2ODJA

Crystal structure of the outer membrane protein oprd from pseudomonas aeruginosa
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
426
structure length
382
Chain Sequence
GMFVSDQAEAKGFIEDSSLDLLLRNYYFNRDGKRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTDYSRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGDQPFDYIGFGSIFLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into OprD substrate specificity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Porin D
total genus 93
structure length 382
sequence length 426
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2odjA01
1HXUA 2XE2A 3K19A 4D5UA 1BH3A 2FGQX 4GCPA 8PRNA 3UPGA 3T24A 3SYSA 5JDPA 1GFMA 3T20A 2PRNA 2ODJA 3HW9A 6PRNA 2XE5A 3HWBA 4LSFA 4GCQA 5PRNA 3POQA 2J1NA 3SZVA 3JTYA 4FOZA 3VY8X 4FT6A 2Y2XA 3VZTX 2ZFGA 3VY9X 4FRTA 3SY9A 3NSGA 3A2SX 3VZUX 5FVNA 4GCSA 2J4UP 3WI4A 4C69X 1MPFA 4KRAA 4BUMX 3PRNA 1PRNA 2XG6A 3SZDA 3T0SA 2PORA 2Y0KA 4LSIA 1OPFA 3POUA 5DL8A 4D64A 3SY7A 2K4TA 2QTKA 3O0EA 4D65A 4FRXA 4JFBA 1GFQA 4FSOA 2XE1A 4FMSA 2Y0LA 3UU2A 2O4VA 2ZLDA 3SYBA 1H6S1 4FSPA 5DL5A 3POXA 1GFPA 3WI5A 3FYXA 4RJWA 4KR8A 5DL7A 2FGRA 7PRNA 5DL6A 4RJXA 1OSMA 2Y0HA 1GFOA 1HXTA 4LSHA 1PHOA 3VZWX 2OMFA 1BT9A 4LSEA 4KR4A 1GFNA 2XE3A 3EMNX 1E54A 3PORA 1HXXA 4AUIA
chains in the Genus database with same CATH superfamily
4GHBA 1HXUA 4RL9A 2XE2A 3AA1A 4XNLA 3AA0B 5KAFO 3WU2O 3LK2B 3K19A 4N75A 4AKRA 4D5UA 4JCHA 4AYEC 1BH3A 2FGQX 2R4LA 3AA7B 1IZNB 3V8UA 4GCPA 8PRNA 3UPGA 3JCUO 3SYSA 3T24A 1P4TA 4C00A 4FUVA 4N58A 2KZ7A 4XNKA 5JDPA 1GFMA 2XTRA 3T20A 2PRNA 2ODJA 3HOEA 3HW9A 6PRNA 2AXTO 3DZMA 2XE5A 4O4UA 3PF1A 4E1TA 4O3ZA 2R4PA 3AAAA 3HWBA 1MM5A 1S5LO 4LSFA 4GCQA 3RBHA 2F1TA 4O3XB 5AFUL 1MM4A 4FQEA 2R4NA 3LK3B 3POQA 5PRNA 2J1NA 3SZVA 5GTHO 4N59A 3JTYA 4FOZA 1Q9FA 3VY8X 4FT6A 3VE1A 2XMXA 2JQYA 3AAAB 2IWVA 4N74A 2Y2XA 5G26A 5G38A 5T5FA 3VZTX 4AFKA 3AAEB 3A0BO 4CTDA 2ZFGA 3VY9X 4FRTA 4K3CA 2R4OA 3PQUA 4C4VA 2LFUA 5AFUK 3SY9A 2M07A 1ZHZA 2WJQA 3A0HO 3A2SX 3NSGA 2YNKA 4FESA 4GCSA 5FVNA 4U9CA 3VZUX 4O4XA 2J4UP 2Y7SA 5G39A 3AA1B 3WI4A 1MPFA 3G7GA 4KRAA 4BUMX 2KDYA 1PRNA 3PRNA 2R89A 2XG6A 2XTQA 4F4BA 3PGUA 2JMMA 3AA7A 2WVPA 3SZDA 1YS5A 2PORA 3PQSA 3T0SA 2W81C 5E79O 2YPVA 