3DNKA 1KLUB 2IBZY 1PCSA 4HXAH 3PWNB 3FC8A 3T0AA 5E99H 1KJ2A 1U3HA 2I9TB 3NCWA 4LKXB 4YZFE 1TJXA 3P3SA 3ZTNL 3DX9B 3MV9A 1HSAB 2JCCE 2XLLA 5AOJA 4BKTC 3CFCH 3B9EA 1KB9K 4P5TD 4QLWA 3FQ4A 4I18B 1KCRH 3IJHB 4C4KO 5DCCA 5IHHA 3E9UA 1IBYA 2KQMA 2A9ML 4Q9CA 1P84J 5E8EA 4HETA 1AGFB 4ZFOA 2BY1A 2VZ3A 3B2UC 5IW6A 1WZAA 4NNPL 1QG3A 5FM8A 1NCWL 4OV5B 3SQBA 1SEBA 4OT1H 5AAMC 3EF7A 1H3GA 3HHMA 4FFVD 3D12B 4GMSH 2SODB 4F5CA 1L7TL 3MJ8A 3S5ZA 4BFGA 3FH8A 1I53A 1YEHH 4LCWB 3QXVA 1SJMA 5AVRB 5IEKB 5IT2L 2W9LA 4ES9A 1MIMH 4RLDA 1KJ3L 1GZPA 4E9SA 1DZBA 3I9PA 4LOEA 4JQVA 3T2OA 5ACZB 1NKRA 2O6CA 1EJOL 3VSTA 4KNQA 1BEXA 3AMLA 1TETL 2KPWA 2DI7A 1AS6A 4R84A 2XQYK 4YPJA 4OCRL 1SHSA 1FL6A 3ARED 3LQAH 5KBMA 2W81C 4AI7A 1QBBA 2PP8A 3TH4T 1EAPB 2KI6A 2ZWSA 1TO5A 1SMAA 3MRJB 5D4HA 5F1IA 2NOYA 3RL2B 3MRKA 4NHUB 2EP6A 3CZEA 1SGKA 3BCDA 2G5RA 2X9YA 4KQ4H 2EUZA 3ZOAA 4DQOH 1HI6A 4BE6A 4Y5VB 4MNHB 3U7YH 5DFVD 1DVYA 1YDPA 5FYJL 3OX8A 5CCKL 1CURA 2EDHA 5EEYA 2JI3A 4ODWB 2JIXA 3SEPA 4APXA 4JO5A 1KNOB 1TJMA 3QEHB 4QRFA 4NGHL 1BF8A 2W80C 1JSYA 4JPKL 1TZGH 1NLBH 4YX2L 4WAFA 4A7QA 2I27N 2W9DL 2QSVA 3QO1B 3H2WA 4PSPA 3VX0A 1QLEL 3HZ3A 3VD1A 4KZDH 1Q94B 1FH5L 3NCXA 2IANE 1FORL 3ZDWA 5I8OL 3WD5L 1BXAA 5IBUG 4AC4A 4KFZC 5AB1A 2NY3D 4TSBH 1FAIL 3PL6C 4O4YH 1KT2A 1MNUL 1G9NH 3THML 3MRGA 3G6DL 3FT0A 2HRPH 3E3QC 2VB5A 3QG6A 1S9KC 5IB1B 1T0NB 2B0SL 4OFQA 1MI5B 1Z5LB 1ZV5A 1K2DB 2EEFA 4R97B 5DHEA 5FGCE 4POZD 3SZKC 4POYA 1F3RB 5AFAA 1RUKH 3G5YA 3D3VE 1BMGA 1TSRA 3T65B 1QFPA 1GAFH 1ID2A 1E8XA 2YD2A 1L9NA 1N4XL 4JPVL 4B9FA 1HL5A 4UIMA 3O2VL 1I1AB 4IGBA 4WNJA 2CR0A 1AGBB 5CHNB 5EF1A 3VUAA 2IG2H 3MNVA 3DIFA 5GGSY 3S9DB 2Y07L 1SXSA 3SSGA 3UAJA 1DFBH 1JWSA 4L8SC 1NCDL 1G6RA 3WDHA 4RETB 4GT7A 2ZXGA 3ZLQC 2WLZA 3DXAA 2J1XA 5LWYH 1L6XA 4GB9A 4NIKB 4UTBL 4M1CC 4PJEB 1U2CA 4Y4KB 5SWZB 5D93B 1EAJA 2H8PB 3VYNA 3Q1EA 1WBYA 1DJXA 2AJ3A 4WFFD 3WFHA 1G7IA 3GYRA 1ZT7B 5DGQA 2GJ6D 3DTXB 4GW1A 4LDCA 4MJID 5DMGC 5D1ZC 2WLHA 1TSHA 1UC6A 1QBLL 2Z0BA 3WEXA 1PZUB 3FFDA 2GY7B 4C56B 1A6UL 5F7FA 3CFDA 3BVTA 2WIMA 3EYSL 5IB5A 3JWNG 5D72H 3BAWA 5T5NF 2AC0A 1BIIB 1ZTXH 1ZE3H 4NAMA 5CGYC 3EYOB 5DRNB 5D2LF 2PP9A 5IB4A 4ISVA 3QPQC 1BFVH 1E9QB 3QDMA 2DD8H 3NN8A 3RGHA 3F3HA 4EIZC 1TU2B 1UD6A 4JY5L 5FUZH 3TO2B 4JREC 3KMDA 4MB3A 1S7VB 4YR6B 5F7NC 1UT9A 1ONQA 4PGBA 3TBVA 3S4SB 4P3DA 3GM0A 4JQIH 1ILUA 1PGRB 2I9LB 5EH1A 1GIGL 3NFSL 4XTRC 3VH8A 5B1AB 3KPSB 3U30B 3U2SB 1OOAA 1ZVSA 4WQOA 3N42B 4PREB 1LYQA 3VG0L 4PJ7B 1U8HB 3K2UH 1EANA 3U9UA 3VRIB 2GG1A 4XNQA 2WV3A 3NJXA 1MFDH 3Q6GL 1DL7L 5CMAA 2YC1A 1GMEA 4KAQH 3VXRD 2UY7A 4DGVH 3AU0A 3QNYA 1OM3H 5J0BA 2IV9A 3FS9A 5HHXL 1OANA 2WWKT 1IE5A 3KPQA 3FOLA 2R8SL 1B3JA 1NLDH 3KBFA 5KANI 1A3LL 4V1DB 3P9MB 3T0ED 1JGVL 5BVJB 1VHPA 4GQPH 3LKSB 5K39B 5DEGA 2BJML 5KYXB 3B2VL 2B1OA 4XCEA 4Q6YA 4JY4A 4YHIB 4JMNA 1CBVH 4UOW0 5DQ9B 3QHTC 4CVWA 1X5ZA 3IDYC 1HQ4A 1ROWA 1KPUA 4NQTA 4L5FH 1KN4L 3DX6A 3CZNA 5GSRB 1NSNL 5BXFB 2APFA 3DUSA 4XC1H 1NDMA 1CDYA 5BS0B 1YNKH 3P4MB 3CC5A 3T3PB 3DJTA 3EJZD 3LZLA 4IMKC 1KSRA 5T3ZH 4L5FE 4MHHI 1BZDA 3QDJD 4S11A 5D2LA 5DD5H 4BINA 4LQFH 1R47A 4M6NH 3O2WL 3I9GH 4PW9A 3A4AA 1QKZH 4MJ5A 3HPLA 3TFBA 4D0CA 2VLJD 5T3ZE 3V95A 2VXQL 3DECA 1MFMA 4NQDB 1R4XA 4UDUA 3SIKA 1HXYA 4K5OA 4Y16C 1K4CB 3LH2H 3QQ4A 4P2QA 1BD2D 1YN7A 3KGSA 5FOJA 5C0FB 3QP3A 2WBJD 15C8H 12E8L 2XZAL 2WO4A 1USQA 2VRKA 4HIIA 1E8ZA 2Y7MA 1BOGA 3C6SA 4AG4L 2DIAA 1XH0A 1LQBC 4M62H 1CDCA 4O02B 5IB3B 4GUCA 2Y6TE 4APQA 5BRZA 4NRYB 1LNUB 3ZDYB 4AMKH 4KPHL 5KBDA 1VEOA 3N0AA 4WEUD 1T1ZA 2VDRB 3BQUB 3WJJC 2FGWL 5DJ8A 4X0NA 5TE7H 4UZUA 2LU7A 1MCQA 3GEWB 5EZIH 4IKNA 3L95B 3ZSSA 2OI9B 3QPKA 1TZAA 1EAOA 1IGYA 4JFHD 1U95A 4N8CL 5B38G 4AYFA 5IHUL 4YHNB 4ABQA 4XMTA 4GAAA 4J8QA 1TJIH 5GJTL 5AW0B 1AGEA 1JPGA 2R51A 1JMZA 5EC1B 5JLZB 5D1XD 4XNYL 2WN3A 4HSAC 4MLSA 1AIFB 5TF1L 5K93A 1KPRA 3N43F 2LLGA 4AMWA 4FQ2L 1F0OA 2XDHA 3PHQB 2BFVL 4X9BA 4XHJC 3N0PB 1CGTA 4D3CH 2ILLA 2CO6A 4O2FA 1VEPA 5EOQH 3X12B 3ARDA 2YMXH 3D7PA 3MR9B 1RD6A 4POUB 4C83B 4RZCA 3RWHB 5HHNA 1RZ7H 2DH3A 4BCYA 2R7EA 4AWJC 3WGUB 4FLQA 1XMEB 4G7VL 4G3YH 3QYNA 1BM3L 