2ODJA

Crystal structure of the outer membrane protein oprd from pseudomonas aeruginosa
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
426
structure length
382
Chain Sequence
GMFVSDQAEAKGFIEDSSLDLLLRNYYFNRDGKRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTDYSRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGDQPFDYIGFGSIFLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSILHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin D
publication title Structural insight into OprD substrate specificity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 93
structure length 382
sequence length 426
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2odjA01
5JDPA 4FRXA 1PRNA 4KRAA 3JTYA 4KR4A 4RJWA 1GFQA 2XE1A 4LSEA 1BH3A 4FRTA 4D64A 2J1NA 3SYSA 2ODJA 5DL5A 1H6S1 2Y2XA 1GFMA 1HXXA 4RJXA 3T20A 5FVNA 3UPGA 3VY8X 3VZUX 4D65A 3EMNX 1BT9A 4FMSA 4FSOA 2Y0HA 2Y0LA 2Y0KA 3SY9A 2XE2A 3FYXA 4LSFA 3K19A 8PRNA 3SZDA 3UU2A 1GFPA 2O4VA 7PRNA 2ZLDA 4D5UA 3SY7A 2J4UP 4FT6A 4GCPA 3PORA 2PORA 3WI5A 1OSMA 4FOZA 2ZFGA 3T24A 2XE5A 2QTKA 1PHOA 4GCSA 3SYBA 1HXUA 2PRNA 4KR8A 4LSIA 3POXA 2XG6A 3A2SX 2XE3A 1GFNA 3VZTX 3POQA 4GCQA 5DL7A 3POUA 3SZVA 1E54A 3VZWX 4AUIA 1OPFA 3HWBA 2FGRA 2K4TA 3O0EA 1HXTA 6PRNA 3PRNA 1MPFA 3T0SA 3VY9X 4C69X 3WI4A 5PRNA 4LSHA 5DL6A 5DL8A 4FSPA 4BUMX 3NSGA 3HW9A 4JFBA 2OMFA 2FGQX 1GFOA
chains in the Genus database with same CATH superfamily
5JDPA 3GP6A 4O3ZA 4FRXA 5G3AA 4UB6O 3LK2A 5E79O 1PRNA 2XTRA 3V8UA 1T16A 4K3BA 4KRAA 2F1CX 4N74A 1G90A 3JTYA 1QJPA 1ZHYA 1THQA 2R88A 1Q9GA 2KC0A 2XTQA 4KR4A 3RBHA 4RJWA 1GFQA 2XE1A 4IL6O 5G38A 4Z3TA 4LSEA 1BH3A 2F1TA 2X9KA 4FRTA 5D5DA 4D64A 2J1NA 3AA0A 3LK2B 2KXPA 3SYSA 2ODJA 3AAEA 4E1SA 5DL5A 5B66O 5T5FA 1BXWA 1H6S1 2GE4A 2Y2XA 4FQEA 4QQ1A 1GFMA 1HXXA 4C4VA 4FUVA 4JCHA 2W80C 4FESA 4RJXA 3T20A 1MM4A 3BRYA 3UAQA 4F4BA 5FVNA 3WU2O 4E1TA 3VY8X 3AA0B 3UPGA 3VZUX 4D65A 3BRZA 4RLBA 3EMNX 1BT9A 4FMSA 2R4PA 3AA6A 4FSOA 4C00A 4XNKA 5AFUK 3AAAA 2Y0HA 2Y0LA 2IWWA 3AA1A 4GHBA 3PQSA 5GTIO 5G26A 2Y0KA 3G7GA 1YS5A 2M06A 2XE2A 3DA3A 4G76A 2W81C 3FYXA 1IZNA 4K3CA 4O4UA 2R4NA 3QRAA 3K19A 4LSFA 5KAIO 1MM5A 4CTDA 2X27X 8PRNA 3SZDA 3UU2A 3DWOX 3HOEA 3LK41 5ADXL 3AAAB 4U9CA 3BS0A 1GFPA 3JCUO 4RL9A 