2OESA

Msreca-native-ssb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
327
structure length
319
Chain Sequence
QAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 83
structure length 319
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2007-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oesA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oesA01
1V43A 2C9YA 2KJQA 2O0JA 1OXXK 1AN0A 1Q3TA 2LCFA 4Q4HB 521PA 3IEUA 3KTAA 3KKQA 3VMFA 2P5TB 1Z6YA 4HUTA 5KYKA 1TUIA 4R98A 3B9QA 2G0TA 3OIYA 2AD5A 1K5DA 2EU8A 1ZU4A 3CNOA 4MKGA 1Y3AA 1IONA 3PR1A 4TQUS 2V55B 4TTQA 2YYZA 3EA5A 1R2QA 1F6BA 5LB2A 2QTVB 4AC9A 2DWQA 4URWR 1SVIA 2JLVA 5AUQA 3I5XA 4TL8A 1OKKA 2NGRA 1XMIA 1P2UA 1XNJA 1G9XA 2Q3MA 2PZFA 2A7QA 3LNCA 2QE7D 4FINA 1OLOA 2AK3A 1P9WA 3LBIA 2YOFA 4ERNA 3SYNA 5KSYA 2BVNA 4LUCA 4C2UA 5HR5A 1KZ7B 3R8CA 5IT5A 1KDPA 4ZKEA 5J4HA 4D4LA 2X8AA 4NONA 3PUWA 3QEOA 2ERXA 3TE6A 3CUEF 5HCIA 1N6NA 4RKEA 5BQ5A 1TQ4A 2V7QD 4C0SA 1CJUC 2QEQA 1R8SA 2ZAOA 2VEDA 2WWWA 4JVNA 5B64A 2RGNC 4MRSA 1HQYE 4Z51A 3EARA 2J5XA 4QJ4A 4XTRA 4BLSA 1FMJA 4QM7A 1CU1A 1I4TD 2O8BB 2XJ9A 1GWNA 1G19A 3GLGB 4NL4H 2WWXA 4W9MC 1KAOA 3THYA 4Q1CA 1AZSC 3X1DA 3MWYW 1IXZA 2V54A 3C41J 3ETLA 3Q9LA 4LK2A 4V0ME 4WBSA 1QZXA 1T91A 1DPFA 2PX0A 4JVLA 3K70B 4EQ6B 2EFCB 3AKCA 2X1VA 2QI9C 4NMMA 3EX7C 1G21E 1MABA 4LV5B 1RPZA 4ASUD 3MWKA 3WHLA 4FI3C 4WVFA 2D74A 3SOPA 2D2EA 2FFQA 2CCGA 3N2EA 2R9VA 5FBQB 1KDRA 4UQOA 1EFCA 1ESMA 1S4QA 3ICEA 1QRAA 4L4UA 1YZUA 2MMGA 1G291 2GETA 4JKIA 1E1QD 4RZUA 3ZS9A 2B7CA 2H5EA 3C7KA 1SQ5A 4P4UA 1IXRC 3ZZ0A 3B78A 4BWYA 2A9KA 1LW7A 2VF8A 3ZQ6A 1AZTA 3KQHA 1XMSA 1ZNWA 2IYTA 1T3HA 3RYTC 2JDID 3A1SA 4EIWA 1SVOA 2IYUA 2R6GA 4XJXA 1N3BA 5DGXA 1WBBA 1Z0JA 4URYR 2VQSA 1KK0A 1XMVA 2AR7A 2WSSD 2ZJ8A 3A4NA 5FOUA 1NMZA 2ZRJA 4D80A 1S1CA 2Q9BA 1XPOA 1U8AA 5L8VA 2DPXA 3LY5A 2OV2A 1XEWY 3TH5A 4EJSB 1DAIA 3KQKA 1N5LA 1TQDA 2TMKA 5JECA 1HYQA 3FGNA 1OYWA 2CMKA 4JLKA 3FFAA 1ZW6A 3LLUA 2BWJA 2QBYA 4H1VA 2OCBA 5DLQC 1A5TA 1T9HA 2QMOA 1KI9A 1GRNA 3V9PA 1R0ZA 3GJ6A 3N2IA 1SVWA 3G0HA 3GLFB 1TNDA 1IN5A 4LCBA 4MGIR 1L4UA 3D8BA 1BYUA 4U7DA 2PMDA 3A4MA 3K0CA 3IKJA 3LVRE 4IW3B 5JHGB 1AQUA 2ZR9A 1KI6A 2V6IA 3EIEA 4X8MA 2IYYA 3W3AA 2OEPA 1YVDA 4US2R 1W4BA 3KXIA 3SFZA 1ZD9A 1XCMA 4LDJA 2LWIA 2RGAA 1IN4A 4M1MA 3BGWA 2NO7A 4C3ZA 4BFUA 3JZAA 2IYLD 3WNCA 2J45A 3CRMA 1U2RA 4GT1A 4MGYR 2VPPA 3LLMA 1WDTA 1JR3E 4GP7A 3R7WB 3ONWA 3VR3A 3ZZUA 3V00A 2J9RA 5CYOA 5H68A 1II8B 3BFXA 2ZYWX 4BUJA 1JEEA 5GVSA 4DLWA 1MABB 3GEHA 1P2VA 3AF2A 4NCJA 5AWFC 3AVTA 1XJQA 1FOEB 2VP6A 3HPRA 1CIPA 3PFIA 4MYHA 2BMEA 4BGDA 1U0JA 3CH4B 4JIMA 4QHSA 5KDDA 1LFDB 5FBRB 4QNRA 3V4FA 1KO4A 1NY5A 1MO5A 3X2SA 3KXKA 1OV4A 2GESA 4JLMA 2JLZA 3RS7A 1MT0A 1XRJA 1ZAKA 2YNMA 4TLEA 1Z0AA 2ZU0C 4DHEA 5CM8B 5M04A 5DE3A 3TJZA 2ZSFA 4Q1EA 2RB4A 3K09C 5KTYA 1AS3A 1MOZA 4DKXA 2BBWA 4QGAA 4B47A 1E2DA 4XOIA 1II8A 3TSOA 2FA9A 2BJWA 3K0CC 1Z6GA 1XCPA 1GSIA 5C4GB 2IW3A 1KY2A 2DFTA 3CB4A 4EJSA 1IN6A 2O5VA 4B48A 2P6NA 3O47A 3LRPA 1YZKA 2IS2A 3EA0A 4G1UC 4Q9JA 1E2NA 1GIAA 3X1WA 1G3MA 3BWDD 4KXFB 4ZDIA 3MG9A 1SKYB 5G41A 2NPIA 2RMKA 3WYFA 4I1OA 2FFAA 4B44A 4GNKA 5A0FA 1WMSA 4LC0A 1MH1A 1NVVQ 2GCOA 1SZPA 5JRJA 2Q6TA 1QHSA 2FPMA 2C99A 3BB4A 1XDBA 4OI2A 4N3NA 1KMHA 1LF5A 2MSEB 1RYHA 1T4GA 5DO9A 3G82C 1XXHE 4LJYA 2FSHA 4Q01A 2FZ4A 3KXLA 2EWWA 3W3ZB 1VHTA 1VKJA 4MGZR 4NYMQ 4BPBA 1F60A 3OIWA 3Q7QA 5E3HA 2G88A 5AK0A 2WKQA 3VAAA 2C5LA 5L3QA 3SC3A 3T1OA 2GF0A 2Z43A 2WV9A 1FW6A 2Q21A 1UADA 2F43B 2IS1A 3KZ1E 5JBQA 3QKSB 1S9DA 3TLXA 4NYIQ 1U8ZA 3HYTA 2W00A 1OB2A 5TMPA 1HQCA 4QOSA 3A37A 2QPTA 1JQLB 3QY0A 2G0NA 2AD1A 1GM5A 2AXNA 1KKMA 1FTNA 4DT1A 3AVUA 1T8UA 1S3SA 4TWZA 3MCAA 4RJLA 5EE0A 1W44A 1J70A 1W5SA 2QY9A 3FKQA 4LJ6A 4PHFA 3WBJA 2CVFA 4XVQA 1SXJE 2OO7A 4ZI2A 3THYB 1CS4C 5DNYB 4Q18A 4YC7A 5JMTA 1WBDA 4R7ZA 3AUYA 2ZI3A 2I1VB 4R2HA 1HTWA 4ZI3A 1GL7A 3R8FA 5JWHA 4NYMR 1YR8A 1ELOA 2QGZA 2QBYB 4E22A 3VKGA 2GVDC 4PC3A 3IIMA 1UKZA 1IN7A 2XSZA 1N6LA 2F55A 2HLDA 4P4TA 2GF9A 4D0LB 5J5CA 4HB0A 3GJ4A 4HDCA 2ZRIA 1YZLA 4JSTA 3K0SA 2J59A 1N0VC 4QKQA 1T0JB 4ZDWA 1VCNA 1FTSA 4BFZA 4D81A 2IXEA 4B76A 1R0WA 3FMPB 4FMBB 1YR9A 2A5GA 3EG5A 1HA3A 3H84A 3JVUA 2HF8A 1E9SA 4Q7LA 3RSOA 2ZE8A 1WA5A 2PL3A 2QG6A 3CX8A 2CL7X 2FSIA 1AM4D 4YMVA 1E9CA 4TL7A 4IXNA 3RWOA 2A78A 2AFHE 4C7OA 4BZQA 4Q19A 1G8FA 4II7A 1E79D 1Z07A 4IJMA 2SHKA 3F0TA 4M9ZA 2J0QA 1QHHB 5E7IA 1FZQA 2P67A 5HZHA 1E9EA 2WKRA 4A2WA 4OI4A 1W2HA 4TYQA 3CONA 3RNLA 2R8RA 3FYHA 2QQ0A 2Q9CA 4EFMA 2P65A 1L2TA 4JL6A 3VNUA 1NLFA 4GP6A 4NYJR 3REGA 2GAOA 1H65A 4WAUA 3VX3A 2RGCA 1PVOA 1WE2A 1W2GA 3W8RA 1F2UB 3W6NA 2R65A 4XTCS 2A30A 4KVGA 3O8BA 2GDJA 1W47A 2G83A 1RYFA 4TN1A 2OE2A 4Q9HA 1UAAA 3BFKA 3DVLA 3SBEA 2DCUA 5HPYB 3SJZA 3MAAC 4ACAA 4NCIA 5EQTA 3M1IA 1QHXA 1Q12A 2BCGY 5B2ZA 1R5BA 1C4OA 2J7PA 2XZPA 2YVUA 5EUMA 3VR5A 1CR4A 5FOWA 3MD0A 1W4RA 2ZRGA 2JGNA 1Z0IA 2VL7A 2ZJ5A 3A1TA 1Q1ZA 5BN3A 4I4LA 1G6HA 1F2UA 4AKIA 1FMLA 3DO6A 4TL6A 4AI6A 4DLZA 1UKYA 2D3WA 4YDHB 4B71A 2GCOB 3GFOA 2E9SA 2XX3A 4A0FA 5HKKD 4LJ8A 