2OE2A

Msreca-native-low humidity 95%
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
326
structure length
326
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 75
structure length 326
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oe2A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oe2A01
2AKYA 2AR7A 2J7PD 4Q4AA 1F48A 3AGQA 1EGAA 1GNPA 2HF8A 4OQMA 5FTJA 4PSAA 5E7IA 2QPAA 2PLRA 2C95A 3VNVA 1E0SA 1H65A 5FR2A 3OFND 3TUJC 4B3BA 5KTYA 1ZC4A 4KBFA 3NHAA 4DLUA 2ZU6A 3P27A 1NY5A 1QRAA 2CDNA 2UZ3A 1W47A 521PA 3CF6R 3LW7A 4RJLA 2PEZA 4HYYA 1TU3A 4FI3C 5C1BA 2H8KA 2J0UA 4DLVA 4Q00A 3SHWA 1UKVY 3B1VA 3RRNA 1ZNWA 3H4MA 2VP9A 1QVAA 5CB6A 1A2BA 1RPZA 1NMXA 2ZRDA 3SZRA 3W5IA 1M1YE 3TSWA 4DWJA 4OHYA 1BO6A 5CB8A 2GJ9A 1C1YA 2EFHB 3Q9LA 4Q7LA 1UAAA 4E22A 4TT3A 2OE2A 3RSLA 5FPYA 3KL4A 1KKMA 2REXB 4M1SA 4Q9HA 3BJIC 5FI0B 4XVUA 2ONKA 1VG9B 4ZKDA 3C15C 1U81A 2V55B 3I3SR 3QKTA 1L4YA 1JXOA 1F3OA 1RYHA 1Z2CA 3LQRA 5LD2C 5EP4A 2BWJA 4YDSA 1TUEA 1CBUA 4HLQB 1X1RA 3D3QA 3AVXA 3UWKA 1KO4A 2CCJA 1JAIA 2OUKA 3WMFA 4US2R 4PANA 3R9IA 3C8UA 3T35A 4AK9A 1II8B 2NQ2C 5J4LA 2QTFA 5TMPA 3U3JA 1E2HA 3GJ8A 1NKSA 4TYNA 5DI3B 1R10A 121PA 1XB2A 2YKGA 4LSGA 1ZUIA 3B1YA 1S1CA 2UKDA 1SKYE 2JEOA 3MD0A 2AXPA 4R7ZA 2GJKA 3R9XA 1SGWA 3ZVLA 3PUVA 4C2UA 2QEQA 1N25A 4Q18A 4QBGB 2PT7A 2ZUCA 1OFUX 3VR1A 1W0JA 1E79A 4FMDF 4I81A 2C9CA 2GZHA 1TADA 2ORVA 2YYZA 3GJ6A 1QF9A 1P9RA 4LY6A 421PA 2ZS8A 1R4AA 3BH0A 4UKDA 3W3ZB 4XTRA 3VKWA 3MWKA 1US8B 1KI6B 4DB4A 1OV4A 3QQ5A 3OE7D 3IIKA 3CNLA 1VHTA 4M22A 4NE2A 3EWAA 4ZCLA 1UEJA 3OZXA 4KHZA 5EUMA 2CJWA 1EX6A 2IF0A 1DS6A 1US8A 4YONB 3SYLA 2ATXA 3A1WA 1E2QA 4CEHA 1HURA 2WSMA 3BE4A 3KQUA 4DSUA 4O2RA 4Q9KA 2ONJA 4N1AA 5B30A 3E2IA 3K9GA 2IT1A 4CEJA 1RYFA 3VTKA 3QY0A 2QI9C 3TSZA 4G01B 2W58A 2WPDD 3DM9B 2J7PA 3K9LA 1EESA 3D7MA 2BMDA 3ZQ6A 1XPRA 2WMNB 4FWIB 4UXJA 5FFMA 1DO2A 1XTJA 4KYIB 1DARA 1VG8A 3QKSA 4EDHA 1RIFA 3PEYA 1P2SA 1KK1A 2JJ2A 4A8JA 4Q1DA 5CYOA 2GVZC 3PITA 4HAYA 4DIEA 2GJAA 1ZINA 4G1UC 3M0EA 2PMKA 1E79D 1G21E 1EFUA 3IEUA 4WZ6A 1JJ7A 1G41A 3A4NA 3CBQA 3A1UA 3KJIA 2WIAA 1R6BX 2W6JD 4JYBA 1KI2A 1N6NA 4QM6A 3HU2A 4ZDKA 3QPWA 1IJEA 1ANKA 4PC2A 4ZDJA 2H92A 2ASEA 2FGKA 1E2JA 1OHHD 2WOJA 4QHTA 3UANA 2CJWB 2PBRA 4PAMA 3QEJA 3QG5A 1ZBDA 3HR7A 4MKHA 4EIWA 3NKVA 3SFZA 3EZ7A 4C0HA 2ZXUA 5G3YA 1KAGA 3P32A 1AM4D 3AVOA 1WP9A 3IHLA 3L0IB 5H70A 1VYTA 3CH4B 4AG5A 1D5CA 3FKSD 3ZS8A 1N0WA 3CF2A 1OXUA 4KVGA 1KMQA 2ZRMA 5FUWA 2NO9A 3IUYA 1Q1EA 4G5SA 1JNYA 2IYXA 2X8AA 2W00A 4I1OA 3WY9A 3RSOA 1NKTA 2CHVA 2BMFA 4TSFD 5E95A 2VO1A 1RVDA 3KJGA 1X1SA 2ZI4A 4TL6A 5FTKA 2OAP1 1OB5A 3ASYA 4ZO4A 3QXSA 3SJCA 3TR5A 4JVNA 4JLOA 4JVMA 5JEDA 2MSEB 2JA1A 2QA5A 4XD7A 1E9AA 4DUGA 4NYIQ 1TQ6A 1ZCAA 2A3RA 2XB4A 4II7A 4HLDA 4Q01A 3Q72A 4FWTA 2JCSA 1VMAA 3GEHA 5M04A 4IDNA 2AWNA 1P3JA 3MAAC 5DLQC 2OCBA 1KY3A 2V1XA 4HB2A 3NDBB 4M21A 5LD2B 3ASZA 3BFVA 4Q4HA 2VHJA 2WM9B 5FPHA 5IRCD 1NJGA 3ND8A 2OM2A 2CE2X 2X2FA 3GLHB 1JPNA 4ARZA 2MSCB 1QG4A 2GTPA 2R2AA 3BIFA 2J1LA 4LV6A 1IXRC 3H1TA 4PC7A 2XTMA 4UXIA 2CMKA 3KB1A 4UJ5A 3FKSA 2JJ1D 1I2MA 4URXR 3RNLA 1YZLA 2IYLD 1QHSA 2WHXA 5KPDA 4MRSA 2ZEJA 4B33A 2EYUA 4E5UA 1ZUNB 3BB1A 4HSEA 1S96A 4DEXA 3K70D 1E4VA 3X1XA 2C98A 4ZDIA 3RS7A 4TSFA 4BECA 5L3QB 3RWMB 2QSZA 2IYVA 2RHDA 3IHWA 1FMJA 1OXSC 2V6JA 5CITA 2GDJA 1J2JA 1CR1A 4JLVA 821PA 5F9HA 1N6OA 3B82A 5AWFC 1KNQA 1GWNA 1YHNA 2RB4A 4M1TA 3FPAA 2PLFA 2F55A 3ZD7A 3ICQB 1L7VC 1UBEA 4FCWA 2HYDA 4DUGD 4TYYA 2GBLC 4OK5A 1R8QA 3I62A 5KOYA 1E2LA 3A6PC 5HPYB 2VRWA 2HJVA 1TQ4A 4Q7KA 4DT1A 4M1YA 4QNMA 4RZXA 2GF0A 4NMMA 1WQ1R 3CZPA 3GEIA 4P4UA 5FPSA 2BOVA 2DR3A 1E2PA 2KBFA 2TMKA 4OJQA 4QBHA 2R6GA 1N0VC 2V8OA 3VR6A 5TVKA 4DRZA 2B21A 5IK2A 3RANA 3LXXA 2JDIA 1Z3IX 1R0WA 2FA9A 2W0SA 1DTSA 2J3EA 3K09C 1DAEA 2ATVA 4GOJA 3P4XA 3C14C 1FP6A 2FZ4A 4HZIA 2VP4A 4RFSA 1DAKA 4LJAA 4KCGA 1W4RA 4QJ5A 4BFWA 4CEIA 4LDJA 2V1UA 1O3YA 1KO7A 2D3WA 4LZZA 2XOKD 2NPIA 5ELXA 2GHIA 4JLNA 3QKUA 2QL6A 1XWIA 4YMVA 2C5LA 2O8FA 3CRQA 1D2MA 1JR3D 3CW2A 2BBOA 3RHFA 5EE5B 3QXHA 5DI3A 3U61B 2VH5R 2P5TB 4L16A 3CRRA 2FDCA 4HB3A 3T5GA 1M7BA 3B2EA 3MWJA 4IRUB 1NIPA 4BFZA 3Q5EA 3FMPB 1XTIA 2GETA 4V0NA 2FEOA 1L8QA 1P2UA 3AKDA 2O8EB 3GLIB 4WW0A 1FFHA 4W5HA 1HT1E 1Q12A 3VHXA 4ACAA 4B3DA 3DHWC 4BASA 1T5LA 4JVSB 3QE0A 1MKYA 4BE7B 4BFTA 3LDAA 1EX7A 1G5RA 2QMUA 2H1LA 4BLSA 1XFAA 4YMTA 1A4RA 2IYZA 4LC0A 3RRMA 2QE7D 4NCJA 3CNNA 1JAHA 3B9PA 2CLDX 1XEFA 2E1RA 4EKDA 3PQCA 1SQ5A 4WXPA 1SKQA 1SVSA 2ZI9A 4NYMQ 4X8OA 1W1WA 1BH2A 3AF0A 2EFGA 2BHRA 4KU4A 1RFLA 3U7EB 2X19A 5CLQA 2JJ1A 4QJ4A 1KZ7B 4RZUA 3O47A 2XTZA 4TWZA 3CX8A 4P4SA 2BCJQ 1KK0A 5F3WB 4M8NE 3K09A 3GJ4A 5JSZA 1D2EA 2ZUBA 3EA0A 3WXMA 3IPYA 1E94E 4U02A 3THXA 1UFQA 1E2EA 2D7CA 4PAOA 3CNOA 2BEKA 4J0QA 2FMXA 5EQTA 5GADl 4URWR 4HLCA 5FTNA 5BYKA 4BFYA 3OAAD 2C2HA 2Q9BA 5BQ5A 4LJ6A 3WRXC 3QXJA 5FBRB 1CIPA 2ZI5A 5FL7D 4A6XA 4XVRA 4LBVA 1G64A 1PUJA 3KXIA 1N5IA 4LJ8A 1X8KA 4QL3A 3GLIA 4HUQB 5JLJA 2QQ0A 5E4FA 2IS2A 3LX8A 4URVR 2REBA 2WZQA 4Z1MA 2JLXA 4A9AA 4DHEA 1KGDA 1RRCA 