2GEQA 1MW0A 4YXKL 1MW3A 4KX7A 3CFUA 2NSQA 4Z76A 4TUKL 2IDCA 4PLKC 1IEHA 3BPNC 3MLWH 1HHHA 1GGCH 1N59B 3L3KA 3RZCD 2Q76B 4QXVA 3IJEA 3OKKB 5DD0L 1SF5A 4HU8A 1AR1C 4P5KB 5L8JB 4ZT1A 4CSSA 3QEQE 1E2WA 2DWYA 1QPXA 1WZ1H 4AEFA 1K5NA 3QNFA 3SPJA 2F7PA 4UM8B 4ZD3H 1TEYA 3SODB 2ODIA 1WVZA 1W72A 4RAVA 4S1DC 4FA6A 3KYMB 3QUXB 4HHGA 1FAKT 5DHXB 4UB0H 4KHTL 4G70B 1P7HL 4Y9FA 4HAKA 4G72B 3DWTA 4XPHL 4Z7VF 4X6DF 4ANVA 3SBWA 1HIMH 1JK8A 3ETBJ 1E4JA 2DAVA 4B41A 4G9FB 2DJMA 4P9HL 1D5BA 3G5ZA 4KO6A 5HHQB 1GR7A 3R1GL 4XN7A 4K3DL 2DQ6A 3D0VA 3O6KH 3TVMC 5LJYH 3U0PB 2XV3A 2WOYA 1SDAB 3HZVB 4PJBB 5AW4B 3VXUE 1KN2L 3Q3GB 1XD0A 2PR4L 4G11A 2HTKC 5IOKA 2DM7A 1QRNE 4BRVA 2E56A 1TJGH 3CLFH 3U46A 5I1GH 3IGKA 4HJ0C 2X88A 5E9DE 5HYJA 1FWXA 3V5DB 3TNNA 1IGML 3MLXL 5IY5B 5MP6H 4JM2B 5C3LD 5J3HD 2VISA 3QG7L 4QO1B 1U3JA 3X3FH 1ZS8A 3R8QA 3MUY1 3NUKA 1QOKA 3DPBB 1PYWA 2AJXH 4H1LB 4KKQA 4LP8A 5DK2B 5HI5D 3UYRH 1WE5A 2FO4A 4LXFA 4ORGA 4H8VA 3EJSA 4U49A 2PPFA 5EIIB 4Y4FC 2BRRH 4U2ZA 4KK8C 3BH4A 1A64A 2YARA 1C7TA 5F1SA 4YHMH 3TYGH 6PCYA 2B9BA 2XA8L 3CFNA 4EI6A 5EDXA 5GS1C 4RQQB 1Q9LB 2C9SA 4UOJA 2NX5B 5DJYA 5JQ6L 3ZT5A 1GGUA 1BX2B 2A5UA 2H2SC 3D50A 4L23A 4MNQD 1RK0B 1QSEA 1RFDL 2YMOA 1RUAH 1U8MB 3K8MA 2ZYIA 3AQXA 1GRWA 1LD9A 4Z7VA 3VD4A 4DWHA 1A9VA 1H9DA 1DFXA 1ROCA 4XRCB 3GHBL 1DQLH 2NQ3A 3MFGB 1MELA 2ZXDA 1OAUL 2IQAA 4GJTB 3RDTB 1XSIA 3ILEA 2NNXA 1BAFH 1EJFA 1W8NA 2YA1A 4M4PA 3RB5A 2K78A 1R24A 1G7JA 5FYKL 2N01B 2BP5M 2BNRB 5KYYA 1NGYB 4Y7MA 1E90A 2Z0UA 4ZUTA 2OSXA 2GK0A 3W3BA 3MRLA 1QBMH 2CXGA 3M88A 4XXWC 4AT6B 1OAKL 1XMWA 4OCYH 3AB0C 4N0CC 3EBAA 3IDIA 4GUPA 4YHKH 1FNSH 4KXCA 3V4PA 4O5LH 5DVNA 4H13C 4BUQA 4YVUA 3P2TA 2F1BA 5EPMA 3V4VH 4F8LA 1X9LA 4TVPL 3VXRA 2GT9A 2BVPB 3HG2A 2B1HH 2X53A 4WHYG 4WHDA 2IFFH 4MJ4A 5K9JH 2W60A 3GS0A 3ZQ9A 4MZ3A 5FS5A 4XB8A 5I23A 4LRNH 1WD8A 4GYBA 3ZU8A 2CLRA 4MCYB 3AU1B 4RGNB 1TZHA 1FNLA 2NSXA 2WYZA 1SOQA 1S7TB 1NGPH 3D51A 1CO1A 4S10A 1QW8A 4ZQKB 4L8CA 3QIWC 2NY5C 2FX8H 3HBZA 1JVLA 1SDDB 4M8QA 3MRQA 4FFYL 4I88A 2YBRA 3VG9C 1X44A 3BGMA 4K9JA 1P7QD 3TO4C 3Q05A 5T33H 4XMVA 4EIUA 1WS7A 4QHUA 1S78D 3EJJX 4QMEA 2QVMA 3VO0A 1RLWA 3J27A 4Q4IA 4YGVB 1JV5A 2Q6WB 2OMUB 3MRCA 1GY2A 4O2CA 2F54B 3RURA 3UADA 4P57B 2CNYA 3A0OA 3B43A 1PKQE 3DI2B 2DZEA 3UG5A 2DQCH 3BZEA 1XGQA 1QUNB 3BFWA 1NAMB 4DEPC 2MTPA 2ZUYA 3GMPB 3JV6A 4WTXA 4E2OA 4HK3N 1IBHA 3WLBB 2A4CA 3O3BA 2G9KA 5DJDB 3P0VH 2IAND 4DUWA 2EH7H 4TPRH 2EXSA 3G04B 3WXWL 5EO0A 4BZYA 5EO1B 1U8KB 2WXMA 3QNXB 2B1AH 3H9SE 1I8MB 1L9QA 4P4KC 3S4SG 3VD2A 1Q0YH 4RFNC 2YOAA 4HJUA 2N7AA 5KVGH 1T6VN 1CR9H 1MAJA 3WXVL 1KLGA 3S34L 3V8OA 1CC3A 1UOLA 2FR4A 3QQ3A 1VADA 4RMVA 4XX1G 2ZQKA 4K7PL 4HXBH 4U1JA 5IUCA 1X5HA 4NDMB 2JKIS 3P4NA 4Q14A 5MENE 1S7RA 3D3VD 5KVGE 3BAEL 5E1AA 4N2DA 4FLHA 4Y9GA 3EYUH 3KPNB 4WEEA 1RZFH 3GBEA 3T2LA 3NIGF 3DGDA 2PW2B 4MAYD 3VXQB 4L8SA 4PIBA 5I1LA 2XPGB 4JVWA 1JOIA 4BGDA 3PWPD 2EIDA 1J18A 2CMRH 3DRQA 4KKNA 2Y69B 2O93L 3K71A 4WNSA 3JUZA 1R5VB 1NOFA 3LPOA 2AABL 4X0KB 4YDNA 3Q2VA 3WSQL 5CEZH 1MWOA 5D7JD 1UB5A 4JM0A 1XH3B 3CZFB 4CVUA 1MFCL 3WTVA 5DLLA 3ORJA 4NN7C 7FABL 2Z9TA 3SGEI 4WJKB 4QXTB 1IIIA 1FBIH 4NKDA 4R2GD 3DUUB 5J12C 2EC9T 4XN5A 2JNZA 2J8UF 1IC4L 5BVPL 2EE0A 3ASNB 5IF0A 2APWA 4OBRA 5KTEL 3C2AH 4YPGB 4HUVB 4KJYB 5A43C 5HYFA 4JFVA 5JXAL 4YSRA 2WQXA 2E76C 1DN0A 1U91B 2W9EH 3GXFA 1FNEB 4IRJD 4L8DA 2ZKXA 1EFXD 4KDVA 4MRBA 5LCVH 5A1AA 3ZXAC 3GBLA 4N5UA 2VDKB 4JR9H 5ID0A 5HVGB 4JO3H 4AL8C 1T1YA 4K5LA 1BFSA 1CLOH 1KIRB 2O1AA 3EOAB 5IW1B 3ABZA 3NIFB 2J72A 2DI9A 2DEYX 1KY6A 3FO9B 4NZJA 4BSWA 1CD1A 2XFXB 1ZWIA 4GEIA 1I8KB 3FYIB 4W9KC 2EIKB 2X6AA 3IJSB 4TVUA 4FXTA 4CC0A 3CZUB 2XN2A 1EO8H 3D1MC 3OGCB 2KERA 1C8PA 5J9PA 3PWLA 3QDGA 1YJDH 1HHJB 1PQZB 4KRPD 3HG1B 5AKVA 2KT6A 1JWMB 3RJOA 3GS7A 4J3SA 1KGWA 4O02L 5ILTH 2HN7A 3EHBD 3TN0B 3RVWC 3MA9L 4Z7NB 1F8TH 5FYLH 2VDRL 5ALCH 4Z3FA 1AD9B 2LU3A 3KE0A 4FTDA 1MHPH 5I2IB 3IBEA 4LPVA 3RWDA 4XVTH 2O5XH 1JNNH 4KROB 3MGTA 2WVSA 1J12A 3QUHA 1HYRC 4N90E 5FYLE 3AACA 4YDKH 1I9IL 3W11D 1KJVB 5FUCC 2J8UA 2E0PA 4F80A 3V5HB 2WJ5A 4KOBA 4YL9A 2GPZA 5CJXC 2HVKA 4I4WA 