2OESA

Msreca-native-ssb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
327
structure length
319
Chain Sequence
b'QAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 83
structure length 319
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2007-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oesA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oesA01
4NBSA 2B92A 2XB4A 4HAVA 5JMTA 4M21A 3PUVA 3Q85A 3SFVA 1M8PA 2PJRA 1Q21A 3A4MA 3RABA 1OXXK 2BMDA 4JBWA 2QMOA 1WXQA 4Q7JB 1KSFX 2A78A 3EPLA 3GLFE 1VG8A 4B75A 4EQ6A 2V7QD 1M7GA 5E3HA 1SXJE 4LV8B 4YMUA 3SN6A 3ZS8A 2QAGA 3HYRA 3AVYA 2WJHA 3OESA 1VHLA 2VL7A 4I81A 2V8OA 3B6EA 2Z0MA 3B1ZA 5AJVB 5FL7D 1VYVA 1ZUIA 2QQ0A 1EESA 1ZC3A 3GLGB 3L8ZA 4JBXA 4DLZA 4D26A 2FFQA 5FUYA 3Q7PA 5FPTA 3LDAA 1HE1C 4US0R 2WIBA 4ZPXA 4WVFA 3B13B 4IVPA 4DB2A 4NYJQ 5KDDA 1IN5A 1JPNA 5B2ZA 2D7CA 4H1VA 3VR4A 1E2IA 1CJVC 3BD9A 2ANBA 1ZU4A 3REFA 1UAAA 2CK3A 4IVQA 2ZIAA 5UKDA 3WHLA 4DEXA 3GLHE 2KBEA 3T1OA 1DAGA 1R8QA 3CPEA 5IK2A 5FTKA 5EXTA 5GJCA 3PVSA 1II8A 3HU2A 3SBDA 3GEEA 4LJ5A 1DBSA 5CYPA 2ZRHA 3BERA 3FFAA 3TH5A 4Q03A 2MMGA 1Z08A 3QKRB 4BE7B 1D2MA 4PO8A 4URXR 1DPFA 2YOGA 4QGHA 1IXSB 3KQKA 3K9LA 5AUOB 3MMPA 1C1YA 3LBIA 5EXXA 2ZRAA 2Q3HA 3WY9A 3MGCA 1MOZA 2H7VA 1OH7A 2F1IA 3K09C 4R71A 2CCJA 3K0FA 1KNQA 3QE0A 3K8YA 4QM7A 1Z6YA 4OI2A 1MO3A 2XSZD 4ZI3A 3IPYA 4Q47A 1F2TA 2QU8A 3W5JA 3NDBB 3M6AA 2J46A 3T06B 4M9SA 1GAJA 2XZLA 2ORVA 3A4NA 1G3QA 4AG5A 2P3SA 2XXAB 1HT1E 2CNWD 5GVSA 1J99A 1UPTA 1VYUA 4HUQA 2EVWX 2V6JA 2V3CC 1KYIA 1P2TA 2RCNA 4Q4HB 1P3JA 3VQTA 5GVRA 1TUEA 4Q00A 1G9XA 2OLKA 3QPWA 3LA6A 2Q6TA 2XTNA 4NCJA 4CRWB 3FHTA 2ZJOA 4GT1A 5BYJA 1N6LA 4FIDA 4DEYA 3MJRA 1G5PA 4HAZA 1YZNA 1EXMA 3KB2A 4TTQA 1QG2A 2BKEA 2EFGA 2IF0A 2VEDA 2QT0A 4B3FX 5FTLA 4TT3A 1IY0A 4C0LA 5H68A 3ASYA 1CRPA 4KLZA 2QORA 1RRPA 4H9GA 3AP2A 5FBRB 2ZAOA 3BOSA 2QG6A 4ESHA 5FPSA 1XCPA 4OK5A 3NBZC 4R7ZA 3DOEA 3VNUA 1KAOA 3FKSA 2ZTSA 3V9PA 1KDPA 3W9YA 4IOLA 2GZAA 2ONJA 2ZRNA 2CHGA 5KTYA 1CEEA 2QMEA 4M1MA 3CRW1 4C30A 4OK3A 1DAKA 3RANA 2VHQA 2PMDA 1AZSC 2YC4C 5CIWA 4KXFB 2F7SA 4HDOB 1W0JD 3OFND 1JECA 2G88A 3R20A 5L3QA 2V1UA 4NTZA 2DFLA 4MGYR 2NO7A 2ZEJA 2GRJA 4Z1MA 2BVNA 3Q7QA 4JLNA 3RRNA 4B3GA 1HYQA 4RVCA 5TY0A 3RVBA 1XMVA 3HR8A 1E6CA 1GUAA 1W5SA 1W48A 5FI1B 2J87A 4Q9KA 3U44B 1E2FA 4TLDA 2AXNA 4PAQA 4TWZA 2BJVA 1V43A 4QJ4A 4RZ3A 4UXHA 4MYUA 2ZRFA 4DLSA 4UNNA 1G7CA 3LNCA 4OHZA 4MKFA 1LS1A 4PFSA 2PLRA 1VCNA 2OO7A 4JSTA 3B1XA 4D0NA 1N0VC 2WWXA 2W0MA 1XJQA 1JQJC 1MKYA 1U0JA 1II9A 5JRZA 3ND8A 4ON9A 4CT4B 1ZM3A 3RRMA 5KPDA 4PSKA 2QE7A 3CLVA 1J2JA 1XEFA 2FE4A 2DR3A 1SZPA 1G64A 2WJVA 2YWHA 4Q4JB 3RS4A 3NBXX 3ZDQA 1VMAA 4QNRA 4A92A 1PUJA 1RRFA 1FW6A 1KK1A 2GBLC 2C5LA 2ZI3A 2NO1A 4Q4HA 2MSCB 4ARZB 1KI9A 3BB3A 2E9SA 1D8TA 4QBIA 2V9PA 1I4LD 2OE2A 2JLYA 3LQQA 3KUCA 5LDDC 1UEIA 1XTQA 2XJ9A 2R6GA 3CR8A 1TEVA 4NYMR 1K6MA 5C18A 2G0NA 2IYTA 5F98A 4EFLA 2XB2A 3I4LA 2J0UA 1T91A 3NXSA 2EWVA 4TN1A 1YR9A 3BXZA 2XNDD 1QHNA 2OM2A 1E2MA 1Q0UA 4XOIA 4BFYA 4RKFA 1W36B 1DE0A 3MWJA 3J81k 4HATA 2XGJA 4OQXA 1ELOA 3CRRA 5DHFA 4DLRA 5TMPA 1Z0KA 2F6RA 3AH8A 3L82B 1FMLA 3Q72A 4TLEA 4CW7A 3K70B 4DUGD 4IFBA 4Q21A 3TJZA 1KGDA 4R2HA 4B73A 4BZQA 5E4FA 3GJ3A 3DEFA 5EE3A 1Q3TA 4EFMA 1GITA 1VYTA 3ZVNA 1G5TA 2ZJZA 4URUR 2RGAA 2VO1A 1AKEA 4PPGA 1KK3A 1T5IA 4TL6A 4ITRC 2JJ8A 1L4UA 3JVUA 5EQTA 521PA 2LCFA 1E69A 1XJCA 4URYR 1SVOA 4GZMA 4P32A 5GJWC 1GILA 3GJXC 3LW7A 4D81A 4JSYA 2OXRA 1E9DA 1N5LA 2B8TA 5FL3A 4B35A 4HAWA 1W0KA 3IPXA 4FN5A 1G3MA 2WPDD 1IM2A 3WP1B 4B2PA 3BFXA 1VG9B 1FNNA 3DVLA 4M4SA 1UDWA 5JWOA 4GOJA 2GXQA 1A82A 4RFVA 3KUDA 1IN8A 5FOWA 4XJXA 2HV8A 1KHTA 4FI3C 3RS0A 1HURA 1NBME 2ZQ5A 4D4JA 2L0XA 3D7MA 3A1UA 1F2UA 1UKEA 2AKAB 1E98A 1QZXA 3RWMB 4ARZA 3FMOB 1EGAA 4DIEA 4V0NA 3THXB 1JR3D 3FVQA 4OYHA 2VP0A 1G291 1RVDA 1XRJA 3RDPA 3KQLA 3BS4A 2ECKA 4BECA 1Z8FA 2WV9A 5SZJA 1GRNA 1M34E 3EWSA 3FPAA 1Q1ZA 4I1UA 4KHZA 3C15C 1X8JA 1TQ2A 5CM9C 1GNPA 1LY1A 1NF3A 1NLZA 2ZJ5A 5LB4A 2REBA 2YWEA 2W6ID 4R2IA 3RS7A 4DLXA 2P65A 4PZLA 2D62A 4WA7A 4QL3A 2ODEA 4MDFA 1G6HA 2Z4SA 1QVRA 2B6HA 4AYTA 4NKRA 1DG1G 3HJNA 2IA5A 3KQHA 4YXWD 3DOFA 5KU1A 3FKSD 1Z0FA 3T61A 3MRSA 3ZZ0A 3IIJA 2QAJA 3HPRA 1WA5A 3G5UA 4ZKDA 4TZ0A 4HB2A 4LC1A 4LV6A 1E0KA 1T3LA 1HT2E 4FCVA 2ZYTX 2GXUA 5LB2A 4KVGA 1UKYA 1YVDA 3PUWA 4C0SA 3VKGA 4LYHA 1SVIA 1RJ9B 2IW3A 1TF5A 3MLEA 3NWJA 2VHTA 4K46A 1QHIA 5A0FA 4C9BA 2NZ8A 2VA8A 5ANRB 3AF4A 1TPZA 4RFSB 5DSZA 3DM5A 1GG2A 1II0A 1ZU5A 3M0EA 2D2FA 1E9RA 3WBKA 2OLJA 4TMZA 3C5HA 