1ZAKA 2RGEA 3W8NA 2OLJA 3EZ6A 4JL6A 3MJRA 2KBEA 1XJ0A 1TQDA 1DOAA 1E9RA 4NBSA 4Q9LA 1Y63A 5AK0A 3NC0C 3RS2A 3X1WA 5EE1A 1Z6YA 4D81A 3EASA 4QBIA 2CL7X 1T6NA 4P4SB 4L9WA 2UVQA 2NZJA 2FX3A 4KSCA 2YC4C 4B2LA 2XJ9A 5FH9A 2WAYA 1VCOA 1ZM4A 1DAFA 2W83A 5AUPB 5SZHB 4IEIA 4LBWA 3HYTA 4ON9A 1Z6GA 5JS7A 2IS4A 1P60A 3B13B 1NVUQ 1Z5ZA 1F6BA 2G83A 2IBMA 2RMKA 3ZGXA 3B8HA 4LC1A 1R0XA 3ZZ0A 4Y0AA 1TUIA 3GPLA 1DE0A 4GOXA 4JKYA 3O8CA 1GKUB 3FMFA 2ZYUX 2QORA 4QHYA 1UJ2A 1IN5A 2H17A 4Q4AB 3A1VA 1C9KA 2QSYA 4NU0A 1OT3A 2ODWA 3SNHA 1J8MF 2AFIE 2P0EA 1P4SA 2DHRA 1AA3A 1PLLA 2ZR9A 1G5PA 2CLSA 4AKEA 2VYFA 2XXAA 3PEVA 2AWOA 2V4ZA 2BJVA 1Z29A 4D25A 2HXYA 2QAJA 4LBYA 1FX0A 1K6MA 5AUNB 5JWOA 1AGPA 1FP7A 4O3MA 4ESVA 3KTAB 3KUCA 3SOPA 5P21A 2WWFA 4PC3A 2F1RA 2NZ8A 3CONA 3DMDA 4C0SA 2ZRHA 3LW8A 2J59A 3V00A 1TPZA 4F4JA 1KK2A 1XJCA 3QNUA 1W7AA 2QE7A 4GOKA 4BFUA 2IHYA 3EPHA 4IVRA 3K8YA 3OESA 1BYUA 2ZTSA 2IC5A 4DLXA 2WJIA 1UDWA 3SBDA 1KSHA 5DI9A 4FCTA 1KJYA 4ZKEA 4EFLA 5BXQC 4D0LB 4WOPA 4B35A 2E9SA 2XNSA 2BIFA 2ZJ2A 1OH5A 2CHGA 1ZD8A 4KLNA 1R0ZA 4QG7A 3FGNA 3SYKA 1SHKA 4JBWA 1XPOA 3DVLA 4Q19A 5LB4A 3THOA 4GI7A 3GLHE 4YMUA 3T61A 3SI7A 4PZYA 2Z83A 4B71A 1OXVA 3GJ5A 4QNRA 4TTRA 4B44A 2ZI7A 2YC2C 1V43A 4DLWA 1XRJA 4PPFA 2DFTA 3LRPA 1JR6A 2QPTA 2JLSA 1II8A 2ODNA 4IDPA 5J4HA 4F91B 3VR2A 4XTCS 4N3NA 1W0KA 1Q1BA 2GRJA 4AYWA 4QGAA 1TU4A 3GJ3A 1JALA 1G16A 3W90A 2ZR7A 3HU3A 4PO9A 2VA8A 4MGYR 4LHWA 1U0JA 4PR0A 2QP3A 2ODBA 4IDQA 4C3ZA 5JMTA 2RAPA 2OT3B 1CULC 1QHIA 2X2EA 1A2KC 2VP6A 1Z83A 3QJYA 4TMKA 2GCOB 1KI4A 1XCPA 2RGCA 1GZSA 2PL3A 3NG1A 3JZMA 4TQAA 1GL6A 4M1OA 3SBEA 5K8TA 3WYFA 3ZQJA 1SULA 1WMSA 3VR4A 2OCAA 4XVQA 2GJ8A 2GXSA 2G6BA 1QHXA 5LB2A 1G6OA 3PCRB 1P9NA 3BK7A 1GNQA 3EAQA 3KQLA 2CNWA 2IXEA 5LDDC 3Q8XB 4EAQA 1OE0A 4C0JA 1Z8FA 1DVRA 4ZDWA 1LF5A 5H1YA 2BMJA 2QROA 1V5WA 3WYGA 2J45A 2J87A 2VHQA 2BKUA 2DFKB 1WB9A 3ETLA 3ZIAA 4POAA 1G8HA 2IYSA 5TV2A 3OEEA 3CRMA 4KLZA 5GJCA 1II0A 3QXXA 4PZZA 1RRGA 1BS1A 1P75A 2L0XA 3K0SA 4DCVA 3I73A 3I92A 1E0KA 3CZQA 5D3MA 1H8ED 1F60A 1TF2A 3B5JA 1UM8A 3TRFA 2Z43A 3ZLJA 3EZFA 1BMFD 1KMHA 2QNRA 4A2WA 1MO6A 1XEWX 2IYWA 4XD7D 1HE8B 2YWFA 4TLCA 4PAQA 4PQFA 4AKHA 1UADA 1J8YF 4QHSA 2ZRFA 2JJ8A 3A36A 3T1VA 5HZKA 2PZFA 4M9XA 3VQTA 3U6BA 2OXCA 4M2LA 4DDVA 4US1R 1MO3A 3AF3A 2C04A 2X77A 3KXLA 4DLYA 2ZR0A 1GG2A 3AF2A 5B64A 3FOZA 4PO1A 4NYMR 3RYTC 1FZQA 1SZPA 2QMOA 3GJ7A 2RGNA 1G1MA 4AG6A 1LFDB 5AJYA 2QRNA 3ECCA 1BIFA 3U7HB 2DPXA 1OIXA 3DKPA 3H84A 5KPJA 1K5GA 3N5CA 1RW4A 1N2CE 1VDZA 3WNDA 2O8EA 1PJRA 5BW8A 1X8LA 4RSGA 2FSFA 5DHFA 2Q21A 1L4UA 3TGPA 3CR7A 4MGZR 1U8ZA 2YOHA 2GCOA 3Q3JB 3R7WB 1U2RA 2BDTA 2BV3A 3F3YA 2FFBA 3SDZA 2IUUA 4B6FA 1YZTA 2BC9A 5DN6D 1IOZA 3CPHA 4QFMA 1PUIA 4AYXA 2FEMA 3GLGA 1S9HA 2WJHA 5G3ZA 2IYRA 5DSZA 3TMKA 1AKEA 2ANBA 2WOOA 2QAGB 3U3OA 3NBFA 1CKEA 2BVNA 3KUDA 1R5NA 4LYJA 2ZSBA 4AI6A 4D26A 2VHUA 2CCKA 1KDPA 1XEWY 1JB1A 3MSXA 3RABA 2F3RA 5DE3A 2HLDD 3T1QA 3ZZTA 2B7BA 1TF5A 2DFLA 3ICEA 3H0KA 4HZUA 1P7CA 4EQ6B 2ORIA 4Q9IA 4MUBA 1RE0A 2NGRA 2QGNA 1A82A 2IL1A 3LLMA 4ASUD 1Q1QA 4CT5A 1SHZA 5L3RA 1HUQA 5CDFE 3QKRA 4MRPA 2HV8A 3PFIA 5LBIA 1U8AA 1HEIA 2BM0A 2ZPTX 1NNEA 4RD3A 3K0EA 4MYTA 3M6AA 1G17A 1UKEA 4AIIA 5C2JB 4FXPA 1GIAA 1QHGA 5FR1A 1W5TA 1NRJB 4RD1A 2V9PA 5J4YA 2JDID 1OIVA 1N5JA 3KQNA 1E99A 2HCJB 5A0FA 5FTLA 3UMFA 1U0LA 3AEZA 5FBWB 5EJEA 1OXXK 3GFTA 5L8VA 3AQ4A 1R0YA 3OEED 1Z08A 2Y8EA 4U5XA 5LPNA 2PX3A 2XOKA 1DADA 1E4YA 1SXJD 2D2FA 3ZS9A 1ZM2A 1TF7A 1W5SA 3N2IA 3REGA 3TNFA 4DLSA 4JSYA 2CL0X 3K9NA 3P26A 1G4AE 1KSFX 2PT5A 3KTAA 1H8EA 3DOEA 2YNMA 2VSXA 3NDPA 5JS8A 4LJ9A 1SVMA 3RLFA 4JJZA 3U7FB 1JBKA 3A1SA 1YVDA 4RKEA 1EFRA 2O52A 4QKQA 3TVTA 1VHLA 4Q4JA 4MYUA 4C7OA 1E2FA 3S1AA 4P31A 5EE9A 1F2UB 4HDOB 5AJZA 2RHMA 2ERXA 1GAJA 5K8LA 1Z0IA 3WRYC 5DYIA 2F7SA 2GEDA 2VQSA 1CRPA 2J41A 2EVWX 2Q3HA 1ZW6A 4YXWA 1N6KA 2XAUA 3MCAA 5KSOA 1LS1A 2IXFA 1GTVA 2YV5A 4B3XA 5IDVA 4YMWA 2XNDD 4QOSA 3VNUA 5J5CA 4Q1EA 2WSSD 3GLGE 3U44B 2RKOA 1JJVA 2WJGA 1LS6A 4ABYA 5JHHB 2WWXA 4ILEA 4AD8A 3B1XA 2Q6TA 2W6IA 2VSFA 1NL3A 1TEVA 3I4LA 2IK8A 4RD0A 4WIAA 4Z8YA 4A15A 1PLKA 1JEEA 2C77A 3AH8A 3FB4A 1KK3A 4LK2A 1D6JA 4A2PA 3CRW1 2JGNA 4BLRA 2LCFA 3RRYA 4DCTA 3D6TB 4IW3B 2A2ZA 4XWOA 4C9BA 1N6IA 5D3QA 2FWRA 1U9IC 1E32A 4KXFB 4NCIA 1GSIA 4U7DA 4FMBB 5JSZB 4A8JB 4FMCF 3BAFA 4G5QA 3D8BA 1IHUA 4Z8XA 4B75A 3KJEA 1G3RA 1G8FA 4GMXA 3W9YA 4OL0A 2ZQ5A 3IILA 2WJYA 3QF4B 4P0TA 1QHNA 4MKGA 4UXHA 4XJXA 4E07A 3FMIA 1ZIPA 1H8HD 3EC2A 4Q1FA 4OI0A 1CJKC 2H5EA 3CO5A 4MQBA 1N6PA 1ZM9A 4O2LA 2ZRGA 3KX2A 1XXHA 1NP6A 2OG2A 2FNAA 3L82B 1D8TA 3FKQA 4GNKA 2FOLA 2ZSDA 1NG9A 1UF9A 4I1SA 4HAWA 3GLFB 3IDQA 1HA3A 4V0LA 2ZSEA 3KKOA 5SZJA 2QZ4A 4B32A 3HU1A 3AVWA 3KKMA 4OQLA 4TN1A 3RS4A 1BKDR 3AVTA 1PV4A 1OYYA 4R71A 3EXAA 1Z6AA 2ZM5A 4CF7A 2VLIA 4B48A 4W5JA 5B2ZA 3X1DA 1GKIA 4JLAA 5E7JA 1W49A 3ZYCA 3BFKA 3IBGA 2P67A 3THYA 2O8CA 4MKIA 3B7GA 1M7GA 3AKEA 4JLPA 4BZPA 4LV5B 3C5HA 1ETUA 4L9SA 4V0KA 1OSNA 4GZLA 4NZYA 1F5NA 2XSZA 2QQEA 3PVSA 2VP2A 3EARA 4DT1B 3NHBA 1A1VA 1FPMA 