3C5ZB 2PXYB 3KBHE 1CFVL 3EJUA 2HA1A 4M00A 3WCYA 4IMKA 1FZKA 2DWDA 2XWBA 2CJ3A 1IC0A 3NOIA 3MODL 3PRZA 4F93B 1E28A 3V10A 1FLTX 4JHAH 2W0FB 3O11B 1Q1JH 4R8WL 4QXWA 5IK3B 4CNIB 3QCUL 1KIQA 2FL5A 2E4FA 3TPUB 4HLZG 4XMKH 3S97C 5I17A 3T6QC 2GSIB 2ATAA 4LPWA 5DYOA 5I28A 1N19A 1UJ3B 2X89A 5T3ZD 1D7BA 1EZLA 3FQWA 4RRPM 5CD3B 3GXTA 5PAZA 1NAKH 1TCRA 1GPOH 3BUIA 3K6IA 4HEPA 3BH9B 4JDVA 4OJFL 5FA4B 5ANMA 1BZOA 3KJ4B 2ZNWA 1D3CA 4JANB 4M6OL 2A6KA 1S7QB 3CFBB 3HI6H 2IAAC 3QAZC 3FQ1A 1V27A 3O2DA 4NWTH 4ESKA 1EXUA 5CSZA 1KJ2B 1U3HB 3JWDL 5CR8A 3X1EA 4A2LA 2VJXA 3BAYA 1AAJA 3EYVA 1JPTH 5JA9A 5DJCA 3MV9B 3ZL1A 2ITCA 5BO1H 2MPAL 2DQDL 4JG1H 2V9RA 4RFOH 1ACCA 1F00I 3FO2A 2OMBA 1YAZA 2GC7C 3QCVL 5AVUB 4ENEC 5DJAB 4F8NA 1BFOA 1YMMA 4EOWH 3TASA 1N6VA 3L5XH 4UTAL 4OLEA 5E2WL 1FCGA 5E8EB 4UOW1 4ZFOB 1OSPH 5IW6B 3UROR 1ZANH 3WOVA 4KH2A 3SQBB 1SEBB 3WTTA 2EIMB 4ZMOA 3ZN6A 3RWGA 1BZ8A 2F5BL 4X6EA 4LLYA 4TTDD 1M71A 3CFKA 2EZ0D 4NI3A 5JW4R 4J4PC 4PBXA 3MJ8B 4RFEA 2NY7H 4QWWD 1U0QA 4HOWA 4HIJA 3RL1A 1GZPB 3S2AA 4FNRA 2XTJE 2XZQH 2GUOA 3S5LA 4FEMA 2WSPA 3CK0H 3CH1A 1KTKE 4JFYA 4GRLD 1YSOA 3N1PC 3WTSA 3TM6A 4UQ2A 3MLZH 3VYPA 2QDWA 4N5EC 1MFNA 3P77A 4LL4A 4LKCA 2AJUH 3UZVA 4YSOA 3UAAA 1DUZA 5SX4I 2RD0A 2GSGA 3MUUA 1FL6B 2FO1A 1FN4A 4H1LG 3HBQA 3BVDB 4GXFA 3CMGA 4CU8A 1R19A 5F1IB 5JYLA 4WEMB 1DVQA 9CGTA 3MRKB 4LSVL 4Z7OE 2ZUTA 2KLRA 1CL7L 1GOHA 1TCMA 1JPSL 3ASOB 1TF4A 4MMXC 4MA7L 3C6LC 5DVPA 3VFSA 4UMGA 1OPGH 1HI6B 3QIUA 1PZ3A 3ZE0E 3VGDA 4B9IA 4K3JL 2YKLH 3QEQD 1YDPB 3LEVH 3OX8B 1T7ZA 4K5MA 1A7QH 4YFLF 4ZJ9A 4RSVA 5AAPA 3ILDA 2VDMH 2F19L 2Q3ZA 2C4FU 2JIXB 1JWUA 1VZHA 2VZUA 3LNIA 5JZ7D 4W68A 1CFTA 4APXB 1YCSA 1ND0A 1ADWA 2R39A 4K8RC 5I75C 1NIAA 1UUSA 3PAZA 5I1IL 1CE1L 2IANA 1GHFH 2X2JA 2HG5A 3K91A 2ZUQC 1NEPA 3BRDA 4L1BA 3IJYA 4KX8A 4NB7A 2LHAA 3TVMA 5L4MA 5IWLA 2MCPH 3W0WA 1G7HA 1O5DT 2DKSA 1A14L 1RLBA 3MUZ1 4XPTH 1VENA 3WY2A 4AC2A 1WTGT 3TF4A 1GC1H 2WLMA 3IFLL 1KT2B 4M43H 3EDFA 1PS3A 3E7JA 3B3IA 4K2UH 3MRGB 3ERXA 3WEBA 2Y5EA 3QG6B 1KTCA 4KY2A 1QRND 3AQZA 2ZP0T 1LO4L 2X3BA 1AFVL 4ZMTA 1W8EA 5E9DD 3TLRA 3G5YB 4O2EA 3SE8H 1SJEA 1BYOA 3MRPA 5E08H 5ADPH 2ZAIA 1QAWA 4UIMB 5AW1B 3GTTA 4XNZB 4Y4FA 1KELL 2L4OA 1EGJH 3NEEA 3RI5F 3ZBMA 2OP4L 3Q9QA 2DYRB 3DIFB 1RVFL 3MNVB 2BRQA 4JO4H 1JWSB 5D7SH 3B2PA 2EDEA 1G6RB 3F7QA 1XAKA 3DXAB 2VQ1A 1ZLWH 1JZ2A 2HFGL 3P4OA 2CGRL 1AQMA 1NCGA 5ANHA 2A3TA 1EHKB 2NXZB 4OD2A 5C9JA 2CJUH 4YHPA 3S5YA 2D4FA 3ES6A 1WBYB 2AJ3B 1UFUA 3WFHB 1G7IB 5EC2A 4LSQL 1TQVA 5EEXA 2FK9A 4GW1B 2R27A 1JF6A 2OTUB 3DX3A 1WCBA 4K3EH 3GSVA 3HZMA 3WEXB 3FFDB 4N0UE 3AWFA 2UZIL 3VI4E 1EJ8A 2VLME 3CFDB 3KLKA 5IB5B 1NAML 4CMHB 4H25B 3PREA 5I76A 3SE4C 5KVDL 3T8XA 2G4EA 2NY4B 4XNAA 3V6OC 2B2XH 1E2VA 3O8XD 5HD8D 4XXWA 3WIHA 4YHYB 5IB4B 2VRAA 4ISVB 3TEYA 3QDMB 5HHVL 4G5AA 3NN8B 1URZA 2WZPA 3K1DA 2WLLA 4LLWA 3SPIA 4Q0XH 5GZOC 1T03L 3EJCA 3SGJC 3OXSA 4L0ZA 3QRBA 2OXHA 1ONQB 4PGBB 3TBVB 5KYNA 4P3DB 4PJHE 1KUMA 4W9FC 2OA9A 4NLHA 3A6BH 4UOQA 2AEPH 1UA6H 4NC0B 3VH8B 1ZVSB 2H0PA 1QFWH 1UD2A 3U9UB 4XNQB 1T2JA 2YLKA 4N8VA 3BYTA 4HS3A 3K81A 1FHGA 5CMAB 2P3YA 2YC1B 4AVJA 1EEZA 2BSRA 2UY7B 2PTVA 4G43A 3QIWA 3QNYB 1YY9D 3HNVL 5AW7B 4IOSD 2YA0A 2GIXA 3KPQB 3B2XA 3FOLB 4URTB 1MNNA 2ZKMX 2W94A 2FEDC 2WP3T 4NQEE 3MV7E 3EOYG 1D6VH 4OLXH 5AOKA 1H9VA 4JPIA 5DEGB 1EUUA 2W1NA 3NSCA 4YHZL 3QH3A 1R0AL 2VLRE 3OZLA 1MVFA 4XCEB 4JY4B 2HFEA 3NACL 4YSPA 1HQ4B 3JWOL 1KPUB 3DX6B 2E47A 3NIDE 1FRGH 1J1PL 3DUSB 3BN9C 5D7KE 4ADGA 1NDMB 3FKUS 2XQBH 1EHXA 4R4NC 4WWID 3VTTA 1CICD 3CC5B 2R59A 5LDUA 1JXKA 4HJIA 1A7BA 4N2KA 1FLRH 2VDKL 5D2LB 5F0JB 2DH2A 3GBML 2WAQA 4UQ9A 1V10A 2ITDA 2VXVL 3HPLB 4MJ5B 4QF1A 4D0CB 1P6AB 4ZAKD 3VFWA 3FOMA 3H9SD 4UDUB 1O6TA 1SOSA 1HXYB 5F6IC 1OAZL 1WWBX 3OPZH 4RBPK 4CAGA 5I19H 2E6QA 3QQ4B 4KWUA 1YN7B 1S5IH 4YE0A 2EE2A 2A4EA 4OF8A 4HIIB 1GGTA 2QGCA 1BOGB 1ETJA 3C6SB 4A68A 5E2VL 1SXAA 1PDKA 4QHNB 4Y4HC 1XIWD 5MEND 2GK2A 3RIAF 2GI0A 1R5IB 4PUBL 4APQB 5BRZB 4M7LT 5F9DC 4PLNC 5HGBA 3LZNA 1T1ZB 2OCFD 3L5IA 3MKKA 3QUMA 3QZWA 5DJ8B 5HJ3A 2QHRL 1FFPA 3OBAA 4DP8X 3VXSA 4NT6A 3CHSA 2Y3NA 1J0JA 2CO3A 