3CPJB 4LV8B 1AGPA 3RVBA 4EFLA 3TGPA 4TZ6A 4OHXA 2NOAA 1OXUA 3QIAA 3U7EB 3U5ZB 2XB2A 2HJGA 4LBZA 4BZXA 1ZBDA 4AWXA 2R2AA 3CRVA 3KKNA 3TQFA 1DTSA 4JLAA 2VP2A 4EPYA 4DDVA 3TAUA 1R0XA 2V1XA 1NVXQ 5FPKA 3RWMB 3Q85A 4JZKA 5KSPA 3DM9B 4NDZA 1RE0A 2CJWA 1T3SA 3U3OA 4TQ9A 1OKKD 1NG1A 3REFA 1P61B 1E1RA 1JR3D 1CR1A 4KYUA 2XTMA 3K0AB 4IDNA 1O3YA 3RAPR 4DCSA 2GXSA 1OT3A 2OM2A 5CK4A 4GL2A 4MRPA 3I73A 4OHZA 3FMFA 2G1JA 3K0EA 3UMFA 4CT5A 1E32A 1KO5A 1PLJA 1BKDR 1F2TB 5TVKA 2FOLA 4IFBA 4M53A 4FMCF 5SZKB 1NN0A 2WWHA 1P5ZB 4HAXA 2ZJYA 4TYNA 4BFTA 1Q1EA 1BO6A 1B23P 3CNNA 1Z63A 3DL0A 1R5NA 3EPLA 4NYIR 3A1UA 4KI0A 3PCRB 4XSHA 4JL5A 1G4AE 3NEYA 3K0AA 4PSAA 1XTSA 3GQBA 1KI7A 3QSYA 2CLCX 4C9BA 2Z0MA 2QSZA 5FPHA 1NG9A 3ASYA 2BBSA 4AKHA 2JAQA 1W0JA 4GBMA 4JYBA 5CK5A 1P60A 5LB4A 5JCZA 4M1OA 1MRNA 3THWA 1NSTA 2ORVA 3QUSA 5LPNA 1N6KA 2IHBA 4E09A 3DEFA 2P6RA 2BIFA 4C0QC 5JEDA 1J2JA 4B43A 2C03A 1HEIA 3TMKA 1TEXA 2DWOA 4M1YA 1Z5ZA 2ODNA 1G8GA 2H7VA 3AEZA 3ZZTA 1R5OA 5FR1A 1ZM2A 1ZP6A 4IDHA 2YOHA 5IDVA 1VIYA 3Q3JB 5FTKA 2WJGA 3RANA 2CLSA 1E9AA 4BRWA 3GJ5A 1Q44A 1DAHA 5JJLA 4F4CA 4TMKA 3GLHA 4HLUA 4E07A 4PPGA 2D06A 5FL7D 4M1TA 1BH2A 5EP4A 3THXA 4B2LA 1WXQA 2FFHA 5ANRB 5CB6A 4QM6A 3B5JA 4KV9A 4LJAA 1NVVR 2WWGA 1W36D 1JXOA 4UNNA 4LHWA 4QBGB 3RRNA 2R6DA 4MRNA 2WIBA 1AA9A 4HZIA 3C14C 2C9OA 5BYJA 2EFEB 4LRWA 2VHTA 4PPNA 1YR6A 2OCAA 1Z22A 1U81A 1C9KA 5EP3A 5JWOA 2ZUBA 3ND9A 3SHFA 2A5DA 3IBGA 4KU4A 4DSNA 2KI5A 4PHHA 1GL6A 4V0OA 2QN6A 2GJSA 3SYKA 2RAPA 3VHXA 3GLIE 1OFHA 5A5GA 1FL9A 1XEXA 1DAEA 2V8OA 2IUTA 3CF0A 2YKGA 2CK3D 4U5XA 1P2TA 2J0VA 3QENA 3AGQA 1X3SA 4C7OB 1CLUA 3R20A 2ZEJA 1X8LA 4HLUC 3DKVA 1FQKA 1NKTA 4OBEA 4AYXA 1WB9A 1CKEA 2VSFA 4PC2A 3U4QA 3NBZC 1OFTA 2D2FA 1CJKC 1KYIA 4RD6A 3L0PA 5TV2A 2GVZC 4P4SB 3SI7A 2YC4C 1S96A 2F1JA 2F1IA 1E94E 4OQMA 1E9BA 221PA 3NC0C 4QHYA 3GCGA 4Q1BA 4DC9A 1Q57A 3ZLJA 4M9SA 4XVUA 2GA8A 5C4MA 3IGFA 4PQRA 2DFKB 3LW7A 1P9RA 2I4IA 3C4JA 1JNYA 1AS2A 2VP9A 3CX6A 2WM9B 2QM8A 3E1SA 1U94A 2OFXA 2QNRA 1DS6A 3PEYA 3VU9B 3BBPA 2BBTA 1B0UA 5EZ6B 5E95A 2XNDA 4A36A 4DRZA 4C30A 1JALA 3ADDA 2ZJZA 5DI3B 5DISB 1ZCBA 1FX0B 1HV8A 3CRW1 4UNSA 4Q7KA 1K8RA 2YWEA 2ZRMA 1KSJA 2VA8A 2PJZA 1GKUB 2XTZA 3OFND 3SN6A 4CZ2A 1L4YA 5J4LA 1N2CE 1UJ2A 3FTQA 3OAAD 5EZ5A 3QXXA 3KUDA 1CBUA 3DHWC 3FB4A 5G3YA 2ZM5A 1GVNB 3GLGE 1G8PA 5FTNA 2C77A 4DSTA 5JI3E 1QBKC 2ATVA 4OHYA 2WICA 4EAQA 1F48A 2IYSA 3WYGA 4V0NA 1S3GA 4PC6A 4TLDA 3NXSA 3GEEA 4U00A 4YMTA 5A4JA 1M2OB 3AP3A 1MRSA 4HZUB 3GP8A 4PQYA 2G77B 2QUZA 4WZ6A 4I99A 2GJKA 4G01B 3RLFA 1E3MA 3ADCA 2VTKA 3NBYC 1LS6A 5L3SA 1TADA 4OI1A 2OXRA 2W6JD 2XITA 1KI8A 4X8LA 2ZI7A 1E96A 1ZNXA 1ZUIA 1KJZA 2CL0X 1UM8A 2WHXA 1CJTC 1T3LA 1NN5A 2WWFA 3OESA 3UG7A 1X1RA 1Z0FA 2ZQ5A 4PXAA 1U0HC 3I8XA 3L0OA 4OQLA 1OH5A 3HR8A 3D7MA 2F9LA 3Q7PA 2B8WA 1D2NA 1T6NA 4ZKDA 4BECA 3NIBA 2JJ8A 2CHQA 4JT4A 1JEDA 4G5QA 4W5HA 1M7BA 4A92A 4MUBA 1KY3A 2IYQA 3FPAA 5KO2A 3BK7A 1ZNZA 1G64A 4FWIB 2BKUA 2Y8EA 3QI2A 2FFBA 4IFEA 2B6HA 2OLKA 1JAIA 2IBMA 4LYJA 4Q1AA 1G1MA 4RSGA 2ANBA 3W8NA 3UK6A 4OKSA 3LBNA 4P33A 3VU9A 1GNQA 1WCV1 1M1YE 4FD2A 1PLKA 2QP9X 4HAWA 4JL8A 4DCTA 2D4HA 2ZI9A 3CO5A 1TU3A 4HDQB 4BE7B 4DCUA 5BWMA 2QMHA 1M8PA 3PUXA 1KOFA 3PUZA 2IUUA 3UMSA 4D4JA 3D6TB 2QSYA 4XWOA 1E2KA 2FZLA 1NF3A 1ZC3A 3C16C 1Z28A 3I5YA 4NE2A 4TMZA 4Y0VA 2F6RA 3CH5A 1KHTA 3BH0A 5AJZA 4AD8A 2QPAA 5FPYA 1C1YA 5FFMA 1UFQA 1W0KA 4V02A 1XXHA 3ZVNA 4DLVA 5B58C 1AQYA 4G3XA 3WMFA 4KHZA 1E2IA 5GJWC 5JCPA 5EJEA 1VDZA 1XF9A 4BFYA 1RRFA 4EPWA 1UDWA 4HZUA 4DLSA 2FNAA 3K9LA 5FUWA 5FTJA 1GOTA 3DKPA 1XTIA 1VHLA 1GUAA 3WRXC 5LD2C 1NBMD 3GLIB 4UNRA 2OCYC 2EFDB 1VIAA 3W5IA 5LDDC 4NH0A 5TXGA 1NP6A 1NRJB 2HCBA 1W46A 4NCHA 4ZIRA 3U7HB 1DVRA 4US0R 5JLJA 4NCKA 1NIPA 1VCOA 2WJYA 3LAWA 3N70A 2R44A 3AF1A 1EG7A 2WVJA 4KCGA 1L7VC 1XD9A 4MYTA 4MKFA 4F93B 2YWFA 4UXJA 4EUNA 2NQ2C 1RKBA 1G8HA 3CLVA 5AUPB 1G6OA 4TMVA 3RRZA 1VG0B 1VYUA 2VSXA 4KBGA 1VECA 2QT0A 4BFWA 1YR7A 4CIDA 1R7RA 3W90A 3LX5A 2GAAA 1TTTA 4DBLC 5JRZA 3UPUA 3B13B 1BS1A 2GKSA 4Z1MD 1IJEA 2B92A 4OQXA 5DI3A 5EP1A 1W4CA 2BJVA 2MSCB 3AVVA 3RC8A 3I92A 1A82A 1DE0A 4N1AA 1N5KA 2ZRKA 4Q4AA 1G4UR 1VTKA 2BDTA 3QG5A 3WP1B 4A4DA 3DDCA 1D2EA 1UPTA 2QRNA 3EAQA 3K8YA 4QGGA 1NBME 1US8B 1XU4A 3SE0A 3CX7A 4ON9A 2ZRBA 4S35A 3GLHB 1YJ5A 4IHQA 2QAGA 3BE4A 3W5JA 1Z08A 2RGXA 1XEFA 1G41A 4PANA 5SZIA 2ZE5A 1JI0A 1I4LD 3WRYC 2H16A 2F3TA 5E7MA 3T1VA 4DDUA 2QENA 2ZSBA 5F2EA 5CDFE 2JDIA 4WOPA 1Z3IX 1VG1A 1Z47A 2QU8A 1NKSA 2GZHA 1E2LA 2I3BA 3N5CA 4I1VA 1LTQA 5DHFA 4OJQA 2FWRA 2JEOA 3J81k 5L3RA 1KI1A 4NZYA 3IUYA 3I62A 3AVPA 1K6MA 1EFHA 1GRRA 4WXRA 2HF9A 4YONB 4IKEA 4KYIB 4C0HA 1Q3HA 1NJFA 3A1WA 3HU1A 1Z6TA 4W5WA 3BD9A 3GLGA 4FCTA 3UMRA 3QE0A 2V7QA 1U9IA 1GZSA 4ZIRB 5JWRA 2AKAB 2VF7A 4MA4A 5H1YA 2B21A 2IT1A 1D6JA 2IX3A 3FHOA 3SNHA 3H2YA 2NO1A 2J41A 3TUJC 2ZRPA 1OE0A 4RZ3A 5FOVA 4B3BA 2JLSA 4MKIA 1NMYA 2G9NA 1IY2A 5J47A 1SXJA 2ZETA 2E87A 2FGJA 2RH5A 2A5YB 3BRWD 4P4SA 4RD2A 4AKGA 4PR0A 4HI0E 1ZUNB 2DBYA 1E9RA 2REBA 4RD3A 4ZO4A 5FTLA 5JI2E 2PZGA 2IYVA 3FKSD 4Q4JB 