3U2QA 3QKSB 4QXAA 2IA5A 3JVVA 3AUYA 1R8SA 4Q5IA 1TTTA 2H57A 3MJHA 3CUEF 3ZVMA 4RZ2A 2ZREA 3BBPA 3IGFA 1LW7A 2DB3A 4A2QA 2P2LA 2IS6A 3KDSE 3LBNA 5ANRB 1ODFA 2DCUA 3MGCA 2Q9AA 2IXGA 4HAVA 4XSHA 1E96A 2W2XA 2OBNA 1ZCBA 2FFHA 3BC1A 1U8YA 2F9MA 3U60B 1Q22A 1I4LD 1IM2A 1G7TA 3EWSA 4OBEA 1OHHA 3CX7A 4WAUA 2OFXA 4M0LA 1JECA 1NVWQ 1QHYA 4BEBA 4KBGA 5SZKB 3LBIA 4CEJB 2P6NA 5FOSA 1NVVR 5KNBA 1E2IA 5HE9A 1Z0KA 2NPFA 4URUR 3RRZA 2ZJ5A 4F4IA 3U4QA 2A30A 1SVKA 1KTVA 3GEEA 1P9WA 3ZJYA 4NPHA 1E2NA 3BB3A 2AD1A 3UMSA 3DDCA 4EPTA 1KKLA 1P61B 1MT0A 2QTVB 1Q3TA 4JBYA 4FMCB 1UBGA 1SXJE 4JKIA 4DKXA 4JL8A 1NVVQ 3LLUA 4LHYA 1Z0AA 2XJ4A 2A9KA 4V0OA 4H1VA 4V02A 4M1MA 2H18A 2ZETA 2RGDA 1KO1A 2F1HA 2J0SA 1CRQA 1Q3HA 3KQHA 5B57C 3BD9A 3I5XA 1MABB 2QMEA 2OAQ1 3TK1A 2YWGA 1WRBA 4O25A 1FW6A 3NEJA 1T9HA 4A82A 1KJZA 4NCNA 4PHGA 2VBCA 2FH5B 4BLOA 3I8XA 4X8HA 1NMYA 1FQKA 4OQNA 4UJ3A 1CS4C 3SR0A 3W8RA 2D2EA 5GVRA 4LJYA 1XEXA 4P32A 3RS3A 2ZJZA 4OKSA 5FBVB 1W46A 4Q1BA 2GCPA 3NXSA 4S35A 2D74A 4PSKA 4EJSB 3FFAA 1YR6A 5EXTA 2ZRCA 3CIOA 3IPXA 5EP3A 1KSJA 4FD2A 1OFTA 1Z47A 4PPQA 3A58B 4DLZA 1XMIA 5FUYA 1HQYE 4PQYA 5J47A 1NG1A 1R5OA 2MSDB 2PX0A 3MWYW 5G40A 4D4KA 3KB2A 1EFCA 2YJTD 2GKSA 2O8DA 1QDEA 4Q9JA 2WTUA 1JPJA 3GFOA 3KZ1E 1E1RD 2P5SA 2XX3A 3A1TA 4B43A 2B92A 1TL7C 2CNWD 2JLQA 1XP8A 4BZXA 2N46A 2O8DB 1KHTA 2QG6A 1G3UA 3QBVA 2BKEA 4IVPA 1TNDA 2J0QA 3N2EA 5CM9C 2GXUA 1NBMD 3ZDQA 1AQYA 1Z6TA 2WKRA 2FZLA 5FOUA 1N6LA 5HCNA 3WP1B 4QBFA 3NEYA 2JLVA 1COWA 1ZJ6A 4ZPXA 3TUZC 1VIAA 1NLZA 1XJQA 2BMEA 5A5GA 1FOEB 5KDDA 4Q47A 4M53A 3V4FA 1WE2A 2VPPA 721PA 2ZRBA 4EJSA 2O0JA 2XEXA 2R6DA 2UZIR 1IN4A 1KSGA 4FCVA 2ZROA 3V4RA 1Z22A 3FHOA 2NO1A 3TW4A 1EWRA 3PEWA 1QG2A 1FUUA 2PJRA 1W4AA 4FW9A 3PUZA 3TH5A 1K8RA 3MRSA 4NCKA 3PXGA 1FNMA 4O0MA 1T4GA 1EXMA 3KJHA 4IHQA 4ACBA 2OLKA 1AGRA 2ZI3A 2NMVA 4JYCA 1KOFA 2W0MA 3DZ8A 2RGAA 3P1JA 3K70C 4TMTA 3QG1A 2FFQA 4MA4A 2HEIA 1E1RA 1NSFA 4R2IA 3WNCA 4EPRA 2EFEB 3VR5A 2QBYA 4ITRC 2LKDA 1DEKA 5CLLA 1OKKA 3IEVA 3CRVA 3MFYA 2P6UA 1XTQA 3T1TA 1YZGA 3WBKA 3TBKA 1OLOA 1R2QA 3OIUA 4LUCA 3CB4A 5FTMA 1TX4B 4HZUB 4LJ7A 1DO0A 4PHTA 1RJ9A 1AS0A 1EG7A 1G8PA 4DXAA 1W36B 2J46A 4GT1A 1WCV1 2J5XA 3X1YA 3K70B 1Q0UA 1SKYB 1NLFA 4W9MC 2WKPA 1SVWA 4H9GA 3DO6A 3K1JA 3EPJA 4GDFA 2YWHA 4D4JA 4KITB 5KNCA 1WBDA 3QSYA 1C4OA 3U3MA 4C0QC 5HR5A 3R7WA 4DZZA 2PZGA 1WA5A 3GD7A 5DNYB 1KZGB 3N70A 4PPGA 4G0NA 3NVAA 1KDOA 5HCIA 3CLVA 1S3GA 3SEAA 4DSOA 2OFWA 4RFSB 2ZE6A 1YE8A 2AL7A 3CPEA 4URYR 4XIGS 1WF3A 4LYFA 4WA7A 2GBLA 4DDWA 2O8BB 3F0TA 3OE7A 3PUYA 3OEHA 1UKYA 1GM5A 3EZ2A 1E0AA 2YVUA 1DAHA 4I99A 3IBYA 3KQKA 1NIJA 3C16C 2HXSA 1XD2A 3MUFA 4RCZA 4P33A 4NH0A 3L0OA 2RH5A 1SVLA 3AV0B 2CK3D 1LVGA 1YRAA 1OJLA 2WKQA 2IHBA 2IF2A 2DWOA 2VSOA 1T3SA 2C96A 4EJSC 4Q21A 1NI3A 1QZXA 4DDTA 3BH7A 1GNRA 2Q0HA 2RGBA 4UNPA 4TL7A 3A8TA 2ZSFA 4X8MA 5EXSA 3AUXA 2CVHA 2OEPA 1EFHA 2ZUDA 2KWIA 4A0HA 1G7RA 2V7QD 3TE6A 2ZE5A 4TQ9A 2ZYTX 1LY1A 1N5LA 1KNXA 4Z1MD 5FOXA 1TMKA 5FBQB 5CIQA 4NONA 4IOJA 1Z2AA 1TAGA 3AVPA 2R6AA 4D6PA 5L3QA 2GXQA 4D80A 5SZIA 2KJQA 3LFUA 1E9DA 4PC6A 3VU9A 3QPVA 1RZ3A 1W44A 1EK0A 4F4CA 2RGGA 4M9ZA 4B74A 3K9HA 3O8DA 4PHFA 2VIIA 4Q4HB 3PUWA 2NO7A 1ZYUA 4DSNA 3E5HA 5AR1A 3PJRA 3FHCB 3ADKA 2HCBA 1KDRA 1HQCA 1YJ5A 2WBLC 1XXHE 5GJWC 2DY1A 3GLHA 4CRWB 4F92B 1ZM7A 3WYAA 3K0CC 4XWKA 1D9ZA 1YZKA 2GILA 3LX5A 1E9SA 2MMCA 3W6NA 5B58C 2I1VB 1BYIA 3SJBA 3AGPA 4A0FA 1CXZA 1NF3A 3W6OA 1XCGB 4HB4A 4TLBA 2ZJBA 2W6ID 1Q1ZA 2NTYC 5DGXA 3NBZC 1EWQA 1IY1A 3VFDA 4EPWA 4HAZA 2OV2A 3NTUA 4AY2A 1GDDA 3AVQA 2BBSA 4DCUA 4GRAA 1E9CA 3BOSA 3QUSA 4WVFA 3CWQA 2YOGA 3IQWA 2O0HA 2OO7A 3Q7QA 4TTPA 5DH9A 2XGJA 1A5TA 1UDXA 2ZANA 4UNSA 1W4BA 3AF4A 1GFIA 3UG6A 4KSBA 2QMHA 3GLIE 4JLBA 5F98A 3KKPA 4HI0E 1GL7A 1AKYA 4HATA 4CZ2A 3U5ZB 4BWYA 2ZRPA 4BRUA 1HV8A 2KSQA 1SXJC 1FUKA 2VEDA 2W2TA 3QXCA 4L5BA 5JEEA 3WHKA 4KFRA 3O8BA 2AK3A 2XB2A 3RAPR 3V9PA 3FMOB 2WWIA 4PSVA 3U6KA 3TIFA 2WV9A 4K46A 4PX9A 4M9QA 3GLGB 1EFTA 1VG1A 2MMGA 2KE5A 3SQWA 3L2OB 2C78A 2FSHA 3F8TA 1SXJA 3MMPA 1W48A 4DCSA 4DLRA 4LWZA 1YR7A 4NKRA 5DN6A 2WWYA 1QVRA 4D0NA 3FWYA 1IXZA 1ONBA 1SVIA 4JIMA 1E1QD 3QF4A 4L8GA 4KJZA 5EXXA 1XU4A 4WZAE 2Z4RA 4OHVA 2CBZA 5JJKA 3OAAA 1J7KA 1JR3E 2O5VA 2ZJYA 1XMJA 1ESMA 1UBFA 4DEYA 4LX0A 1HE1C 2I1QA 1ZIOA 2F3TA 2FGJA 3IQXA 1P2TA 2P65A 3K0AB 5J4VA 3THWB 5FOVA 4XH9B 3U3RA 1W36C 3RVBA 4GP7A 2J9RA 5GJVC 3SJZA 4RCYA 4EFMA 4PQRA 2OSBA 1P62B 2KI5A 3TKLA 4A8JC 2ZE7A 4E03A 4A6PA 3ZVRA 1U99A 2ZRAA 1NVXQ 2ZJOA 2XNDA 3T06B 5BN3A 3GMTA 4D4LA 3GLFE 3E70C 2FG5A 1VPLA 2OCPA 1XTSA 2CVFA 1M7HA 4TL8A 1T91A 1MR3F 2AFHE 4A36A 2R62A 1G8YA 2QGZA 2IUSA 3IO5A 3GFPA 1R5BA 4FN5A 2ERYA 2HT1A 3I32A 2HJGA 3SS8A 3I5YA 4LOAA 1J90A 1RC8A 3VKHA 3BWDD 2JLYA 1KI8A 1GL9B 4IOMA 4U00A 4CDGA 1U0HC 2QY9A 4XOIA 5KSZA 1GVNB 1P2VA 1XDBA 2GJSA 1II9A 1YR8A 4KO8A 2ZRNA 4HUTA 1O87A 4Q4LA 5CK4A 4NTZA 1OW3B 3LBHA 1YQTA 2YHSA 1YZUA 5K8UA 2JLZA 2J0VA 4LYHA 3I72A 1E0JA 1EFRD 2R6CA 3TAUA 1ZD9A 4YQFA 4HB0A 1AN0A 4W5WA 4JLDA 3AKCA 1CJUC 4MRRA 4TLAA 1KY2A 1NSTA 1XX6A 4R98A 