5JHAA 1ZLSH 3PXHA 4JCLA 1IGYB 1XL4A 2VJ0A 1U95B 3E9TA 4AYFB 1H0DA 1K3ZA 1BPVA 1DQIA 4WKXA 4Y19A 1JPGB 1AGEB 2COQA 3TL5A 3IXTA 1MRCH 1KPRB 1SEQL 1OARL 2Y5TA 2ZP8A 1UWGH 4A67A 1A3QA 5FM5O 4KK5D 1XL6A 2CO6B 3HE7D 4O2FB 25C8H 3LEXA 3ARDB 4I9XA 2Y6SD 2B4CC 2WXGA 5C0IA 4NQXA 2EDYA 2OLDA 4RZCB 1P4BH 1F02I 4G6AC 4YK4B 5HHNB 1S7XA 2R7EB 3LXBA 4XAWH 1YC7A 3V0GA 3UPCA 3BEVA 1YPZE 3IK2A 2E9GA 2OL3A 3VDAA 2EXWD 1H15A 2ZE0A 4E41E 1U8IA 4JFXA 4Z76B 2AHIA 4ONGH 1B88A 4G42B 5IVOA 5C08A 3UC2A 4PBVC 2BSDA 1HHHB 3L3KB 2R69H 1PFCA 4YBLC 3IJEB 1RXLA 4O9HL 1KJ2L 4ANUA 4PP1D 3SDAD 3MBWA 4HEME 4H0GA 1V3LA 4JW3A 4I1NB 5KVEL 3CDCA 1DQJA 1K5NB 1Z6JT 4FFVC 4JCMA 3ZW3A 2NY1D 2PO6D 4OBSA 1W72B 3D8MA 3QHFH 4RAVB 2D7NA 4GT0A 5JW5A 1EDHA 1ZT1A 2YD7A 1XF4A 2B5IB 1H6TA 3KLLA 3UYOD 3BE1L 3WFDL 5EN2A 4WWNA 2EUWA 5FYLD 1HH9A 5JHLA 1ZXQA 1ZJBA 2HTLD 2OMNA 4UU9A 3I84A 4GSUA 5DD1L 4ZFOL 1CDIA 1J7VR 1J10A 1GGIH 3ESMA 5DJ6A 3B7RL 2NY3B 2J1ZA 1JK8B 1TLKA 1T7YA 4Z0BH 4DETA 2TRHA 3CVCA 1D5BB 3G5ZB 3U36B 4QYAA 3ULUH 3EYQC 3VXUA 3N43B 4IBYA 4D94A 1WAAF 2MNUA 1ZS2A 2AZUA 3D0VB 2QQLL 1XSOA 4X6BA 3DYPA 1E4XL 4Z3JA 2IXQA 5ENWB 4HOZA 4AQZA 3AREC 2XOTA 3NH7L 4XVJH 3OAUL 3U46B 1Z66A 2EABA 5HYJB 5IUSA 3TNNB 1BJ8A 1CGWA 3MCLH 3R0NA 3IGAA 2E4TA 1XF1A 2VISB 4OZGF 2DJSA 1AKJD 4PWJA 3FTXA 2Q86A 3N85L 1KB5A 1ZS8B 2QVTA 4QRPE 2WTRA 1PYWB 2IFGA 4DP1X 5A16A 2FO4B 1DQML 1AXTH 5T1DH 4ORGB 3GO1H 2L7JA 2WQAA 3ESPA 3D34A 3ETTA 3HFML 2BVUA 3KBPA 3X11A 3HW7A 5L2JA 2ED6A 2AJZA 2NY2C 4C4KT 4CC4A 5FECA 2AVFA 3RX9A 3TF7C 2D4DA 1MDTA 1BECA 3HN3A 1B4LA 2C34A 3EH2A 4EI6B 1O6VA 5I1JL 1FGNH 4X4XA 1UHVA 1G0YR 5K1VA 1AYOA 4ZQTA 5DJYB 2UXFA 1CXIA 2FHFA 3EDJA 3DOSA 4BELD 5I1HH 3M17A 4DJMA 4ODTH 2IPTH 5IQNA 1QSEB 3T2NL 2JKRM 4ELMF 5CR1A 1CS6A 2R1YA 4F37F 1EQWA 2Z4QA 32C2A 4OSUL 4Z7VB 1JRHH 1WP6A 2GTQA 4J4PA 4UQIM 5L9DH 4X42A 3BKJH 3ULVE 5GGQL 3HN5A 1E2ZA 3AG3B 3IFNL 2X2YA 4LAQH 4M6ML 4LOVA 2IQAB 3T6ZA 2ED9A 2EYTA 2VDOB 1WAAA 5CU5A 3FUMA 1G7JB 4POZC 1U4EA 3O41B 4S0TD 2XTJD 2FX9H 1XT5A 5CINH 2IQ9L 4ZUTB 5JO5A 2GK0B 3MRLB 1I75A 3VRJA 4R26L 3RKPA 1YECH 4FAAB 2QPFA 3IDIB 4GUPB 1G87A 3UJJL 5DMYA 3EG9A 3MRNA 3V4PB 1IBGL 4DN3H 4DOHE 5EPMB 4I3SL 1GVIA 3B37A 1QFHA 4OZGA 1JHLL 4WDIA 5HDQH 3VXRB 2GT9B 1E0OB 1MWAA 3FO0L 4HS8H 2B8OT 4UCFA 5E95B 4IOSA 4F9PA 3GMLB 4YSCA 2W60B 4PRHA 5IEHA 3QFGA 2VW4A 3C6LA 5KJ7E 1TT6A 2CLRB 3ZE1B 4G6FB 1LHZA 1TZHB 3H2PA 4U0RB 5EU6E 1G6RL 3O6MH 2FH8A 3ARBC 4L8CB 1DBAH 4OCWL 3C5SA 4M8QB 2FHBA 3MRQB 4XZUA 2YBRB 3BGMB 2DWSA 1GSMA 4PVMA 3LDBC 4AENA 5LNDA 1BZEA 2VMEA 4C55A 1MQKL 4QHUB 4AJVA 4ONOA 2EVJA 1PKQA 3SYPA 1F45A 1LDPL 4BK8A 4DEUA 4ELMA 1JV5B 2X4OA 3MRCB 3T4AC 3PY9A 4O2CB 1K6QH 1OSYA 4PJCE 1Z9MA 5IJKC 2AK4A 3PJSA 2FIKA 3MRHA 3BZEB 1XGQB 1HOCA 3CXDL 3UTPE 1GH7A 5HY9A 3JV6B 4UWQB 5J8OA 1KULA 2UX7A 4HUNB 4DP0X 2WUBL 3OV6A 4Y7OC 3O3BB 3WE6A 1S7WA 3KHOA 2P45B 3DYOA 3H6AA 4XP1L 5DLML 5EO0B 3GI9H 1JZFA 1ZLUH 2Q8AL 1JGUL 2E7DA 4MQXC 3H42H 5IHLB 1K0ZA 1GS7A 5CZRA 1FJ1A 2WBXA 5I6NA 5LBGA 1KLGB 5LBSH 1AJ7L 3VH8G 5E5MA 2FR4B 3QQ3B 1VADB 3GDCA 1OT1A 4U1JB 5FK9A 1OAXL 3BP5A 3P4NB 1S7RB 2YZ1A 5GSVA 3PAVA 1UENA 4U3CA 5E1AB 1J11A 1S9WA 2XCMC 1G1YA 4YIQA 5IJBC 2HXAA 3LNGA 3MLPA 1F4HA 2QELA 3C5JA 1GOFA 4L8SB 5IQ7L 1A4AA 4F33A 5I1LB 2WC7A 2FQFA 3MNDA 3DRQB 2HJLA 2XV6B 4U1LA 4KTEL 4HPHA 3K71B 3KDPB 1R33A 3FRUA 2D31A 4Y1AA 1PLCA 1UB5B 2A9MH 2OM5A 3V9CA 1EXHA 2A77L 3FUHA 4W9EC 3IS0X 4N4YB 1UM5L 5IREA 4NKDB 5BMFL 1XCXA 1L7TH 1HAWA 1L7IL 5IF0B 4GIOA 2AEWA 2IADA 3HE7A 1JZHA 1KJ3H 5D1QC 3NSXA 3TYFA 3O4OC 4WI7A 3BAJA 1JFHA 4JFFA 1DN0B 1K5WA 4L8DB 2VLMD 3V6OA 2OTWA 3NABH 4JL1A 1HXKA 3LN9A 3L3OC 4PRIE 1EJOH 5ID0B 5E1IA 3Q1SL 5GZOA 1T1YB 1P1VA 1H6UA 2WBJC 4XO5A 6FABL 3SGJA 2FLMA 4WCYL 3DHPA 1TETH 1KTBA 4XMLL 1CD1B 1J9QA 3MNWA 1RZ8A 1ZWIB 4PRBA 3FU6A 3O9WD 3V0IA 4JN1L 2X70A 3LRSA 2J1YA 4M1DL 3AT0A 1T1XA 4R9HA 3F7YA 4AQOA 5D5MF 3ZMEA 5J9PB 3PWLB 3TZVD 3QDGB 1G9ML 3AY4C 5LN8A 3GRWA 3X17A 2PR9A 2C1PA 4N2HA 1DSFH 3GI8H 4UZGA 2YPKA 3NIGB 5C6TL 5DVOA 1BWMA 2HN7B 1QW9A 3PWVA 4N24A 5KBKA 4OR1A 5A2FA 2ZX8A 2M8XA 2VSMB 1I85C 2DY2A 1AZZC 3NJJA 