3TE6A 3GFPA 5L3VA 1OIXA 3I72A 2ZJAA 4BLPA 1Z0AA 4ZDJA 4HLQB 3RNLA 5BQ5A 4YMTA 1U94A 3T1VA 2Q9BA 2ZRCA 4HLUA 3U6KA 3IHLA 3A1VA 1W2HA 4B6EA 2FEOA 5J4YA 3F8TA 1U8AA 3KKOA 4TMXA 2IWHA 1AM4D 1KI8A 3QSYA 4DJTA 4M2LA 2BC9A 4DB4A 1OLOA 1YHNA 2ZUBA 1UF9A 4PC6A 1GVNB 4JLJA 2F1JA 3EWAA 2BBWA 1DARA 3N2IA 3ZLJA 4DC9A 2XOKA 2YWFA 1R5BA 5EP2A 2ZM5A 3AUYA 1GSIA 3U7EB 5FI0B 2HEIA 2A7QA 1T0JB 3C8UA 3CF2A 4JMPA 1UKZA 3IKJA 4EKDA 5HKKD 2ZR0A 4PC1A 3BGWA 3CF0A 1FTSA 5BXQC 1FX0B 3N2EA 1Q1EA 2OCPA 3B78A 3DZDA 2ODBA 3TIFA 1NSTA 3ZZTA 2VYFA 2WWWA 4QNMA 1ZW6A 3PCRB 1HEIA 1SKQA 1L4YA 2WAYA 1KIMA 4WZ6A 5J47A 1KI7A 4MQBA 2HYDA 5P21A 4BLQA 1W5TA 3ZD7A 2IYXA 4HAUA 4G0NA 3NBYC 3I32A 4XTCS 2XEXA 2BV3A 2JDIA 4QM6A 1LF5A 2A5GA 1ZM2A 3RC8A 2Q21A 4HI0E 3D6TB 3OAAD 1D2NA 2Q3MA 4HLDA 2XITA 3VTKA 5J5CA 2REXB 2W58A 3EW9A 3TQCA 4DBLC 3TW8B 1KK0A 2EFDB 1MABA 3IBYA 2O8DB 1PZNA 1XPUA 1RJ9A 1OFIA 1RKBA 1KO1A 4HYYA 2AL7A 2QM8A 5E7MA 4OQNA 3QPVA 4CEJB 1D2EA 3TW4A 5KUTA 2JAQA 3BJIC 3OIWA 2OXCA 4RFSA 4ZDKA 3BAFA 1CR0A 3AKEA 3QY0A 1HQYE 4LBVA 4WW0A 1JXOA 3VMFA 4LJYA 1E1QD 1XXHE 1NL3A 2QENA 1K8RA 3IHWA 1IAQA 5FPHA 4DLWA 1P60A 5H1YA 3P27A 4B48A 2QQEA 4V0MA 1O87A 1VG0B 1W0KD 1TQDA 1NP6A 1IOZA 4BGDA 5LPNA 3ZYCA 2YYZA 1US8B 1P4SA 3CO5A 2OUKA 2BEKA 1NVVR 821PA 1TQ4A 3ZIAD 4UJ5A 3VKHA 4MKHA 3FMIA 2ZI9A 4DKXA 2JJ2D 3CF6R 1Z2AA 2O8BA 4QBHA 2A5YB 1JR3E 2IYWA 3AF3A 3MJHA 4B6FA 2OAP1 2WWHA 3THOA 4KAXA 2W6JA 3K09A 1P2UA 4Q1AA 3GLGE 3PXGA 1KMQA 1E2HA 1VECA 4DDUA 2GEVA 3GD7A 4I1VA 2CVFA 2ASEA 3O8CA 1BIFA 4JYCA 3T1QA 1NKSA 1YJ5A 2WHXA 5FUWA 2WSSA 1VCMA 5KNBA 4JJKA 1N5JA 1SVMA 1WF3A 4C0BA 2W0SA 2WAXA 4EJSC 3HU1A 4UNSA 4EPWA 5FBVB 4RZ2A 3BH6A 4OI4A 4ZI2A 3AVOA 2JASA 5J40A 3BFVA 3KZ1E 1SXJC 5JEDA 3SS8A 3PJRA 1KDRA 4D0LB 4GP6A 4B3DA 3N70A 2D2EA 4LBZA 4UNQA 1DO0A 3EPJA 1W36D 3IQXA 1NN3A 1XD9A 2RGGA 2WJYA 5JSZA 2BM1A 1U81A 2KJQA 4KBGA 2RMKA 4Q7MB 1NIPA 5KSOA 3LQRA 5KO2A 4FWTA 3OEHA 2PZFA 1T4GA 5KDOA 4LYJA 1P6XA 4CEHB 3K70D 3SC3A 4AKHA 3VR1A 4JLPA 1P62B 4O0MA 4TMVA 4DHEA 5KOYA 2OBLA 2YC2C 2J3EA 2JCSA 2O8DA 2GCNA 4EPXA 1RC8A 3ZS9A 5JCZA 1F6BA 4U7DA 4KITB 4CEJA 3CKLA 2DFTA 1MO5A 4L16A 4MUAA 1CRQA 4S35A 5EP4A 1G21E 4KFTA 1Z6TA 5EP3A 5BW8A 3AM1A 4A4DA 3UATA 4MYTA 4JLDA 4HZIA 4K8OA 4MYCA 2W2VA 2YZ2A 3B9QA 3B1WA 2ORIA 3CBQA 4M1WA 4NYIR 2N42A 4ZCIA 4ZIRB 3I8SA 3S1AB 3IO3A 4QGFA 4DCSA 2WJGA 5L3SB 2V55B 3MSXA 5E7IA 3IIMA 1N6NA 1KO4A 5AJZA 2EFHB 2PL3A 3C16C 4MITA 3I92A 5K8TA 3LBNA 1AS3A 3IUYA 1JQLB 5FOXA 4NYMQ 3R7WA 5JJIA 4OJKA 3W6OA 3W6PA 1UEJA 2H92A 4BLRA 1K5DA 3HP1A 5TARA 3TKLA 1ESMA 4PAOA 2RGDA 1J8YF 2ZRGA 3NC0C 2BMJA 2XTZA 2ATVA 1E2LA 5FOSA 3OIYA 3VR2A 5FOUA 721PA 4KFUA 2EYQA 4QBGB 1S1CA 4KVAA 1OFHA 1UBFA 3C41J 1ZNWA 3A1TA 1U8ZA 1QBKC 2PCJA 3F3YA 3TMKA 1NG1A 1YRBA 1X1SA 4B3BA 5B58C 2GBLA 2P0EA 3E1SA 5AJYA 1D9ZA 2N1BA 4O25A 4Z8XA 1COWA 1W4CA 3LRPA 2R6AA 3NTUA 1EWQA 2FMXA 1N6KA 1XDBA 5KNCA 3NH9A 4MA4A 2OFOA 5EZ5A 3X1DA 4KYUA 3DM9B 4OQFA 1QHHA 2GKSA 3PEUA 1U99A 1ODFA 2OCYC 3L0SA 4CEHA 3VR6A 4Y0AA 4DCNA 3TUZC 2JLWA 2VRWA 1XNJA 2W2XA 4YONB 2QEQA 4RCYA 1OYYA 2CL0X 2EU8A 4D6PA 4Q18A 5J4KA 4HUQB 1EWRA 4KLNA 5AUQA 2BKUA 4BLTA 3SJCA 3BH0A 4M9ZA 1G41A 1CJKC 4LYFA 1RZ3A 3QG1A 4BRUA 2O8EA 1BH2A 1XU4A 4RSGA 1CJTC 3SU8A 1N6RA 4M1YA 2Q9AA 2YWGA 4MDEA 4A2QA 1J70A 3EX7C 4ZIRA 3PFIA 3S1AA 5L3SA 2ZXUA 3VFDA 3SQXA 2NO9A 4OQMA 1S2MA 2CL6X 4PHGA 1FFHA 2FSHA 3RLFA 3TQFA 1I4TD 1E1RD 4LBYA 4BRWA 4G5QA 4YQFA 2ANCA 2FZLA 1IN4A 4BLOA 2EW1A 2LKDA 2J7PA 1P9RA 4OHVA 4AYXA 2AX4A 2UZ3A 2WVJA 1XTIA 4TTRA 4PZYA 1G16A 2IUSA 4B34A 1BKDR 2NPIA 2R44A 3B7GA 1OXUA 5JZVA 4CF7A 2F1HA 4FMDB 621PA 1ZNZA 3PG5A 1VCOA 3DDCA 3QEOA 4B3CA 3SYKA 5AK0A 3EXAA 1G8PA 3E2IA 3EG5A 5L3QB 4C2UA 2HT6A 4JJZA 4URZR 2FPMA 3A6PC 4LWZA 2CEAA 2VP2A 2WSSD 4EPVA 3AGQA 3LWNA 3EASA 4ZDWA 1RRGA 1NKTA 3ZD6A 4BZXA 1B0UA 4G01B 2ZYWX 1QDEA 1M1YE 1Z2CA 4XIGS 5IF9A 4IW3B 2VSXA 2QMHA 1JJ7A 2OFWA 4TTPA 1GNRA 1WBDA 1P7CA 1SGWA 3QF4B 4C0KA 1FUKA 5AJXA 1G18A 3U7HB 5EE0A 5C4GB 1EFHA 1P9WA 3QOFA 4Q02A 3EPKA 2WIAA 5CB8A 5E7JA 3AQ4A 2BHRA 4NCKA 3E5HA 1M7BA 3MD0A 1U98A 4LZZA 3OEHD 4C3ZA 4RD6A 1YR6A 5JHHB 2YINC 1GDDA 5JLJA 3GQBA 2CLCX 1XP8A 3RSLA 5J4HA 3NEYA 1EFUA 1GRQA 4WZBE 2R6FA 1MRSA 2GCPA 3QQ5A 1O3YA 1OHHD 4P0TA 3RRZA 2ZRMA 1KNXA 3OEED 4PSAA 1Q20A 1LW7A 1IY2A 3IGFA 3NIBA 1AN0A 4M53A 3KB1A 4Q01A 2NQ2C 1KMHB 4HSEA 1OXTA 4AKEA 5JS8A 1ZNXA 2DFKB 3NBFA 4FD2A 2CCGA 2ATXA 1AIPA 4A6PA 3WXMA 1MR3F 2RHMA 1BMFD 1W46A 2J0UB 3KFVA 1NN1A 4LJAA 5HCNA 1FL9A 3R8FA 2Z83A 1E94E 3CH4B 4IJMA 4AWXA 