4TSFA 3QPVA 2ZS9A 3P26A 1GKYA 5EE9A 2P2LA 1WF3A 2KBEA 3DZDA 3EXAA 4TT3A 3MFYA 3QVVA 1RZ3A 5EXXA 5C46F 1KDTA 1KGDA 3QXJA 3UANA 3B1VA 1G20E 1ZD8A 4EPXA 3L43A 3U6BA 5F9HA 5JSZA 2O52A 4DUGD 3A4LA 2FEMA 2ATXA 2OCPA 3IPYA 5GJVC 2HDNB 3LFUA 2KSQA 1T8TA 3SBDA 1EXMA 4JS0A 1SXJD 1HT2E 2ZJBA 2EW1A 1COWA 3NBXX 3KTAB 2ZR0A 1E69A 3VTKA 3ADKA 2PBRA 4L8GA 3LWNA 4GOJA 5EP2A 2GXQA 2XJ4A 3DMNA 1OHHD 1E2EA 2CCJA 2V4ZA 1KK2A 1NL3A 3TRFA 3DMDA 1E0JA 4KFRA 3RRYA 1OH6A 2VBCA 5FH9A 4Q00A 2A3RA 5FL3A 5FL7A 5GVRA 1H8HD 1E99A 1Q0UA 3FDIA 4Z54A 2P0EA 2F9MA 5JHHB 4M1SA 3A36A 1W7AA 1S8FA 4V0LA 3AKDA 3TQCA 4BLTA 1S0UA 5DN6D 2FPLA 1AGRA 2R6FA 3B1XA 4JBYA 4D82A 1N5IA 3Q8XB 4D4KA 3BAFA 3UG6A 2Q0HA 3RHFA 1LNZA 3A58B 5DYGA 3SJAA 3LX8A 1NJGA 3SJBA 4QXAA 4BLQA 1QVRA 4BEJA 2FF7A 2VO1A 3MRSA 5CM9C 4PO1A 1E2QA 3GLFE 1I4DD 3BJIC 3KUCA 1FUUA 2GRJA 1UF9A 2R62A 2GXAA 1DG1G 3EZ9A 1AKEA 4PSKA 2PMKA 2QM7A 4AYWA 3LQRA 2OFOA 1LV7A 2WJJA 3R9IA 2IYXA 4PHTA 2H1LA 3RRMA 3ND8A 3L82B 2BHRA 2E1RA 1U99A 4NPHA 3TBKA 3TSWA 3EASA 2ZSAA 2D7DA 1CEEA 2OLJA 1JR3A 1CTQA 4BASA 1LVGA 1N25A 3MWLA 3NDPA 3B1YA 4DDWA 5CLQA 3CNLA 1XJ0A 3ZYCA 2YINC 3CRRA 3WXMA 4BQSA 2IS4A 4POAA 5J40A 3S1AB 4DLUA 3Q5DA 3BS4A 3U6KA 4C0LA 4RCZA 4O3MA 3DOEA 2WIAA 3C15C 2HT6A 2NMVA 4MUAA 4TL9A 1SVLA 4R9UC 5HTKA 4WA7A 4H1UA 2W6IA 4YLGA 3QKTA 2ODWA 2G3YA 3G5UA 4B3DA 3HPQA 3QXSA 3QVUA 4EPTA 3AF3A 2GCNA 5FUYA 3I32A 3SS8A 1N5JA 1Q22A 2W6ID 3LD9A 1E2PA 4RCYA 2JLXA 3EZ6A 1E0KA 4EKDA 3I4LA 4Q4AB 4MKHA 4IDPA 4N0DA 4ITRC 3TVTA 4B35A 4KSBA 2H92A 4LHYA 1OW3B 4B6EA 2JLWA 1VG9B 2HCJB 2PEZA 2PCJA 3AP1A 4LHZA 3GEIA 4FMDB 3OEED 1PUIA 3HU2A 3ZDQA 5E7JA 1AA3A 4O2LA 2UZ3A 4A0GA 4B2PA 1KK1A 1NLZA 2ZANA 2FU5C 1KNQA 3QBVA 3TK1A 4P32A 2Z83A 2XOKA 2Q3FA 3CZQA 4P0TA 1ETUA 4G5GA 3KFXA 2CXXA 3EWSA 5DH9A 3IBYA 5JEEA 4JYCA 4JVSB 2C96A 2IYWA 2FV8A 2WSMA 4LX0A 1DADA 2JLRA 4DB2A 3EPHA 2GZAA 3VKHA 4PAMA 2V1UA 3GD7A 4KODA 4JLBA 4NP6A 5L3VA 2O8EB 4YDSA 1OXTA 4K46A 5FOTA 1LY1A 1ZM7A 1PJRA 4F4JA 3KL4A 3U44A 4DB4A 2WWIA 4PHGA 4TMXA 5BYKA 4Q66C 2XB4A 1KI4A 4TLBA 4HUQB 2CNWD 1Z29A 1HE1C 2GBLC 1EGAA 5DHAA 2B8TA 1J90A 3FE2A 1VMAA 3QJYA 3WNBA 2OILA 4Z8XA 3PVSA 1S1MA 4JBXA 4CYMA 5KNDA 1KDOA 3O8DA 4Q9IA 4C0JA 4C4PA 1E0SA 4HATA 3FMOB 4F38A 4LV6A 3Q5EA 1TQ6A 4JJKA 2B7BA 3TIFA 5IHPA 1U0LA 2WMOB 4IVRA 5EE1A 3T5DA 3EZFA 1J99A 3K70D 4GPTA 4L15A 3VFDA 2QP3A 2BKEA 2RGEA 1BYIA 1CJMA 3L8YA 1N0UA 5BN4A 1XZPA 1HURA 2ASEA 2BOVA 3BC1A 3CIOA 3OF5A 4JJZA 4Y0AA 5CLLA 1XFAA 4C0BA 2R6CA 3VX4A 2KB0A 4QBHA 5FBWB 1Z0KA 3QKRA 4BEBA 2G1KA 4I1UA 4PZYA 5KHOC 1ZINA 5GJCA 4WW0A 5IK2A 2FEOA 3PENA 3KJIA 2HYIC 3THWB 1RRPA 4M9QA 5D3QA 1JXMA 1P2SA 2LKCA 3LDAA 2AN9A 4DCVA 4F92B 4HB2A 2GEDA 2OHFA 4BLOA 3K53A 2GEVA 2HYDA 1JECA 1AS0A 2O0KA 1S2MA 3IHWA 1QDEA 1ZIOA 1DO2A 3AGPA 4IDQA 4IDOA 1SXJB 4AKEA 2IF0A 3AVOA 4QJ5A 1G3IA 4Z1MA 1JAHA 3UWKA 4EPRA 3P4XA 3L2OB 5JZVA 5FUVA 1G3UA 4IXMA 1ZC4A 4KO8A 3WNDA 5CB8A 2AFIE 3LVQE 3SR0A 3EW9A 2C9CA 3PUVA 1TPZA 4L5BA 5AJVB 4YXWA 2AWOA 2UVQA 4MYUA 4G5SA 1Z2CA 1J8YF 2QROA 3TW4A 3VR4A 3TW8B 4BFXA 4CEIA 3SFVA 2OUKA 4JLVA 4KFUA 2IUSA 3HP1A 1G18A 4RFVA 2ZRNA 1XWIA 1KIMA 2P3SA 4QL3A 3L0SA 4H9GA 4AIIA 1G3RA 1G5RA 1PLLA 2PX3A 4FN5A 4GFDA 2BCJQ 1XXHB 4LWZA 3KB1A 3GLFA 3BH6A 1LB1B 4ZV4A 3CF6R 1EFUA 5AR1A 1UBCA 2GWHA 3OIUA 4LJ5A 4C2TA 3X1YA 3AF0A 4URZR 5D3MA 3CRQA 2JIZA 2JJ1A 2EQBA 4M21A 2JJ2D 3NH9A 3E70C 3K9NA 3RS0A 3W6OA 1OH8A 2YWGA 1W0KD 5H70A 1DBSA 4Q47A 1MO3A 4CEIB 3PUYA 1CJVC 4ZCMA 1RIFA 1SKYE 1RW4A 2ZYUX 4A6PA 1G5PA 1P73A 1IJFA 1QHIA 8OHMA 1E2JA 1F3OA 3S1AA 2JJ1D 4QFMA 4XVRA 5EXPA 4A8JB 1JPJA 2GJAA 3A6PC 4W5JA 5FR2A 2F7SA 2IK8A 5HZKA 1D9ZA 2OFWA 4A9AA 3QKRB 2DB3A 2H57A 3WMEA 3MJRA 3GJ3A 4DSUA 4K8OA 1DG3A 4MGKR 4WIAA 4XWKA 2ZUDA 3U44B 2QPOA 2ZR7A 1X6VA 1JQJC 2FMXA 3HYRA 1CRQA 2ZS8A 1QVAA 4QBIA 2ZXUA 1DEKA 3GLHE 4ASUA 1OB5A 2KE5A 1A1VA 3T1QA 1UEIA 4RY2A 4BRUA 3AM1A 3PV0A 2IEZA 4ILEA 1VPLA 1OIWA 1HT1E 2NTYC 1ONBA 5B57C 1GRQA 3KX2A 1XTRA 2PLRA 2AWNA 2NPFA 4GOXA 5CDFA 1YZQA 4BZPA 2JATA 2G6BA 2WPDD 4Q02A 5K8LA 1OH7A 5KUTA 3M6AA 4L9WA 1KI6B 4HLQB 4DSOA 1S9HA 3E5HA 3U3JA 3EC2A 2W6JA 2WTUA 2OAP1 2OAQ1 1EFTA 4DLTA 4EDHA 1OFUX 1E1QA 1QHGA 1KTVA 1E2GA 2R6AA 2YWHA 3F8TA 4Q9KA 3SYLA 2YHSA 4IOMA 4QC2A 2XNDD 5KU1A 1N6HA 2JJ2A 4LC1A 3RS5A 3ZH9B 1YU9A 3LW8A 3WYAA 3U61B 1GL9B 1VCIA 4US1R 3FVQA 4HB3A 1KJYA 1KMHB 2WSSA 621PA 3M4YA 1E4VA 2ZTSA 3TAHA 4CF7A 5D3MB 2KWIA 1U90A 3QNUA 1Z8FA 2QE7A 3T35A 1ZU5A 4LOAA 2CHVA 2IS6A 4HEJA 1TU4A 4D6PA 2QZ4A 3MGCA 4DVGA 1OXVA 2MSDB 3NG1A 4X8HA 5UKDA 2N46A 2QP4A 1DAMA 1FUKA 5KNBA 2FSGA 4URVR 1ZJ6A 1E2FA 1P6XA 2C78A 1KNXA 2QA5A 4JT2A 2NO6A 2OESA 3WHKA 5JS8A 3EPJA 1UBGA 2CK3A 3UIEA 5IF9A 4Q1FA 2JLYA 1D2MA 3DM5A 4BFSA 4D0GA 1KKLA 4G5RA 3U3KA 2GNOA 1XEWX 3HU3A 2C2HA 2FG5A 3ZVMA 1XZQA 4M1WA 1CULC 4Q4JA 3T1TA 3GMTA 4XWAA 4ACBA 1YRAA 4IOJA 1RC8A 1VYTA 4PSVA 5DN6A 4CEJA 2WJIA 1HH4A 4B75A 5JS7A 4X8OA 4RD4A 1YZTA 3NH6A 1SHKA 1GG2A 3AVQA 1E9DA 4QNMA 4O0MA 3QOFA 2PCLA 3IIJA 3THXB 4JLNA 4IVPA 1DAKA 4IEIA 4B6FA 2O8DA 2ZJ2A 3U7FB 4DXAA 1G7CA 1OIXA 3MMPA 