3SY9A 2YPVA 2R8AA 2O4VA 2WVPA 1IZNB 4O49A 3NJTA 4N75A 2JMMA 3C5OA 4AKRA 7PRNA 2KDYA 4AZLA 3PF1A 2ZLDA 2KXPB 4UB8O 5G39A 3SY7A 3AAEB 4D5UA 2ERVA 2J4UP 3DA4A 3VE1A 4FT6A 4AYMC 4GCPA 2XMXA 3LK42 3A0HO 3PORA 4C4VB 1S5LO 2KZ7A 3AA7A 2PORA 4O4XA 2LFUA 4AYDC 3DZMA 3WI5A 1OSMA 2AXTO 4FOZA 4PR7A 3PGRA 4O3XB 3KVDD 4AKRB 2ZFGA 2N2MA 4AYEC 3T24A 2XE5A 2QTKA 1PHOA 2LHFA 4GCSA 4O3YA 3SYBA 3AA6B 1HXUA 1P4TA 1T1LA 2M07A 2PRNA 2R4OA 4GF4A 4KR8A 2KZ7B 3AA7B 3AA1B 3POXA 2XG6A 3PQUA 1ZHXA 3A2SX 2XE3A 1GFNA 4LSIA 4AKMA 5IYUA 3A0BO 2YNKA 3PGUA 3VZTX 3POQA 4GCQA 5KAFO 5B5EO 2R4LA 4PJ0O 4N58A 5DL7A 5ADXK 3TZGA 3PGSA 3LK3A 3POUA 2F1VA 3SZVA 3KZIO 1E54A 3VZWX 2Y7SA 2MNHA 4AUIA 1OPFA 3QRCA 4G75A 5EE2A 3HWBA 4B61A 2FGRA 4AYNA 2WJRA 3HOLA 4PUXA 2K4TA 2MHLA 3O0EA 1HXTA 1QJ8A 2IWVA 4N59A 4FZMA 3VE2A 6PRNA 4RLCA 5GTHO 1QJ9A 1ZHWA 3PRNA 1MPFA 5TISO 1ZHZA 3T0SA 5H2FO 3DWNA 2JQYA 3LK3B 3VY9X 4FZNA 4C69X 2WJQA 3WI4A 1ORMA 4AYID 5PRNA 5GV0A 4LSHA 5DL6A 4FZLA 2N2LA 5DL8A 1ZHTA 2R89A 4FSPA 4BUMX 2K0LA 3NSGA 3HW9A 4XNLA 1Q9FA 4JFBA 4O3WA 5AFUL 2OMFA 4AFKA 2FGQX 1GFOA
chains in the Genus database with same CATH topology
5JDPA 3GP6A 4O3ZA 4FRXA 3LK2A 1PRNA 2XTRA 3V8UA 4KRAA 1G90A 3JTYA 1QJPA 1ZHYA 1THQA 1Q9GA 2KC0A 2XTQA 4KR4A 3RBHA 4RJWA 1GFQA 2XE1A 4Z3TA 4LSEA 1BH3A 2F1TA 4FRTA 5D5DA 4D64A 2J1NA 3AA0A 3LK2B 2KXPA 3SYSA 2ODJA 3AAEA 4E1SA 5DL5A 5T5FA 1BXWA 1H6S1 2GE4A 2Y2XA 4QQ1A 1GFMA 1HXXA 4FUVA 4JCHA 2W80C 4FESA 4RJXA 3T20A 1MM4A 3UAQA 4F4BA 5FVNA 3UPGA 3VY8X 3AA0B 3VZUX 4D65A 4RLBA 3EMNX 1BT9A 4FMSA 3AA6A 4FSOA 4XNKA 5AFUK 3AAAA 2Y0HA 2Y0LA 3AA1A 4GHBA 3PQSA 5G26A 2Y0KA 3G7GA 1YS5A 2M06A 2XE2A 3DA3A 4G76A 2W81C 3FYXA 1IZNA 4O4UA 3QRAA 4LSFA 3K19A 1MM5A 2X27X 8PRNA 3SZDA 3UU2A 3HOEA 3LK41 5ADXL 3AAAB 4U9CA 1GFPA 4RL9A 3SY9A 2YPVA 2O4VA 1IZNB 4O49A 2JMMA 3C5OA 4AKRA 7PRNA 2KDYA 4AZLA 2ZLDA 2KXPB 4D5UA 3SY7A 3AAEB 2J4UP 2ERVA 3DA4A 3VE1A 4FT6A 4AYMC 4GCPA 2XMXA 3LK42 3PORA 2KZ7A 3AA7A 2PORA 4O4XA 2LFUA 4AYDC 3WI5A 1OSMA 4FOZA 4O3XB 3KVDD 4AKRB 2ZFGA 2N2MA 4AYEC 3T24A 2XE5A 2QTKA 1PHOA 2LHFA 4GCSA 4O3YA 3SYBA 3AA6B 1HXUA 1P4TA 2M07A 4GF4A 2PRNA 4KR8A 4E1TA 2KZ7B 3AA7B 3AA1B 3POXA 2XG6A 3PQUA 1ZHXA 3A2SX 2XE3A 1GFNA 4LSIA 4AKMA 5IYUA 2YNKA 3VZTX 3POQA 4GCQA 4N58A 5DL7A 5ADXK 