1AA3A 2FV8A 3ND9A 3NDPA 3U3KA 1P9NA 2CVHA 2QT1A 2X8AA 3U3OA 1Q57A 5FR1A 4GNKA 4JLVA 4GZLA 4DDTA 1DELA 1IHUA 3THWB 2ZETA 3LW8A 5EXSA 2ONKA 3V4RA 1E0AA 2GILA 2ZI6A 3KXIA 3LLMA 4Q1CA 4Q9HA 4URVR 3DHWC 1YU9A 4RZUA 5CLQA 4B44A 3MWYW 1U9IC 2FA9A 3HU3A 4DCVA 2QP9X 4OK6A 2CDNA 2AWNA 2H8KA 3AKDA 4M1TA 1KSJA 2WICA 1CR1A 2ZSEA 1G3UA 1YZUA 4IDPA 1E9BA 1E79A 1S9HA 4DVGA 4XWKA 2FOLA 3W90A 4XD7A 1EFRA 1E4VA 4F4CA 3NC1C 2BDTA 4RD3A 2KI5A 5DLQC 1GZSA 3GMTA 2QRZA 4BQSA 2QPAA 4Q7KA 3U6BA 1A2KC 3AVVA 1HE8B 4V0KA 3T12A 4K81B 4LHYA 3K0SA 3AP3A 4DLVA 3B82A 1UM8A 3QF4A 1WDTA 2JLSA 3EARA 4CGZA 1Q22A 4FMCB 5CIQA 1GWNA 1QHSA 5SZIA 2GJSA 2WWGA 4IEEA 1AA9A 4IXNA 3B9PA 2ZRKA 2FGKA 5B30A 4WIAA 5IHPA 1M74A 3DL0A 2K5UA 1ZD8A 1SXJB 1Z47A 4FCWA 4TL9A 1LB1B 2OFXA 2ZE5A 1P73A 3LY5A 4WBSA 4Z54A 3G0HA 4B33A 1F2UB 4BFVA 4LY6A 3GJ5A 4D82A 1NIJA 2QZ4A 1YR7A 4TMWA 1NVVQ 1TF7A 4Z8YA 3CPHA 4LJ4A 2DB3A 1OKKA 3UIEA 1KMHA 4NONA 3AGPA 3JZAA 4KBFA 5K8IA 4JVNA 1G19A 3MWKA 3LX8A 3AUXA 3WP0A 2YV5A 1OH5A 3FGNA 3PV0A 4QKQA 3GJ6A 1WQ1R 3I73A 2ZVQX 2AXPA 1G7TA 2I1VB 2ZU0C 1RPZA 3GLHB 5B64A 3THWA 5DH9A 1XMJA 5FPKA 1XCMA 2A2ZA 3ECCA 5D3MB 1XZQA 2EWWA 2CK3D 5F2EA 4A0HA 3AVWA 2GESA 2LKCA 3O8BA 5J4LA 1U90A 4UNRA 1FTNA 3K53A 2IXEA 5IK2D 1HH4A 4BLSA 1IN6A 2LWIA 1X6VA 1D9XA 1FOEB 2G83A 4D2IA 5KNDA 3LXXA 4P4UA 3GJ4A 3SI7A 1DADA 3ETLA 3CRVA 1E9SA 2FX3A 3GLIB 1QRAA 4N0EA 2IS2A 2QTHA 2TMKA 1YQTA 3U7GA 1WP9A 5CJ2A 4UQOA 2NIPA 1XPOA 3L8YA 4GOXA 3B1YA 3W5IA 1RYHA 2DYKA 2AKYA 3GFOA 3EZ2A 1C4OA 4B2LA 4IXMA 4E07A 1JEDA 1JJVA 3IEUA 4XSGA 5IT5A 2O8FB 1ZD9A 2J5XA 1QVAA 2C04A 4TLCA 3ZH9B 1E2NA 2P6NA 2QI9C 1U8YA 2C8VA 3TSWA 4B43A 5J4VA 2NMVA 4QHSA 1T9HA 4UNPA 3QI2A 3G82C 4Q9IA 1XEXB 5AR1A 2GXAA 1GNQA 4EJSA 3KXLA 2OEPA 3B8HA 3SBEA 3GLFA 4NYIQ 3CNNA 3RWOA 2Q0HA 1SXJA 1YZGA 5FFMA 3DKVA 4XVUA 2PEZA 5DE3A 4UXJA 5SZHB 1OXVA 4KI0A 1J8MF 2CL7X 2OT3B 5GJBA 4U5XA 1OPXA 2I1QA 5H8WA 2QP4A 5FTNA 1DAHA 4NP6A 2IHYA 3IO5A 4QHTA 2FDCA 2EYUA 5HCIA 2WKPA 2A3RA 4I1SA 2AK2A 4JZKA 4TYNA 2QN6A 4LBWA 3SR0A 3THYB 1NSFA 4GMDA 5CITA 1SVSA 2FSIA 2MMCA 2IX3A 2OILA 3CX8A 5HTKA 1U2RA 3L0PA 2PH1A 4M0LA 1CIPA 4QFMA 2ZSBA 5TB5A 1ZUNB 1XEWY 2VBCA 3NG1A 3D3QA 4TT3D 1F3OA 3ONWA 2HXYA 2R9VA 4IVRA 3TSOA 5LD2C 4NZYA 2CJWB 3GLHA 2JEOA 3IIKA 4Q1DA 3KQNA 1TU3A 2KE5A 4NH0A 2G6BA 1P75A 4Q19A 5D3MA 3SE0A 1E2PA 5CDFE 2HJVA 4RD4A 4MRSA 2QNRA 1HTWA 1SULA 3I5YA 4W7SA 4ZO4A 3SYNA 4NL4H 4GI7A 2YVUA 1BS1A 2BWJA 1TF2A 1FMJA 1MABB 1N25A 3D8BA 3L0OA 1ZAKA 3VU9A 5DN6A 4WAUA 1EX7A 5TV2A 2J45A 3L2OB 3VR5A 3OIUA 2FGJA 3GLIA 1G5RA 2WMNB 2EQBA 2RKOA 4LK2A 4Z1MD 4XD7D 5C2JB 1EFRD 4IOKA 2BBSA 2Z43A 5G41A 4RD0A 2WKQA 3BH7A 4TQAA 1ZBDA 5FTMA 3QXJA 2O8FA 1T3SA 3MCAA 4KFRA 3SJAA 2J0QA 1B23P 3TK1A 1S0UA 1IONA 1NY5A 4DSNA 4F7WA 2H1LA 3UK6A 3KJGA 4IHQA 1XZPA 2AN9A 3WRYC 4AI6A 2KSQA 1W4AA 1JAIA 5BN4A 1KOFA 2ODNA 4I4LA 3ASZA 4HAYA 1XEXA 3ZVRA 1DS6A 2DY1A 3TUIC 1Z63A 4KCGA 4EPRA 1X86B 2IBMA 2QE7D 2HF8A 4NCIA 2WKRA 4D4MA 3U3MA 2ZJBA 2IS6A 4LYAA 4PR0A 1OFTA 1Z6XA 3FHCB 2O8BB 4BFSA 4YDHB 2JJ1A 1MT0A 4BFUA 5JJLA 4Q1BA 1H8EA 4IDOA 1R0ZA 1G3RA 2DWOA 2C98A 1G4UR 2FNAA 2HJGA 3LXRA 4DCUA 1NY6A 3CIOA 2WOJA 4HB3A 1R5NA 5JRJA 2ZPTX 4CVNA 5FH9A 2VHJA 2ZSAA 1IJFA 3H2YA 3THYA 2O0KA 4RCZA 2ZSFA 4A2WA 1OF1A 1MRNA 1A1VA 1DG3A 3VHLB 2JATA 4Q9LA 3BB4A 2QPOA 4DT1B 1OB5A 1RW4A 2QM7A 4LV5B 4MRVA 3KQUA 1E9AA 4BFXA 1UDXA 4JL6A 3P26A 1QF9A 1E96A 4LJ8A 4AURA 1D5CA 2C03A 1N6OA 1T5LA 1HQCA 2RB4A 3UG6A 2JLXA 2CJWA 2H18A 4ZCLA 2X2EA 2I3BA 2QTVB 2V54A 1FPMA 3Q3JB 2O0JA 3X1ZA 1P5ZB 3CX7A 3GEIA 5JSZB 4BZPA 4TZ6A 2OBMA 5JS7A 5JBQA 2BMFA 2FSGA 1XWIA 2QUZA 3T34A 3BB1A 4LOAA 3CRQA 5HZKA 3I61A 4RJLA 1R0YA 4US1R 3A36A 3MWLA 4PHTA 2XAUA 3AKYA 1I2DA 4NE2A 5DYIA 5CB6A 2XNSA 1H65A 1Q1QA 2PMKA 2FPLA 1XFAA 2R6CA 1NMZA 3TAHA 4KV9A 3FTQA 3WRXC 1ZCAA 1NJFA 3OF5A 1JI0A 1G20E 4F4IA 2JLZA 1A5TA 4EDHA 3P1JA 3PR1A 4JIMA 4M8NE 5DI3A 3T35A 2N46A 2RHDA 2V7QA 2BEJA 4DCTA 2QL6A 3VAAA 4DXAA 4AY2A 1WE2A 5JWRA 1G8HA 1JPJA 5JJKA 2FZ4A 1CKEA 2FFHA 1CJMA 3R7WB 1F48A 4J0QA 2GVZC 3RS3A 1Y63A 4EAQA 2GJ9A 3BK7A 4X8LA 4L9WA 2VF7A 2VSOA 5TDHA 4A0GA 3UPUA 2O8CA 4Y0VA 1KO5A 1R2QA 4V02A 4QJ5A 1XTJA 4EFNA 5IRCD 2GAOA 4NU0A 5JI2E 2ZAMA 2DBYA 5AUPB 1WCV1 1TU4A 4CT5A 4C0HA 4ZV4A 1K5GA 4HDQB 1SHKA 1G3IA 3A8TA 5A5GA 4DT1A 5M04A 4JLMA 4KSCA 1QHGA 4NDZA 1U0LA 2GETA 2ODWA 1MV5A 1EX6A 3VKWA 2C9YA 2V1XA 4P4SB 1NVUQ 2J1LA 1N3BA 3ICEA 2H5EA 5K8UA 3X1WA 2GK7A 1QHHB 2CMKA 1KO7A 1SHZA 1PLKA 3AP1A 4HAXA 3K9NA 4FINA 2O5VA 4TLBA 1Z6GA 1A2BA 1A4RA 1YZLA 3O8RA 1I4DD 