3H4MA 3IILA 2F43A 1U8YA 4CEJB 4DLXA 1G5TA 5JSZB 3B1WA 3MJHA 3TNFA 2IEYA 3SU8A 1ESNA 2Z4SA 3PEUA 3FHTA 1IBRA 2REOA 5FBLB 4Q9LA 1IOZA 2A5JA 4O2RA 2ZSEA 4NTZA 2RGDA 3OFNA 2AL7A 1F5NA 3WMGA 2W2VA 3MWJA 2I1QA 2IWHA 4O25A 2ZU6A 3A1VA 3JZMA 1R10A 3ZIAD 2UKDA 1J8MF 5FPSA 2D62A 3I8SA 4B3CA 5J4VA 4P31A 4CGZA 5FTMA 2ZPTX 2ORIA 2CLDX 2DYKA 3HJNA 2CJWB 2RGGA 4LY6A 3PEVA 2PT5A 1A4RA 2ORWA 4A0HA 4N0EA 4ZDJA 1SGWA 2CNWA 3LH5A 3IIKA 4NCNA 3X1ZA 4ARZB 1AJEA 1TQ2A 2ONKA 4KAXA 4A0RA 5GADl 2XAUA 1RJ9B 5L3SB 3BERA 4M2LA 4MRVA 2OBNA 1PZNA 4YMWA 1KSGA 2DY1A 4ZPXA 4A82A 1OJLA 1ZM4A 3FMIA 3RC3A 2BM1A 4B2IA 4D4MA 4URXR 1GFIA 2O8FA 4OK3A 3RSLA 1A2KC 3KQUA 3CPHA 3GFTA 1ANKA 1TEVA 2GXUA 1UDXA 4IVQA 5GJBA 4BLPA 4NYJQ 1G16A 2IXGA 2NIPA 4B32A 3VHLB 5FBVB 1KO7A 4XD7A 2IHYA 4CW7A 1BIFA 4TQAA 3BOSA 1X8JA 5TDHA 1QG4A 1QG2A 3TR5A 2CVHA 1PV4A 4B74A 4TT3D 1VCMA 2VP0A 1ODFA 2QL6A 3H0KA 3AVXA 3PEWA 2REXB 4RD0A 1W0JD 4RFSA 3OE7A 5DI9A 1SULA 1HE8B 2ZROA 3B7GA 1P62B 1R4AA 3NEJA 1KK3A 4GDFA 1W4AA 2W2XA 1XBTA 5HE9A 3NHAA 1J7KA 1XTQA 2GILA 3QXHA 4B34A 2O8DB 3VR2A 5KDLA 4D0NA 4Q4LA 3OE7D 4ZDKA 3EWAA 4PZZA 2GZDA 2CE7A 2ODBA 3BB3A 2W58A 3BXZA 4TMTA 3IQXA 3PJRA 2CE2X 2ZUCA 3QF4B 3X1XA 4CRWB 1KO8A 1CF4A 2WOJA 2CCKA 821PA 1M34E 5L3QB 1P75A 3P32A 2EFHB 1WP9A 2PZEA 2F1HA 2Z5FA 5DSZA 4QBFA 1NN1A 4KSCA 1N6IA 3MUFA 3OEEA 5CYPA 4WZBE 2YJTD 3GJ0A 3LBHA 3KQLA 3W9YA 4MYCA 3AKYA 5H8WA 5CIWA 2PEYA 3BB1A 4LBYA 3U3RA 4TTRA 5JJIA 1QHHA 2YZ2A 3FFBA 4LI0A 4FWTA 1CR0A 5KNCA 3NDBB 4LBVA 3E2IA 4RVCA 4IRUB 4OYHA 4OL0A 1RJ9A 1N6PA 4PO8A 4FIDA 1W48A 4KJZA 4JLPA 1SXJC 4OHVA 3CF2A 3UKDA 5JFGA 4MQBA 4QG7A 2ZJOA 2O0HA 3QBTA 4ESVA 1XPUA 1UKVY 3B6EA 3KKMA 1KO1A 3L0IB 2OXCA 2YV5A 4HUQA 1E98A 5KPJA 2V3CC 2ZIAA 1FNNA 3ZIAA 3FKSA 4TSFD 3B85A 4G0NA 1NVWQ 2HEIA 4B3FX 3RS4A 2HXYA 1IY1A 2OZEA 3AUXA 3M0EA 3KDSE 3SQXA 3C5HA 1XTJA 4MITA 3VR6A 1ZUHA 3MLEA 2EFGA 4C0AC 3O8RA 4A15A 1XB2A 3AP2A 3FHCB 2QAJA 3EPKA 3IO5A 4GMXA 2CDNA 2X2EA 121PA 4Q03A 4GMDA 2V9PA 4LBWA 3U7GA 4OQFA 5DIFA 1W49A 1Q1BA 4HAUA 4L9SA 2W0MA 2XTNA 3TUIC 3P4YA 2VSOA 3K0FB 2ZE7A 4UXHA 4JMPA 5AUNB 3O8CA 5KSOA 2JCSA 4DDTA 1X86B 4RKFA 5AUOB 5CIQA 4TYWA 2ZS7A 1W36B 1ZNYA 2WAXA 2J7PD 4HAYA 4A2QA 1E1RD 1XD2B 2BMDA 4LSGA 1ZYUA 4PQFA 1OFIA 2ZRHA 2OBLA 4YMUA 6Q21A 3QPWA 5AJWA 4DT1B 3ADBA 1M7GA 1TF2A 2VHUA 2XSZD 3NBFA 2ZYVX 3ZS8A 1Q21A 1ZM3A 1FX0A 4HAZA 2Q9AA 5C18A 1XJCA 3IO3A 2ODEA 3UWOA 2CEAA 1BMFD 3K9GA 4C0KA 2J0SA 2CL6X 3K0FA 2IXFA 2RGNA 1HY3A 2FPKA 4DIDA 1K5GA 4QGHA 4F4IA 4XSGA 2WOOA 1EWRA 4Q48A 3B8HA 1P72A 3NKVA 3B60A 2BEKA 1NN3A 4ABYA 3KJGA 4HDOB 2N42A 3JVVA 4UJ3A 4CVNA 4DWJA 3LA6A 1WQ1R 3K09A 2ZI4A 4B73A 1E79A 2BV3A 1P7CA 4NHOA 1YRBA 2HLDD 5EXTA 4URUR 1KI3A 2GBLA 3EZ2A 2IYZA 4KVAA 2LKDA 4RD1A 4EJSC 1NNEA 3MSXA 1L8QA 1NSFA 4KFSA 4DUGA 2W2TA 2C98A 1H8ED 1EX7A 1EESA 2P5SA 2EYQA 4PFSA 5G53C 4NU0A 2NZJA 2J0UA 3SJCA 4AY2A 2WBLC 3H1TA 4FMCB 4J0QA 4B33A 3THOA 3QF4A 4PPFA 4NBSA 3TR0A 4UNPA 2H17A 1Z6AA 2O8FB 2ZRLA 1IN8A 3QXCA 4KLZA 4Q7MB 3AKEA 4GRAA 4BFVA 2DFNA 4JLJA 3T61A 2GHIA 1CP2A 4R2IA 2XNSA 2ZVQX 1R8QA 1G8YA 5TARA 2PT7A 4LJ7A 5CITA 4MH0R 4AURA 2WAYA 1NBMA 3CKLA 4UJ5A 4ZCIA 3HWSA 2C04A 2RKOA 4QGFA 3ZD6A 3AVYA 1E0AA 5C1BA 5E4FA 4AYTA 1FP7A 3AV0B 1W5TA 3P1JA 1TX4B 3FWYA 1DARA 3FOZA 5FI1B 3K70C 4W7SA 3TSZA 4A8JA 2BC9A 4IOKA 1TMKA 4EFNA 2VHCA 1KZGB 3R9WA 1EFRA 1JJVA 1EK0A 2ZRCA 1G7RA 2GCPA 4CEHA 1SVMA 1WRBA 2YC2C 3I72A 1V5WA 2IWRA 2QORA 2ZREA 5KSZA 2C95A 4PO9A 4HB4A 2ZI5A 4F7WA 1Z83A 4DLYA 4K81B 1AK2A 3LO5A 1G17A 1VYVA 3QPUA 1ZMXA 2WMNB 2ECKA 2FX3A 5F9FA 4EQ6A 5SZJA 2Q3HA 4PTLA 2WKPA 4DCNA 1NVUQ 4FMDF 4LZZA 2Z4RA 2QAGC 5HE8A 2NZ8A 4PC1A 4DJTA 3RS2A 4D2IA 2H8KA 4GZMA 2RCNA 1UEJA 3NHBA 3UXMA 2ZE6A 5EUQB 2FGKA 3K1JA 1DAGA 3PG5A 1KAGA 2O8EA 4DEYA 1O87A 1AIPA 2P6UA 5EE5B 2OG2A 4MDFA 3RABA 1EFRD 1FP6A 3V4RA 3PXGA 3GJ7A 1G7SA 2J46A 1OXSC 4P3YA 4DEXA 5G40A 2AHOA 1UKEA 3QG1A 4PAQA 5BN5A 3TVDA 2XXAB 2AK2A 4LJ4A 5CJ2A 1XP8A 1AKYA 1QF9A 3IQWA 1FFHA 4A8JC 2ZI6A 5JJKA 2O8CA 5DYIA 3QEJA 2VH5R 4KFTA 3QF7A 4IEEA 3B1ZA 1EWQA 1XD2A 3RDPA 1Z0DA 3U4QB 2FJUA 5K8TA 1JJ7A 4FCWA 2IYRA 5KDOA 1OIVA 2J87A 1SVSA 4XIGS 3TKLA 3U60B 1YHNA 1U98A 3CPEA 2DR3A 5AJYA 1RRGA 1MV5A 2H18A 4KBFA 4I81A 3KQNA 1IM2A 1RFLA 2AX4A 3EIQA 1TF7A 3WY9A 2K5UA 2IC5A 421PA 4ESHA 1Z06A 5FOXA 1FPMA 3P20A 1RRCA 2IA5A 5EXSA 1OSNA 2XZOA 1JBKA 2VP4A 3R7WA 4UXIA 1Q20A 3B9PA 3DPUA 4A6XA 2ANCA 2CBZA 3T34A 4Q5IA 2RHDA 2VYFA 4GOKA 5HCNA 2GEUA 1NMXA 2HUPA 1R6BX 1W1WA 1U9IC 1N6RA 2GJ8A 5AJXA 4WZAE 1EX6A 3EZ7A 2QMEA 4TYPA 3F5FA 2A5FA 3OHMA 4XH9B 5IK2D 3T5GA 5LD2B 1Q1QA 2RGBA 3BIFA 3QKUA 5FI0B 3NVAA 4QRHA 3VQTA 4HLDA 1YKSA 3PITA 2IL1A 2UZIR 3B2EA 4I1SA 4JLOA 1JR6A 1LF0A 1CXZA 3DOFA 2JIZD 2VRWA 4WXPA 2QMUA 1XD8A 1KSFX 3KB2A 2PJRA 4AK9A 1E2HA 4LJ9A 4MDEA 1TL7C 4TYYA 4Q21A 3L8ZA 3D31A 3LQQA 3P27A 4TMWA 3PQCA 2EYUA 2QRZA 2PLFA 1HUQA 1OF1A 2NG1A 4JSYA 1MO6A 1Z6XA 2ONJA 1ZIPA 5F3WB 2GTPA 4OK5A 2XXAA 1D5CA 5TY0A 2Z6VA 3B82A 2D7CA 1IQPA 4FCVA 5P21A 2XZLA 1II0A 3NTUA 4ARZA 4GZLA 1PUJA 4ZCLA 2CHGA 3CWZA 1ZRHA 4LPKA 2QTHA 