3RWDB 4KKLD 4LDEB 3MGTB 1G6VK 3OKNA 1A6AA 5D1XC 4LNVA 5FYJE 2BMKA 1IQWL 3UG4A 2L8AA 2X4PA 3QZNA 1PTZA 3MXWL 4L4VA 4NGHH 1D7FA 4U1IA 1YEEL 1OCRB 1N6UA 5F6HJ 3X1BA 4JPKH 4NQED 1O7DC 3Q48A 5CIPA 4YX2H 2FBJL 2O6EA 1CIUA 2Z8VC 3IDYB 2J8UB 1RULH 3VXOA 1QLEH 4Q52A 3GMOA 1UZ6E 3KL0A 3OLGA 1FH5H 2AI0L 1JGDA 3FT1A 4EXKA 4LSSH 2HVKB 4I4WB 5I8OH 5B1BB 3NCFB 4NXSA 4J8RA 4HULB 1I1RA 3V55A 1FZKB 2DWDB 2ZOWA 2XWBB 1KYOK 3CQQA 4N1EA 3VDCA 1FAIH 1A21A 2VZOA 3ISRA 4NBXB 5D7KD 1E28B 2DBJA 1MNUH 5GS2H 3THMH 1DUYA 1AKJA 3IU3A 2B0SH 3WY1A 1KIQB 2EC9U 2FL5B 4DAGL 4BFRA 2Y3AA 5I17B 3D25A 1Z2KA 4NENA 2Y1VA 2ESVE 5DYOB 1AO7A 2Q10A 1NPJA 2B15A 3FQWB 2XWCA 5GRXG 3O2VH 2GKIA 3MJ9A 1TCRB 3RFRA 5IFHH 1OAQL 4JDVB 1LE5A 5ANMB 1R3IL 3WG7B 5D5MA 2HPOA 2FQEA 4Y4HA 1LO3L 2A6KB 5MHSE 2EUVA 5FOBA 2Z6FA 3Q2LA 4GXVL 3OHMB 4ODBD 4FTVE 1NCDH 4ZXBD 1CFBA 4RWHA 1EXUB 3B8YA 5CSZB 2QVIA 2O6DA 3EYVB 2H2PD 2UXVA 4UTBH 5DJCB 3ISWA 3GXUB 2ITCB 5CF3A 3QBTB 5JIPA 2QZ5A 2J1KA 4UM9D 3FO2B 3ZRSA 4Z77A 4ZMWA 1T2XA 5A2BA 3IJ8A 1W72L 4FP8L 1V5JA 1BFOB 1YMMB 4P0DA 3RX7A 3VGAC 3NJMA 2ZOLA 1A7NL 1NMCC 2CPCA 1E42A 2GHZA 2G75A 3MV01 1QBLH 1RZKL 2CJTA 4OZIE 4U1GC 4U6HA 3RWGB 3BP7A 2B3RA 4X6EB 4LLYB 4BA0A 1M71B 3CFKB 4NKMA 4AV4A 1ITCA 1MCKA 4RFEB 5FFGA 4UT6A 4Q8BA 4HIJB 1YHPA 3JWNH 4WTWA 1NBYA 4UILL 3RL1B 3IBOA 1KB3A 2MOGA 4HPOL 1Q90A 4QPEA 5D7IF 1AZNA 2GUOB 5AENA 1AANA 1KEGL 2V2TA 4JGNA 4NFCA 3S5LB 4BYHA 4JY5H 3CH1B 5J57B 4JFYB 1G4MA 1PD1A 1W80A 1SQ2N 4UQ2B 1XTMA 2W65A 3WS3A 3MI6A 4P59L 1GIGH 3NFSH 3P77B 5EDSA 4LKCB 3NBNA 1CDBA 1ULVA 3UZVB 1DUZB 2RFXA 3VG0H 2GSGB 1OTTC 2N3JA 1FN4B 3WHE0 5E8DH 2QMJA 1NGXA 3BPNB 1LP9F 2P80A 5IQLA 3UAEA 1DL7H 1A4JA 3AFLA 1SPDA 4HD5A 3OLIA 2HKHL 4E41D 3MBED 4OD3L 3U0WL 2OSYA 5HHXH 3VFSB 2F1EA 2HG0A 4ZYKA 4Q6KA 5LXGL 5EBWA 1OAYL 3QIUB 4XCYA 1DTUA 1A3LH 5AW9B 1JGVH 2K3TA 4FJYA 5F7BA 1R9FA 1A1OA 2K3HA 1T20A 2BJMH 4FXKC 5C07A 3H4FA 1JWUB 4CL7A 3F58L 4WY7L 4K07A 1CFTB 4MS8D 5KYUA 5DHVA 1ND0B 1KN4H 5DF0A 4JEGB 2OKMA 3QQ9D 3M1CA 5KVFL 2IANB 1FH2A 2HG5B 3F01A 3QEUA 3LPPA 1D9KD 2DTML 3IJYB 4PYHA 3K5SA 3RTQD 3TVMB 4P8QA 1OEZW 1F11A 4DF9A 3VI3F 3W0WB 3HVDA 1G7HB 4IS6A 4BWUA 5D7IA 4X98A 2X38A 3O2WH 2XT1B 5DUBA 4BSVA 3B9AA 3OTTA 3FTWA 3UJTL 1BFTA 1KBWA 3B3IB 5ITBH 4OM0L 3P0YL 4QTHA 5HHPA 4KUCD 1U2YA 4LQ1A 1DP0A 3FCUB 12E8H 3W9DA 3V4PL 1A9EA 3LH8A 4O2EB 2IVFC 1SJEB 3LQAC 3MRPB 1L9SA 2LGNA 1LP9A 5I6OA 3QORC 4K94L 1Y07A 4QRPD 4Y4FB 3F62A 4KPHH 3UJIL 4HMEA 4BKSC 3SOTA 3UH8A 2FGWH 4HW6A 4BQ6A 5E24E 4B53A 4ZFZA 2WO2B 3FQYA 2DIJA 2V2WA 3M8OL 1TQBB 2IALA 4YQXL 3ZHKA 4AUYA 3QDHA 2DBLL 4HKBA 3N5AA 2Q9OA 2VQ1B 4B0MM 4XWOD 5F7EL 3P4OB 4LSUL 4RMQA 3SCMA 4N8CH 3DOIA 4OD2B 5IHUH 5C9JB 4YHPB 5B39A 4XNDA 3ES6B 4JDTL 4WVRA 3N6YA 2WVTA 5GJTH 1RJYA 3KXFA 4B50A 5EC2B 1JDDA 4PLJC 3NIDF 4XNYH 2NY6C 3GJFK 4DFHA 5KJ4A 1WCBB 2OJEA 2Z3FA 3TJEH 4FQ2H 3GSVB 3HZMB 4FQLL 1EHLH 2BFVH 4EIBA 1L0YA 2VAAA 3FPXA 1THAA 1A25A 4V2CB 3VI3A 1KCUL 5I76B 1I9JL 4BCXA 3T8XB 2D0HA 3FUEA 4W9LC 5IV2B 3AS3A 3NDZE 1T89C 2EEAA 3AB0B 1G9NC 2WLLB 4LLWB 4G7VH 3G6JF 3MOAH 2BX5A 1CVSC 3GSUA 1BM3H 3OXSB 2OXHB 4YXKH 1EZVX 1NGQL 5I5JA 3SGKC 4DGWC 1YAIA 4MAYC 4N2LA 1UM6L 3IPBA 4TUKH 3E2HC 4M8UA 3VVWA 5KOVC 3VXPA 1NM4A 3VFGL 1P6FA 5CNHA 4PG2C 1GZQA 2AJYL 2WXNA 3IWUA 2WZ6A 3GZQA 5C0AA 5DD0H 1E6JL 5KYWA 2I5YL 4HS3B 1Z9NA 2QSCH 4LEEA 4N8VB 4XCFL 3UTSA 3MLUH 2WXOA 3HRZC 4PY8J 1EEZB 2BSRB 3L4UA 3ARBA 4G43B 4PB0H 1Q9OA 4KKRA 1OGPA 3MV7A 4KDTC 2GBAA 2X40A 5ESQA 4I3RL 5EU6D 4OF6A 4KHTH 4PU2A 2VLRA 1OE3A 3RGVD 4GQ9L 4XT1C 4HG4K 5L7XL 4XPHH 4YDLB 4JPIB 3VFOA 4ZOEA 2NRDA 4F8QA 3T4AA 4IRJC 1VCBC 3UBHA 3QH3B 3QJOA 2VWEE 3D05A 2EQDA 1CIDA 3W2DL 1CYGA 2HFEB 2XQYA 3QFDA 4R83A 2ADJA 3R1GH 4K3DH 3L1GA 3SO3C 4IBQA 1HH6A 4NYLA 1KN2H 5AVQB 4GI9A 1M3IA 2BIHA 2DQJL 3D39A 1I7ZA 3HTLX 4LCWE 1ZE3C 4FL4C 4WTQA 1G5AA 5A2LH 3U4EB 2YAHA 5BCAA 2WIIA 5JIKA 3V0EA 3MLXH 4Q2ZA 1KENH 1HEJC 2ITDB 4QF1B 3G6JA 3QG7H 3H55A 1P7KA 3VFWB 3DJZA 3FOMB 2WQRA 5I16A 4IKLA 3LEYL 3MOBL 4XOAA 4NWUL 3WKQA 4Y9EA 1GS8A 4XVUD 4BCZA 3FQUA 3KWUA 4FQCH 3DLQR 3L4CA 1PDKB 1OVZA 1N18A 1VFBA 2NXYD 4U6XA 