2CLCX 3LO5A 2EYQA 4I1UA 5BN5A 1E69A 4NYJQ 1M8PA 2J0UB 2AKAB 2IEYA 1XCMA 3THXB 1IBRA 4BFVA 2CE7A 2VHCA 1FQJA 2Z0MA 2ZJ8A 3DZDA 3L43A 3LVRE 4OK6A 1CJVC 3U4QB 3FVQA 1NMZA 2EWWA 5GJBA 3H2YA 2AN9A 5C4MA 1VKJA 2W2VA 4LV8B 3TUIC 3NBXX 2AD5A 2QUZA 1MOZA 2WAXA 3K0AA 1VECA 4KI0A 1X3SA 1WBBA 3TLXA 3SFVA 5JFGA 5BWMA 3TAHA 4B2PA 2ZS7A 1CP2A 1OH8A 4JMPA 5FPTA 2JAQA 1G19A 4B76A 2WWHA 5EUQB 1IONA 4ZIRA 2A7QA 4DB2A 5EP1A 5F2EA 2GXAA 5AJXA 1NN0A 2LKCA 2HLDA 1XMSA 1VYUA 3W5JA 1ZNXA 2VTKA 1XF9A 1DG3A 4XSGA 1P73A 2EQBA 4TZ0A 6Q21A 4MDEA 4WBSA 3Q5DA 3SHFA 4QC2A 3FYHA 2ZI6A 3WMGA 2REOA 2FN4A 2SHKA 3GJXC 3K53A 2OESA 5KDOA 4PHHA 4OHWA 4RD2A 5JWHA 4ZV4A 5G53C 3G5UA 4NCHA 2JLUA 3F5FA 4NHOA 4RD4A 3TQFA 4C0KA 4AKGA 3LD9A 2Z4SA 2G88A 1KI6A 4BPBA 2VF7A 2DBYA 4LPKA 3LH5A 5TDHA 4ZCMA 3B1ZA 5DO9A 4KODA 4PFSA 4MUAA 3LAWA 4K8OA 3TR0A 3W34A 3B78A 1WDTA 4RD6A 4Q7JB 3FFBA 2C8VA 4DC9A 1G8GA 5CK5A 1S2MA 3KXKA 4OI1A 1U9IA 1FL9A 2O0KA 2JATA 1U90A 1AJEA 1KI9A 4DCNA 1J70A 4V0ME 4A1FA 2CXXA 2E87A 1ZC3A 2FPLA 2R65A 1XBTA 4OQXA 4G5OA 4UQOA 3HP1A 4M4SA 1SXJB 1QHHA 5AUQA 3TSOA 2ZU0C 4C0AC 2OZEA 2IYYA 1W2HA 5CJPA 1DBSA 1MH1A 1UKZA 2C9OA 4V03A 3QIAA 2GVDC 1G4UR 2CHQA 1ZU5A 2XITA 2F43B 4BUJA 1B23P 4RFVA 4IFBA 2XXAB 2A5DA 4FINA 4GL2A 1N0UA 1GITA 4N0DA 2ZAMA 3UKDA 221PA 2FPKA 1R7RA 2ZRLA 2B8TA 3QI2A 5JRZA 2OHFA 1LF0A 4TZ6A 2WSSA 3L0PA 3T34A 1D9XA 1MRSA 2GK7A 1S8FA 2BBTA 3W3AA 4IVQA 1OH6A 1F2TA 1G3MA 3FDIA 4GFDA 4OYHA 1MV5A 2HUPA 1E6CA 3VKGA 3UIEA 1Z07A 4HEJA 2NIPA 2QP4A 1HYQA 3AP3A 3DEFA 4FIDA 2FPMA 4P4TA 5K8IA 4JSTA 4RZ3A 5TB5A 3SE0A 3LV8A 4HLUA 4IJMA 1GUAA 5E3HA 3UPUA 2VF8A 1JR3A 1FMLA 3L8ZA 2ZITA 2EU8A 1E9FA 3DM5A 4Q66C 4A0RA 2XZOA 1CR2A 2WJJA 3P4YA 3IO3A 2QM8A 1T0HB 1GILA 4I4LA 4MDFA 4JLJA 3AVVA 1AZSC 5D3MB 4LCBA 2ZRJA 5KO2A 1FNNA 4Q48A 4GZMA 3RS0A 4Y0VA 3CPJB 4WZBE 4UNQA 2HYIC 4Q1AA 5EE0A 1G5TA 4B3CA 3PEUA 1XD8A 2Q9CA 3ND9A 1PLJA 4HUQA 5DISB 4B34A 1N5KA 4DDUA 5UKDA 2P3SA 3OF5A 3GJ0A 1ZD1A 1IN8A 3C5CA 4BFXA 3U44A 2FE4A 2AK2A 3MLEA 3WNBA 4BLQA 3ADCA 1G6HA 3ZD6A 1CTQA 4KFUA 2N42A 4IDHA 4P3YA 1XZQA 3CF0A 2QN6A 2KB0A 3VU9B 2BM1A 1XEXB 2I4IA 3DOFA 3LXRA 3SU8A 4B47A 4S2EA 3AM1A 2JLWA 5L3SA 1W2GA 3HJNA 1LB1B 1XD2B 5KHOC 3BGWA 2ZYWX 4TT3D 1A7JA 3TVDA 3R9WA 1DPFA 2ZSAA 4JZKA 5F9FA 1OF1A 1MO5A 2F43A 3R8FA 3QKRB 4TLDA 2QENA 5EE3A 2QTHA 2GNOA 2XSZD 2NOAA 4CVNA 2FU5C 3ZIAD 2DYKA 5DIFA 3X1ZA 3HPQA 4IXNA 4RVCA 2WPDA 1DAGA 4JBXA 2R9VA 3CWZA 1IY0A 4C0BA 3LVQE 2NO0A 5FI1B 2LWIA 2FJUA 2RGNC 5JRJA 1TQ2A 2A5JA 5CM8B 4LHVA 4N0EA 1G291 1ZP6A 3PIRA 5AJVB 2QPOA 4MYCA 3RC3A 3NC1C 4EPXA 4CEHB 3CX6A 4KAXA 5HZHA 5FUXA 1N6RA 4QRHA 2ZRKA 4TMZA 1AIPA 1ZUHA 2NG1A 2YZ2A 4YC7A 3RS5A 2GESA 1AQUA 1IN6A 1IY2A 4G5RA 1Q57A 1ELOA 1M2OB 3HWSA 4HDQB 4JT2A 2GAOA 1S1MA 3SYNA 4ERNA 4QGHA 4UNNA 2XTNA 4MITA 3O8RA 1CR0A 1G9XA 4DIDA 1W36D 5L3VA 3EZ9A 4Z54A 4ESHA 1HTWA 5J40A 3G0HA 4QJ3A 1SVOA 4GP6A 4TLEA 3HR8A 1S4QA 1I4TD 4DLTA 5TXGA 4NP6A 2AX4A 5DHAA 4PTLA 1ZNZA 2QP9X 2QU8A 4OHXA 2NO6A 1XXHB 3UWOA 8OHMA 5JJLA 4DJTA 4Q02A 5IHPA 2OCYC 3GQBA 3AKYA 2GZDA 2Z6VA 4IOKA 1AK2A 2GEVA 3GLFA 1E3MA 5JCZA 3REFA 1ZM3A 2C03A 5CJ2A 4LBZA 2ZYVX 4F7WA 4W7SA 1T5IA 2IYUA 1I2DA 2X1VA 3JVUA 2VL7A 3QF7A 2O8FB 5DYGA 5A4JA 3C4JA 2IWHA 5H8WA 1OFHA 3THYB 2K5UA 1AS3A 4AC9A 2G3YA 1LV7A 2V7QA 1U94A 4A0GA 1Z0FA 3QPUA 1RJ9B 4M1KA 2V54A 1T8TA 2R6FA 3QBTA 1Z63A 2OFOA 3KFVA 4ZI3A 3FTQA 2JJ2D 2F9LA 4IDOA 4D2IA 1CF4A 2FF7A 2GCNA 1OYWA 1VIYA 5C18A 4D0GA 1KJWA 4V0MA 3ZH9B 1OFIA 3H86A 4GSYA 4IXMA 5EZ6B 1CU1A 3D31A 4OHZA 4F38A 1AZTA 2VP5A 5HKKD 3B60A 3L0SA 4OQFA 1P5ZB 1VCMA 3IKJA 1J99A 4CT4B 2G0NA 5TY0A 1OH7A 2BBWA 4R2HA 3AP2A 2IEZA 1KDTA 3HPRA 3EX7C 1S3SA 1HY3A 1YU9A 4C4PA 4L15A 2PMDA 3R8CA 1E9EA 1Q20A 2WIBA 4KFSA 4MRVA 1ESNA 2J7KA 2IYTA 4C2TA 1Q21A 2D06A 4PXAA 3UATA 4JL5A 5CDFA 4Q03A 1XTRA 2G1JA 1NBMA 3T12A 1F2TB 4M9SA 4YLGA 4OI2A 3FE2A 3EA5A 5KDLA 3TW8B 3NWJA 4R9UC 2HDNB 1X8JA 2C9YA 2F6RA 1YZNA 4TMWA 5EZ5A 1F2UA 2F1JA 2GEUA 1JXMA 2Q3FA 5J4KA 1IJFA 1GRNA 2FFAA 1G7SA 2QRZA 4HDCA 4GPTA 2GK6A 4TQUS 3PG5A 5KNDA 3AVYA 1N6HA 3NH6A 3U7GA 4EFNA 1Q44A 1W0JD 1XZPA 2BCGY 3DL0A 1WXQA 3BORA 4KV9A 1RRPA 3HDTA 3WMEA 3ADDA 2OBLA 4TTQA 3SQXA 3BS4A 4OI4A 3VAAA 1UBCA 1YKSA 1GKYA 2OXRA 4NYJR 4YXWD 2YOFA 4OK3A 4Q4JB 3FHTA 4HAUA 4BGDA 1CR4A 4QGFA 1T3LA 5H68A 1KO5A 1OKKD 2QT1A 4C0LA 1IXSB 1KIMA 1RRFA 4IOLA 4JT4A 4TYWA 1DAMA 621PA 3TQCA 3OIYA 2IYQA 3KFXA 4H1UA 1YR9A 2D62A 4EQ6A 2ECKA 2PJZA 1T8UA 3CKLA 5JI3E 1NN1A 4AWXA 2AXNA 3Q85A 4K81B 1CJTC 2I3BA 2DWPA 3LA6A 5KYKA 3BERA 4X8LA 2B8WA 2BEJA 3K0FA 3KKNA 2RGXA 4E09A 1E1QA 3ONWA 4HLUC 5EXPA 4EPYA 3T15A 4Q7MB 1UEIA 3PV0A 1BMFA 1Z0JA 1HH4A 2EFDB 1VCNA 2QAGA 2VHTA 3EW9A 3MG9A 3CM0A 1FX0B 2RCNA 5E7MA 3I8SA 3AVUA 5C4GB 4B6EA 2V3CC 1AS2A 5AJWA 2IS1A 2W6JA 4WXRA 4IKEA 3RWOA 1NN3A 3U3KA 4PPNA 5HKKA 4JLKA 2DFNA 2A5YB 2QBYB 2PH1A 1QBKC 2ZE8A 4MGIR 3TJZA 4CYMA 2CL6X 4MH0R 4JJKA 4B2IA 4KYUA 5G41A 4TMVA 3VHLB 1AA9A 2G1KA 2ZVQX 3SC3A 3P20A 1CJMA 1T3HA 2B6HA 1UPTA 2Z5FA 2CCGA 4PC1A 3EPKA 1Z0DA 1E98A 1P6XA 1VG0B 3QOFA 2GWHA 5IK2D 