2HXSA 3KJHA 1XPRA 1US8A 3K9HA 1GTVA 4U02A 1QHNA 2IF2A 3W6PA 2WZQA 3GJXC 1YQTA 1BMFA 1N6OA 1T5LA 1MR3F 3T12A 4E03A 2JASA 2QAGB 2QGNA 1TAGA 2GJ9A 1X8KA 4UKDA 1H8EA 3ASZA 4M0LA 5BW8A 1YZGA 2NO9A 3CBQA 1Z2AA 3ZQJA 4HYYA 1RVDA 3EC1A 3I61A 2HJVA 1XX6A 4M4SA 1CRPA 5TB5A 2A2ZA 1SHZA 1GNRA 3KKPA 4CDGA 2J0UB 3QKSA 1E6CA 2ZJAA 4L16A 3IPXA 4OQNA 4AG5A 1W36C 2XGJA 1D9XA 2RHMA 1A2BA 4G5OA 5EE3A 3ICQB 2ZYTX 2HT1A 1MKYA 1GITA 1ZM9A 1ZVQA 4Q7JB 4JBWA 1GAJA 2F3RA 2GK6A 3QQ5A 1UBFA 3SDZA 4YMSA 4RFSB 1N0WA 1NIJA 5CJPA 1BOFA 3LXXA 5KOYA 1E9FA 2ZAMA 1YZNA 2QT1A 2BEJA 2VHQA 3C8UA 4TLCA 3VKWA 2HV8A 3ZD7A 4EPVA 2OBMA 1M74A 2WWYA 1M7HA 4YXWD 3BORA 3C5CA 4LGMA 4KLNA 4DZZA 5IRCD 3CR8A 4PPQA 5C2JB 2VLIA 2ZRFA 1FNMA 1KI2A 1Y63A 4A2PA 4JLDA 3SZRA 3I3SR 721PA 2BBOA 1DAFA 4RZ2A 4TTPA 1X1SA 4LHXA 1GKIA 4HAVA 4Z8YA 3CM0A 1KSHA 1YE8A 1E2MA 3OAAA 5J4YA 4BLRA 1G7TA 1UBEA 3ECCA 3VR1A 4D26A 3AQ4A 4OHWA 4IOLA 4Q4HA 1CR2A 3NWJA 3RS3A 3IHLA 2X77A 3GLIA 3D3QA 1DELA 4Q1DA 2NO0A 1XEXB 4LYFA 1P3JA 4LHVA 3HR7A 4V03A 2X2FA 3OIVA 2EVWX 3DZ8A 3T15A 5BXQC 3U3MA 4D25A 1JB1A 3U2QA 2XEXA 2FDCA 1GDDA 3CZPA 1XCGB 4KITB 2ZVPX 1IY0A 3IEVA 4R71A 1QHYA 3CWQA 1I2MA 4OJKA 5FOSA 1NY6A 1IXSB 1NLYA 2BMJA 2VP5A 1FQJA 3UATA 1OHHA 2PH1A 1GP2A 1MO4A 2ERYA 1OPXA 2WJVA 4OI0A 3OEHD 2BM0A 1GILA 1I2DA 2DWPA 3HDTA 3T06B 3KFVA 5J4KA 4MRRA 4M9XA 2J3EA 4DLRA 1R0YA 3BFVA 2OT3B 2QTFA 3OEHA 1T0HB 2VIIA 3PIRA 1DO0A 4S2EA 3GFPA 1XTKA 3SEAA 3AB3A 2FH5B 2ZITA 1SKQA 2AKYA 2EWVA 3ZVLA 2VHJA 3GJ8A 1ZCAA 2JLUA 2XOKD 5F98A 4RZXA 3GPLA 4PC7A 1T5IA 3A8TA 3EIHA 4QHTA 3BH7A 2WJHA 5FUXA 4CEHB 3ZGXA 1JPNA 4LYAA 3ZVRA 1A7JA 4CT4B 3WP0A 2DHRA 4TZ0A 3VNVA 2YOGA 4OK6A 3SHWA 2W83A 1DOAA 5FPTA 4AG6A 2O8BA 1D8TA 1KJWA 3KJEA 2GK7A 1NI3A 2FE4A 4NKRA 4YQFA 4B3GA 4PZLA 1GNPA 2W0SA 3F3YA 4GI7A 1IHUA 1IAQA 5LBIA 2ZSDA 3I1FA 4M22A 2X19A 2V6JA 2FN4A 4F91B 5KPDA 2KBFA 3LV8A 1LS1A 4V0MA 3NC1C 2ZRDA 5ELXA 3Q72A 5HKKA 2JA1A 4JVMA 5K8IA 4LYHA 2J7KA 1P9NA 3SQWA 2QQEA 4M8NE 1XMJA 1ZD1A 1KMQA 4DIEA 1M6NA 5B30A 3LXRA 3H86A 2O8CB 3IDQA 2FSFA 3AF4A 3AH8A 3W34A 3CW2A 4LPSA 2C8VA 5G3ZA 3CR7A 2F1RA 4PAOA 3R9XA 3AVWA 1OYYA 2N1BA 4QJ3A 2BMFA 4V0KA 3WBKA 3ZJYA 1H8HA 4UNQA 3OZXA 1TUEA 4FW9A 5K8UA 4GSYA 2OSBA 1E4YA 2JLQA 4XD7D 2ZRAA 4HLCA 1II9A 2DFLA 3TUZC 4B3XA 4PX9A 3KKOA 2MMCA 1G3QA 4FXPA 4JKYA 4A1FA 4TLAA 2WPDA 2L0XA 1COWD 5SZHB 2J1LA 1VG8A 4HSEA 1P4SA 1TF5A 4E5UA 4M1KA 2AXPA 1SVKA 1F2TA
chains in the Genus database with same CATH superfamily
1V43A 1GAQA 1ZJZA 2C9YA 2O0JA 1OXXK 4KSYA 1AN0A 1Q3TA 2CVPA 4FX2A 4HFJA 3SXUA 4DJJA 2X8BA 1NYTA 1UK8A 3DL2A 2PIDA 2QD2A 1THGA 1PQYA 3KTAA 4F06A 3DBIA 4O4JA 4HUTA 3KSBC 1OX5A 2RHGB 2JHAA 3HDGA 3OIYA 1JSXA 1XWFA 2H52A 1K5DA 1KZYC 2WINI 2LVBA 3KAKA 3MJDA 3WRXA 2WF6A 3PXAA 3CZAA 4CCAA 2CUZA 3HACA 2V55B 3QTTA 4MP3A 4TTQA 4DSAA 3NHSA 4LNUA 2XBUA 2QJWA 5A9SB 3EXEA 3A4TA 1I2AA 4C4YA 4AC9A 2DWQA 1CVRA 1VBMA 4MINA 2OP1A 1EWYA 2XBLA 3QU9A 5AUQA 3W5VA 4ENVA 3G7SA 1JEQB 3EHEA 4GI5A 4UNIA 1XMIA 1P2UA 3QV1A 4CF6A 5U4QA 1L1EA 2A7QA 1XU9A 2C7BA 3NOVA 4I46A 1EBUA 1T13A 4U6NA 3SYNA 1YMQA 3NP9A 3PGXA 3IP7A 3FGPA 1C7IA 4EARA 2OSVA 5JAPA 3DBLA 3QNMA 4OFBA 5DDIP 1UT6A 3R8CA 3T7RA 5HR5A 1Q0HA 4X97A 2RGWA 5J4HA 4L4RA 4NFHA 3OZBA 4RF2A 1PK9A 4NONA 2R8XA 2R86A 4RIEA 1FJGB 1XZEA 3HXPA 3KQQA 2VDWA 2ERXA 4MGEA 1JG1A 2RC6A 3H9CA 4P53A 5G02A 4BN4A 5LMCA 1QV9A 3CGGA 5BQ5A 2GOYA 3C39A 3LYHA 3EXHC 4KWEA 5LBUA 3TKAA 3ZHBA 1PEKE 3NWEA 3ABZA 3G9XA 2Q3LA 2D59A 2DSTA 2RGNC 3L7IA 2NU8B 1HQYE 4JBHA 1QE5A 4H3KB 4CLDA 2VRNA 3F98A 3I9JA 5TGZA 1W6UA 3EGDB 4RHTA 4RPJA 5E1MA 3UUWA 3WRWA 2CNNA 2O8BB 2NSDA 3SZ3A 2OZVA 3TL6A 4L8LA 2D5BA 3H2KA 4NL4H 3IAHA 1B6SA 2VCYA 4L7QA 1D6SA 4Q1CA 4X84A 3A6JA 1AZSC 3MWYW 3ETLA 4LK2A 4YAEA 4WBSA 5I9MA 1XDGA 4L7VA 3BZUA 5T41A 4KRFA 1EMDA 1WZCA 1T91A 2A0XA 1Y89A 2YCLA 1SA0A 3DWFA 4QXRA 5AJUA 1NF8A 2F8LA 3BWCA 4GUAA 2XCRB 1PGPA 3GJTA 2EFCB 3AKCA 2X1VA 3EBPA 1NFQA 3FOBA 4FK8A 1QK4A 4DPLA 1SCIA 2H06A 2D74A 4FI3C 3SHOA 3ZD8A 3D5TA 2CNBA 2R9VA 2YS6A 3DFUA 3L7CA 3OIGA 4UQOA 3U49A 4ETMA 3O95A 3TBFA 4MUXA 4MLPA 1JJAA 2H1IA 3T4PA 4DG8A 1YZUA 4PG5A 1V41E 5A6SB 3O91A 1R64A 5HK8A 1E1QD 1QTNA 4P08A 4RZUA 3R0IA 5I6DA 3ZS9A 1VHQA 4P4UA 1SQ5A 1QO0D 4DR1B 1NQUA 3T1YB 2WYVA 4YP7A 2IYTA 1LPAB 1T3HA 3RYTC 2JDID 5H7XA 4TVOA 3H17A 1Z25A 2IGTA 2JCBA 2X0RA 4ND2A 1SVOA 2GWRA 2IYUA 3BULA 3SPXA 3GL9A 1N3BA 4URYR 5JO9A 1YMVA 2X9GA 2AR7A 2Y1FA 2DFPA 4LTMA 4AY3A 4JKOA 4K26A 4D80A 1GCGA 1S1CA 4QTTB 3AJDA 4MWCA 2QZZA 1NAIA 4IO1A 4G0UA 3O3OB 2OV2A 3TH5A 4OXQA 2GCEA 5ECYA 1ZSYA 1CHNA 1JDSA 1XZHA 4C2AA 2IEBA 1ES9A 3H65A 4OHMA 4PYRA 3RBXA 4DMCA 3FGNA 5JECA 2HK8A 4JLKA 1DX9A 1NUHA 5AVYA 3I2FA 4BUCA 1XE3A 2BMWA 4YYEA 1C9EA 4C4OA 4OSPA 1U4OA 2QMOA 3ESDA 1KI9A 5DLQC 5CFRA 3V9PA 2YZMA 4QU8A 4BGEA 1VM6A 3OOJA 4X61A 1SVWA 4Y3UA 5H9VA 3GLFB 4BQRA 2GHRA 1Z4NA 3QVGA 4HEA6 1KYVA 2G0AA 4MGIR 1A4XA 3GUHA 1I32A 1F9AA 3D8BA 5DCYA 5I4IA 3OQOA 5D5PA 4ZTUB 3K0CA 4DNFA 4IW3B 1H0KA 1E6KA 1RXEA 3A6LA 3LVRE 4HXFB 5JHGB 1AQUA 4UDXX 3A2KA 2V6IA 2P79A 2I66A 3PYXA 