2Y0KA 1Q9GA 2KXPB 1T1LA 3AAEA 3BRYA 2MNHA 4LSIA 5B66O 4G75A 1OPFA 2R88A 1ZHXA 3POUA 5DL8A 4UB8O 4D64A 1G90A 3AA6B 3SY7A 4PR7A 2K4TA 2QTKA 3BRZA 3O0EA 4E1SA 5ADXK 4D65A 4FRXA 5B5EO 2F1VA 4GF4A 2M06A 4JFBA 2X27X 1GFQA 3PGSA 4FSOA 5IYUA 2KC0A 5KAIO 2XE1A 4FMSA 2Y0LA 3DWNA 4PUXA 3UAQA 4AYDC 5D5DA 1T16A 4RLBA 4AYID 2WJRA 3UU2A 2O4VA 2ZLDA 3SYBA 4FZLA 1H6S1 4FSPA 5G3AA 3KVDD 4K3BA 3TZGA 5DL5A 3HOLA 3BS0A 4AYMC 2X9KA 3POXA 3VE2A 1GFPA 2KZ7B 1QJPA 3DA4A 3QRAA 2N2LA 4AKMA 5ADXL 3WI5A 3LK42 2LHFA 3FYXA 1ZHWA 4C69X 4RJWA 4KR8A 5DL7A 4IL6O 2FGRA 4AUIA 1QJ8A 1ZHTA 3DWOX 2GE4A 5EE2A 7PRNA 2F1CX 5DL6A 4B61A 5TISO 4RJXA 1ZHYA 4O3WA 4PJ0O 1OSMA 5GTIO 5H2FO 2W80C 3LK3A 1IZNA 2Y0HA 4UB6O 1ORMA 1GFOA 1THQA 4RLCA 1QJ9A 4Z3TA 1HXTA 3AA0A 2ERVA 3DA3A 3KZIO 3LK2A 4LSHA 5GV0A 1PHOA 3PGRA 4AZLA 3C5OA 2N2MA 3VZWX 3AA6A 2OMFA 1BT9A 3LK41 4LSEA 4O3YA 4AKRB 2K0LA 4C4VB 4KR4A 1GFNA 1BXWA 4FZNA 2XE3A 2KXPA 3NJTA 3EMNX 2R8AA 3GP6A 4FZMA 1E54A 3PORA 4AYNA 2MHLA 2IWWA 4O49A 3QRCA 1HXXA 4G76A 4QQ1A
chains in the Genus database with same CATH topology
4GHBA 1HXUA 4RL9A 2XE2A 3AA1A 4XNLA 3AA0B 3LK2B 3K19A 4AKRA 4D5UA 4JCHA 4AYEC 1BH3A 2FGQX 3AA7B 1IZNB 3V8UA 4GCPA 8PRNA 3UPGA 3T24A 3SYSA 5JDPA 1P4TA 4FUVA 4N58A 2KZ7A 4XNKA 1GFMA 2XTRA 3T20A 2PRNA 2ODJA 3HOEA 3HW9A 6PRNA 2XE5A 4O4UA 4E1TA 4O3ZA 3AAAA 3HWBA 1MM5A 4LSFA 4GCQA 3RBHA 2F1TA 4O3XB 5AFUL 1MM4A 5PRNA 3LK3B 3POQA 2J1NA 3SZVA 4N59A 3JTYA 4FOZA 1Q9FA 3VY8X 4FT6A 3VE1A 2XMXA 3AAAB 2Y2XA 5G26A 5T5FA 3VZTX 4AFKA 3AAEB 2ZFGA 3VY9X 4FRTA 3PQUA 2LFUA 5AFUK 3SY9A 2M07A 1ZHZA 3NSGA 3A2SX 4FESA 3VZUX 2YNKA 4GCSA 5FVNA 4U9CA 4O4XA 2J4UP 2Y7SA 3WI4A 3AA1B 4C69X 1MPFA 3G7GA 4KRAA 4BUMX 2KDYA 1PRNA 3PRNA 2XG6A 2XTQA 4F4BA 2JMMA 3AA7A 3SZDA 1YS5A 2PORA 3PQSA 3T0SA 2W81C 2YPVA 2Y0KA 1Q9GA 2KXPB 3AAEA 2MNHA 4LSIA 4G75A 1OPFA 1ZHXA 3POUA 5DL8A 4D64A 1G90A 3AA6B 3SY7A 2K4TA 2QTKA 3O0EA 5ADXK 4E1SA 4D65A 4FRXA 2F1VA 4GF4A 2M06A 4JFBA 2X27X 1GFQA 4FSOA 5IYUA 2KC0A 2XE1A 4FMSA 2Y0LA 4PUXA 3UAQA 4AYDC 5D5DA 4RLBA 4AYID 3UU2A 2O4VA 2ZLDA 3SYBA 4FZLA 1H6S1 4FSPA 3KVDD 3TZGA 5DL5A 3HOLA 4AYMC 3POXA 3VE2A 1GFPA 2KZ7B 1QJPA 3DA4A 3QRAA 2N2LA 4AKMA 5ADXL 3WI5A 3LK42 2LHFA 3FYXA 1ZHWA 4RJWA 4KR8A 5DL7A 2FGRA 4AUIA 1QJ8A 1ZHTA 