1ZJ6A 2CHVA 221PA 4BFTA 1Z3IX 3V4FA 4NCNA 1G7RA 1DTSA 2GF0A 3CM0A 4YMVA 1CU1A 2FN4A 2F43B 2G1KA 4GPTA 3LH5A 4WXPA 4P33A 4X8HA 5DN6D 1ZD1A 2HXSA 4DLUA 1Q1BA 4OI1A 1MO4A 2XSZA 3AF0A 3CNLA 2C2HA 4NMMA 1AKYA 2GCOA 3NKVA 5BN5A 1D6JA 2O8EB 1FUUA 4JLAA 4ESVA 1EG7A 1U9IA 4M22A 5KSZA 1JALA 4PTLA 2WMOB 2YJTD 4N0DA 2GA8A 4W5JA 3X1XA 4CIDA 3ZGXA 3AKCA 2H16A 2CNWA 1WMSA 4HB4A 2GXSA 2VPPA 3UG7A 1T0HB 1G6OA 3P20A 4LJ6A 5CJPA 3UKDA 4C7OA 3DZ8A 3I62A 1VDZA 1W4RA 2RGNC 4G3XA 4XWOA 2DPXA 2W00A 2HYIC 2XX3A 4PPFA 2B7BA 3FOZA 1W36C 1XMSA 2VHUA 1NBMA 3I3SR 1YZKA 1GRRA 4KFSA 3WYAA 3R9XA 2C99A 5D3QA 3CNOA 2FG5A 1ZVQA 3CR7A 2OCBA 3M4YA 4I99A 1KI1A 2XOKD 2UVQA 3K70C 3FB4A 1KKLA 4UXIA 5JFGA 3RS2A 1N6IA 3H0KA 4IDHA 1KZ7B 2P5SA 2Z6VA 3TRFA 2F3TA 3KXKA 2F3RA 4V03A 1KI6A 2ZR7A 3GJ8A 3WMFA 3QPUA 1SVLA 5KHOC 2ZS8A 2P6RA 4I1OA 1KSGA 3SEAA 3AVUA 3DMDA 1SVKA 4C0QC 3W3ZB 2QPTA 2IYZA 4OL0A 2NPFA 4LSGA 5A4JA 1PUIA 2GK6A 2P2LA 4FW9A 3CX6A 5HE9A 2BBOA 1ZCBA 3I1FA 1IBRA 4XSHA 5C46F 4HB0A 2BOVA 1W0JA 3OFNA 4P4SA 2GJ8A 2FF7A 1XD8A 1LNZA 2ORWA 4Q7LA 2B21A 3HPQA 2JDID 1M2OB 4PQFA 4LHZA 2C96A 2OAQ1 2P67A 4ASUA 3QKUA 4B2IA 1AGPA 3VNVA 1HY3A 4IFEA 1NVWQ 2X1VA 4A15A 3QIAA 2YKGA 1E4YA 3O47A 4KYIB 4BEJA 4JKYA 1FQJA 1KJYA 4HEJA 2JLRA 2X2FA 4FMBB 2GDJA 2F43A 1WBBA 1N5IA 1WB9A 4OQLA 1GOTA 3CWZA 2PZEA 4XVQA 3REGA 3FE2A 1F5NA 2QBYB 2C77A 5DISB 3LBHA 4A36A 2UKDA 3K0EA 4D0GA 1EFTA 1PLJA 4JLOA 1ESNA 1OXSC 2GAAA 2RAPA 4TMTA 5L3RA 3BFKA 2QY9A 3SNHA 4JL8A 3QEJA 4RD2A 4E22A 3FHOA 4F92B 2ZREA 1Z0JA 5KPJA 1R0WA 4TYYA 2JIZA 2ZS9A 2G1JA 2NTYC 1OB2A 1Z6AA 1E2JA 2XJ4A 4RD1A 3NHAA 2IYRA 4L15A 2OESA 4DZZA 5EUQB 3KKNA 2ZRIA 4JKIA 4QBFA 1X8KA 2H57A 3QENA 1IN7A 2OV2A 2HF9A 3QXSA 3UWKA 1NRJB 3IQWA 4D25A 2QP3A 2WM9B 4W5HA 5CYOA 2ZE6A 1UKVY 1UJ2A 3Q5EA 4Q4AA 1PLLA 2ZRBA 2AFHE 2CLSA 2W6JD 3FWYA 2XNDA 2XTMA 5BYKA 4P31A 2R8RA 3A4LA 3NEJA 2ZI7A 5FBQB 4AK9A 4HZUA 4US2R 1EK0A 2CXXA 3LAWA 1S4QA 2DWPA 1DVRA 3EAQA 1ZIOA 3KKMA 1KSHA 2ZUDA 1S3SA 1UBCA 2J59A 1G8GA 3QUSA 2PBRA 4QC2A 4X8OA 3KJEA 1VTKA 3CZQA 1SKYB 3LVQE 1E2EA 5G3YA 3ZVLA 1JEEA 2IT1A 4QOSA 1CTQA 4JVLA 2YNMA 3L0IB 4A0RA 1GL7A 2IYLD 1JXMA 4A8JA 4PC3A 2B7CA 4DUGA 4B71A 4Q5IA 3W8NA 1VCIA 5DI9A 2XZPA 2QGNA 1Q3HA 5LBIA 1OV4A 1XEWX 1LVGA 2C9CA 4MYHA 1AS2A 4D80A 2C78A 3VX3A 4LCBA 1L8QA 4BWYA 1SVWA 4M9QA 3A1SA 4TQUS 5JCPA 6Q21A 2RGEA 2NG1A 1SQ5A 3OE7A 1G8YA 4ZKEA 3SDZA 3T5DA 1M6NA 2SHKA 2VP4A 4TQ9A 1KI3A 2ZROA 1DAIA 5FOVA 3GLIE 3P32A 2QGZA 5FBLB 4OHYA 2JLQA 2NGRA 2G9NA 1X8LA 1JR6A 2PX0A 3B85A 3QJYA 4E09A 2J0SA 4YLGA 5EE9A 4A1FA 5G53C 4A2PA 4AKIA 5F9FA 4OBEA 3W3AA 2OBNA 4P3YA 1RYFA 4HLCA 1GP2A 2ZUCA 1AQYA 1XB2A 2WPDA 2ZJYA 1G1MA 2CCKA 3B1VA 3QVVA 3QBVA 1XXHA 3SJZA 1YRAA 1GFIA 4ABYA 1E0SA 2QBYA 2VHCA 4NPHA 5HPYB 5B57C 3OZXA 4F91B 3W6NA 4C4PA 2D7DA 5AJWA 3C7KA 4PXAA 1AJEA 1R4AA 3WBJA 1R7RA 4L9SA 1CJUC 4LJ7A 1PVOA 1C9KA 1CXZA 4POAA 2MSDB 1GKIA 1U0HC 3I5XA 4KODA 1QHYA 3EZFA 4DIDA 2VP6A 4Q1EA 1DEKA 4QG7A 3UMRA 3LO5A 1KTVA 1HV8A 2V6IA 4PC7A 2F55A 1NVXQ 2Q9CA 1Z28A 4JL5A 4M9XA 1JR3A 1CP2A 4DSUA 3W8RA 1NBMD 1DAMA 3ADBA 1IXRC 3KKPA 4JS0A 3GLGA 4QXAA 2V4ZA 4B76A 4ACBA 1TEXA 3LVRE 2W6IA 5EE1A 1JAHA 3F0TA 2ZE8A 4G1UC 4TL7A 4JVMA 3DMNA 1GL9B 4IEIA 2P5TB 1X3SA 4XWAA 1MO6A 3EA0A 3OIVA 4RKEA 5EUMA 1W2GA 2FEMA 4YXWA 4F4JA 4U02A 2PX3A 4R9UC 4FWIB 5L8VA 1ZRHA 2ZU6A 5G3ZA 121PA 1LS6A 1T6NA 1TADA 2HUPA 4MGIR 1W4BA 1YR8A 3EPHA 4TLAA 1G7SA 2PT7A 2H17A 2X19A 3Q9LA 3QVUA 3GJ0A 2IXGA 3X2SA 2QSYA 3R8CA 1T3HA 1COWD 2RGXA 4H1UA 4C0AC 1TQ6A 2KWIA 4BFWA 4GMXA 1W7AA 3BE4A 3B60A 1N0WA 4LX0A 2ZVPX 3QKRA 2AK3A 1N0UA 4M1SA 4EJSB 4ASUD 3PIRA 2GEUA 2DCUA 3GLFB 4PQRA 3FDIA 5FR2A 2IYYA 1XTRA 1LF0A 4Q48A 2AD1A 1YZTA 2ERYA 1S96A 4QGGA 4PANA 1NJGA 2IEYA 3EZ6A 4TYQA 3FKQA 4YMWA 5E95A 3P4YA 2GZDA 3VHXA 3ADKA 3EZ7A 4MUBA 4UJ3A 4D4LA 3KFXA 4IOJA 4DLYA 1ANKA 3BRWD 3B2EA 4PC2A 4V0ME 3RHFA 2NO0A 4MRRA 3H84A 4O2LA 2R2AA 1NMYA 3W34A 2WSMA 2VQSA 1AQUA 3UXMA 5F3WB 1GL6A 1ZIPA 1AS0A 2FPKA 2XXAA 2WWIA 5EP1A 4LGMA 4MRPA 2JIZD 4LI0A 1R10A 1E2GA 1Q44A 4CZ2A 4KO8A 2IC5A 3WMEA 2DWQA 4V0OA 4B74A 4ZCMA 4BASA 3AB3A 4PHFA 5HKKA 3TGPA 5HR5A 2J7PD 2VH5R 1RIFA 3FYHA 2HT1A 3TNFA 4YDSA 4BPBA 1CR2A 1P61B 3KL4A 3SYLA 4GBMA 4N1AA 1OYWA 1DAEA 1HUQA 1TMKA 1NLYA 2A5JA 1KJZA 3BWDD 5FUXA 1OH6A 2JLUA 4URWR 3A37A 3JZMA 2QTFA 3GCGA 4M1KA 4PO9A 3VU9B 4QGAA 1OIVA 3R9WA 3MAAC 3HYTA 1KKMA 4AIIA 3QXXA 2QMUA 2QAGC 4BEBA 3HWSA 5DGXA 2WWFA 1OSNA 1XF9A 1RE0A 3OAAA 1KJWA 3Q8XB 2IEZA 4YC7A 2GZHA 4MRNA 3ZVMA 4PZZA 4O2RA 1XTKA 3T5GA 3H4MA 3KX2A 