3L3DA 5HGBB 5J1AA 5EZLA 4ZG1A 3QUMB 3BD3A 3QZWB 5HJ3B 1KFGA 1HS6A 1FFPB 4PV8B 1OAJA 4B9GA 1IAIL 3V9FA 5JQ6H 2PYFA 4NT6B 1EMTL 4KI5E 3CLEL 4NN7B 5KSVA 1J87A 1RFDH 1CUOA 1IAOA 2M2DA 1BVKA 3R19A 1QFWI 1DO6A 1E30A 5AKSA 1H0DB 3KGUA 5LQBL 2IOMA 3PABA 1I7UA 4A6YH 1AOZA 4Y19B 1V3MA 4CN1A 3GHBH 2CGZA 1FYHB 4NIYE 5D1QA 1A5FL 2C9UA 1KFAL 4Y5XC 2PWGA 2ZTBA 1YY8A 3IGFA 3IXTB 1HKFA 4NQUA 2J6WA 5FYKH 1A6WL 2Y5TB 4Y89A 2DJUA 4D8PA 3L3OA 1A7PL 4PRDA 4QRQA 1GW6A 5J11C 1OAKH 4RMSA 1NFAA 3LEXB 5FYKE 2QADC 3WJLC 1VFOA 1UA3A 4X7DC 1V54B 4OY9A 5C0IB 3BPCA 4NQXB 4PRID 5DZ9A 5HPMA 4KV5F 1M7DA 1S7XB 1H3WM 2CLVA 4B9CA 4M61A 3ZKNC 4TVPH 2GJZA 2QT6A 2KZKA 1UD8A 3A4EA 3BEVB 2OL3B 3HB3D 1MI5E 4KNUA 3FBKA 1MJ7L 1H15B 4WHYH 1U8IB 1CLZL 2E7BA 2UY6A 4JFXB 4TVPE 2WAHA 5C08B 5JXED 1GCYA 2EKJA 2BY3A 5GJSL 5BV7C 2AQNA 3KVPA 4FG6D 5GS3A 3O2DL 4DVBA 3FW6A 4OF5A 2DL2A 1CTNA 2H41A 3U7AA 3MBWB 3UBXI 4PVLA 4F58L 2J55A 5A2JH 1PPIA 4WENB 3LN5A 3AQYA 1DQJB 1U8LA 2H0EA 3VB8A 3C60D 4UI2A 5DSCA 3TA3D 3EO1A 4LGSB 4TTDC 5EUKA 5LG1A 5JW5B 4JRXE 1ZT1B 1XF4B 4PJEE 1G0DA 5SWZE 3ULVF 1CGSH 5EN2B 5FYJD 1HH9B 3L9RA 3DETC 4AV5A 4HCFA 4UU9B 5C3IA 4ZOAA 5L0QC 2EYSA 5DJ6B 3APNA 1UD3A 3CHRA 4GRLC 4PRAA 4UF7C 4MJJA 1SM3L 2EDBA 2EE6A 3PDGA 2J71A 2DKUA 3VXUB 5AG9A 1EUTA 1S9VA 2A9DA 4C56E 3UEZA 3S5LG 4O00A 1A66A 4X6BB 1JGLL 2IXQB 2WNXA 5CZXC 4LEXL 1NGZB 3CVBA 4OIAA 4PW4A 4OQTA 1H5BB 1TQCB 5KBPA 3WXVH 2E27L 4MXQD 3Q0HA 5FPIA 3BKML 4B3VA 5IG7A 1ZHBA 4YHLL 3IGAB 1SLUA 2FE0A 2H9GA 4XBGA 3ETSA 3BAEH 2ESVD 2P46B 3CH8A 2Q86B 1OQOA 4G7QB 2WTRB 4XO4A 1SUHA 3QAZB 2BH0A 3DHMA 4KK9D 4M4RA 1WT5C 5A16B 4BWWA 1ZIAA 3OF6A 4XX1E 3X11B 5L2JB 5MHSD 4JFDE 4PJ7E 1B0IA 2AJZB 2DM2A 3SJVA 5FECB 4BKLA 4FTVD 2YD0A 1DJZA 5I26A 3WSQH 5AEAA 5BZWA 2R1XA 1XQ4A 1MFCH 2I32A 7FABH 4X4XB 1QA9A 2GABA 2HRGA 1H3VA 3NGBC 2XI9A 3FZUD 3JT0A 1FUNA 3MXVL 3RP1A 3EIFA 1VZIA 2CDFA 3DOSB 1IC4H 3T0WA 5BVPH 2YRLA 4V1DE 3TT1L 1U33A 4AIZA 1UYWL 4N2CA 3M17B 1ZGLP 4IDLA 3ECVA 5KTEH 4AYEC 2VXSL 2R1YB 1PU0A 2Z4QB 32C2B 3MDJA 3VQLA 2XHNA 5CP3A 3QA3B 4DO4A 1CDHA 2BM3A 1CFSA 1UCTA 3FU3A 4N2FA 5H35A 3D2UD 1B3IA 2EYTB 1M3JA 3GBNH 3FQXB 2LVCA 5BS0E 5J4MA 5C0BA 3T3PE 3UMNA 3WNOA 3NJKA 5MEOA 2ETWA 5JO5B 1T80A 1F42A 4D0BA 3VRJB 4PMEA 2QLYA 3GXMA 3F65A 4NZUL 5EA0H 2WGXA 4GRMA 5K9OA 1JXFA 4ZOBA 5ECGA 1BQ5A 1JI1A 2ZX9A 3EG9B 3MRNB 3NK4A 4JG0L 1EEYA 1BEYL 2V4LA 2PKDA 1GYAA 4OZGB 4WDIB 1E5AA 5FLVA 3CN2A 4I8DA 1A6VL 1OQXA 1MWAB 2BP3A 2KC0A 3K6SA 4XP4L 4OKVA 3ZR6A 5H8DA 4O02H 4DHLA 3CE1A 2RACA 4WHCA 4PRHB 5HGDA 3MA9H 5IEHB 4G8IA 4RESB 2C9PA 3O0RL 5E2UL 3C5XA 4TL5A 4EUPA 1N7ML 1A4CA 5E2JA 2HUEA 3QI9A 2J5WA 4HIQA 4H2AA 3VMOA 2YEQA 4AQ8C 3MJ6A 1QZNA 2Y7QA 3ZDYE 1TFHA 1OM9A 2YGPA 3LKPA 4FXKA 3PG2A 2JH2A 3C5SB 4XZUB 3PIQA 3RFZC 5DUML 1I9IH 1N68A 4P2OD 1RIVL 4XOCA 4X9IA 1GS6X 4AENB 3S3JA 1KMGA 1FIEA 1XZWA 2C9VA 1I8LC 3MLSL 4UMSA 1IKNC 5I75B 1PKQB 5KN5B 3RA7L 3LIZA 4FHKA 3TJHD 4ELMB 1DVFC 1CFVH 2EACA 2X4OB 3B9VA 4EE2A 2ZUQB 5KZCB 2X0WA 1KYUA 2AK4B 3P4LA 3PJSB 2FIKB 1I9RL 3MRHB 5AG8A 3MODH 4H8WL 1A7OH 1HOCB 1J1XL 4ADIA 4FG2A 5HY9B 3HC2A 1NUNB 3CX5K 3DX4A 4PWIA 4R8WH 4WJG3 3WE6B 3IMTA 1A22B 1FDLL 1S7WB 3IDMA 3WIHL 4HX1A 1JTPA 4EN3D 4HLZH 5T8IA 5IVXE 2GTZA 3UYPA 3LS5L 4XBEL 3DX1A 1JRHI 3TA4D 3CGTA 1FJ1B 3BRFA 2NSMA 1EWHA 3WHE1 2I07A 4HC1L 4BIKA 4FHJA 3ARYA 2P8LA 3F7VA 4M6OH 1IBDA 2C9XA 1LO0L 4FG4A 4YDJA 2BS8A 3LYRA 4Q9RL 5FK9B 3QORA 4C4BA 3BP5B 2DYPA 2V3FA 5GSVB 2NT0A 4IIQC 4ZNEA 2PCYA 4AV0A 3JWDH 3VD0A 4N8VG 3VFVB 1SBBA 1S9WB 2CBPA 4AGOA 4YIQB 2WLNA 2XX0A 3D69B 2JKJA 3C5JB 1SQMA 2MPAH 2DQDH 3CXHK 4F33B 1DBML 2X4TA 3AG4B 2HJLB 4U1LB 1FYTA 1OP5K 2NY5L 3QCVH 1FSKC 4NKQB 2ZJSL 3FRUB 1FV1A 2D31B 4UTAH 3QJRB 4Y1AB 5E2WH 3QZPA 4UUJA 1AE6L 2AXWA 1UZ6F 1UWXK 4JMXA 2F5BH 3IDJA 4ZX3A 3FCGA 5I9QC 2P4AB 2V8LA 2B3IA 5ITFA 1KTDA 2IADB 4XH2A 2OMVA 3HE7B 2YGVA 1P6WA 2X05A 3TYFB 4W9GC 3PNWA 4MVBC 1AZCA 2G0KA 4CW1A 4JFFB 1D2PA 2ZPKH 4G9FE 1INEL 1IM9D 4JFEA 3L2MA 2OTWB 5AUMA 3FAWA 4UV7L 4HJEA 2E86A 1OO2A 2Z7YA 3LH9A 5DC0A 2EDRA 4PJBE 2BZ7A 2EDWA 2ERJC 5SV4A 5FM4A 3SGKA 3V0JA 1P5VA 2FT8A 1ICTA 