5EE2A 2GE4A 7PRNA 4B61A 5DL6A 4RJXA 1ZHYA 4O3WA 1OSMA 2W80C 3LK3A 1IZNA 2Y0HA 1ORMA 1GFOA 1THQA 4Z3TA 1QJ9A 1HXTA 3AA0A 2ERVA 3DA3A 3LK2A 4LSHA 5GV0A 1PHOA 4AZLA 3C5OA 2N2MA 3VZWX 3AA6A 2OMFA 1BT9A 3LK41 4LSEA 4O3YA 4AKRB 2K0LA 4KR4A 1GFNA 1BXWA 4FZNA 2XE3A 2KXPA 4FZMA 3EMNX 3GP6A 4RLCA 1E54A 3PORA 4AYNA 2MHLA 4O49A 3QRCA 1HXXA 4G76A 4QQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXU A;  2XE2 A;  3K19 A;  4D5U A;  1BH3 A;  2FGQ X;  4GCP A;  8PRN A;  3UPG A;  3T24 A;  3SYS A;  5JDP A;  1GFM A;  3T20 A;  2PRN A;  2ODJ A;  3HW9 A;  6PRN A;  2XE5 A;  3HWB A;  4LSF A;  4GCQ A;  5PRN A;  3POQ A;  2J1N A;  3SZV A;  3JTY A;  4FOZ A;  3VY8 X;  4FT6 A;  2Y2X A;  3VZT X;  2ZFG A;  3VY9 X;  4FRT A;  3SY9 A;  3NSG A;  3A2S X;  3VZU X;  5FVN A;  4GCS A;  2J4U P;  3WI4 A;  4C69 X;  1MPF A;  4KRA A;  4BUM X;  3PRN A;  1PRN A;  2XG6 A;  3SZD A;  3T0S A;  2POR A;  2Y0K A;  4LSI A;  1OPF A;  3POU A;  5DL8 A;  4D64 A;  3SY7 A;  2K4T A;  2QTK A;  3O0E A;  4D65 A;  4FRX A;  4JFB A;  1GFQ A;  4FSO A;  2XE1 A;  4FMS A;  2Y0L A;  3UU2 A;  2O4V A;  2ZLD A;  3SYB A;  1H6S 1;  4FSP A;  5DL5 A;  3POX A;  1GFP A;  3WI5 A;  3FYX A;  4RJW A;  4KR8 A;  5DL7 A;  2FGR A;  7PRN A;  5DL6 A;  4RJX A;  1OSM A;  2Y0H A;  1GFO A;  1HXT A;  4LSH A;  1PHO A;  3VZW X;  2OMF A;  1BT9 A;  4LSE A;  4KR4 A;  1GFN A;  2XE3 A;  3EMN X;  1E54 A;  3POR A;  1HXX A;  4AUI A; 
#chains in the Genus database with same CATH topology
 4GHB A;  1HXU A;  4RL9 A;  2XE2 A;  3AA1 A;  4XNL A;  3AA0 B;  5KAF O;  3WU2 O;  3LK2 B;  3K19 A;  4N75 A;  4AKR A;  4D5U A;  4JCH A;  4AYE C;  1BH3 A;  2FGQ X;  2R4L A;  3AA7 B;  1IZN B;  3V8U A;  4GCP A;  8PRN A;  3UPG A;  3JCU O;  3SYS A;  3T24 A;  1P4T A;  4C00 A;  4FUV A;  4N58 A;  2KZ7 A;  4XNK A;  5JDP A;  1GFM A;  2XTR A;  3T20 A;  2PRN A;  2ODJ A;  3HOE A;  3HW9 A;  6PRN A;  2AXT O;  3DZM A;  2XE5 A;  4O4U A;  3PF1 A;  4E1T A;  4O3Z A;  2R4P A;  3AAA A;  3HWB A;  1MM5 A;  1S5L O;  4LSF A;  4GCQ A;  3RBH A;  2F1T A;  4O3X B;  5AFU L;  1MM4 A;  4FQE A;  2R4N A;  3LK3 B;  3POQ A;  5PRN A;  2J1N A;  3SZV A;  5GTH O;  4N59 A;  3JTY A;  4FOZ A;  1Q9F A;  3VY8 X;  4FT6 A;  3VE1 A;  2XMX A;  2JQY A;  3AAA B;  2IWV A;  4N74 A;  2Y2X