4LHXA 1KDOA 3IBGA 5KYKA 4FCTA 2IF2A 4AD8A 3WYGA 4MKIA 4MKGA 4L4UA 1IY1A 3SJBA 3AVQA 2A5FA 2OSBA 4WXRA 3GP8A 5CM8B 5EZ6B 3O8DA 3LD9A 3MUFA 3OE7D 1XPRA 1KI4A 2RGBA 2IS1A 4QHYA 3U44A 2BIFA 3D31A 1ZM4A 1E1QA 3TVTA 2VSFA 1E2QA 4LPSA 4A8JC 2IUUA 2WBLC 3K0AB 3AVPA 1BO6A 1QHXA 3R9IA 5AWFC 4TYPA 1OT3A 3T1TA 1KY3A 1NLFA 4EPYA 1AZTA 2PT5A 3U4QB 3MG9A 2IL1A 3ZIAA 3U60B 3QXHA 1NN5A 3RC3A 2JJ2A 3ADCA 2WJJA 2IWRA 5JECA 3WNCA 1CR4A 4Q4JA 1ZM9A 2F9MA 4IDNA 2ZRLA 4GP7A 1J7KA 4JLKA 1NNEA 3EC2A 4W5WA 4O3MA 1GM5A 3PUYA 3IDQA 3VX4A 3LV8A 3RYTC 2ZRDA 4B47A 5CK4A 1Z06A 1UADA 2FWRA 2J7KA 4CYMA 1E99A 2FFAA 4GRAA 4NYJR 4P4TA 1PJRA 1E32A 5JWHA 1N6PA 3QF7A 1IJEA 1E2DA 1ZUHA 3CH5A 4XH9B 8OHMA 4XVRA 4C2TA 5FUVA 3F5FA 3PEVA 4JVSB 1Z83A 3CW2A 1VPLA 3IILA 4NCHA 5ELXA 1YE8A 4BUJA 2ZR9A 5CLLA 4JYBA 4JLBA 3K0CA 2J41A 4FMDF 5FPYA 2D4HA 2QROA 2FJUA 2RGNA 1KZGB 2X77A 4GFDA 3PITA 1NI3A 3A58B 1E79D 2BMEA 2CLDX 3H86A 1TX4B 1LV7A 3CUEF 3I8XA 2ZI5A 4Q9JA 1Q12A 1VG1A 5C1BA 4IKEA 2D3WA 4G5GA 1PV4A 3NH6A 2XZOA 4GL2A 3IEVA 3FMFA 2I4IA 5HZHA 5DYGA 4N3NA 1Z0DA 4PQYA 1CULC 1FQKA 4MGKR 4E03A 5DI3B 2IXFA 2GWHA 3CWQA 1H8HA 1ZINA 2HDNB 3KDSE 5TXGA 3TSZA 4DWJA 3EIHA 2HLDA 2ZJ8A 1TNDA 2F9LA 3AVTA 1AK2A 2EFCB 3N5CA 5DHAA 2Z5FA 4F38A 3BIFA 3WYFA 2OHFA 1BYIA 3GPLA 3C5CA 5BN3A 2BBTA 3KJHA 2D74A 1N5KA 4C0JA 5KSPA 5DO9A 4MH0R 3AVXA 5KDLA 4LDJA 2ZSDA 4PSVA 1OJLA 2O8CB 3K0AA 1N6HA 1JNYA 2FFBA 2KBFA 1CF4A 3BC1A 1Z29A 4R98A 1ZP6A 2J0VA 3U4QA 3K9GA 1VHTA 3QXCA 1X1RA 1OKKD 2A5DA 2VTKA 3KTAB 3OHMA 1KK2A 1YZQA 2R6DA 2GEDA 2IYVA 2P6UA 1UBEA 3CPJB 1S9DA 1KO8A 3TBKA 1NMXA 2WZQA 3AF1A 1E2KA 2AFIE 4U00A 5SZKB 2HCBA 4AKGA 1OFUX 3PEWA 1Y3AA 3X1YA 4YMSA 2ZANA 3CZPA 1W47A 2GF9A 3E70C 4Q4LA 3KKQA 4BFZA 3PEYA 3THXA 4CEIB 4IDQA 2AD5A 2RGCA 1XJ0A 3EZ9A 3NVAA 4PX9A 1ZYUA 3EIEA 1P2SA 5BWMA 1V5WA 2PEYA 3A1WA 3QKTA 1T8TA 1S8FA 2FSFA 3NHBA 4OKSA 1XD2B 4L8GA 3U3RA 3BORA 5FBWB 1HA3A 2IUTA 4AG6A 2ZS7A 4GDFA 4IOMA 1E9FA 3UMSA 3WNBA 2R62A 2R65A 2VIIA 3CONA 2GCOB 4Z51A 3ADDA 4TSFA 2VP9A 1KAGA 3MFYA 2PLFA 5CK5A 1E0JA 2VP5A 3ZQJA 1TL7C 1ZC4A 1ETUA 1IXZA 2VLIA 4B3XA 3QKSB 1YKSA 2GVDC 3RAPR 1CBUA 1XCGB 2IYQA 1T8UA 2IYSA 1G8FA 2FU5C 1N2CE 4PO1A 4G5OA 4Q66C 4C7OB 4KJZA 3U3JA 1JB1A 2GTPA 4FMCF 3H1TA 4DSOA 4HUTA 4OI0A 1TUIA 1MH1A 2F1RA 1GIAA 2DHRA 2REOA 2YHSA 3LX5A 5FL7A 4EUNA 3TR0A 3HDTA 4LJ9A 2AHOA 2GJKA 2W83A 1BYUA 2PCLA 4LHVA 4PAMA 3SZRA 1SXJD 3M1IA 1S3GA 1NG9A 1UBGA 1W44A 3SFZA 3ICQB 5JEEA 3QNUA 3KJIA 3U2QA 1E1RA 3UMFA 2VF8A 2NO6A 3FMPB 2B8WA 2ZRPA 5G40A 1DAFA 2BM0A 4JT4A 1KI6B 3KTAA 1LFDB 4L5BA 1NN0A 2YOFA 2FH5B 4WZAE 5TVKA 3P4XA 2ZITA 1QG4A 2J9RA 1XMIA 1VKJA 1ZMXA 2NOAA 2ZYUX 5FTJA 5EJEA 1VIYA 3ZQ6A 5EE5B 4GOKA 3WHKA 4TYWA 4LC0A 1CS4C 1J90A 5KSYA 4W9MC 3WMGA 2G3YA 3JVVA 2QRNA 1W49A 5DIFA 1OIWA 2OCAA 3PUXA 1ZNYA 2ZJ2A 1UFQA 4CEIA 5AUNB 2O52A 5JHGB 1OE0A 2OG2A 2GNOA 1A7JA 2Y8EA 3PQCA 3DPUA 4QRHA 3TLXA 1W1WA 1RFLA 2A9KA 2G0TA 4A6XA 2JLVA 1FX0A 3QBTA 3L43A 3EA5A 4DDVA 2ERXA 2IYUA 3DO6A 5HE8A 1GTVA 4FXPA 4OJQA 2AR7A 1SKYE 3SHWA 1XD2A 4OHXA 3T15A 2WTUA 1VIAA 3AF2A 1RRCA 1R8SA 1JBKA 4PPQA 2W2TA 3PUZA 1OW3B 2DFNA 3ZJYA 4EIWA 3SQWA 1G4AE 1I2MA 1R6BX 2PJZA 4JBYA 2GHIA 1FP7A 1XTSA 2C9OA 1L7VC 4WOPA 4DLTA 3FFBA 2IHBA 4TL8A 4AC9A 4IRUB 4OHWA 3WNDA 4A0FA 4ACAA 2EFEB 2HCJB 2QA5A 2MSEB 1FNMA 5EXPA 4KU4A 1TTTA 1XBTA 1ONBA 5H70A 1P72A 1R5OA 3BBPA 4LHWA 3SHFA 1L2TA 3QKSA 4CDGA 3GFTA 4A82A 1KY2A 4NHOA 4RY2A 5GADl 3TAUA 3QG5A 1Z22A 1OHHA 1G17A 4EQ6B 1KI2A 3CB4A 3K0CC 1H8HD 4MGZR 4DRZA 3TR5A 3K1JA 4DSTA 5JI3E 2OZEA 1CLUA 2O0HA 2QAGB 2HLDD 2ZE7A 3OEEA 4JT2A 3UANA 1AGRA 5DNYB 2CHQA 3V00A 1S1MA 4D4KA 2WOOA 3PENA 2KB0A 4M1OA 1GKYA 1WRBA 2E87A 4PHHA 4ERNA 1BMFA 3K9HA 4ILEA 1XX6A 5GJVC 3TVDA 2JJ1D 3GEHA 3U5ZB 1GKUB 2RH5A 4Q4AB 4DDWA 4E5UA 1H8ED 1TAGA 2ZI4A 3DKPA 4HZUB 4QJ3A 2WJIA 3EIQA 1EFCA 2BCGY 3C4JA 3RS5A 1US8A 2ZYVX 3C14C 4V0LA 3LFUA 3UWOA 2NZJA 4B32A 4LRWA 3TUJC 3RRYA 3SOPA 2ZRJA 4LUCA 4RZXA 4EPTA 3U61B 4KSBA 1M7HA 2GJAA 2WWYA 4A8JB 4A9AA 1E3MA 1FZQA 2IK8A 2YOHA 1E9CA 5IDVA 3U7FB 1P2VA 1II8B 3EC1A 4F93B 2Z4RA 3AV0B 4X8MA 1IQPA 1R0XA 1ZM7A 2CE7A 2D06A 4XTRA 5CDFA 3RSOA 1OH8A 2QSZA 5K8LA 4G5RA 4HLUC 5C4MA 4HDCA 4PPNA 2BJWA 3LLUA 4GSYA 2A30A 2AWOA 2BCJQ 1FP6A 3HR7A 3ZZUA 1DOAA 3VR3A 421PA 3GJ7A 4S2EA 1LTQA 2PZGA 1BOFA 4TMKA 2CE2X 2IS4A 4UKDA 1KDTA 3AEZA 4Q1FA 1Z5ZA 4LPKA 3B5JA 5LD2B 4AYWA 1DO2A 4II7A 4ZDIA 5F9HA 2UZIR 3K0FB 2E1RA 2CBZA 1Z07A 1F60A 5FOTA 3Q5DA 1Z0IA 2JA1A 2C95A 2JGNA 1XXHB 3CRMA 2G77B 1E9EA 2Q3FA 4G5SA 1F2TB 4TSFD