3TZGA 3LK3A 3POUA 2F1VA 3SZVA 1E54A 3VZWX 2Y7SA 2MNHA 4AUIA 1OPFA 3QRCA 4G75A 5EE2A 3HWBA 4B61A 2FGRA 4AYNA 3HOLA 4PUXA 2K4TA 2MHLA 3O0EA 1HXTA 1QJ8A 4N59A 3VE2A 4FZMA 6PRNA 4RLCA 1QJ9A 1ZHWA 3PRNA 1MPFA 1ZHZA 3T0SA 3LK3B 3VY9X 4FZNA 4C69X 3WI4A 1ORMA 4AYID 5PRNA 5GV0A 4LSHA 5DL6A 4FZLA 2N2LA 5DL8A 1ZHTA 4FSPA 4BUMX 2K0LA 3NSGA 3HW9A 4XNLA 1Q9FA 4JFBA 4O3WA 5AFUL 2OMFA 4AFKA 2FGQX 1GFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDP A;  4FRX A;  1PRN A;  4KRA A;  3JTY A;  4KR4 A;  4RJW A;  1GFQ A;  2XE1 A;  4LSE A;  1BH3 A;  4FRT A;  4D64 A;  2J1N A;  3SYS A;  2ODJ A;  5DL5 A;  1H6S 1;  2Y2X A;  1GFM A;  1HXX A;  4RJX A;  3T20 A;  5FVN A;  3UPG A;  3VY8 X;  3VZU X;  4D65 A;  3EMN X;  1BT9 A;  4FMS A;  4FSO A;  2Y0H A;  2Y0L A;  2Y0K A;  3SY9 A;  2XE2 A;  3FYX A;  4LSF A;  3K19 A;  8PRN A;  3SZD A;  3UU2 A;  1GFP A;  2O4V A;  7PRN A;  2ZLD A;  4D5U A;  3SY7 A;  2J4U P;  4FT6 A;  4GCP A;  3POR A;  2POR A;  3WI5 A;  1OSM A;  4FOZ A;  2ZFG A;  3T24 A;  2XE5 A;  2QTK A;  1PHO A;  4GCS A;  3SYB A;  1HXU A;  2PRN A;  4KR8 A;  4LSI A;  3POX A;  2XG6 A;  3A2S X;  2XE3 A;  1GFN A;  3VZT X;  3POQ A;  4GCQ A;  5DL7 A;  3POU A;  3SZV A;  1E54 A;  3VZW X;  4AUI A;  1OPF A;  3HWB A;  2FGR A;  2K4T A;  3O0E A;  1HXT A;  6PRN A;  3PRN A;  1MPF A;  3T0S A;  3VY9 X;  4C69 X;  3WI4 A;  5PRN A;  4LSH A;  5DL6 A;  5DL8 A;  4FSP A;  4BUM X;  3NSG A;  3HW9 A;  4JFB A;  2OMF A;  2FGQ X;  1GFO A; 
#chains in the Genus database with same CATH topology
 5JDP A;  3GP6 A;  4O3Z A;  4FRX A;  5G3A A;  4UB6 O;  3LK2 A;  5E79 O;  1PRN A;  2XTR A;  3V8U A;  1T16 A;  4K3B A;  4KRA A;  2F1C X;  4N74 A;  1G90 A;  3JTY A;  1QJP A;  1ZHY A;  1THQ A;  2R88 A;  1Q9G A;  2KC0 A;  2XTQ A;  4KR4 A;  3RBH A;  4RJW A;  1GFQ A;  2XE1 A;  4IL6 O;  5G38 A;  4Z3T A;  4LSE A;  1BH3 A;  2F1T A;  2X9K A;  4FRT A;  5D5D A;  4D64 A;  2J1N A;  3AA0 A;  3LK2 B;  2KXP A;  3SYS A;  2ODJ A;  3AAE A;  4E1S A;  5DL5 A;  5B66 O;  5T5F A;  1BXW A;  1H6S 1;  2GE4 A;  2Y2X A;  4FQE A;  4QQ1 A;  1GFM A;  1HXX A;  4C4V A;  4FUV A;  4JCH A;  2W80 C;  4FES A;  4RJX A;  3T20 A;  1MM4 A;  3BRY A;  3UAQ A;  4F4B A;  5FVN A;  3WU2 O;  4E1T A;  3VY8 X;  3AA0 B;  3UPG A;  3VZU X;  4D65 A;  3BRZ A;  