1CGUA 3CFEA 3L6FA 3EZJB 5AVSB 3MNWB 1RZ8B 4PRBB 4CKQA 4WF7A 4O51A 2X70B 3LRSB 1A02N 2WQVA 4H1LH 4I87A 2YAFA 1T1XB 3SDDA 3S8GB 3F7YB 2K7PA 1CL7H 3PFUA 2H0JA 2C1PB 4MA7H 5F9AC 2X6VA 3G6AA 4XMWA 3FQTA 3TA3A 2YPKB 3UC0L 2VDPB 3KLQA 1X7SA 2XY2A 3QZWG 3PWVB 1NDTA 4K3JH 5HGHA 3DURA 4GRWF 2XU9A 5E6YA 3QUML 3BSGA 5CEYA 1PAZA 2F19H 4AQEA 3EDKA 2QR0A 4BQ9A 2DM3A 3OKNB 2AK1L 1A6AB 5I6XC 1JE6A 2BMKB 8FABA 2X4PB 1JK9A 3OB0K 4L4VB 4U1IB 5T5FH 5F88A 5I1IH 1CE1H 2NX5E 3H4HA 1QYGL 5CIPB 2EO7A 1IC1A 3VXOB 4FYRA 1N0XL 1JDCA 3GMOB 5JHBA 1JGDB 2ZP9A 5HDLA 3IVKA 2QTVA 5JMOC 1A14H 4J8RB 4J27A 4MAZA 1HU8A 2JLLA 2E7LA 2A9CA 4DSYA 3BKCL 4JKWA 3V52L 5JQIB 3BWUC 1CDGA 1KBKA 3SDCA 1DUYB 5ID1A 1AKJB 3NRPA 3IU3B 4LCWD 1HKLL 2BNRE 3TBTA 2VDNH 1AFVH 3MTRA 3LTVA 3D25B 3ESNA 3ISYA 4LCVA 1MSPA 4NENB 5AW2B 1J86A 1AO7B 2I85A 1NUGA 5HVHB 3BDYH 3BUPA 3ZVVA 4ZS6C 3SDAC 2OL3L 1KWGA 2JKNA 1LE5B 1KELH 2VQUA 5D5MB 4Y4HB 1KXHA 2OP4H 3SKMA 1TUPA 1OP9A 1RVFH 5FOBB 2K9UA 1JZGA 2BY0A 4AEIL 4F91B 4GSRA 5HJGA 3TCLA 2OBGA 2HFGH 2CGRH 2R0ZL 1Y6MR 4MJHA 4RGNE 1FHNA 3OKLA 5KSAC 4CSTA 1OCCB 3SPVA 1IGIL 4Z77B 3HBPA 1VGEL 1FFNA 4JQXC 1NINA 2DQUH 4LSQH 2Y0SA 5I8EB 2ZOLB 4KI5D 4PB9L 5INDA 5DMJB 4WZ9A 2Y36L 1X3DA 1BQUA 1FZOA 3BVWA 2G75B 2WWKO 3MMEA 5TK2A 5JHLL 1EEUA 5C6WH 2UZIH 4A39A 4U6HB 1XGPA 3BP7B 3UO1L 3OSKA 4GQQA 3CPUA 1NAMH 4NKMB 5HHOA 2F54E 5KVDH 2OSWA 1NBYB 2HJKA 1QACA 3EZ8A 3WAJA 3AUWB 1BMWA 4M6AA 4J3UA 1HL8A 2HT2D 2WINA 5HHVH 2V2TB 2J8OA 5C2BL 3B5HA 1IKFL 1TQUA 3BZ4A 1T03H 3VA2C 4TM9A 4AIXA 3MV11 5E8NA 2YLHA 4JPWL 2WWOA 3STZA 4OGXH 4IU2A 5FYKD 2W65B 5E6ID 3WS3B 2A0LD 1X4ZA 1CD0A 3LB6D 1QFUL 2I60L 4J3VA 4ZTOL 1WZKA 2RFXB 4W81A 3L1FA 4FN0A 4AH2A 3BISA 4G6KL 4GFXA 1NGXB 3KG5A 2DQFA 4W9DC 5B1CA 4MA1C 1KCVH 1A4JB 1E7UA 1MI5D 4FQXA 3FXIC 4YBLB 3TNMA 4IBVA 3KPPA 2ZKWA 1JD7A 4IHOA 4TVPD 5TQ0L 4PGJA 3HNVH 4EBQL 3GXPA 4K73A 3F2LA 4ZYKB 3CN3A 5EBWB 4XCYB 1I1AD 5AKTA 2P5PA 5IBTL 4E9LA 4CGUB 2GBVA 2MHAA 1A1OB 4OCSL 3U48A 4I2XA 4LL9A 1T20B 2EVIA 5C07B 1E8YA 1NGWB 1AQHA 2OR9L 3MO1A 4YHZH 4DPRA 1R0AH 2G3NA 1ZSDA 5F96L 3NACH 5DHVB 3BVUA 5GRJL 4JRXD 5KYUB 2ICWA 3TONA 4YSTA 3WS6C 4Y4KD 5SWZD 3AXLA 1UXLA 1J1PH 4JDZA 2XTJC 4JUSA 1FG9C 3QEUB 1W91A 2EIJB 4S1SL 4W4NA 1PY0A 1PZSA 1OT2A 1NCCL 3S35L 5FB8A 3DTUB 3W81A 2AV1A 2R2BA 3CZGA 3S2CA 3DJ9A 1IL1A 5CJXA 1F11B 2VDKH 4IS6B 4FZEL 5D7IB 3ZGIA 3GBMH 1HEZA 4L9DA 4X98B 5D7HA 5MI0C 5EF3A 5DUBB 2VXVH 2PWDA 4BSVB 4C56D 3GLEA 4H0HB 5HGGS 2G5BA 3OKDA 2V33A 1OAZH 1MCPL 4XGZA 4ZO8A 3ZPDA 1WAEA 3CVHA 1ACXA 3OPUA 4QTHB 4UQEA 5HHPB 3KL3A 2PPCA 2CAKA 1T66C 1ZVHA 3K5RA 3BCFA 3W9DB 1JGIA 1I7RA 1SY6A 1A9EB 4XNXL 2DW5A 4Y8DC 5SX5K 1YNLL 1RZJL 5E2VH 1MWAL 2V5TA 1LP9B 5GGRY 4PUBH 2JLPA 2XIBA 5IZ7A 2XKNA 4HUKB 2NY2B 4Z3TA 3EGDA 1X5AA 3CFIC 4J3XA 3ZDXE 3WY3A 4NO5A 2AEOA 1CXFA 2IC2A 4ZFZB 2OZNA 4HAGA 4JHWL 4ODHL 3HG1E 2V2WB 4OGAD 1MVUA 2IALB 3CBJB 1NJ9A 1KEMH 1ZD6A 1TFPA 2BIOA 3DPDA 2YD1A 4Z7NE 5CN3A 1J5CA 1XV8A 3SCMB 3Q9PA 3U9WA 2QPEB 1N5YH 2NMSA 2FDBP 3OJVC 4M7LL 2G60L 5B39B 5CLXA 4KMTL 1MAML 3FRPA 1RJYB 1OD7A 3KXFB 5EF2A 1BVLA 4X83A 4AEHL 2WHVA 1A1MA 4AY0A 2LTQC 4V1DD 1GSKA 4HBCH 3WELA 4BGLA 2OJEB 4G6ML 1OARH 2ZUSA 1B2WL 3IF1A 4X9GA 3BOVA 1JZ4A 2YPLE 4X7EC 4ZPTA 1AACA 4G82A 2VAAB 1BIHA 1JZ6A 3MBXH 3ZKQD 3VI3B 3VXMA 4BFKA 2MIZA 5I5RA 1RZQA 4WI4A 1T7WA 4TOYL 4HSQA 1QTYT 2WXFA 1GC1C 5BS0D 2OX5A 4LHUA 2VT0A 1KDJA 1G7QA 2SEBA 3GSUB 2EVHA 1U8CA 4E9QA 2EH8L 3QSKB 2A6DA 2ZXWB 2H1PH 1QP1A 1QBAA 4KO5A 4ZW7A 2P5EA 3RKDD 4FFTA 5IMMA 3VXPB 1PSKL 4QLRA 5I1DA 1GZQB 2CZNA 3BZDA 5C0AB 4F2ME 1DHKA 1L4IA 1ZLEA 3S36L 2C3XA 1KJ2H 3FO1A 5I6MA 5T1JA 2YD8A 5JIMA 2XQ0A 5KYWB 2ZUUA 1S7UA 3UTSB 5JA8B 4AQ8A 2A74C 4DP9X 3ZO0A 5KVEH 3Q7JA 2RHEA 1JIBA 2YUWA 3G7TA 3ARBB 5DVKA 1BZ7A 1Q9OB 3MV7B 2BNQA 2V5MA 5ESQB 4B0MB 1TO4A 3BE1H 1IC5L 3LDBB 3MV9E 1AXIB 3QULA 5AYTA 3WFDH 1I8LA 2VLRB 3BQUD 3A23A 1Z0MA 5DD1H 3U1SL 1PZ5A 1G4RA 2YAMA 3VFOB 1DVFA 3T4AB 2O30A 3R4RA 3IWVA 1PEWA 3NIDB 3RI5K 4ES8A 2RJMA 2VMDA 3QFDB 2ADJB 2KLSA 2X41A 4FHBD 3K4DA 2QQLH 4FG0A 4NYLB 1HH6B 3ZDZF 1E4XH 4F5CE 3D4CA 4R0LC 1ZLVK 2UWEE 1QNIA 3NH7H 