chains in the Genus database with same CATH superfamily
4QTTB 5JIBA 1ZD2P 4NBSA 1E8NA 2B98A 2VK4A 4EKYA 1SBHA 3P0HA 2PJRA 3RABA 3II6X 1HNXB 3QMVA 3IE0A 1P1IA 1JFRA 3IUEA 2B0CA 4AB1A 1JF8A 3P71T 3QNWA 4LOKA 3U9TA 3H17A 5E3HA 4LV8B 4X60A 4YMUA 4KQIA 1NUSA 1XA3A 4G0VA 3KUXA 2VWPA 1XZAA 3WZ2A 4L2IA 1U6IA 2B30A 3AVYA 2QN1A 2EZTA 2XTJA 3B6EA 3ZYZA 3HGTA 1ODCA 3DMPA 5L4NA 1VYVA 1ZUIA 4RIHA 2JVKA 3GT3A 4FNGA 4XYEA 1ZC3A 4YAUA 1EESA 2GDZA 2PL9A 4IP0A 3P2OA 1O0BA 2SCUA 2JBAA 5DSXA 1KAEA 1TFRA 2C82A 4GI3A 1KXZA 3SQMA 2Y2UA 4NESA 5BN1A 4D26A 2F8TA 2QTAA 4PIVA 5FPTA 3LDAA 3VDQA 4DWWA 1OZ0A 3DO8A 3UFBA 4X84A 4UTPA 3Q98A 1I0ZA 2VDKB 3GLRA 1KYTA 4IVPA 4QICA 2P5UA 4NYJQ 4WVFA 1RXVA 1OMOA 1IN5A 4DB2A 5BQFA 4NJEB 1BZYA 5B2ZA 3VR4A 2D0DA 3IP6A 3LUDA 2Y1CA 1WV0A 4MW9A 3CR3C 3DNMA 4HDRA 5AVXA 1Y7IA 1DBQA 1ZQ1A 2XBLA 4MKXA 4MCIA 2Z95A 4NENB 4R9SA 3VZPA 1F9AA 3T1OA 4FE3A 2P2GA 2FHSA 2JFUA 4ODIA 1KS9A 2PZLA 3CPEA 1P9LA 4R7TA 3C6XA 4BKPA 3NCTA 4I55F 5EXTA 4YRPA 4W8GA 5LP6F 4CG0A 1II8A 3HU2A 2GA9A 3GEEA 5FWAA 1V3TA 2NV6A 4X85A 1KZ6A 1E6KA 4O2BA 4Q03A 3W7VA 1QP8A 1Z5VA 4PRZA 5ITVA 2C9ZA 4UUMA 5F21A 3LPCA 1D2MA 3QV1A 2YWJA 4MAMA 4MVXA 3I42A 4QGHA 4KWTA 3KQKA 4JROA 1IK6A 1Z3CA 2P2YA 3BYZA 3QBJA 5AUOB 3DULA 2HIAA 5EXXA 4EYOA 3AFNA 2ZRAA 2HRRA 4X6XA 2QN7A 3WL3A 4RV5A 4X6UA 5K45A 2WVGA 3AOGA 2W6OA 3IQGX 1G21B 3ITDA 4XQGA 5F1OA 2RGUA 2YWCA 1GA4A 3AZQA 2Q4TA 5C80A 1KYWA 2EC5A 3K09C 2P77A 4JX9A 2CCJA 4C06A 2WF6A 1F4LA 1NWHA 1RDFA 2A0FA 3IP7A 3RC9A 4QM7A 2O19A 2V7PA 4C76A 1MO3A 4ZJZA 3OPYA 2O2ZA 1UINA 3E9RA 3VOAA 4QUKA 4YRGA 3M6AA 4YXFA 5DYYA 4M9SA 5EN4A 4UDOA 3BMNB 4B4OA 4BBAA 3O8QB 4RE6A 3SVLA 3KT8A 4PLTA 1M6HA 1C9DB 1RT9A 1V6SA 3C3XA 3PCTA 1G3QA 4HYQA 3TIXB 3TRDA 4DMMA 5D7NA 3TX6A 4PLFA 2XXAB 2QTZA 4IIFA 4MW0A 5GVSA 4DLKA 3ZXXA 3LKBA 1V6CA 3TFQA 2EVWX 4ND8B 2WFAA 2R87A 1H2ZA 2BTQA 1D4FA 1PL8A 3BIXA 4Q4HB 4YJFA 4Z0NA 5GVRA 3TL3A 1S2NA 3VZSA 4JKOA 5JD4A 2PD4A 2PH5A 4ZT7A 2ZSIA 3DE6X 1JQDA 3JYLA 3LA6A 4ER0A 4LTMA 3NNNA 2OUIA 4NCJA 4U7GA 4CRWB 5HRAA 3FHTA 1N6LA 5DLPA 2EBHX 1JQEA 3X0DA 2I2XB 1G5PA 2IELA 4WEQA 1EXMA 5MGBA 2JAWA 2VEDA 4B81A 1WUHS 1XQWA 2EL7A 4TT3A 3S0JA 4GD3Q 3I37X 3R6LA 2X0KA 3ASYA 3CNQS 4CMIA 4CKYA 4YCLA 1A77A 1C7RA 4YNBA 5IVDA 3JASB 1QCDA 4KTTE 3ANLA 2H9IA 5DM60 3DUFA 2AB0A 3W05A 4ESHA 1ISGA 2JVJA 1XCPA 3GLVA 4I2NA 3WYEA 3VNUA 2AYXA 4UC0A 3SJUA 4CCAA 3SMVA 4EF6A 1R0KA 1SR8A 4KN8A 3QJ5A 2FW8A 2AF4C 3IJEB 5TJHA 1NR5A 2GZAA 1CUVA 3JQPA 2ZRNA 3JZDA 4QDXA 3LYAA 4KLAA 1A9YA 2EZUA 2YWBA 2J09A 3QE3A 4M1MA 2BZSA 1ZEMA 2UVPB 5CVEA 4UUPA 5JY6A 3JR3A 4S1VA 4H7IA 2DUJA 2PMDA 5ALFA 2V03A 3IA2A 4HDOB 4OUDB 1W0JD 3HJCA 1YZ3A 3VI3B 5L3QA 3KYJB 5K20A 4NTZA 2DFLA 2V1UA 2BH2A 2HJSA 2ZEJA 5AM4A 2BKVA 2H63A 4Z1MA 2BVNA 4BNKA 2PMBA 3H9CA 1HYQA 1NMEA 3WQBA 2VCYA 3VR3D 2BF4A 3N6VA 1W48A 2WA1A 2J87A 2CJFA 2VWQA 4OXRA 1IDOA 2F8LA 1HF3A 1LPMA 4QASA 5D2CA 4DBVO 3QH4A 1L4KA 4QJ4A 2ZRFA 1JJBA 1ZOSA 4DLSA 5K05A 2AGVA 2JNWA 3LNCA 4N9QA 1T3GA 1VCNA 2PLRA 4ER6A 5KAMA 3B1XA 1YE5A 2WWXA 1ZQ9A 3KB8A 4G4SO 4G37A 3ND8A 3D7NA 4CT4B 3HY4A 3RRMA 3C3WA 1I1NA 2R0QC 1OWNA 2QE7A 2JH3A 1J2JA 1XEFA 4LXUA 2GN9A 1E92A 4GLFA 1S8NA 1FU8A 1PR3A 3VC7A 1G64A 2YWHA 2V3WA 4Q4JB 3RS4A 4DARA 4O6VA 3RYFA 2JAHA 3NBXX 3SS9X 3PEFA 4F8YA 5HP4A 1E66A 4QNRA 3LCVB 4HNAB 3UF0A 4B40A 2GBLC 5JROA 3C6MA 2XNJA 1CY0A 1LPAB 2XF8A 5T6MA 1QG6A 5KHLB 1Y3CE 4M86A 3BB3A 1QP7A 2JLYA 3WGZA 2OE2A 1G8AA 2OV8A 3ZE0B 4M1ZA 4HTFA 5LDDC 1CY8A 1E5QA 1RHMA 1XTQA 2DKFA 2XJ9A 1R6XA 1WUYA 2PGNA 2X76A 3JQEA 4RVDA 4D8XA 3K4PA 5CU7A 1DUIA 1GG5A 3I4LA 4DMFA 2J0UA 2BGWA 4DJAA 5KB3A 1KH2A 3NRCA 2XNDD 1CUAA 3E7XA 3EVBA 1JIXA 1CFZA 2YXBA 3F4KA 3R3SA 1ARZA 1GCIA 2GBFA 1U3TA 4AY4A 1Q0UA 4UZEA 1HLDA 1R8YA 5ECWA 1JEQA 4YRIA 2CFOA 5AW4A 1W36B 3M6MD 3M6UA 3MWJA 4HATA 4K1XA 4F6CA 3J81k 3EFBA 4CG1A 1N32B 3WL5A 4ZANA 4UBOA 5TMPA 1Z0KA 2QG9A 2W8ZA 3DQZA 2AJBA 3CLRD 1QAQA 3DEIA 3L82B 3PDCA 4ZOLB 2CMFA 1Y4UA 2SKEA 4TLEA 5B58T 3QEBZ 2O3QA 1NFRA 4DUGD 3ABZA 4Q21A 3TJZA 3UJ9A 1I7QB 3VOSA 1J9GA 5K2MA 4B73A 4G89A 3WGIA 3UOGA 3HUTA 4H3HB 5F12A 1B1AA 3DEFA 3GUUA 5EE3A 3AY6A 1JI3A 3IELA 1G5TA 4TRRA 1N1GA 5DDIP 1CHDA 3FCAA 4I08A 3HI6A 4HFNA 2PX2A 4MICA 5CPBA 1S02A 4PPGA 2AKEA 1KK3A 5LZ2A 2V9ZA 2CV2A 4ZYZA 5AXCA 5AHWA 4AX8A 3JVUA 3OM0A 4YRBA 4XIIA 521PA 5KC8A 5B37A 2LCFA 1QP0A 1W1IA 4JOBA 4P84A 1XVTA 3KHUA 4BNNA 2CT8A 4LMRA 1QQBA 1CC1S 4LC9A 4D81A 5C8ZA 5FLKA 2W90A 3IJPA 4B35A 2JD0A 3GEBA 5DJ5A 1P6QA 2WPDD 2Y1DA 3B53X 5C37A 3MGKA 1KRXA 1GY8A 3C3CA 3NYWA 2ES4A 3UB3A 