4RLB A;  3EMN X;  1BT9 A;  4FMS A;  2R4P A;  3AA6 A;  4FSO A;  4C00 A;  4XNK A;  5AFU K;  3AAA A;  2Y0H A;  2Y0L A;  2IWW A;  3AA1 A;  4GHB A;  3PQS A;  5GTI O;  5G26 A;  2Y0K A;  3G7G A;  1YS5 A;  2M06 A;  2XE2 A;  3DA3 A;  4G76 A;  2W81 C;  3FYX A;  1IZN A;  4K3C A;  4O4U A;  2R4N A;  3QRA A;  3K19 A;  4LSF A;  5KAI O;  1MM5 A;  4CTD A;  2X27 X;  8PRN A;  3SZD A;  3UU2 A;  3DWO X;  3HOE A;  3LK4 1;  5ADX L;  3AAA B;  4U9C A;  3BS0 A;  1GFP A;  3JCU O;  4RL9 A;  3SY9 A;  2YPV A;  2R8A A;  2O4V A;  2WVP A;  1IZN B;  4O49 A;  3NJT A;  4N75 A;  2JMM A;  3C5O A;  4AKR A;  7PRN A;  2KDY A;  4AZL A;  3PF1 A;  2ZLD A;  2KXP B;  4UB8 O;  5G39 A;  3SY7 A;  3AAE B;  4D5U A;  2ERV A;  2J4U P;  3DA4 A;  3VE1 A;  4FT6 A;  4AYM C;  4GCP A;  2XMX A;  3LK4 2;  3A0H O;  3POR A;  4C4V B;  1S5L O;  2KZ7 A;  3AA7 A;  2POR A;  4O4X A;  2LFU A;  4AYD C;  3DZM A;  3WI5 A;  1OSM A;  2AXT O;  4FOZ A;  4PR7 A;  3PGR A;  4O3X B;  3KVD D;  4AKR B;  2ZFG A;  2N2M A;  4AYE C;  3T24 A;  2XE5 A;  2QTK A;  1PHO A;  2LHF A;  4GCS A;  4O3Y A;  3SYB A;  3AA6 B;  1HXU A;  1P4T A;  1T1L A;  2M07 A;  2PRN A;  2R4O A;  4GF4 A;  4KR8 A;  2KZ7 B;  3AA7 B;  3AA1 B;  3POX A;  2XG6 A;  3PQU A;  1ZHX A;  3A2S X;  2XE3 A;  1GFN A;  4LSI A;  4AKM A;  5IYU A;  3A0B O;  2YNK A;  3PGU A;  3VZT X;  3POQ A;  4GCQ A;  5KAF O;  5B5E O;  2R4L A;  4PJ0 O;  4N58 A;  5DL7 A;  5ADX K;  3TZG A;  3PGS A;  3LK3 A;  3POU A;  2F1V A;  3SZV A;  3KZI O;  1E54 A;  3VZW X;  2Y7S A;  2MNH A;  4AUI A;  1OPF A;  3QRC A;  4G75 A;  5EE2 A;  3HWB A;  4B61 A;  2FGR A;  4AYN A;  2WJR A;  3HOL A;  4PUX A;  2K4T A;  2MHL A;  3O0E A;  1HXT A;  1QJ8 A;  2IWV A;  4N59 A;  4FZM A;  3VE2 A;  6PRN A;  4RLC A;  5GTH O;  1QJ9 A;  1ZHW A;  3PRN A;  1MPF A;  5TIS O;  1ZHZ A;  3T0S A;  5H2F O;  3DWN A;  2JQY A;  3LK3 B;  3VY9 X;  4FZN A;  4C69 X;  2WJQ A;  3WI4 A;  1ORM A;  4AYI D;  5PRN A;  5GV0 A;  4LSH A;  5DL6 A;  4FZL A;  2N2L A;  5DL8 A;  1ZHT A;  2R89 A;  4FSP A;  4BUM X;  2K0L A;  3NSG A;  3HW9 A;  4XNL A;  1Q9F A;  4JFB A;  4O3W A;  5AFU L;  2OMF A;  4AFK A;  2FGQ X;  1GFO A; 
#chains in the Genus database with same CATH homology