A;  5G26 A;  5G38 A;  5T5F A;  3VZT X;  4AFK A;  3AAE B;  3A0B O;  4CTD A;  2ZFG A;  3VY9 X;  4FRT A;  4K3C A;  2R4O A;  3PQU A;  4C4V A;  2LFU A;  5AFU K;  3SY9 A;  2M07 A;  1ZHZ A;  2WJQ A;  3A0H O;  3A2S X;  3NSG A;  2YNK A;  4FES A;  4GCS A;  5FVN A;  4U9C A;  3VZU X;  4O4X A;  2J4U P;  2Y7S A;  5G39 A;  3AA1 B;  3WI4 A;  1MPF A;  3G7G A;  4KRA A;  4BUM X;  2KDY A;  1PRN A;  3PRN A;  2R89 A;  2XG6 A;  2XTQ A;  4F4B A;  3PGU A;  2JMM A;  3AA7 A;  2WVP A;  3SZD A;  1YS5 A;  2POR A;  3PQS A;  3T0S A;  2W81 C;  5E79 O;  2YPV A;  2Y0K A;  1Q9G A;  2KXP B;  1T1L A;  3AAE A;  3BRY A;  2MNH A;  4LSI A;  5B66 O;  4G75 A;  1OPF A;  2R88 A;  1ZHX A;  3POU A;  5DL8 A;  4UB8 O;  4D64 A;  1G90 A;  3AA6 B;  3SY7 A;  4PR7 A;  2K4T A;  2QTK A;  3BRZ A;  3O0E A;  4E1S A;  5ADX K;  4D65 A;  4FRX A;  5B5E O;  2F1V A;  4GF4 A;  2M06 A;  4JFB A;  2X27 X;  1GFQ A;  3PGS A;  4FSO A;  5IYU A;  2KC0 A;  5KAI O;  2XE1 A;  4FMS A;  2Y0L A;  3DWN A;  4PUX A;  3UAQ A;  4AYD C;  5D5D A;  1T16 A;  4RLB A;  4AYI D;  2WJR A;  3UU2 A;  2O4V A;  2ZLD A;  3SYB A;  4FZL A;  1H6S 1;  4FSP A;  5G3A A;  3KVD D;  4K3B A;  3TZG A;  5DL5 A;  3HOL A;  3BS0 A;  4AYM C;  2X9K A;  3POX A;  3VE2 A;  1GFP A;  2KZ7 B;  1QJP A;  3DA4 A;  3QRA A;  2N2L A;  4AKM A;  5ADX L;  3WI5 A;  3LK4 2;  2LHF A;  3FYX A;  1ZHW A;  4C69 X;  4RJW A;  4KR8 A;  5DL7 A;  4IL6 O;  2FGR A;  4AUI A;  1QJ8 A;  1ZHT A;  3DWO X;  2GE4 A;  5EE2 A;  7PRN A;  2F1C X;  5DL6 A;  4B61 A;  5TIS O;  4RJX A;  1ZHY A;  4O3W A;  4PJ0 O;  1OSM A;  5GTI O;  5H2F O;  2W80 C;  3LK3 A;  1IZN A;  2Y0H A;  4UB6 O;  1ORM A;  1GFO A;  1THQ A;  4RLC A;  1QJ9 A;  4Z3T A;  1HXT A;  3AA0 A;  2ERV A;  3DA3 A;  3KZI O;  3LK2 A;  4LSH A;  5GV0 A;  1PHO A;  3PGR A;  4AZL A;  3C5O A;  2N2M A;  3VZW X;  3AA6 A;  2OMF A;  1BT9 A;  3LK4 1;  4LSE A;  4O3Y A;  4AKR B;  2K0L A;  4C4V B;  4KR4 A;  1GFN A;  1BXW A;  4FZN A;  2XE3 A;  2KXP A;  3NJT A;  3EMN X;  2R8A A;  3GP6 A;  4FZM A;  1E54 A;  3POR A;  4AYN A;  2MHL A;  2IWW A;  4O49 A;  3QRC A;  1HXX A;  4G76 A;  4QQ1 A; 
#chains in the Genus database with same CATH homology