2X14A 3QPCA 1VJGA 4F0JA 1VXRA 3TRHA 1OX6A 1ULZA 1ZSVA 3F78A 4ZT5A 3KT3A 3PXBA 4GVLA 4MV3A 1ISFA 1C3XA 4RFVA 4S0ZA 2CV0A 5FOWA 1QX4A 2V7XA 2ZWPA 2HBZA 1QQ7A 4P38A 3CCFA 2AI2A 2AYZA 2L0XA 3ORQA 3UHFA 3HK2A 1NYQA 3K2IA 3RAGA 4EUSA 4CG3A 2AKAB 4ZA2A 4F3NA 4EB6A 4HRXA 2ZJ7A 2NZWA 1MJFA 2IEDA 3I6QA 2XVMA 2I4MA 2V7BA 2EP5A 2ZSHA 3F49S 3FMOB 4V0NA 3HY3A 1JR3D 1SBNE 2ZAYA 3R6GA 2VP0A 4RTQA 4FR0A 3AW9A 5LUBA 3T0GA 4YUYA 3G6KA 3KQLA 3QITA 1E6EA 5SZJA 3EWSA 4GWLA 1IBSA 3C15C 1TQ2A 2P0AA 3ZHOA 3C3EA 3IP8A 2Y1LA 4WESB 4X65B 2BTEA 4AY5A 1W8IA 2W6ID 3OZAA 2UUBB 4DNOA 4MDFA 3VH2A 4H0CA 1JAYA 2VHXA 4AYTA 4NKRA 4XPZA 5ALVA 2Q5QA 3PKIA 4IILA 5G4LA 1FFEA 1I7LA 1O95D 2HU8A 2K4MA 5H80A 1NW7A 4DHWA 2FSVA 4P3NA 5ALKA 4ZKDA 4XRRA 2XWPA 2RAVA 4O4IA 3L9XA 3KC2A 5EWJA 2VF5X 4INJA 2JLAA 4LV6A 1L5MA 3MMXA 5GV7A 1GQOA 4P5DA 5EZYB 4D3SA 1I30A 2VJNA 4IPTA 1JT9A 1UKYA 1DXQA 1YVDA 3G5AA 3PUWA 3T7EA 4ZVOA 3H5IA 4LYHA 4MUXA 1E7SA 2HJHA 3M7IA 1LEHA 1TF5A 2BGLA 2DSNA 4G8CA 2VDRB 1SQFA 3AF4A 4AKTA 2ZDGA 1WIWA 4HNQA 5DSZA 4BC1A 1FYVA 2HSWA 2REQB 1G0NA 4IKPA 4OJMX 1O2DA 3DM5A 4BNGA 2HDWA 5A9RA 4UHKA 1NXWA 3BK1A 2DFPA 1B4DA 2EL9A 3A3KA 4LRSB 4KVFA 1K63A 4Q6WA 3RYHA 1EXNA 2QG4A 2WEKA 2ZJAA 3WGOA 4YMHA 4RQAA 1AKNA 4HLQB 3RNLA 4R5HA 1U94A 2WHQA 2Q9BA 3A31A 4HLUA 4LF9B 2IBTA 1QV9A 4B2YA 3CUUA 1EDOA 3G6WA 1KYVA 2WLSA 4UEJA 5B4VA 5C8XA 1U8AA 3QSYA 3BA1A 1AM4D 2O2SA 1UMDA 2BC9A 2H8GA 2I33A 5JAIA 1YHNA 4GVXA 1ADFA 2V4UA 4KR0A 5BT8A 1GVNB 5IJ0B 1GYRA 3AHCA 4RAOA 3NYRA 1NRXA 1CRLA 2NZ2A 1QVWA 3WB1A 3EXFB 3N2IA 4L3OA 4DC9A 3D43A 1ZDMA 2C9BA 1WJGA 4NCXA 1VGRA 1NBAA 2BEWB 4FB4A 2AOTA 1R5BA 3O5AA 1K7XB 1WPXA 4CM8A 2RHWA 3FUTA 5MFZA 3IP3A 4ZVMA 3NIGB 1YS7A 1NVKA 2B4KA 5EIXA 1PNVA 5FI0B 3EGXB 2UYCA 3C8UA 1T0JB 1IHYA 1WVGA 2R79A 3I9LA 1H2FA 1CW2B 3IKJA 4B4KA 2ZLBA 3QLTA 1UDAA 2H48A 3BGWA 4RTNA 5FI3A 1Q0HA 4H4DA 4EW1A 5E2BA 1EH5A 2HMWA 3O84A 3OT1B 4U3JB 5BXQC 2OCPA 1R9JA 4Z86A 4JI4B 1NSTA 2K6GA 3E7FA 2ID4A 1HC7A 1V9SA 3TOCA 4DL9A 2XUZA 5KTMA 3L77A 1JW9B 1FBNA 1TVEA 1HEIA 2WAYA 2CZGA 3E4DA 3LUJA 3AT1A 3PCRB 1MB9A 4WZ6A 2X3UA 5AI5A 4LIPD 2P3OA 5P21A 3W8FA 4Q7QA 2BFBB 3O3MB 1BVUA 2HWYA 1Y5LA 1W1UA 1CP3A 1P0PA 3ZD7A 3C24A 2AHRA 4H6VA 2XB8A 2JCXA 5EQDA 4DM3A 2AYYA 2JDIA 1TTQB 4QM6A 5BV0A 1LF5A 4GPBA 3GRZA 1DOZA 1W75A 1S2GA 2A58A 5EYPB 5LLSA 4ZI5A 4HLDA 1YOVA 5J5CA 3EW9A 1VL0A 2VYVA 5THKA 1JHZA 1KVRA 1T2FA 2EFDB 4KL8S 1MABA 5U4XA 3TQSA 2C61A 3IBYA 1QQ5A 3O4IA 1XZKA 1RJ9A 2QUAA 4GKVA 3AM3A 4HYYA 2CUZA 3H5RA 4ME6A 4MR8B 2Q4DA 4OQNA 4WUTA 5E7MA 5H16A 5IT4A 1NMSA 5KUTA 4BNVA 3OIWA 2HSJA 4RFSA 4DR3B 3KG2A 4RNDB 4MS3A 4YS6A 2QNIA 3AR3A 4GE0A 1ADJA 1FUEA 2JFGA 5AI0A 3ZNPA 4WFJA 1HQYE 2W2MA 4FNMA 4GSKA 4WW0A 1ONNA 1WKCA 1EKXA 1SXHA 4LJYA 3IHWA 1MQ9A 5FPHA 1WXHA 2BHSA 4M3NA 3DJFA 4RV9A 3CVYA 2WYOA 1P60A 3D0KA 2IEAA 2Y77A 2AW5A 4B48A 3MIIA 2I4LA 1U2PA 2QQEA 3OCVA 4LE2A 5D3KA 4AY6A 2LIVA 4DCJA 6AT1A 1NP6A 1W6UA 3OOJA 4BGDA 1QJCA 2PZBA 4FYYA 3L6CA 2C3YA 5F4ZA 4AZVA 1P4SA 2OUKA 3BHIA 3PRHA 1TJNA 1EYZA 2P2ZA 3GRCA 2YXPX 3ZIAD 1APBA 1YKFA 1QNLA 4DKXA 2WU3A 2O8BA 1EE2A 2O7NA 3DEAA 4N0QA 4TTAA 5CJJA 4K6KA 2WWHA 3B6JA 5DP1A 3THOA 4B6OA 3ITKA 2W6JA 2NWQA 3I30X 4FFVA 4D57A 4KJXA 1XT6A 2OO3A 1E3LA 1VECA 2R7MA 2Y4OA 3MCUA 2GEVA 4C6HA 4AP9A 4DDUA 1TECE 1RXUA 2H2IA 3HV2A 1A9RA 2HF2A 3FGOA 2WQ7A 3P2JA 4TKZA 3EOAI 4UQPA 2CVFA 4CMAA 3O8CA 1YTUA 3DYBA 3F96A 3E5RA 4QWWA 5FUWA 1TLLA 1BE6A 4WINA 4AJIA 3ITEA 3OPNA 4GBED 4JJKA 4PFJA 3VDXA 2PIDA 2EEZA 1X8XA 1VCHA 4I55A 2KMLA 5CXQA 1M1NA 4OGWA 4UOQA 4B31A 3BH6A 1E62A 1JG7A 4OI4A 2H4XA 3T3GA 3WLTA 3ZDRA 3BFVA 2JAXA 3K7EA 3TSCA 3KSRA 5JEDA 2A0UA 3FJYA 1N2SA 2V8BA 1KDRA 4PXYA 4RTLA 1GFSA 3N75A 5JH7B 3N70A 1BJKA 1YA8A 5CNKA 1W36D 2JRBA 1XD9A 2RGGA 2WZDA 4L08A 4PNHA 5DHUA 4CBVA 1PG0A 3N76A 4LSZA 1U81A 4P34A 4KBGA 4E33A 5KO2A 5KSOA 3LQRA 2W4QA 3B89A 3H2ZA 2J9GA 5I9IA 2DPGA 1TFUA 2XE8A 1T4GA 1BXGB 3B3AA 2GFIA 3VR1A 4JLPA 1T2VA 3TW8A 3PNPA 3G0CA 5D51S 4DCGA 5AHXA 2JCSA 4WH0A 3AYXB 1CUXA 3UGQA 3VOTA 1N1EA 1XUOA 2PM8A 3CKLA 3E3MA 4RESA 4WDRA 4MYSA 3RB8A 2R48A 5ICMA 1CFJA 4NNOA 4ZQEA 5IDYA 4KFTA 3OUTA 1OX4A 5GONF 3OQNA 4CUJA 3QW2A 5D8DA 4EA8A 2P1RA 4OUKX 4EA6A 2ZYSA 2PH3A 2HTFA 4A4DA 3C3MA 2BFOA 4KXQA 3ZKWB 4UM9B 3ERCA 1JHXA 4K8OA 4MYCA 2AZXA 4Y6LA 3B1WA 4ZK6A 4TTTS 4M1WA 4NYIR 3EXHA 1LX6A 2HDHA 5L3SB 3BL6A 4GUAA 3TNYA 2FAXA 2V55B 3K5PA 5C1IA 3RS9A 4AICA 1T1SA 3OCWA 3KZXA 3SHTA 4TTJA 1LK7A 2EFHB 2OB1A 4EVIA 4G0ZA 5E6SA 5EJIA 1B74A 1KEEA 3IUYA 3IQIX 4OAPA 1JQLB 3EWNA 4BWVA 3JVEA 4J9VA 