2JLRA 3QEOA 1E9BA 1S9DA 2R8RA 5C46F 5FPKA 4NDZA 2D7DA 2F1IA 4LHXA 3BXZA 4BQSA 1E2KA 1DELA 3UMRA 2V6IA 1K5DA 3EIEA 5BYJA 3KKQA 2WWWA 3RC8A 1KI1A 1ZNYA 2Q3MA 3M1IA 1GRRA 1GP2A 1L2TA 1E2DA 3J81k 1YRBA 1NN5A 3K0FB 3QVVA 2WJVA 1U98A 5FBLB 3C7KA 4D82A 4DVGA 3EC1A 4KVAA 2XZPA 3LY5A 3SJAA 5JECA 2GF9A 4KFTA 1JQJC 4DBLC 2BJWA 1HT2E 3B85A 4BZQA 1M74A 4CW7A 4LJ4A 4MKFA 1COWD 1X86B 3VX4A 1VYVA 2EWVA 2OILA 3WHLA 5JJIA 4EUNA 4I1VA 3S1AB 2WWGA 2YWEA 4PO8A 1G3IA 4A92A 5GVSA 3QVUA 4LGMA 4ASUA 4GMDA 1H8HA 3UK6A 3RDPA 3ADBA 1ZRHA 3GCGA 4B73A 4OJKA 5FUVA 1Y3AA 2P6RA 4NL4H 5JI2E 3JZAA 1G18A 1M6NA 4B3FX 4EPVA 3NBYC 4BLTA 2YINC 4D4MA 2HT6A 1CEEA 2A78A 3T1OA 4HAXA 3SN6A 2WICA 3UXMA 1RKBA 3A4MA 3VX3A 3E1SA 4GBMA 1KMHB 2ZAOA 3PUXA 1N3BA 3EIQA 4IEEA 1Z28A 1ZU4A 4MGKR 3I61A 3L8YA 3ZZUA 5IT5A 2C99A 3VR3A 2VP0A 5IF9A 3AP1A 1LTQA 3HYRA 1G7CA 5KSYA 4AKIA 1S0UA 2CEAA 4F93B 4CGZA 1LNZA 1OIWA 2EFCB 4G5GA 4C7OB 1QHHB 3DKVA 4DSTA 2IW3A 1CLUA 1ZMXA 2AHOA 3Q7PA 4LPSA 2FV8A 4MYHA 5FL7A 3OIVA 4NYIR 2G0TA 3G82C 4AYTA 5KUTA 2ZVPX 2N1BA 4JLMA 3THWA 3OFNA 2PCLA 2H16A 2PZEA 3LWNA 1MRNA 1MABA 2IWRA 1XPUA 4YDHB 5FOTA 4G3XA 4BLPA 2EW1A 3B9QA 3A4LA 5JWRA 3ZVNA 5CIWA 3LNCA 2GAAA 1GOTA 2PCJA 3EIHA 1W4CA 1FTSA 4QGGA 2ZRIA 3NIBA 5JHGB 2A5FA 2QT0A 1NLYA 3C41J 2IUTA 1KI7A 3R20A 4AURA 1JEDA 4BFSA 4CIDA 4LI0A 4QM7A 2JIZD 3AF1A 1XNJA 4TMXA 4Q1CA 4CEIB 1BOFA 2D4HA 1NY6A 5AUOB 3OEHD 2O8CB 4L4UA 3NH9A 2ZJAA 5EP2A 4LHZA 1KAOA 1ZVQA 4TYQA 3B6EA 4RY2A 5FL3A 2DWQA 1DG1G 2HF9A 2ZS9A 4RKFA 2O8BA 2ODEA 4JS0A 2CK3A 2JASA 1IAQA 3QENA 1XTKA 1KI3A 3K0CA 4PZLA 4UNRA 3PR1A 5JZVA 2G77B 3BRWD 4M1WA 2XZLA 5KU1A 2G9NA 3X2SA 5KSPA 3WP0A 1E2MA 4ZI2A 2ZIAA 3M4YA 1VTKA 1W0KD 2A5GA 3CH5A 3MWLA 4LYAA 3DMNA 4JVLA 2WVJA 3OIWA 3EPLA 1B0UA 3I1FA 1NJFA 5BN4A 1IN7A 3A37A 1OB2A 3DPUA 1PZNA 3LQQA 1MO4A 1T0JB 2PEYA 3CR8A 3EG5A 4TYPA 4YMSA 4B3GA 2B7CA 5FOWA 3PENA 1XD9A 4ZCIA 1E2GA 1OXTA 1I4DD 4ZIRB 4C30A 2H7VA 1XMVA 4Z51A 2FSIA 3BFXA 1JI0A 2R44A 5CYPA 5JBQA 2QAGC 4BRWA 5L3SB 3WBJA 1IQPA 5HE8A 1Z06A 3IIMA 2JIZA 3T5DA 5JCPA 3BH6A 3IIJA 4LRWA 3UG7A 1PVOA 4BEJA 4URZR 2IX3A 1G3QA 3BB4A 1P72A 3AB3A 3B1WA 4A4DA 1TEXA 2GZAA 1M34E 2WMOB 4LJ5A 1KO8A 1OPXA 1KYIA 2FSGA 2QM7A 5TARA 1VCIA 1JQLB 4FMDB 1FTNA 2GA8A 3VMFA 4ARZB 4XWAA 1Z6XA 3W6PA 4IFEA 1NBME 4MRNA 1D2NA 3OHMA 1DAIA 4US0R 1YZQA 2ANCA 1GRQA 4TL9A 5HTKA 2ORWA 1G20E 3GP8A 2OBMA 1X6VA
chains in the Genus database with same CATH superfamily
4K87A 4Q4AA 1F48A 4OA8A 5FWXA 2D00A 3D6HA 1GNPA 3GJZA 3MBKA 1Z5NA 4N7BA 4OQMA 4PRLA 1ES9A 3AXTA 3PSAA 4XB1A 2QPAA 2PLRA 2H00A 5F1KA 3SS7X 4OX9B 3VNVA 1E0SA 1H65A 2ZTLA 2E18A 3OFND 4ED9A 1SRRA 1USGA 4B79A 2ST1A 5I45A 3O7WA 3FI0A 1JG4A 4ALKA 1V3UA 3JQPA 5AI5A 3TDNA 1GGFA 3ICCA 1G98A 2AH5A 2P79A 2ZULA 3LW7A 3H5AA 4OCZA 3HH8A 4RJLA 5E4JA 4UTPA 1HG1A 1QLJA 1VA4A 4LZJA 1DQZA 3ZWQA 4AX8A 5C1BA 2JFOA 4NX2A 4Q00A 4DLVA 1WPGA 2Y1CA 3OQJA 4MW0A 2A0XA 3G23A 1PHPA 3OTQA 2C4TA 2E3JA 3HKBB 3Q87B 5FIUA 1T26A 1Y1RA 5IAEA 5K1ZA 3VU1A 3ZIDA 3VHRA 3B7PA 2ZRDA 4X84A 3Q7RA 3WFJA 3QVOA 3H17A 4QYIB 4UNIA 3ESBA 4B3HA 4BKQA 9ABPA 4XJVA 1UAAA 1ZQ1A 2OE2A 3RSLA 4B09A 2A9FA 3JAKA 3WNVA 1RYEA 1XCJA 3KL4A 3W1WA 1SH7A 4ZALA 4Q9HA 1BZYA 5FI0B 4XVUA 2HV9A 1W2WB 4TRMA 5B5SA 1I01A 3R76A 3OZGA 3I3SR 3EGEA 1ACJA 3QKTA 4K7JA 4U1RA 2CF5A 3ENWA 3MWEB 1U28A 1KIAA 2WSLA 3LQRA 5LD2C 2R8XA 1GFZA 1W93A 3BHJA 1T6ZA 2BWJA 1ZHHA 3H75A 1REQB 2FP4A 3H1GA 4NNOA 3SJ7A 1XZLA 4YUXA 4KNWA 3D3QA 3KUKA 3GXOA 6REQB 3AVXA 1SQGA 4HAOA 1JAIA 2OUKA 4HGRA 4HN4B 5DLEA 2B8JA 4R1NA 3T35A 3QVJA 1II8B 2P5YA 5U4XA 2ZYSA 3AYXB 4B8ZA 5J4LA 2IPOA 1NKSA 4O29A 5DI3B 4PX3A 4LZOA 1AUVA 1HE3A 3HKEB 4LSGA 3VDQA 2NN3C 4OVKA 4J9VA 2PFSA 1K3TA 2PUAA 4HDAA 3N6XA 4P80A 4UTZA 2GUWA 4ZJUA 3ZHOA 3U0VA 5U1PA 1F7UA 3RNOA 3OPYI 4OXNA 4RY8A 3PUVA 5IG2A 1GUFA 1EMDA 4HVCA 2RC6A 3GRVA 3FNGA 1EVYA 4Q18A 3MCTA 3RSHA 1PQPA 2HPAA 3IA7A 3VR1A 1HYEA 3C85A 2QVGA 1E79A 4FMDF 1VJ1A 1PJLA 1NONA 1CUWA 1ICIA 1YA8A 2ORVA 2YYZA 3GJ6A 1QF9A 1P9RA 1XDWA 2OGWA 3SYTA 2X4IA 3TO5A 1SBQA 1IULA 1IOLA 2CBGA 2HOQA 2JCGA 3G6WA 5TGZA 3G2LA 5T6BA 4E51A 3IPCA 2A5LA 2H9YA 5A04A 3OJLA 4ZHQF 3F74A 1DT5A 2AZXA 1T3ZA 4F45A 2J3QA 3NBKA 2IV7A 4ZHQA 1XK6A 4NE2A 3I6BA 1NXSA 1UEJA 1KFKB 1NQUA 4ZCLA 3G2PA 2EWMA 5TS2A 3EAGA 4WCFC 3MM4A 3P9XA 1DS6A 4YONB 4A0QA 3SYLA 2DBQA 1OBVA 4XVHA 4HXFB 1JYSA 2I7XA 2XOEA 4L08A 2Q6OA 1BN6A 4MZXA 2VVTA 5I5EA 2OBXA 1MU0A 4N1AA 4Q9NA 5B30A 3EGOA 1S2IA 3V55A 3QGMA 3W9BA 4EZEA 5LVAA 2QI9C 1NE2A 3TSZA 3U13A 1M2OA 4XQGA 4FDLA 5B12A 2BAGA 4LMAA 1Z36A 3ZQ6A 3ZWNA 4COKA 4ZYWA 4UXJA 5ALKA 4EL5A 4IMRA 3OPQA 4HRAA 1DO2A 3CNQS 1X7WA 3MJ4A 1DARA 1VG8A 2ZBFA 4PG7A 3P2JA 1GPBA 1CE8A 4F11A 1RIFA 4U7GA 3C45A 3EH2A 1KJ9A 1MB9A 4JI1B 3AF5A 3ZV6A 4MB0A 1T10A 3O6VA 4Q1DA 5EMMA 2GJAA 3IAEA 3FSEA 3LUGA 2PMKA 1WD7A 4IQGA 3JVDA 2H8GA 2JJQA 5I3CA 1R0LA 3R7SA 3SZ3A 2XMZA 3CBQA 3A1UA 3WYBA 3H4TA 5JZMA 1M6VB 1UBLS 1SN7A 1N6NA 4J4HA 2HA5A 1X1AA 2R8PA 3KTDA 4UTXA 3MT7A 4MO2A 3QPWA 1ANKA 4PC2A 5GOTA 2WQ6A 3BE8A 2V6FA 2FE1A 4QHTA 3EFOB 2ZTHA 