4ZS7L 4XNBA 1EVUA 3D39B 1I7ZB 1TZIA 3O9WC 3OAUH 1FFOA 3FFOA 4YLBA 5GGTH 2WIIB 1P5UC 5C7ZA 2KZ1B 4NZRL 4Q2ZB 3TZVC 3G6JB 3S6CA 5HDBF 5HI4D 1P7KB 4KO9A 1S9YA 3KLHD 1F6FB 5FO9A 5I16B 3A67L 3BSZA 2K8MA 3P69A 4KKPA 1YEWA 1WISA 3OJDA 1G43A 2X1WL 1XCTA 4IIQA 1DQMH 5ACMA 2YD6A 3HFMH 2ICEC 4OFYD 4EQ2A 2JKWA 3FQUB 4KKLC 2HRHA 5KSUA 1GL4B 1IFRA 3GRWL 3E6FA 4QNPE 1FFRA 3ZE2E 3WHXA 3B7UX 1PVHA 4HJSA 5DR5H 1VFBB 2VDPL 3INUL 4U6XB 3MN8A 5J1AB 3CSYA 1SLVA 5EZLB 4AK2A 3ZKXB 5DHYA 3NMEA 2WTPA 5I1JH 2VABA 3WMPA 2HLAA 4AJWA 4LPTA 4AIEA 1HVXA 3O45A 2PYFB 5C97A 2CHXA 5FO2A 2NZIA 4KMQA 5CJQL 5FHAL 3VGBA 2O5YL 5KSVB 2A83A 3T2NH 4A2HA 4AZUA 3L4YA 1IAOB 1BVKB 4OSUH 3QR0A 1S4IA 3PXLA 3T2PA 2BIQA 1ZSHA 3PABB 1I7UB 3DO3A 5GGQH 5D1QB 1G0XA 4M6MH 2JXMA 3QUXD 1YY8B 1QD0A 1B4JL 2ZYRA 1J0ZA 1HHIA 4MD4A 1XZ0A 1QR4A 3D4ZA 3DSFL 4HSCX 1J1OH 5E6IA 3NSDA 3L3OB 4PRDB 4D8PB 5DA4A 5KUMA 2IQ9H 4QRQB 5IIEA 4ANKA 2NW2A 3FU7A 1LMIA 4R26H 4P46C 4G9FD 2DLTA 4XMUA 4DPAX 3UJJH 1OGTB 3UZQA 5BZZA 3BPCB 5HPMB 1IBGH 1M7DB 2QPDB 4YBQD 5HTSA 1QFOA 2DWTA 2CLVB 1ACYL 2DJ4A 4I3SH 4LSTL 4M61B 3WKMH 1OF2A 1UACL 4MQTB 2GJZB 3FO0H 4FGMA 2QV2A 1F4XH 4R3SA 2HKAA 1L3WA 1MDAA 2H2PC 3MJ9L 2BCKA 4QAWA 2F6AA 2YQBA 4M48L 2UY6B 3H54A 3II1A 4PAZA 4NJAL 2NYYC 4PN6A 3Q43A 4JM2D 1MN4A 1VLXA 1EDQA 3OAYK 4AQ1C 5C1MB 4XPBL 4DVBB 1G6RH 1F4AA 1TIUA 3ATDA 1OWRM 2YAOA 1OB0A 3GFUA 4OVVA 5DVMA 3QZBA 5IFJA 4BHUA 1N26A 4OI7A 4JRXA 2NDFA 5DD3L 3FONA 3LN5B 1U8LB 3NCJL 3U6RA 2Q20A 3BKYL 3WIIL 1MQKH 5DSCB 1OY3B 3EO1B 1KGCE 5EUKB 3T1WA 2AZAA 1QASA 4HGKC 5F7MC 1N9PA 3C2SA 2YQGA 5D6DC 3NCYP 3V0FA 3KL5A 4YHOL 3L9RB 1YC8A 3EF4A 3PUCA 1XGYH 4TF4A 3X1GA 2YWZA 3GSXA 3OJMB 2EYSB 4XMZA 2NX5D 5F6HI 3RIAK 1U8NA 1LDSA 4PRAB 2E9JA 3HPJA 4GAGL 1IARB 3HMXA 2WUBH 3ZMNA 3T3PF 4UT6L 4X2UA 1S9VB 2EICA 4XP1H 5JOEA 3FUJA 2KLTA 1GY1A 4GP8B 2Q8AH 2Z31A 1JGUH 3EJYD 1JZ5A 1S2EA 3PQYA 4NKIL 2B4CL 3RDTD 1UWYA 3IMSA 1M6OA 4ZTPL 2KDGA 1T0PB 2CO7A 3CVIH 5IG7B 3VWKC 3MROA 3NJIA 2BNRD 5A7BA 1ZHBB 1OAXH 3WY4A 2H9GB 1I3VA 3JV5A 4XBGB 5DYFA 1OF0A 2GQHA 2YUVA 3CXHJ 5C70A 2FJSA 1WO2A 2WCPA 3HLAA 1KGXA 1X5JA 3R7RA 4JFDA 1DLHA 1YYLL 3ECQA 4LU5H 4M4RB 1ASPA 1M1XA 4QHKI 4LMQI 4A38A 5IQ7H 2DQHL 4XMPL 1F90L 1XR9A 3CSBA 1RPKA 1EZVY 4KTEH 4PWFA 3SJVB 1IU1A 1T22A 4H0LC 5GRWA 4BKLB 5KSAA 2H1XA 4HWEH 4MS8C 4Z3HA 5BZWB 3DDGA 1IZKA 4G83A 2GIYA 2R1XB 1RP9A 4JQXA 1QA9B 1FVDA 1GOGA 1UM5H 3VGAB 4RGND 1B6UA 1USZA 5LVEA 1D9KC 4TNGA 4XPFL 3RTLA 3VVVA 2CDFB 4WSJA 1L7IH 4AIZB 4HP5A 2D7TL 2YAEA 1IZJA 1F18A 3MRDA 3ARFC 4GS7C 3MOQA 3FCTA 3V8CA 2QFRA 3MTXA 1DDTA 5IROD 2IWEA 1V3JA 4DTGL 4F9LC 3BVNA 4M7KL 1CFSB 5F3FA 1JHKL 3P3UA 1ZV9A 4NKOA 5H35B 5FCUH 5J06A 4UBDC 1VKXA 3ULUC 4OJCA 3Q1SH 2BSSA 1W0VA 5JORA 2F54D 2WCGA 2FECI 5IVXF 3TP4A 4XI5D 1KYFA 1MQ8A 1UQSA 4FXGC 3DSNA 4NN5C 1YO4A 1WV7T 4Y2DA 5C0BB 4CMMA 1EO5A 5MEOB 3N9GL 4Z5RA 2D0FA 3II2A 4D0BB 5B8CC 5D2LE 4JN1H 3RAJL 5K9OB 2K6ZA 4GRMB 3ZTEA 4M1DH 1UKQA 3R4DA 1EEYB 1PKOA 3VDBA 3OSVA 4RA3A 3FB5A 4NI6A 4A2FA 1TZ8A 4I7ZC 3K6SB 1RZIA 5AWNH 4P2QE 3P11L 4OKVB 5C6TH 2YD4A 4KTDH 4MMZC 3RJQB 5HGDB 1P1ZA 4G8IB 3UTTA 4I9WE 5CUSL 4EUPB 1CXLA 4FX5A 2VO5A 3QI9B 7CGTA 4YE4L 5I0VA 1TXKA 4LVNB 4LT7A 2V9TA 4PJ9C 3CMOL 4NP9A 4JFQA 5BRZE 1F58L 2Y7QB 1UVQA 4U7KA 3IDXL 3LKPB 1LJMA 1IQWH 4FXKB 4I85A 3RRQA 3QUYC 4Y1SA 2O6PA 3MXWH 3WU1A 1TNMA 3PIQB 5B39G 2Z1PA 4MQSB 2VKXA 2JB6A 2FBJH 2EEBA 4KH9A 5HYQA 2FJGA 3N1GC 4YFEA 2AI0H 4NO0A 4BFEA 4HU2A 4GKZA 4PS4H 3DOHA 1P4UA 3VD3A 3AT8A 3IPFA 4ZW5A 5FIEA 4B9PA 6PAZA 5JIDA 2EAEA 2XBDA 4E9WA 2JQAA 5E1HB 4P3WA 1AG6A 3WTUA 1VERA 1WFJA 1ERNA 5IVXA 4DAGH 5JW4M 4KKAD 1WUNT 3IDMB 4GO8A 3ABMB 1C8QA 3GKWL 4HX1B 4TLKA 2IGLA 2GTZB 2H4EA 3UYPB 1OAQH 2N7BA 2I07B 2MCG1 5GISL 1R3IH 2YRPA 2P8LB 1X6LA 2ZZUT 2W38A 4YDJB 2WKLA 3BPOC 1LO3H 4BK5C 4EI5C 1AIZA 2XICA 4D7BA 3QORB 4W9JC 3F7LA 4RMBA 2DYPB 4ANXA 4PI2A 2UZPA 2QGBA 4N85A 1T4KA 2X2HA 4WO0A 3RIFK 5BO0D 4F7TA 1BCIA 4KQ3L 4S1RL 1KXQE 1IVTA 4LCIL 4L1TA 2X4TB 4E9TA 3BPLC 3KDMA 1X5XA 1QHPA 1T3FA 5EEUA 1FYTB 1WFNA 3HG1D 1W72H 4FP8H 4WU5A 4PLOB 1CVRA 1FV1B 5E6RB 3TN0D 4F1ZA 2VMFA 2OR7A 4JAMA