4OQYA 4E5DA 1ML4A 3NIFB 3BHIA 1YVDA 4LAFA 4US2R 3EIWA 3R3YA 1RXWA 3DZIA 5DBEX 3ENVA 4MTLA 2CGEA 3AXSA 3DHYA 2AXQA 3LY8A 4IH1A 4D97A 3AR8A 3ZBQA 3NT5A 4XZ3A 3K30A 1XZCA 5K0BA 3LLMA 4ZVUA 4GP7A 1J9EA 5LQAA 2C1EA 2Q0SA 2Y0EA 1SBQA 3ONWA 5LSAA 2R7LA 1YCDA 3OPYI 2VAXA 5TS3A 1K86A 3BFXA 4RIFA 4B7AA 5GVSA 2AUMA 1FZTA 2HRDA 3HDVA 1M5TA 3K5WA 1VHJA 4LRQA 4B40A 3G8DA 4MYHA 4EF5A 3LDUA 3VNRA 4UBJA 1U0JA 3I83A 3WIUA 4D3DA 5H02A 2MYNA 5TVGA 1KO4A 1X19A 3X2SA 1T4CA 3KXKA 2FTKE 3ZTYA 5JY1A 2WAOA 4JP2A 4MUHA 5L7YA 3KB6A 3H83A 4OKNA 4H08A 4KX5A 2IVFA 4ZYTA 4U6QA 2QNIA 2XPCA 5TEVA 3RHZA 2O20A 5M04A 3TG2A 4URHA 3EK2A 2ZSFA 3PTLA 1EGQA 4D8XA 2XHZA 4G56A 4GLLA 2HOQA 1KEZA 1II8A 4UAGA 1OVMA 3AT1A 3U4AA 4D43A 4DY4A 4UTVA 3SR3A 3KSAC 4X6XA 2NXWA 4LFBB 3UAVA 1KY2A 1S8OA 2DRIA 2ZCVA 3CB4A 4GKBA 2OOSA 4LXQA 5NLLA 4EGJA 5ALZA 2XHEA 4EJSA 5A4MS 4L28A 2NP6A 4QSMA 4DPKA 3ZZ1A 3UH1A 2Z58A 2E48A 2HJRA 3WLMA 3ZY5A 1GIAA 1S2NA 3GEDA 4LXYA 4RANA 4F1WA 5B4UA 5TMDA 3AEYA 2BFNA 3GH1A 5IT0A 2WUWE 3MG9A 3PFBA 4C4XA 3BSWA 1YBVA 3G2JA 4K6KA 2NPIA 5G41A 1J25A 2A9PA 3NOQA 4ZO9A 3WYFA 2GERA 1P0QA 3MUEA 3BD8A 4GNKA 4NENA 4OP2A 1NVMB 3S2SA 3SF8A 1ZGJA 1MH1A 1NVVQ 4II2A 1GKLA 3C3EA 5AVVA 1QHSA 2FPMA 3BB4A 5SYNA 1DFHA 4N3NA 1KMHA 4ZOEA 1JQ5A 1U5AA 3ELDA 1RYHA 4CG1A 2C3UA 3G82C 4TM7A 3W5DA 4LJYA 4WY5A 3CWCA 4MWBA 5IWAB 5TRTA 1VKJA 2PLWA 4MGZR 4XASA 4X00A 2IZ7A 2WAAA 3U4MA 3U7QA 3GA7A 1XO1A 2PR7A 5F2NA 5DTMA 3T1OA 1YTLA 2GF0A 4C6HA 1VSBA 2BE7A 2YVKA 3E48A 3IEXA 3N7TA 4KQ9A 4Y1EA 5ALRA 3WIEA 2I03A 2FK7A 1C1HA 3TLXA 1U8ZA 3FZEA 3HYTA 1MX3A 3V97A 1HQCA 1DTWA 1LUAA 2UZ1B 1JQLB 4R1MA 1C0KA 2G0NA 2OWDA 3UNXA 4DLBA 1P45A 5LA6F 2R87A 2Y1CA 4RJLA 2VZLA 4I5IA 1J07A 4XYGA 3HSSA 5I9TA 3A10A 3IR6A 1J2EA 4MB6A 2OO7A 4EVQA 4X3PA 3UMGA 1XYGA 3V8PA 5DNYB 4M1QA 2IDJA 5JMTA 3CO0S 1JPVA 4ZP1A 1X92A 2O4UX 1QFMA 1B7GO 2V98A 1Q0LA 1T2CA 3JAKB 4BMVA 5I3CA 1BHO1 1UFRA 2W2LD 5JWHA 2A94A 2XDWA 4XARA 1WF6A 3TIGA 1H4VB 1FDSA 2WJWA 4EVSA 1IN7A 2XSZA 4JJ8A 2EERA 2KLBA 1HNXB 1CDEA 2C83A 4HB0A 4HDCA 3ANMA 3N5KA 4LE1A 3X1MA 1M72A 5KYXA 2WPNA 4EHFA 3GT7A 2NUTA 1VCNA 4OKIA 1Y5RA 4LSMA 4D0RA 3JTMA 2VSQA 3EGXB 4FMBB 2XOXA 1R0LA 1YR9A 4MKXA 2OHGA 3TI7A 3TQSA 2QMZA 4WGGA 1UWLA 3KR0A 2JIQA 3LUGA 1E9SA 4Q7LA 4ZV7A 3RSOA 1ECBA 1WA5A 3CX8A 2QG6A 1PJ4A 1RAFA 2FSIA 1POXA 3KQMA 4OLHA 3IJ5A 4G5XA 1E9CA 4YMVA 4WK2B 2G04A 1J0CA 3N76A 1AV6A 4EY8A 2A78A 2YXNA 3TQHA 4ALLA 4BZQA 5LQRA 3NV9A 1RHUA 3T0FA 1W25A 1R9MA 4M9ZA 1X1TA 3O83A 3GRUA 5K6RA 4GU5A 2I4OA 3QJ5A 1FLAA 4OI4A 4RTJA 5LQNA 4S2UA 1L4MA 3FYHA 1W35A 1GU0A 3RNLA 3V8EA 2Q9CA 2JFVA 1CY7A 1L2TA 4BAZA 3O38A 3M9WA 4GMHA 3REGA 4TKUA 5L4NA 2RGCA 3JQ9C 4K6FA 2AMYA 1NXXA 3W8RA 1H2WA 5KCZA 3AO0B 4RA9B 4BDSA 2A30A 3IMKA 2NU7B 3M83A 4KGZA 2JW5A 4NS1A 3TTWA 4HJXA 3AR5A 3SBEA 2DCUA 1I8TA 3EISA 4N5NA 4DHWA 3UT5A 5CXQA 4RWEA 1MGPA 4WXEA 2GCGA 3TW0A 3UAYA 3LDFA 2RAFA 1S8NA 2B2XA 2PUGA 2OWEA 1R5BA 1C4OA 3AZPA 1EUDB 2YVUA 1C4XA 4YAGA 5EVCA 2CV1A 1CR4A 4AY4A 1W4RA 4AO7A 2VWHA 1JDBC 3A1TA 5ILQA 2NSYA 4OY3A 3HVRA 3STHA 1YC5A 5TSDA 1D0SA 3LCJA 4AKIA 3DO6A 4TL6A 1OLSB 4X41A 1KS2A 4DLZA 1JSRA 1OXBB 1YR2A 2D3WA 2G8NA 3GFOA 4B71A 2XX3A 3HVJA 2HTEA 4MR7A 4MUKA 4LJ8A 3SE7A 5CB4A 4J9VA 3PQ4A 3N8IA 2PRZA 4NLLA 4EFLA 4TZ6A 4EVIA 4OHXA 3FGZA 1CY2A 4UBMA 5LKRA 4AL4A 2ZTMA 3U5ZB 3FLEA 2NTVA 2H4XA 1EYZA 2PGAA 3CKMA 3PIIA 5TPWA 4BZXA 3CRVA 2JLCA 4GAEA 3ZCVA 4JLAA 2VP2A 1LQUA 1SKAA 3LXMA 4G0MA 4NBVA 4WY2A 4BTLA 4EPYA 3OCJA 2CVOA 3IAUA 5K8VA 1ZMTA 4R3NA 2Z98A 3ZUPA 3HY6A 1QE0A 4GX0A 2AFIA 1TCVA 1R0XA 3N7AA 2AC4A 5KSPA 2WYIA 1H1LA 3UUEA 5ALLA 1RE0A 5CFMA 1DLIA 1N92A 3C6YA 3KPUA 2XA2A 1SY7A 1P61B 1E1RA 4JVOA 1FXWF 4KYUA 2XTMA 1HZZC 1JTEA 3MA0A 4GPEA 4RU1A 4IDNA 1O3YA 1SZCA 5CK4A 4RHYA 4GL2A 3I73A 2B0CA 2PAAA 2IHZA 2I3ZA 3FMFA 5JXGA 1N3LA 5IJ9A 1E6LA 1K89A 1GUYA 1BKDR 2FQXA 3W5BA 3SMVA 5M3BA 5TVKA 5BSVA 3HGQA 2FOLA 3MQFA 1ZUWA 4EX7A 1TGVA 3KHUA 4FMCF 4M53A 2HHHB 2BGWA 1EM8B 4BFTA 1BN6A 2CSXA 1B23P 2PA0A 5BUZA 3G23A 3DL0A 3I9V1 2YJNA 2ZB7A 1PP4A 2H08A 3TIIA 3DMTA 4BO6A 4KI0A 4E32A 4XSHA 3T7TA 4LDNA 1H85A 3CJRA 1T5DX 5JSYA 5LP6C 4QBKA 4C9BA 3QSYA 2Z0MA 1D6NA 3CLSD 2HJSA 3HP7A 5B3JA 2JAQA 4HEQA 5LB4A 3FJYA 1P60A 2PL1A 4K2AA 1MRNA 4M1OA 4ERXA 2QRVB 1QK3A 4L07A 3QUSA 2DUNA 3CPSA 5BR7A 2POQX 2P2ZA 3BCHA 1O6FA 3BMNA 3D64A 3DEFA 3P9KA 4JA0A 2PRKA 1XNGA 4Y9TA 2R1TB 4FOPA 1K3UB 1SIBE 1ZQ9A 3H8JA 3FTFA 3ABIA 5IC4A 1TEXA 3TR6A 4I5GA 4J0IA 4M1YA 3OWHA 3ZI0A 1Z5ZA 1QVVA 2IZ5A 4UBNA 3W5UA 1G8GA 2V7GA 1R5OA 5FR1A 5BOSB 1ZM2A 4B82A 2C8JA 3PFFA 2DHCA 4QYWA 3MN1A 4TUYF 2JGJA 3ITNA 1DHTA 4X7MA 5IDVA 5CDTA 1VIYA 3ENWA 1ZL2A 1APBA 3AUFA 3NZEA 2WJGA 1SC9A 5FQOA 1E9AA 2CXUA 3RANA 4BRWA 4BO7A 5LL6P 2V96A 5JJLA 3F3MA 3P52A 3RSSA 3OLYA 4TRMA 4E07A 2D06A 1O94A 1BH2A 1UXOA 3KPYA 3GBSA 4FR5A 1QH8B 3THXA 5ANRB 4CFSA 4XAQA 5CB6A 2DHEA 2WDZA 4PCVA 4JJEA 1NVVR 1NOIA 2C8LA 2IPXA 1W9MA 4QBGB 3RRNA 4BBAA 2R6DA 4B7XA 4DMHA 5FO0A 4B4VA 4GBGA 1U7PA 1NP3A 2X4LA 1MORA 3ZE8A 5E9QA 3HBNA 1IU9A 3VR2D 4RKWA 3DULA 3ND9A 5JWOA 3BGDA 5KYXB 