1KOJA 1R6TA 4PAMA 4UDOA 3VR5D 1UMDA 3NKVA 4BO8A 5BV8A 1FB5A 2IZ1A 5G3YA 1JWLA 2IIBA 4PZDA 3IJEB 4UREA 2REQB 3L0IB 5H70A 3FOCA 4KO2S 4LYYA 1YBHA 4QOFA 3GF4A 3FKSD 1NP3A 3KTFA 4FTWA 5E7QA 3CF2A 1DUIA 5FUWA 2D1QA 2NO9A 2ZWAA 2BDEA 4CR7A 4G5SA 1JNYA 2FUNB 4ZZIA 3WY9A 1NRWA 1XGKA 1NKTA 3LPLA 2JBWA 2GASA 1N8KA 2Z2KA 3CF4G 1H6DA 4TSFD 2XWBF 5IJ9B 1NVBA 5F76A 1RVDA 1ZWLA 2H4JA 3BMOA 2ZI4A 2ZIUB 1JV2B 2Z8ZA 4UU8A 5CVCA 1C4KA 1T2VA 3C3CA 1FIUA 5BWCA 2FMHA 2OAP1 1W75A 4XR9A 3HGQA 4CIXA 5FEUA 4JLOA 2CDRA 4JVMA 4UAUA 1J07A 1FNSA 2JA1A 4KLRA 2DR0A 4QU9A 2HIHA 2VQ3A 4FK8A 5E1OA 2CN1A 3RYCA 2A3RA 3DD5A 2HEGA 4HLDA 3Q72A 4P34A 3GEHA 5CA0F 1AKMA 3LYHA 4BS9A 4EZIA 5JDIA 2EG5A 3QHQA 3VZPA 5FD8A 4F2WA 1Z4OA 2SICE 2HHCA 1C2TA 5BSTA 2HL6A 4BP8A 3KR9A 4IIVA 3ELWA 5HBGA 1EFDN 2Y99A 4HXGA 3LXMA 4JC4A 1VGRA 4XZ3A 4WI1A 1NJGA 1NMEA 3ND8A 4B46A 3HLKA 5BSHA 1NNLA 4OHPA 4XGKA 1AKUA 1JPNA 1Y0BA 2A1TS 1QG4A 3ZPXA 4CQMB 5D00A 4NC9A 1IXRC 2X0RA 1GGJA 2XTMA 4HNAB 2AW3A 4PC7A 5I6DA 2CMKA 2QTGA 2VQEB 1WEHA 1ZGAA 1Y6JA 3B52X 1VHJA 3FYDA 2ZIVB 2JJ1D 2ERCA 4HRYA 4UJ5A 3V2GA 3R0JA 3RNLA 4DDMA 2WTNA 5IAOA 2GCEA 2ZEJA 4YR7A 2PGXA 4RK6A 4HSEA 1VMIA 4DEXA 1S96A 4GWGA 5CEFA 2HLNA 3CZAA 3LHIA 3X1XA 1I6KA 4DUGA 5C1PA 1K7CA 3ENNA 4IUBS 4E15A 2ZUEA 1I1QB 1Z68A 3OLVA 4R0MA 1OVGA 4FFOA 1GPYA 1QH1B 2C2MA 1U02A 2IYVA 2H31A 4J91A 3TZCA 3F5QA 3RSSA 3V1LA 2RHDA 3CTPA 1G8KA 1RYZA 1SBTA 3NVKI 2XCSB 3RK1A 4WBNA 2GDJA 3SICE 1T0BA 5CX4A 3AETB 4LXYA 2RHOA 5DMHA 4AN0A 1XZJA 2LNDA 4H6PA 4NOMA 3CN7A 2F55A 2MYNA 2IXAA 2X8LA 2WJAA 3HB7A 4M6WA 1L7VC 1XRPA 3USCS 5CB4A 1GAXA 2VRCA 2TMDA 1LTKA 4UM5A 5KI6A 5JIBA 1E0DA 4TX1A 1QIKA 3WC4A 3LQ1A 3ORQA 1YQ9A 1R8QA 1QZUA 4QPNA 3VVLA 4X7BA 1YUMA 1GXSA 2EGGA 4YO8A 1Q19A 2Q29A 1E2LA 5JQGB 3GDWA 3A6PC 1SCNE 1AUQA 4IZOA 5I7RA 4BFLA 2P3QA 1I32A 4Q7KA 4M1YA 1CEYA 2UUOA 4NMMA 5BR8B 1PZGA 1S2NA 2OHJA 4A23A 5I4IA 4C4YA 1VKRA 4BNZA 4HWGA 2BOVA 2DR3A 1E2PA 1UOEA 1W8IA 2KBFA 3JD0A 5AM4A 2R6GA 1N0VC 5FA8A 5FUBA 3WSTA 4DRZA 4D9NA 5KNBD 2OQIA 2B21A 3J80A 2JDIA 2POCA 1R0WA 5HZMA 1MF7A 1TXGA 4YPOA 2XUOA 3L6OO 2XAAA 1RP7A 4GXTA 2P9BA 5DM2A 3RSGA 2GSWA 3HDYA 1F0NA 1KL7A 4U2KA 1QHFA 2VP4A 4QWMA 4PQGA 3TGLA 2HTFA 2NYAA 1G5HA 1MJHA 4QJ5A 2FEKA 1ZVJA 3CLSD 1Q14A 3INTA 4LDJA 1BD4A 2D3WA 2IU6A 4I1YA 1O96A 2KLHA 5DYYA 3QKUA 3KU4A 5LP6A 1NOJA 4LQCA 2QG9A 5K0LA 3UGTA 2O8FA 1JR3D 3EUAA 1D0SA 3S6JA 1A9XA 1WXWA 5E2BA 1BXZA 1K8QA 2VH5R 3MUEA 5G0VA 3CRRA 4AZSA 1OA0A 5DX1A 3DOHA 3ER8A 4JJAA 2QN1A 5CH3A 1CF2O 1M7BA 4G0WA 4BMPB 5AW3A 2BFNA 3LU1A 1XIVA 4IRUB 1NIPA 3FMPB 2GETA 2H59A 3CJRA 2FEOA 1L8QA 1P2UA 4UEWA 1SUDA 2BGRA 3I23A 5ERXA 5JT1A 1YHZA 4MYSA 1WULS 4P92A 3AW9A 2E4YA 2CEKA 3BK2A 4PZ9A 4J7XA 3WL8A 4ACAA 1FQWA 1ZOIA 3ETGA 1ACMA 1H2YA 1T5LA 4NMLA 3TIXB 4L5JA 2D5AA 3CJTA 1RWQA 4D3ZA 3B1FA 2ZXEA 1G5RA 4BYGA 2H1LA 1QV9A 4HH0A 4YMTA 1A4RA 1EJBA 4FKMA 3RRMA 3T5CA 1XKXA 1JAHA 2LDXA 1E1NA 3B9PA 3EVBA 3HZZA 2E1RA 1IXKA 4Y18A 2FW0A 4CNQA 5TJ9A 4X8OA 4NYMQ 2ZI9A 2PNFA 1BH2A 1NBOA 3I52A 1Y9AA 3RIGA 1FSFA 3U7EB 2HIMA 5JAUA 2FSPA 2HRBA 4G23A 1KZ7B 2V7WA 1GGEA 3O47A 4P4SA 1NYTA 4CCSA 4CE6A 2JIOA 4UOEA 1ZIDA 4HSGA 4M98A 4DAEA 1S02A 2IH4A 1F8YA 5BUCA 1EI9A 5ENDA 3AR8A 4RH1A 3QITA 4FHGA 4J0QA 3F3KA 5EQTA 5EQFA 5GADl 2C7QA 1O6BA 2Z04A 4I1PA 2OOSA 1PK9A 4P82A 5AXAA 4DREA 3WRXC 1ZSVA 2BFAA 4QUBA 1ZGCA 4A6XA 5FL7D 3UVEA 4XVRA 1OXMA 1X1EA 2YXEA 3ID6C 3I9FA 3PEFA 1G64A 2JFUA 3TKAA 4LJ8A 2D1FA 2DPHA 2DTEA 1CJBA 4Z5XA 4CM7A 4P98A 2IS2A 2G5PA 4HXYA 2WZQA 3KHUA 2IX9A 1DV2A 1QV7A 3H5VA 4XGQA 2NYUA 5EZSA 5CXUA 4ARSA 4Q4DA 2JLXA 1RRCA 2J33A 3S40A 2ZBQA 3EZ6A 2ZYIA 5ITZA 1KZ6A 1N7HA 2GX6A 1NWHA 1MJGA 2KBEA 2QTMA 3H0CA 3OIGA 4JL6A 4PYRA 3RUEA 4YJ2A 2PG3A 1RTTA 3Q11A 3QU2A 4Q37A 1A69A 1D07A 3NC0C 4LVCA 3DZCA 4QBIA 3AL0C 4LMBA 4UDYX 1T6NA 1W5BA 4WXHA 1CV2A 1E3SA 2UVQA 4JEMA 4PG6A 3RIHA 3X1MA 4P5PA 4B2LA 5HG0A 1K5HA 2ACWA 3ZLVA 3VA7A 4E3WA 1VCOA 1XXLA 4GE3A 2O06A 2XBUA 4IEIA 4LBWA 4Y9RA 4ON9A 1N5OX 4GW3A 4G0PA 1S6YA 2EHJA 1P60A 4QPCA 4LE0A 1XTUA 1F6BA 1OMOA 2IBMA 2EXXA 2RMKA 4TKUB 1Z4NA 3ZZ0A 4DV2B 1QPBA 1YBFA 1SOAA 1DE0A 3M4JA 4GC5A 4JKYA 4DS3A 3VOTA 1VPVA 4JODA 4WKCA 1UJ2A 1IN5A 4LGVA 4RHCA 4AMUA 4K0KB 3UM9A 4NU0A 3ZDXB 1OT3A 3V4OA 2AFIE 2XYVA 1O96B 5EWLB 4FU0A 4AKEA 2VS1A 4RS3A 1DIHA 4Y6OA 4HYTA 2HXYA 1C41A 1KEVA 3CO0S 5LA6B 1KJQA 3U7IA 5ALVA 5ESXA 5JWOA 1T1GA 1UP6A 2ZDQA 3KTAB 5JLAA 3AFMA 1ZXXA 2GK3A 2H2WA 3E3OA 5P21A 4BATA 4UEOA 2NZ8A 3DW3X 1V7QA 3K6SA 3DMDA 2Q99A 4G85A 1F8XA 3GVHA 2J59A 3LW8A 5E9AA 1RPTA 3OZIA 2A9QA 1KK2A 1CY2A 4JC5A 4GOKA 3SLGA 3VNAA 2W6NA 3EXHC 1HL3A 3TZBA 2FZCA 4WWHA 1BYUA 1YS1X 1B1AA 2IC5A 3I28A 4OY3A 2N47A 3MRXA 1UFKA 3SBDA 3VM6A 2W43A 1DFIA 1H2EA 3W05A 2VSQA 2B3DA 3S2ZA 4G4SP 1FS5A 1HK7A 4B35A 3LBFA 3K5WA 5AKHA 3PHGA 2XD4A 1FXWA 4H60A 5BR4A 5COQA 2OCKA 2NP6A 2OV3A 3BGOS 1SHKA 4JBWA 1XPOA 1HZJA 3THOA 5LQNA 3HI4A 3BHIA 3ZHBA 4X6YA 1E59A 1L5NA 1QPGA 5C53B 4KWIA 1NQXA 1UPXA 3GJ5A 3PGJA 1NZJA 1BXRA 1RPAA 4BNMA 2Y1OA 3ASVA 2FPWA 1RMTA 4PPFA 1Z4QA 4NPAA 5DGHA 2Z58A 2JLSA 