 4GHB A;  1HXU A;  4RL9 A;  2XE2 A;  3AA1 A;  4XNL A;  3AA0 B;  3LK2 B;  3K19 A;  4AKR A;  4D5U A;  4JCH A;  4AYE C;  1BH3 A;  2FGQ X;  3AA7 B;  1IZN B;  3V8U A;  4GCP A;  8PRN A;  3UPG A;  3T24 A;  3SYS A;  5JDP A;  1P4T A;  4FUV A;  4N58 A;  2KZ7 A;  4XNK A;  1GFM A;  2XTR A;  3T20 A;  2PRN A;  2ODJ A;  3HOE A;  3HW9 A;  6PRN A;  2XE5 A;  4O4U A;  4E1T A;  4O3Z A;  3AAA A;  3HWB A;  1MM5 A;  4LSF A;  4GCQ A;  3RBH A;  2F1T A;  4O3X B;  5AFU L;  1MM4 A;  5PRN A;  3LK3 B;  3POQ A;  2J1N A;  3SZV A;  4N59 A;  3JTY A;  4FOZ A;  1Q9F A;  3VY8 X;  4FT6 A;  3VE1 A;  2XMX A;  3AAA B;  2Y2X A;  5G26 A;  5T5F A;  3VZT X;  4AFK A;  3AAE B;  2ZFG A;  3VY9 X;  4FRT A;  3PQU A;  2LFU A;  5AFU K;  3SY9 A;  2M07 A;  1ZHZ A;  3NSG A;  3A2S X;  4FES A;  3VZU X;  2YNK A;  4GCS A;  5FVN A;  4U9C A;  4O4X A;  2J4U P;  2Y7S A;  3WI4 A;  3AA1 B;  4C69 X;  1MPF A;  3G7G A;  4KRA A;  4BUM X;  2KDY A;  1PRN A;  3PRN A;  2XG6 A;  2XTQ A;  4F4B A;  2JMM A;  3AA7 A;  3SZD A;  1YS5 A;  2POR A;  3PQS A;  3T0S A;  2W81 C;  2YPV A;  2Y0K A;  1Q9G A;  2KXP B;  3AAE A;  2MNH A;  4LSI A;  4G75 A;  1OPF A;  1ZHX A;  3POU A;  5DL8 A;  4D64 A;  1G90 A;  3AA6 B;  3SY7 A;  2K4T A;  2QTK A;  3O0E A;  5ADX K;  4E1S A;  4D65 A;  4FRX A;  2F1V A;  4GF4 A;  2M06 A;  4JFB A;  2X27 X;  1GFQ A;  4FSO A;  5IYU A;  2KC0 A;  2XE1 A;  4FMS A;  2Y0L A;  4PUX A;  3UAQ A;  4AYD C;  5D5D A;  4RLB A;  4AYI D;  3UU2 A;  2O4V A;  2ZLD A;  3SYB A;  4FZL A;  1H6S 1;  4FSP A;  3KVD D;  3TZG A;  5DL5 A;  3HOL A;  4AYM C;  3POX A;  3VE2 A;  1GFP A;  2KZ7 B;  1QJP A;  3DA4 A;  3QRA A;  2N2L A;  4AKM A;  5ADX L;  3WI5 A;  3LK4 2;  2LHF A;  3FYX A;  1ZHW A;  4RJW A;  4KR8 A;  5DL7 A;  2FGR A;  4AUI A;  1QJ8 A;  1ZHT A;  5EE2 A;  2GE4 A;  7PRN A;  4B61 A;  5DL6 A;  4RJX A;  1ZHY A;  4O3W A;  1OSM A;  2W80 C;  3LK3 A;  1IZN A;  2Y0H A;  1ORM A;  1GFO A;  1THQ A;  4Z3T A;  1QJ9 A;  1HXT A;  3AA0 A;  2ERV A;  3DA3 A;  3LK2 A;  4LSH A;  5GV0 A;  1PHO A;  4AZL A;  3C5O A;  2N2M A;  3VZW X;  3AA6 A;  2OMF A;  1BT9 A;  3LK4 1;  4LSE A;  4O3Y A;  4AKR B;  2K0L A;  4KR4 A;  1GFN A;  1BXW A;  4FZN A;  2XE3 A;  2KXP A;  4FZM A;  3EMN X;  3GP6 A;  4RLC A;  1E54 A;  3POR A;  4AYN A;  2MHL A;  4O49 A;  3QRC A;  1HXX A;  4G76 A;  4QQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...