1GD1O 2YXPX 3IBGA 3H8SA 4BE9A 1PZHA 1P0CA 2QN6A 3ZJTA 3OTGA 5F64A 1XP5A 2SKCA 2Q5OA 3GLIE 4MCAA 4EG3A 3H5WA 4P5PA 4YBRA 1DT5A 5A5GA 1WL8A 3D3KA 4BX2A 1A97A 1A5BB 1FL9A 1XEXA 2JH9A 3LNTA 4PR3A 3JQAA 2LPMA 2ETVA 3SX0A 9ABPA 1NVTA 1JSZA 1R12A 1U1CA 3I3OA 4LXGA 2YKGA 4U5XA 1K6IA 2I78A 3FTNA 2J5KA 3VPDA 1P2TA 2J0VA 3EMDA 1X3SA 4C7OB 1CLUA 5BV0A 3SC2A 1W52X 5FAXA 3N2YA 1YZHA 1OOEA 3QE4A 4O0LA 4HQLA 1X8LA 4HLUC 1Y5LA 1FQKA 1Z6ZA 1BWQA 1NKTA 1RAAA 1WB9A 1KVRA 5K0CA 3O82A 3HL0A 4PLVA 4S04A 1QTQA 1KYIA 1JQAA 3NBKA 3NPMA 4QDJA 1QPZA 1Q83A 2PIAA 2H4JA 3SI7A 2DP4E 2G4LA 1S96A 3ABOB 4M0DA 4A5SA 3D8RA 3VSCA 2F1IA 3PI7A 1E1MA 3G59A 2XYVA 3NC0C 4KZKA 3GCGA 4QHYA 5F12A 1LWNA 2GA8A 1A8HA 1J0DA 3WL5A 3GZ4A 4KE7A 2DFKB 3ZE0B 3P97A 4FZVA 4XKJA 1RKQA 3SZMA 3FHLA 3IQDB 3CV3A 1NR5A 1JNYA 2O0LA 2XZTA 3GVXA 4KUGA 4L02A 4EHAA 4CG2A 4IJUA 1V5EA 3CX6A 2Z8XA 3ASUA 4HNGA 3RG2A 3JVEA 4C7VA 4D9NA 1JBQA 3AFHA 2BBTA 1B0UA 3EA4A 1HFWA 1RCUA 2B8NA 4KFCA 2FP4B 4C30A 5T57A 2JGLA 3CRW1 1QP7A 1HV8A 4FYKA 3E7PA 2QLFA 3OEWA 2QLBA 3D59A 3MJTA 2P9CA 4MCIA 5CW1A 3VC3A 2CFCA 1GGNA 2A59A 2BJHA 2V6BA 2PH3A 2XTZA 2XECA 3ROFA 3FZQA 3T7IA 4ZJPA 1QRUA 3L6BA 4XB2A 2H54A 5CYFA 3FTQA 3OAAD 5J2TF 3KUDA 1Q95A 4E2XA 1KPHA 1PFUA 1LI5A 4V1CB 4AKTA 3O4FA 2GSWA 2TECE 3ZHZA 4A0SA 2C77A 1WY7A 3M6WA 2GVNA 1QBKC 4NK5A 4YJ3F 1DRJA 1UFOA 2RIPA 3WGGA 5JI3E 1P39A 1F48A 1XPJA 4OV6B 1N8SA 3VPCA 4KR7A 5IJXA 1E3TA 3D43A 3EXFA 4Q3AA 5DULA 1OLXB 1S3GA 3C7DB 4PC6A 4IMIB 4JGIA 3GJRA 5LZ4A 4IIHA 4I1RA 4HZUB 3GI1A 3GP8A 3OVMA 1PT7A 4WZ6A 5CM2Z 4B6OA 3SXUB 2GJKA 3EVTA 4G01B 1Y6GA 4AZ3A 3RARA 2P7IA 2FMHA 1U1IA 4EW6A 4EELA 4H3SA 4D74A 4D9MA 5EC8A 3D81A 1PJZA 1VL0A 1X38A 1A72A 1LS6A 3R24A 3A6EA 3HGTA 1TADA 1YK0A 4I14A 1TAUA 2OXRA 2W6JD 3R3SA 4JC5A 3K6SB 4F9FA 5EIXA 1PDOA 4X8LA 4J16C 1E96A 1H69A 3N28A 3U3XA 1UM8A 3BDAA 1CJTC 3H9UA 3OESA 4DYHA 1D1QA 1Z0FA 2WMDA 1LFAA 2ZQ5A 4PXAA 1L7XA 3B5EA 4GYWA 1EXNA 3I8XA 3FZGA 3I9V6 4TN5A 3PDUA 4YROA 4AJJA 4JU8A 1SBNE 4OQLA 4A27A 4JR2A 4U2DA 5CG2A 3Q2OA 1Y9EA 2QN3A 4O4IF 1D2NA 2XA9A 4ZKDA 1V7ZA 5BWLA 5B6PA 1A2QA 3OHPA 5DHRA 4D9KA 3COSA 7GPBA 5A4KA 4RO0A 4A92A 4CI9A 1KY3A 3M3HA 1SXGA 2IYQA 5KO2A 3OOYA 3HR4A 2GFHA 1VI5A 2FFRA 2X0IA 3CFYA 4QEZA 1FF9A 1MVNA 3G0BA 5CVTA 1A9ZA 1UINA 2JNWA 1FJ2A 2OLKA 3ILSA 3AI2A 3O03A 1FTQA 2HRCA 2DUWA 5C8YB 4LYJA 3FCYA 2XUOA 4RSGA 1Y80A 1F9EA 3UK6A 3NGXA 1L6IA 3VU9A 1WCV1 1P8AA 1XRRA 4C21A 1ACJA 1SBIA 2QP9X 1C1DB 4RNDB 2X5JO 4FOTA 4C29A 5CBPA 3ZDAA 4V3BA 3CO5A 5H80A 4BNHA 4BE7B 5G0WA 5BWMA 2QMHA 2IUUA 3PUXA 1KOFA 3KOWA 1T5OA 3OUZA 2ZW9A 4WFKA 2E4YA 3A9RA 1Y48E 3UPDA 4XWOA 2RHHA 3HJRA 1E2KA 2FZLA 2QTWB 1EM6A 2I4MA 3OFSA 5FEUA 1Z28A 1PG5A 4YP6A 1J09A 1HORA 4Y0VA 3TEFA 2JI9A 3BH0A 5AJZA 3TCXB 1I10A 2QPAA 2ZUUA 4W5RA 3HJNA 1C1YA 5FFMA 1TM4E 2BI4A 2JFPA 4R84A 1XXHA 4V02A 4GWKA 3G2MA 3NDRA 4MW6A 5DRYA 5LJIA 3MT0A 1AQYA 3WMFA 3UGTA 2YWCA 2WILA 5DGDA 1WVIA 1E2IA 3HRKA 4F6CA 3MTJA 4BFYA 2VT6A 1K4YA 4DLSA 1DIRA 3CVUA 2FNAA 4FYPA 3UBTA 2W42A 2O3SA 5K1ZA 1HLFA 1OAAA 4A7PA 4CDRA 4RKQA 5A02A 5KYYB 1VHLA 4YJ2A 2A0WA 5EMNA 3G2HA 1NBMD 2L42A 2C7OA 1EXDA 3F78A 1ZX1A 1ZN9A 3E2PA 5BQ3A 5LDDC 1EXVA 2L82A 1A71A 3QWBA 4FSXA 1S2DA 3H5LA 1HDCA 2I65A 3D5QA 3M2PA 2JAOA 3AZQA 4PU0A 3I9LA 1Z33A 2XWBF 5EJIA 5JLJA 3BDVA 3OPYB 1QBGA 4KLRA 4BO4A 1EG7A 1M1NB 1FUIA 2CLOB 1WXWA 2BH9A 2C4VA 2JGEA 3GXOA 2O7SA 3MMZA 4MKFA 4MVCA 4UVHA 4UXJA 3BTUA 3EXIA 5DYYA 4D9BA 4EUNA 3OIDA 5AUPB 1G6OA 1ZS9A 2QR3A 2Y99A 4TMVA 3UOWA 4E7PA 1N33B 2NX2A 5AVXA 4N3GA 1F17A 4KBGA 1YBAA 1L5HB 1VECA 3NNDA 5DX1A 5HUHA 3LO8A 2B5VA 1YR7A 2I4NA 2D13A 1PX0A 4EA6A 1FC0A 1IL0A 1JHDA 5D86A 4XPIA 3UPUA 2C2YA 4M1EA 1SUAA 3EFOB 2XUAA 1IJEA 4J0JA 1MJGA 1ESDA 2GM3A 2DHDA 2XWPA 1LTHR 3KEGA 1W4CA 3E9MA 3GFFA 1MAAA 5DI3A 3RC8A 1A82A 4N1AA 1B6RA 2ZRKA 4Q4AA 1PJ2A 4L2IA 1VTKA 2BDTA 3QG5A 3ZVNA 1GAWA 3DDCA 5DKFA 2F2TA 3AFOA 2XT6A 1KS9A 4K6CA 2VF2A 1NBME 2FZ5A 2BMAA 3SE0A 5LP6B 3CX7A 2ZRBA 2YZNA 2JF0A 4LRXA 1GPYA 2DT8A 4ZYWA 3ZDCA 2XMGA 4QG3A 4RGQA 3DW1X 2AGVA 3ANSA 3LOUA 1P29A 1W5EA 4BNMA 3RVMA 2GTIA 4FE3A 3I6QA 2QDXA 3T5MA 2PWAA 1I4LD 1SCDA 4IINA 1QYCA 5B53A 3MW8A 2F3TA 5AKYA 4IEFB 4CM9D 4OUKX 3DUFA 1NP7A 1EVYA 1P5HA 2Q2QA 5ESDA 1Z47A 5DM70 3KPJA 3Q7TA 4UMVA 1LLFA 1NKSA 1MC5A 2GZHA 2PJDA 3C97A 2I3BA 2FSVA 1V9LA 1MQ9A 1WO8A 2I7XA 1Y4AE 1QGED 3TPCA 1XEAA 4OJQA 2JEOA 5IM4A 3IVAA 3J81k 2ZJ1A 1WV1A 2ZKIA 4NZYA 1VL2A 3IUYA 1GL3A 1Z8DA 2OHXA 4BVFA 1GRRA 1LDMA 5CT8A 1T24A 1Z5WA 4UZEA 3DFIA 4BVBA 4P83A 4AXBA 4CKYA 1FRZA 7MDHA 4C0HA 1E60A 4KE9A 2R7KA 4YJFB 2ARKA 3HU1A 1JIQA 4QASA 1KE1A 4MPRA 4XUEA 1R6AA 4B6QA 5M29A 3QE0A 4G0ZA 4F9EA 3QX3A 4LFAB 4Q4CA 3OF3A 1QUFA 1GZSA 2EF1A 4ZIRB 5C52B 2AKAB 2Y0DA 4QL3A 1JS1X 1GLGA 2JI7A 2P1ZA 2B21A 2O2JA 1D6JA 2GZ2A 3PGKA 2FUKA 1RXVA 4B3TB 3R7NA 2V7VA 3O1IC 1O1YA 5DLEA 3ID6C 2ZRPA 1WHSA 4TGLA 5FOVA 2NUAA 4BVKA 4MKIA 1WUTA 5C7LO 2G9NA 3A9WA 5EJ9A 1KEEA 3KB8A 1AUQA 3FJOA 3ZWQA 5FA5A 4DW8A 2E87A 1M1XB 2C59A 1ZHHA 4EHNA 3QYFA 3WGOA 1LEHA 1LRJA 2FGJA 4I3FA 4NOLA 3RREA 5J23A 4KRGA 4QGBA 