4C7XA 4XX0A 3DUFA 3JQFC 3UGJA 4J29A 2JH8A 3DVQX 2QUJA 4I50A 4JT9A 1CQJA 1YRWA 4J0CA 4W7HA 4AYWA 1J2YA 3QMWA 2WE8A 2W2NA 2C58A 2CLIB 2JFZA 3DTYA 4YP5A 1RI4A 3HU3A 4PO9A 1OYOA 5JD4A 3VOSA 2SKDA 3OQMA 4K0RA 4F4DA 1EU1A 4PR0A 4IDQA 5JMTA 4X3CA 2ZJFA 2XGGA 1HZZC 1RWBA 5J9FA 1KEEA 2Q2VA 3OZDA 2QJFA 4CLOB 1KH1A 2X2EA 1A2KC 3BSYA 3H1EA 2ADMA 2VP6A 4D9KA 1Z83A 3QJYA 4FKZA 3F6BX 1EK1A 1Z82A 3VPGA 1XN1A 1R74A 3VC1A 2DE0X 1QE0A 1GL6A 1XA4A 1Z5GA 3OBIA 4TQAA 1B6RA 5JH7F 4QFDA 1NF9A 2JVKA 3PXDA 4BLUA 3GVCA 4M37A 3ZQJA 2RG7A 5KTNA 1IPHA 2F1OA 3MYRA 4DOMA 3T7SA 1A4XA 2OCAA 3GG2A 3MS4A 4I5GA 4J7AA 4XVQA 4YCLA 2Q8QA 3EVFA 1BTOA 3CINA 1K88A 3BK7A 1GNQA 1G21A 3KQLA 3PQ8A 3WGVA 4LFBB 3Q8XB 4EAQA 4C0JA 2BF4A 4QEZA 1DVRA 6ADHA 4NBTA 4ZDWA 2AMYA 2Q3LA 3QUTA 5H1YA 4CV3A 4DILA 1V5WA 3K0HA 2Q8NA 1XMQB 2J87A 5EZQA 4N3CA 3HXOA 3ZK9A 4J49A 3ZIAA 1T13A 3DR3A 3LCUA 1V16B 3A32A 7MHTA 3PNOA 1CFZA 3CSUA 1D6NA 1V45E 4FHDA 3GT3A 3CRMA 4CKEB 5GJCA 1II0A 1Y4UA 4WN3A 1H93A 1J5EB 1UC9A 3ZDEA 4X60A 2PANA 2L0XA 5HMMA 1Z8DA 4EKGA 4P54A 2RGRA 3PQ7A 4QT4A 5JDIC 1RWXA 4K6CA 2MYUA 3SY8A 3JR7A 1ISIA 3OOWA 4P93A 1E0KA 3E22A 1LDGA 1NA5A 4QDOA 4XI9A 5CJ2A 3FNRA 3S29A 1F60A 1TF2A 3DAHA 4AG6A 3KOYA 4ZVUA 1JE0A 4DLLA 1KTIA 1NOIA 3AU8A 2RHCA 2WYWA 3TRFA 2Z43A 3C8DA 1KMHA 3NTQA 2QNRA 2B1GA 5CA1B 4EW1A 4XD7D 1ZL2A 1HE8B 4EHKA 5A4AA 4DLBA 1JQ5A 4ZANA 5KAMA 1U6KA 3DEHA 3NTOA 4RVOA 5HUJA 4AKHA 4YAJA 2WHPA 4JXZA 4OQYA 3OPYA 2JJ8A 5T67A 4EG5A 2CXOA 4G1EB 3T1VA 3UPDA 2PZFA 1UXOA 3MQ4A 5IAGA 1T1EA 3DE6X 3U3DA 2WUEA 4DHWA 4NFLA 5EJ5A 5BYAA 1PQWA 2PUEA 3R5FA 2ZR0A 3HXKA 4GSLA 5DLDA 5REQA 3FOZA 3H65A 1WXFA 2G63A 3BPSA 4YB8A 5CAEB 3RYTC 4CG2A 1QE3A 1LA2A 1QYCA 1SPBS 3GJ7A 4HQKA 5EKTA 3WK4A 1JHOA 1U31A 3ECCA 3M9XA 3C43A 3H84A 3U7HB 4N6NA 1RW4A 2B8EA 1VDZA 2O8EA 3FKJA 1LK7A 1DB3A 5DDIP 1DJOA 2FSFA 2V7EA 5DHFA 4CCYB 3NYWA 3TGPA 5J1SB 2POQX 4F9FA 4EQZA 1CY6A 2GCOA 4RA6A 3S81A 3F3YA 4E21A 4UMFA 5F77A 3UFXA 4IMJB 5CHYA 4KE8A 1QAOA 1YZTA 4B6FA 5CCXA 4FEGA 1ZGGA 1M72A 3KRTA 2XCLA 5E6RA 1X7ZB 1UIRA 2L17A 2WJHA 3H5OA 2IYRA 4U8HA 5G3ZA 3S2YA 1AKEA 4L4XA 5AESA 1C0PA 2X3UA 3EDOA 3NBFA 4KDEA 4Z9BA 2BVNA 1R5NA 1D1SA 3TQSA 4AI6A 5IHXA 1I33A 2EHDA 1SUEA 1KP9A 4FYXA 4ZGGA 5EEGA 4JQOA 5FORA 1R4MB 1UJMA 3MSXA 4HQRA 5DE3A 3WGMA 2FY8A 1VRCA 2B7BA 3ES9A 4OMDA 5FHQA 3ICEA 3H0KA 2KX7A 4HZUA 1B76A 1P7CA 2LVBA 2IYEA 3H87A 1J23A 1D7AA 2ORIA 2RAFA 3WGTA 1PSZA 2NGRA 2QGNA 4QPDA 2X6QA 1DIBA 1SQ6A 2V58A 5AH0A 1H5QA 1SHZA 2OCLA 1UWKA 1XALA 2QVBA 3HO8A 4O2BA 5EHXA 2HV8A 5LP6B 1PV2A 1XWFA 3PFWO 1NQWA 2XKJE 3F97A 4LW8A 3HFRA 3K0EA 3R5KA 4MYTA 5KVQA 4J90A 1RYDA 3ROFA 3B1JA 3RYIB 1BCRB 1HE5A 1UKEA 4AF7A 4AIIA 3GDFA 5CH5A 1U7OA 3OECA 1NRJB 3MMNA 3P2YA 4I5IA 4BNYA 3OLYA 4OBWA 4YP7A 4E3ZA 3TXAA 1N5JA 5CNIA 1JFLA 1DOHA 5FTLA 1GVHA 2YJZA 3AB8A 4BBAA 1ZH8A 3AEZA 3UMFA 3R4CA 2Z9CA 4EGQA 3F6RA 5FOQA 1U7ZA 1OQAA 3KIPA 4LK3A 3GFTA 3TSCA 1O9GA 4CR8A 2PGLA 3OEED 4GDMA 4IIEA 1J1UA 1WL8A 4K6FA 3HJAA 4GKBA 3GK3A 3RAJA 1E4YA 2PR2A 2D2FA 3JQ8B 5C80A 1ZM2A 3V1UA 1TF7A 2PFGA 3N2IA 2R0QC 2CL0X 2BT4A 2B3TA 2P4QA 5CFZA 1Q7RA 1DV1A 3EA4A 5DRTA 4RIGA 3DOEA 4FNAA 5JS8A 4MQEA 1Q6YA 1UMCB 1RHMA 1F7VA 5SY6A 1YVDA 1RZUA 2YWBA 4Q24A 1P77A 4IDGA 4N5NA 5F51A 4BB5A 4QKQA 3ME5A 4Q4JA 5K99A 4C7OA 4ZK2A 1NW9B 3TOVA 5T5QA 3QSGA 2A92A 3PLRA 4HDOB 5JNSA 4ER5A 4G36A 1J9GA 1EWKA 5CUQA 2QJOA 2RHMA 1UPCA 3WRYC 3ZGLA 5E6SB 1CUCA 2VQSA 4OHCA 1RXCA 1QO7A 5EJFA 2J41A 4L1KA 3TRHA 4GNRA 2Q5QA 1JQEA 1UANA 2P9YA 4FN4A 4KWCA 1N6KA 2XAUA 2BN4A 4ALJA 1LS1A 2H63A 1UC8A 2YV5A 1WSWA 3D8TA 1VBMA 4NBNA 4RE6A 4ZVPA 5IDVA 3VYSB 1BJKA 2XRYA 3EOZA 4JXJA 4EFDA 3IJ5A 2W22A 2WSSD 4D3FA 4GMGA 5LQUA 1JJVA 1DWOA 4HD8A 1LS6A 1OX4A 1SUFA 3GOQA 4ABYA 4BFCA 1KAMA 4ILEA 4KR7A 2WHQA 4AD8A 1V2HE 2Q6TA 1KKUA 2IIQA 2WILA 4A15A 5K2OA 4ZVLA 3ITDA 2C77A 4PW0A 4RW0A 4NECA 4ZCTA 1X7HA 4WSOA 3IKLA 2RIRA 4BLRA 3H8VA 4OHFA 4ZYYA 1RYNA 2LCFA 1ITZA 3D6TB 4UHBA 2B82A 5HF5A 4Q3LA 4IW3B 2A2ZA 5K9ZA 2YASA 4P2BA 1V11B 4C9BA 2IP1A 1JHVA 2FLVA 1RYBA 2ZIGA 1U2TA 1E32A 3I5AA 4XUCA 2OZVA 4N76A 4FMCF 2YCBA 4CETA 1C5KA 1JZSA 2AMLA 3MF4A 3I9MA 3KJEA 3IE2A 4P0TA 4NFHA 3RIMA 2YMPA 2QE6A 3OZFA 3BMCA 1GZVA 2ZBUA 2SCUA 2Y0BA 1Y4AE 5ILOA 3BGDA 2E55A 4Q1FA 1CIJA 2QLBA 1CJKC 1R12A 1ZUWA 1DAPA 1T5TA 1ZM9A 1KVQA 2GOYA 4O2LA 5SY4A 3VTFA 1ZY2A 1NP6A 2PGNA 2FNAA 2A3NA 1EFLA 2DQ4A 2R48A 3FKQA 3L82B 4GNKA 5GMOA 3RUAA 4LZAA 2R1UA 3P2KA 1NG9A 1FA9A 2AZ4A 4MS3A 1KIFA 2NSLA 1L7QA 2R8OA 3DVAA 2CDBA 4KKVA 1BROA 2BFDB 2QZ4A 3HU1A 4QDTA 4L3WA 5CH8A 2VR1A 3S2IA 2QZPA 3RS4A 4Y2JA 2NZUG 2JANA 2DWCA 3GHHA 3N0TA 1LXCA 3KE9A 4H15A 4GPEA 4OJTA 5B2ZA 4N47A 4JC8A 3UJBA 1CZOA 4JI0B 1Y7TA 4C5CA 4CI0B 4MKIA 3B8EA 3H3JA 4BC0A 2GBFA 1M7GA 1A4IA 4FE7A 1QANA 3ZW7A 2I8LA 3GUHA 1DPGA 2OCXA 4NZYA 3V4SA 1LDMA 2HADA 2FLKA 3MINB 4EG7A 2OQ2A 3HNPA 2JBAB 5D3KA 3T7AA 3U5TA 2OZPA 4KGXA 3OLXA 3CVYA 5D86A 3TJMA 2C5SA 4J75A 3EXFA 4U2BA 3NHBA 2YFQA 5CNMA 2AT1A 3WL4A 1EUZA 3O3OB 4UMVA 4XEUA 1Y3CE 3R7LA 2O07A 1QUEA 3AUYA 4Q5IA 2H4ZA 4QQNA 3L6EA 1DIAA 