 5JDP A;  3GP6 A;  4O3Z A;  4FRX A;  3LK2 A;  1PRN A;  2XTR A;  3V8U A;  4KRA A;  1G90 A;  3JTY A;  1QJP A;  1ZHY A;  1THQ A;  1Q9G A;  2KC0 A;  2XTQ A;  4KR4 A;  3RBH A;  4RJW A;  1GFQ A;  2XE1 A;  4Z3T A;  4LSE A;  1BH3 A;  2F1T A;  4FRT A;  5D5D A;  4D64 A;  2J1N A;  3AA0 A;  3LK2 B;  2KXP A;  3SYS A;  2ODJ A;  3AAE A;  4E1S A;  5DL5 A;  5T5F A;  1BXW A;  1H6S 1;  2GE4 A;  2Y2X A;  4QQ1 A;  1GFM A;  1HXX A;  4FUV A;  4JCH A;  2W80 C;  4FES A;  4RJX A;  3T20 A;  1MM4 A;  3UAQ A;  4F4B A;  5FVN A;  3UPG A;  3VY8 X;  3AA0 B;  3VZU X;  4D65 A;  4RLB A;  3EMN X;  1BT9 A;  4FMS A;  3AA6 A;  4FSO A;  4XNK A;  5AFU K;  3AAA A;  2Y0H A;  2Y0L A;  3AA1 A;  4GHB A;  3PQS A;  5G26 A;  2Y0K A;  3G7G A;  1YS5 A;  2M06 A;  2XE2 A;  3DA3 A;  4G76 A;  2W81 C;  3FYX A;  1IZN A;  4O4U A;  3QRA A;  4LSF A;  3K19 A;  1MM5 A;  2X27 X;  8PRN A;  3SZD A;  3UU2 A;  3HOE A;  3LK4 1;  5ADX L;  3AAA B;  4U9C A;  1GFP A;  4RL9 A;  3SY9 A;  2YPV A;  2O4V A;  1IZN B;  4O49 A;  2JMM A;  3C5O A;  4AKR A;  7PRN A;  2KDY A;  4AZL A;  2ZLD A;  2KXP B;  4D5U A;  3SY7 A;  3AAE B;  2J4U P;  2ERV A;  3DA4 A;  3VE1 A;  4FT6 A;  4AYM C;  4GCP A;  2XMX A;  3LK4 2;  3POR A;  2KZ7 A;  3AA7 A;  2POR A;  4O4X A;  2LFU A;  4AYD C;  3WI5 A;  1OSM A;  4FOZ A;  4O3X B;  3KVD D;  4AKR B;  2ZFG A;  2N2M A;  4AYE C;  3T24 A;  2XE5 A;  2QTK A;  1PHO A;  2LHF A;  4GCS A;  4O3Y A;  3SYB A;  3AA6 B;  1HXU A;  1P4T A;  2M07 A;  4GF4 A;  2PRN A;  4KR8 A;  4E1T A;  2KZ7 B;  3AA7 B;  3AA1 B;  3POX A;  2XG6 A;  3PQU A;  1ZHX A;  3A2S X;  2XE3 A;  1GFN A;  4LSI A;  4AKM A;  5IYU A;  2YNK A;  3VZT X;  3POQ A;  4GCQ A;  4N58 A;  5DL7 A;  5ADX K;  3TZG A;  3LK3 A;  3POU A;  2F1V A;  3SZV A;  1E54 A;  3VZW X;  2Y7S A;  2MNH A;  4AUI A;  1OPF A;  3QRC A;  4G75 A;  5EE2 A;  3HWB A;  4B61 A;  2FGR A;  4AYN A;  3HOL A;  4PUX A;  2K4T A;  2MHL A;  3O0E A;  1HXT A;  1QJ8 A;  4N59 A;  3VE2 A;  4FZM A;  6PRN A;  4RLC A;  1QJ9 A;  1ZHW A;  3PRN A;  1MPF A;  1ZHZ A;  3T0S A;  3LK3 B;  3VY9 X;  4FZN A;  4C69 X;  3WI4 A;  1ORM A;  4AYI D;  5PRN A;  5GV0 A;  4LSH A;  5DL6 A;  4FZL A;  2N2L A;  5DL8 A;  1ZHT A;  4FSP A;  4BUM X;  2K0L A;  3NSG A;  3HW9 A;  4XNL A;  1Q9F A;  4JFB A;  4O3W A;  5AFU L;  2OMF A;  4AFK A;  2FGQ X;  1GFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...