5CURA 3JW8A 1TT7A 4V39A 3VPHA 3BRWD 1EFKA 1XK7A 2RGUA 1ATZA 5FTLA 1ZUNB 3GJQA 5JI2E 3RI3A 2V1UA 2PZGA 4ITVA 4BNJA 1QX3A 2ZS9A 4P7FA 2DBRA 1N2EA 1GKYA 1UC4B 4WKNA 1P0IA 1VL5A 2P2LA 3GPBA 2UV8A 3N2KB 1DFIA 3H04A 3I2IA 4R8RA 4ZO6A 1I80A 3SHVA 3FNQA 4ZK2A 1MQ8B 1G2QA 2OGWA 5ESWA 5EXXA 1QQ7A 4WBNF 2GYVA 2J33A 4LIPD 1U2PA 1KGDA 3GDGA 1IM5A 2ACVA 2VPZA 3E9RA 4ZFNA 4UEKA 4EABA 3B1VA 1K7FB 5AVZA 1RWVA 1ZD8A 2MTBA 1E7QA 4QDZA 2BRUC 2W4QA 3C1AA 1Z35A 1C80A 4X0EA 1NNSA 3DTYA 5CYGA 5F9HA 2O52A 2QUKA 5A5EA 1DCKA 2FEMA 3ITKA 2ATXA 4HDMA 2GPSA 4Y1RA 5GJVC 2WSLA 2ET6A 3LL4A 5ADWA 2KSQA 5C5EA 4UBIA 2YWXA 3FWNA 4JS0A 3TSYA 1QDUA 1NRWA 1VIMA 2QSUA 3RTGA 4UATA 3T3OA 1W96A 1XTTA 3R9KA 1XZ8A 3WJAA 4KIFA 4B83A 3A06A 4R31A 1GLVA 3FN4A 1DJPA 3E3OA 1THMA 1GN9A 1TM2A 1OHHD 2V4ZA 3QELB 2BKAA 2Q1XA 3I52A 3CH7A 4PVDA 3WKAA 1ORVA 2L18A 5A9TA 5BY2A 1OH6A 5FH9A 2C9BA 1RQLA 2A3RA 4WEOA 2WHPB 4IF4A 1H8HD 4MS4B 2LRHA 4M1ZA 3U9LA 1U28C 1PR0A 3M89A 3AR6A 4Q12A 3FHJA 2J3JA 2B3TA 2F9MA 2P0EA 2FK8A 3L0ZA 4OG2A 4PG7A 5JHHB 4UM8B 1T43A 1YL5A 3NEAA 1RQ2A 1S0UA 3N6VA 2XD9A 1CVIA 2N3ZA 3KSMA 2L17A 2VDMB 2R6FA 4ZVKA 1WXGA 4IIEA 1N5IA 3K2IA 3FLBA 3RHFA 3PC3A 4JT8A 5DYGA 3FCOA 3WDLA 3LX8A 3WXBA 1YE3A 2OZLA 3S4YA 1U9YA 4BEJA 2FF7A 1QQ6A 3MRSA 5JZBA 4ML3A 1E89A 3KUCA 4JYPA 1YKFA 2I87A 2Z3WA 1K08A 4M9CA 1JWBB 4MX8A 1AKEA 3SS7X 4JFRA 3I2HA 1OZAA 3R6WA 4M7PA 2SCUA 4C6TB 1LV7A 2WJJA 4NCXA 2H1LA 3LZDA 2B36A 4ZQCB 2IU4A 1ULBA 2APJA 3UM9A 4TVKA 1I3LA 5FUMA 3L82B 2C0QA 1Y8AA 1U99A 1WMEA 3TSWA 3A1DA 3EASA 5ICFA 1CEEA 4PPYA 3GEBA 1UQTA 3B20A 2VN8A 2IV2X 2DETA 5FJJA 4BASA 1LVGA 1RPNA 4KQFA 4NV1A 2E6KA 4ZVNA 3RUPA 1X80B 3KSDO 4R9NA 5CLQA 3CNLA 3JD1A 1R0KA 1E5LA 1HYBA 2JB9A 2FW0A 3G3EA 3KC2A 5C7YA 3CRRA 2FMUA 5HJ5A 3QV2A 4LK3A 3TFWA 5J40A 5C8VA 1TVEA 1W34A 1WSDA 3K7EA 4RMHA 3U6KA 1N5DA 3AHEA 1HF3A 3PK0A 5DU2A 4BX9A 4YMLA 1LSUA 1R6XA 2WIAA 5IP5A 5LQUA 4O3MA 4MUAA 1KXJA 4N5IX 5IJWA 4R9UC 5LMNB 3GAFA 5HTKA 1G8KA 4FMPA 5K3FB 1MB3A 3PNYA 3REOA 1XZKA 3I42A 2W6IA 4YLGA 3QKTA 2G3YA 2I8CA 3L9WA 1QIGA 4KE6A 3SS9X 1IXKA 4K28A 1JMVA 3AF3A 1EP1B 4Z53A 5KYWB 2GCNA 5FUYA 1W30A 5JD4A 1Q22A 2XLBA 4R54A 4LF8B 2AZTA 1V7CA 2AI3A 3EZ6A 1E0KA 2WD7B 1I94B 2YFKA 3EDRA 4KDCA 1CQPA 3W4KA 1YFJA 3JQBA 1A9TA 2GTHA 2YIVX 1QH9A 1USIA 4RDIA 4B35A 1WULS 5U9CA 1E1CB 2V3WA 4J0GA 4TZTA 3WAJA 2W2LA 1OW3B 1VG9B 4LC9A 4LHZA 3MUNA 2B4QA 1RJFA 2GUGA 4D3XA 3MWGA 2C07A 2VUSA 3RKSA 2NUTB 5E7JA 5HHTA 1TFUA 2UZ3A 3Q4GA 3WO1A 1KK1A 1PR9A 2BGKA 3A0UA 3D6MA 3R8XA 1RLJA 3LUKA 1TJ5A 4OLAA 1XRLA 4RTLA 3BREA 4G5GA 4MIKA 1X7HA 3H16A 1UOEA 5FYDA 2ATEA 1V5GA 4LXHA 6REQA 1Q0RA 1T6ZA 4JYCA 1E9VA 1IUPA 5ESXA 1JIKA 1QZZA 3IMEA 2E49A 1DADA 2JLRA 3T9FA 3EPHA 1SD5A 5CHYA 1ODIA 1HFJA 1VA4A 3PR2B 4KODA 3ELWA 1ST2A 4EI8A 5FWXB 5L3VA 1L5FA 1PV1A 2XYHA 3GK3A 1L5HA 2AMLA 4XJVA 5KQSA 5IVKA 2A1TR 4YDSA 4OHPA 2WU0A 4R7TA 1O54A 1V71A 4IMPA 3U44A 1ENYA 4IDEA 4DB4A 3HKDA 1CLEA 4KXLA 4PHGA 1NHGA 2QYHA 4W9RA 1V6AA 3F73A 1EBBA 2VXOA 3PQ5A 2Y27A 4D4GA 2GBLC 3VUFA 2IOFA 5IVPA 2OBBA 1VMAA 3EG9B 3V1MA 3WNBA 3WAGA 1N57A 1YS1X 3WK9A 1Q0PA 1GTRA 1Y3DE 4JFAA 5CIYA 1S1MA 3IAEA 4CYMA 5KNDA 4NESA 2VH2A 3O3MB 2WV7A 2V03A 3R6LA 5TPZA 1B41A 4G41A 4KPUB 3KEOA 5EPEA 1EFPA 2E6UX 2Q4RA 3FOWA 5K0GA 5JLAA 3GY0A 2JHGA 1YHZA 4LV6A 2V74B 4HN9A 1RZRA 4YUXA 5MHTA 2CFRA 3SVZA 5EE1A 4A0QA 3KVRA 3IJEB 2A86A 3T5DA 3KDAA 2XUGA 4FOSA 4GPTA 2ZBVA 2Z9BA 4I50A 1JLSA 3IR7A 3DAPA 1H3EA 4JT9A 3DTVD 1VMKA 3IOEA 2QP3A 4MVWA 4XWWA 1JQKA 1BYIA 5JJBA 1JB9A 3OD5A 3QU5A 1HURA 1NYQA 3BC1A 1TA0A 1BZYA 2JGDA 1XFAA 1Z7GA 5IT4A 3A7DA 3QE2A 1U3DA 1Y8QB 1YE5A 2KB0A 3G0IA 3TMYA 1CZHA 4DA8A 2E5LB 4NULA 2JFBA 2H29A 2IEIA 5FFFA 2VCEA 1EVQA 5BNWA 4I1UA 2QD1A 5DJ5A 3HYLA 3QVJA 4E70A 1TYAE 5EJAA 3IPRA 5IK2A 1Y0BA 3QEMB 1N9KA 1H4TA 2FEOA 3D7LA 5CP8A 2FUEA 3KJIA 2HYIC 4UHDA 2AQKA 1FMTA 4M9QA 3D8UA 2OGZA 4P3NA 2LKCA 4E51A 1WLSA 4CUKA 2K87A 2GEDA 2OHFA 1LTKA 2CXOA 4ZHQA 1E3WA 4P36A 1DAPA 3NB0A 3G1TA 1QDEA 3OE1A 4AKEA 4IDQA 3CGWA 2R66A 4IDOA 3B70A 3EGEA 4QAQA 1KE2A 3WLFA 1PG0A 4DV7B 1BE0A 1G3IA 4AQYB 5A7HA 3L2OB 3TO5A 1CIJA 2OD2A 1LBTA 1G3UA 1RIIA 3DXYA 4FTWA 4IXMA 4KO8A 4MRMA 5CB8A 2AFIE 2EJUA 3LVQE 3EW9A 2PKYX 4R8MA 1RYDA 4L5BA 4WDQA 4ZO8A 4DV0B 2AWOA 3LCMA 4J16A 3WA7A 2H85A 1HDGO 1SOAA 5KNCH 3S8YA 4OPMA 3GZNA 3DYBA 3OX4A 1R9JA 4ENTA 1J8YF 2GD2A 3WB9A 5CCBA 5CB0A 1H2RS 4ZC1A 2ZUTA 1U9CA 4OLJA 3SFVA 4BFXA 2OUKA 3SEFA 1BHJA 1WD7A 5AW5A 4G67A 4ABTA 1KIFA 4RTSA 3NWOA 1G18A 2HWYA 5DTRA 4H16A 2DQKA 1YVUA 4DMRA 3IQZA 1KVTA 3STYA 4OEHA 1G5RA 1N2JA 4L8WB 1PLLA 3SIWA 4JBIA 3PYMA 4BOYA 5EWJA 2HK6A 1RWPA 2ZAGA 3FVRA 1XXHB 2ZIEA 4ZV4A 3FAKA 3A26A 1UBCA 4C2TA 3X1YA 4URZR 3QBJA 1H6BA 3RIHA 2FWPA 3EZLA 4O1MA 4UREA 5FWDA 3NH9A 4HRAA 4CKEA 5JVDF 1QG6A 3DDUA 3F5SA 3W6OA 1OH8A 2NU9B 4ARUA 1DBSA 4Q47A 1MO3A 4CEIB 2C92A 3PUYA 3NANA 1DWOA 4CL8A 1H1LB 3AHHA 5JS6A 4INOA 1Q2XA 1RIFA 2P62A 2YV3A 3G7UA 3ZHOA 1QHIA 2W22A 4IPTA 1T8SA 1F3OA 2RD2A 2JJ1D 4QFMA 1CT9A 2JZCA 1GZVA 3EULA 2RONA 2XKBA 3B3GA 5EXPA 4TV8B 5LXTA 2YJ3A 1EAYA 3N8NA 3A