2RH8A 3ZVMA 1L5SA 2GZ2A 3HRKA 2ZREA 3OSUA 1DBWA 2HU8A 1DBPA 3AV3A 3BBPA 4RDXA 1BJTA 1SZCA 1P2GA 5LFAA 2NUAB 4DR7B 4KIWA 4A2QA 3K72B 1M8JA 2HH9A 4PU0A 4EA8A 1IBCA 4I8XA 2YN4A 2IXGA 4WXEA 1C7EA 2OBNA 2FFHA 2PR7A 1JEAA 5DGCA 1F0KA 1NI5A 2XF2A 3KEMA 2F9MA 3KJXA 2DTXA 1OHHA 2IITA 1MX5A 5IBPA 4TV8B 1G8AA 1JECA 1XDDA 1QHYA 5FCDA 4BEBA 1BQ4A 1THGA 3EXEB 4NZNA 1EDDA 4YFVA 1J0BA 5FOSA 4UTNA 1PNRA 1NVVR 1Y8RA 1U4SA 1U0NA 1DC5A 1Z0KA 1Z4PX 4URUR 5CT4A 3RRZA 4PNZA 4B4DA 5CDSA 2I9KA 3L3BA 1KMMA 1KTVA 4GI1A 4TROA 4JYAB 1P9WA 3S1LA 2C7OA 3C3YA 1OUMA 2Q8PA 5KBYA 3BXXA 5LPNA 4TZ6A 4JBYA 4B4KA 4DKXA 1UWVA 2HMSA 2C7BA 3MD9A 1N5MA 3NZEA 3MJDA 4OBXA 4I4TF 4QTXA 4V0OA 2N1MA 3C7AA 2GM9A 2DPGA 5HK8A 2W8ZA 3MOIA 4FNGA 4LX8A 5IBQA 5F78A 3PI6A 3OQVA 1EFAA 2Q3JA 1E5XA 3ETNA 1XNQB 1FYVA 2NNLD 1RIIA 4I08A 3I5XA 4RSMA 1GL3A 2YWDA 4HWTA 1WRBA 1TKAA 2PZJA 5CNKA 4UTOA 3WB2A 5TPZA 1QYDA 5FWDA 4A82A 3QW2A 4OUKX 2F4VB 3Q3HA 1PL0A 3AUFA 5ICSA 2WD7B 3J7TA 4PYQA 5TPWA 3TXYA 3I8XA 3ZDFA 4X8HA 5ETJA 4BQQA 3KS9A 2ECOA 1FUIA 3SR0A 3ZW9A 4DYDA 5IC4A 1CS0A 4EAAA 2PRKA 1JDVA 1E60A 4DFDA 1K7YA 2DSTA 2I6TA 2M6SA 5FBVB 3IP9A 8GPBA 3NXSA 3A4TA 1NE7A 2H85A 3KOXA 2FR0A 3EEOA 2OK7A 3OCWA 5EP3A 1X9GA 2VZ8A 1K2VN 1KSJA 3C4QA 3MMZA 3F1KA 1OFTA 1Z47A 4PPQA 3HRHA 3DL7A 3WOHA 2NAFA 4EA6A 1QXSA 3T9FA 1IEQA 2V0CA 3R0QA 4H7PA 4PQYA 3GU3A 2ZVDA 4E1AA 3I2IA 3A3OA 2Q5OA 3H2IA 3QM1A 4CKBA 2YJTD 2GKSA 4Y6QA 1OILA 3KQPA 1N1GA 4KUGA 1H2FA 2PSEA 2YWRA 4XCVA 1J06A 1SWWA 2HCFA 4MKRA 4Q9JA 3O4JA 2CNKA 1VKZA 4U9HS 1TL7C 2B7LA 4CU2A 5JZ9A 4JB8A 1XP8A 2CXHA 3R0ZA 2N46A 2OTCA 3AM3A 4NICA 3HL0A 3NFRA 3BL6A 3Q4GA 1TNDA 4HP8A 2ZJ0A 4IVPA 2M6LA 4LS3A 3WICA 3I9V6 3ZGYA 1QP7A 3FZNA 1MD9A 1J97A 2EKLA 1AQYA 2OV4A 1C3VA 4Y30A 2GWRA 1B8VA 1N6LA 3AR4A 4RS4A 2JLVA 1N33B 1ZJ6A 1PFUA 2VNSA 4XWYA 3L1UA 2W2KA 1KQGA 1NLZA 3MS2A 2A4KA 4M1EA 3IEKA 4OB7A 5JBNA 3DZHA 1AUXA 1NR7A 3TLKA 3FNIA 3LZCA 1YJBA 2EZUA 4E2ZA 1TGVA 3FCYA 2O0JA 1DGQA 5K3AA 1LH0A 1U1IA 4V1CI 2NLOA 1BU8A 2UZIR 1TK3A 4H2DA 1U8XX 1CPYA 4C6TB 4LF7B 1KSGA 4RAQA 4GKKB 3OX1A 4BLVA 2AF4C 3M8KA 4FCVA 4EBBA 3V4RA 5K3FB 3T5PA 4WJKB 5FV4A 3VKVA 7GPBA 4KMRA 3GAFA 1HZZA 2FEAA 1FUUA 2Y1LA 3K16A 3W2EA 2PJRA 3JCZA 4ND6A 1BGWA 3UAXA 1IWOA 1ZONA 1QMPA 4NCKA 3K9BA 3PXGA 2PT9A 5CXQA 3K0BA 4EJ2A 1MX1A 1B8NA 4M9RA 1B2RA 3JAWA 2ZI3A 3MTGA 3OP1A 4JYCA 3NB0A 3IR7A 4MJ3A 2JAXA 1P1JA 1HFJA 3QG1A 4TMTA 3ZI0A 1KORA 1VM6A 4LNUB 1KY5A 1L3CA 2JI6A 3NHZA 3COPA 3FCUB 4EY6A 1E1RA 1NSFA 4R2IA 4D56A 4EVIA 3UMYA 2O19A 2M9MA 3LHFA 2O7SA 2VNHA 2QBYA 3CS3A 2OV6A 1D2CA 3MFYA 3PRJA 1YZGA 3R3JA 1OLOA 3TBKA 1R2QA 1KEKA 3CB4A 5FTMA 4DNPA 1PJ2A 3V4PB 5FAKA 4HZUB 5DBFA 3HS3A 1S2DA 1A9OA 4PHTA 5B4UA 3G1WA 1TCBA 2ODQA 2A14A 4O4JA 4DIKA 1W36B 3E7DA 1SIWA 2J46A 3THXA 4YFYA 5AP9A 3X1YA 3M1YA 1VB3A 4J4BA 3K70B 2O1EA 4QDXA 3V3TA 1C1DB 4UARA 1SKYB 1NLFA 4W9MC 2WKPA 1WPRA 1SVWA 3COWA 4H9GA 4B5LA 1GV0A 2DG2A 5CLIA 4C6HA 3K1JA 3DAOA 2PHZA 2QN8A 2X15A 3WVNA 3U40A 3IEIA 4ME6A 3QSYA 2BISA 1EPUA 4P9NA 3U3MA 3C87A 4C0QC 4ZCRA 1AQNA 1WA5A 3OKPA 3ZE7A 1J5PA 4M8SA 4PIPA 1PQ4A 5DNYB 1XTVA 1J00A 4UBMA 3QX9A 4YCDA 1BWQA 4CL0A 5EZYA 3CB2A 4ILKA 4G0NA 4RFSB 1N5RA 3RU3A 2IZ0A 2AL7A 5JCJA 4URYR 1ZK0A 2EP7A 2HCRA 4XIGS 4CIAA 4R5MA 4MVJP 5A02A 3OWHA 3NVMB 1W59A 5LNK1 4I99A 3PX7A 3KQKA 1NIJA 1CE8B 2O23A 4GGPA 3O2JA 5CB4F 4RCZA 4NENB 5NLLA 3LY9A 4EG1A 1E66A 3AV0B 2YW9A 1LVGA 1IU9A 4UBJA 4LDNA 4C2BA 2Q4TA 2YYSA 4Z49A 1YRAA 3ROKA 4DR2B 1T3GA 2IHBA 2IF2A 1BVHA 2R7LA 4GVPA 3SM9A 4EJSC 3ETHA 4QVGA 1AH2A 1I8TA 1E77A 1NI3A 2I6GA 4QRIA 5F1YA 1T0IA 1GNRA 4OIMA 3RRBA 1A5BB 1RHRA 2AF3C 2RGBA 2MSNA 4TL7A 1AXGA 2ZSFA 2ZIEA 3MJCA 1F8UA 3G9QA 4J0EA 2OEPA 1EFHA 1G55A 3TE6A 5FLKA 4LTNA 5C0OE 1LY1A 2G06A 2QS9A 3ZTYA 2H9AA 2GN8A 1SZDA 3DBLA 3MSCA 4QUJA 3E5MA 3T3EA 2C7PA 3ZD9A 3O8OB 4XYGA 3TCKA 4D6PA 5L3QA 3R5HA 5SZIA 2KJQA 1SD1A 4F5WA 1E9DA 5DK4A 4E0BA 3RSFA 3DXYA 1GG8A 4Y2XA 1F4PA 4GO1A 1EDOA 1RZ3A 3QWIA 1TKRA 3ZGNA 1EK0A 1LLUA 4N8DA 4F4CA 1FLVA 4V0QA 4ZICA 3O8DA 2VIIA 5DNCA 2NO7A 3U37A 2RGUA 4O8ZA 3PJRA 1MC5A 4K2HA 3QNWA 5EVCA 4C7KA 4LYDA 1G5QA 1YJ5A 3ZCUA 1UJ6A 3G8YA 5EGSA 1J2UA 3EH1A 2DY1A 3HB5X 3ILHA 3NM4A 1PAUA 3GLHA 5C8YF 5HQ3B 1ZWKA 5JAMA 2R4TA 3WYAA 4XWKA 1D9ZA 3LO8A 3VVBA 5EG5A 2H51A 5BWBA 2I1VB 4NULA 1ZVVA 4C01A 3COYA 4IS2A 1AK1A 1Q7TA 5BQXA 4JI8B 2XQFA 2XVZA 4YRTA 2F00A 1CXZA 1O4WA 2DM6A 3GGGA 4CM4A 1AT1A 3KUUA 3NETA 4RDHA 1W52X 2NTNA 1L8XA 4MKXA 3P0FA 1JJBA 3FPCA 2W6ID 1OLXB 1NHGA 1CQXA 4PBRA 1Y3HA 2NTYC 2FZWA 3D64A 3AXSA 3GWGA 4TOIA 1IY1A 3KT8A 4EPWA 2VK2A 5JVDA 4DCUA 5DNEA 3SXPA 1V9LA 4ALMA 5CT6A 4ZRMA 1NV8A 4A8PA 1XZIA 3DMYA 4WVFA 3WWEA 3REOA 5GIOE 2YOGA 1WY5A 2O0HA 2OO7A 1N2OA 4J16C 3UJPA 3KYBA 5LMNB 2J3MA 3R5XA 3PPWA 3RCBA 3COJA 2W2QA 5BVGB 1SCDA 1RKVA 2IYNA 4Y98A 5CTAA 2PNJA 1IDOA 2YZNA 1UDXA 1C0KA 1RZVA 2WHEA 2CVOA 3ZY4A 4UUAA 1S89A 8MHTA 1L9KA 4IWXA 1E1CB 3GLKA 2QTVA 2I6SA 4KHPB 2DBVO 2C82A 3AF4A 5AM2A 1IEXA 3UG6A 1EDBA 4KSBA 3B3FA 1JLHA 4L6CA 5DM0A 1LJ8A 2QW8A 3OU2A 4WKGA 1B73A 3KYCA 3HCAA 1C4WA 2DTDA