5EPUA 3R7WA 5KWEA 3V8QA 3HDQA 5LMUB 4POOA 3O1HB 5IEJA 2ZSJA 4MQ4A 4B8WA 1SA0A 1D0IA 3AIOA 2NU7B 4PAOA 2FEXA 3TKLA 4LF8B 1NPDA 3PHHA 2RGDA 4M7PA 4HVCA 3NEAA 5EMMA 4C4TA 4L8YA 2IUEA 1P1BA 3NC0C 3QLVA 4NZOA 3OEWA 4O2AF 5EGNA 2GUGA 2BELA 3ZY2A 1SUDA 5JQGF 2GLTA 721PA 3TJRA 1OPRA 4KFUA 1N5MA 3WR5A 3U3ZA 2HV9A 3H19A 1CUCA 4PN3A 1Z45A 4CNQA 2W42A 4JR2A 1I0IA 1R0BA 1U9ZA 3RIEA 4K5QA 2HUNA 3COYA 1TRKA 1QBKC 2PCJA 3F3YA 3QPAA 1NG1A 3NETA 5AHKA 1MQAA 1SC9A 5LVAA 4B3BA 1IRIA 1X1CA 5B58C 1K1EA 1KDYA 1QGUB 3GOHA 5J1SB 3G5MA 3PWTA 1HK7A 3O1IC 2DAPA 2WR8A 3F5SA 3PSAA 1GEEA 2FR8C 1VB3A 1OGIA 2R6AA 2RHTA 3C6KA 3NB0A 5DBFA 3G1WA 2A1IA 3NTUA 5IXYA 2WZBA 1B8UA 3L5OA 1P4HA 4X94A 2QRHA 5KNCA 1QR2A 2DXIA 1A8SA 3L0DA 3OURA 3SF0A 4OQFA 3OZGA 4KPEC 1ZOLA 2GKSA 1L9XA 1U99A 1RMQA 1ODFA 2JHCA 2OV4A 1FNCA 3PP8A 5AOCA 1MOPA 1L6RA 4BRSA 3IKTA 4CEHA 1C3OB 1OZGA 2NTJA 3ZE1B 2JLWA 4ZYUA 2C7PA 2GO7A 2QEQA 2ZCVA 3K9WA 4GAEA 4PX2A 3IUPA 5F5LA 4KXVA 1NVEA 8AT1A 2I65A 4CF5A 3PDIA 4Q18A 1JE1A 5J4KA 4HUQB 2RH8A 3I12A 2AXQA 1K5PA 1KF0A 3AEQA 3L6RA 2HRZA 3QU5A 1JG2A 3KYDA 1G41A 4JCCA 1Y82A 3Q1LA 4KOEC 4ID3A 3MAGA 1AKWA 2DUNA 3V4ZA 4B6SA 4HDNA 3SU8A 4EGQA 2PKXA 4LMAA 4AQYB 2YWGA 2XI4A 3JVIA 3JYQA 4EUEA 1YGYA 1J70A 1FK8A 4ZIRA 4GXQA 1AF4A 2HZ7A 3S1AA 2ZXUA 3EX7C 3LWZA 3U37A 1KEKA 5CHEA 1NOKA 3DLCA 3PTLA 2C7BA 1HG1A 2ATIA 4DMUB 4Z4HA 1FDWA 1GU1A 1GAXA 3FGZA 2FZLA 4BLOA 4R1SA 2EW1A 2HCRA 3V1YA 4RQTA 1RZRA 5IUNC 3HXLA 4OHVA 3CUVA 3PI6A 2C0QA 1PKXA 1DAOA 5K6AA 2GHTA 1U2DC 3OOYA 2GN1A 1E6WA 4PLHA 5REQB 4YJ2B 3W4IA 3WJ2A 4PZYA 3B7GA 3OEYA 1OXUA 2OLEA 2O1XA 3JWPA 4M0FA 3PJGA 3ISJA 3SXUA 4PCVA 4YAIA 2C4UA 4FDLA 1C2YA 2BFCA 1NULA 3NFRA 1E18A 5AK0A 1CF2O 4ZVLA 4ECAA 3DC7A 1T36B 1I2CA 2R1VB 3E2IA 4Y9SA 5NLLA 1KEVA 3VR6H 3LQ4A 1O89A 4M87A 4PZ9A 1WTAA 1Q5PA 4NBKA 4R31A 1QYXA 4KE7A 2CEAA 1PS9A 2QTGA 4LF5B 1HORA 4EPVA 1OQAA 1Y37A 3PQDA 4EYGA 3EASA 4G81A 4ZDWA 1A95A 1NKTA 2MTBA 2VUHB 1OI3A 1PG2A 5GGXA 5BURA 2GSDA 2ZYWX 4G01B 4BO8A 2LVBA 4JNCA 1M1YE 1MCZA 1B8PA 3I4CA 1Z88A 4L95C 5KVCA 2PKCA 5IF9A 4A03A 5MN5A 3AI1A 4YBZA 3VYSB 4JLWA 4XIYA 1F5SA 1JJ7A 5BPHA 4TTPA 4G24A 2DUUA 5K0FA 2EHJA 4HFMA 2AOUB 1FUKA 3HKBB 4C0KA 1T0PA 3BXOA 2BR4A 3QOFA 8ABPA 5E7JA 2OVFA 4HCJA 4HYTA 2PRYA 4OAOA 3SF8A 4DIBA 3BCHA 5EJMA 5B7GA 1M7BA 2PYIA 4G9BA 5EHIA 6REQA 1U98A 3V1UA 4Q3NA 4N40A 7REQA 2GOYA 4LZZA 4C3ZA 5KIAA 3OFVA 4H7KA 4EHAA 2GPWA 2VSQA 5IKOA 5JHHB 4BNDB 3V8MA 1EUQA 3GQBA 2D13A 3BSYA 1XP8A 3OLQA 4KMOA 3PD7A 4G1BA 5J4HA 1EFUA 1GRQA 3CUWA 4WZBE 3WWOA 2OAEA 1AXEA 5I45A 2R6FA 1AC5A 2HDOA 1WXEA 1PK9A 1AUOA 3RRZA 2HR1A 2E7ZA 4ML3A 1H2XA 1LI7A 4HGRA 3EGEA 5EJ4A 1Q20A 5TS3A 4U7HA 3AHHA 1AN0A 1KZYC 3KB1A 4CTKA 4YRSA 2CFTA 2XTAA 1ONSA 2DTEA 1AHPA 1Z5UA 3EIWA 3OICA 2X8BA 5KBYA 3BUSA 1MPTA 2KX7A 2RHMA 3GN2A 3SC2A 1W46A 4EJFA 4WBNB 5ELLA 5JCOC 4BXOB 4OATA 1FL9A 1ITZA 1GN9A 3G23A 1IEVA 1V8ZA 1B6TA 1E94E 3CH4B 2BHLA 4QPPA 4FC6A 4R40A 1ZR2A 3ND9A 3NDPA 2Y93A 4F5DA 1XRRA 2Y66A 4FDTA 3U3OA 5JJCA 1V16B 2WQ6A 4NQZA 1F1BA 1LTHR 1TYCA 4WZAA 5CNMA 1SZCA 4GEGA 1C8VB 5CFMA 4XUDA 4X1KA 3I76A 4HWOA 5IDXA 3R4VA 2WHEA 1P5JA 3V4RA 4HTAA 3AILA 4M55A 2XCQA 2H0RA 3OQBA 5B7QA 2XA2A 1YS6A 3MWYW 4BE4A 5LKAA 1GTJ1 3HVJA 3KYCA 1BMDA 1D3AA 2CNDA 4OK6A 3VSEA 2A35A 2FE1A 1Y5IA 3PQEA 3BWYA 2VPYA 3EXG1 4PVCA 4V0SA 1CY6A 3OETA 4A1OA 4M1TA 4D97A 2WICA 3VR2D 3EFOB 3ICWA 4ZYWA 1YZUA 5P8WA 1FY2A 3CLSD 3JYHA 1E79A 1Q14A 3DBVO 3KHSA 5B1HA 3WADA 1B8VA 1V35A 4XWKA 1GGVA 1L8OA 3UJ6A 3IOYA 1MDFA 2F3UA 5FLYA 4O0LA 3VH3A 2IYOA 3I9V1 4DM4A 2C97A 4RD3A 5IMBA 3LQ1A 3I0NA 4J8PA 3TMYA 4BHTA 4DNXA 5DLQC 3PT9A 3NWOA 2QQFA 4F45A 1KFEB 4Q7KA 1T4MA 2PXCA 1A2KC 3WLFA 3PQ4A 5DNVA 3T12A 2H52A 4K81B 3K0SA 3H2BA 3AP3A 3AK4A 5GOZA 5SYAA 2IU6A 4ZGWA 4ETMA 1U2TA 1P3DA 2PGIA 1A96A 3EARA 2O4CA 2PUVA 2NSJA 5SZIA 1QHSA 3KPWA 5CG1A 3JAKB 1T2CA 1I10A 5B3AA 2NZUG 3AI3A 1SBCA 2HRCA 4D8TA 3OX2A 3R7BA 2FGKA 1I3LA 1ODTC 5GAJA 3LZ6A 4FFNA 4GYWA 4UAJA 5BOSA 1P8JA 1QHEA 3GZ4A 3I6IA 5I7FA 2V5VA 2LIPA 3VR6D 2FW7A 2K5UA 1Z47A 4FCWA 1UEXC 2FRDC 2Z2ZA 3Q7IA 4DLBA 5KTSA 4B33A 4NSNA 2GI4A 1RPAA 1TW2A 2HK6A 4BFVA 2ZJ6A 1NNSA 2RGRA 4TMWA 3NOOA 4XDHA 2XHZA 2ZWIA 2OENG 3IVXA 5A6VA 1OKKA 1AV7A 1KMHA 5AKXA 3RIGA 4D9BA 3PYLA 3OC6A 4X7PA 4UM9D 1PNOA 5K8IA 1RZUA 1G19A 3H05A 2O5EA 3RPEA 2PRKA 2VWGA 4OM7A 1OH5A 3S6JA 1GU7A 1NONA 2I9PA 2ZIXB 3JQDA 4H77A 4Y30A 3GJ6A 3TQRA 4F56A 1WQ1R 3I73A 2I99A 3IAM1 5EUBA 3JATA 3UV7A 4DIFA 1IOLA 1FXWF 1P17A 3H2SA 3PICA 1KOLA 1UAYA 2R00C 3SMQA 1TJPB 1XVIA 1NUAA 3EGDB 1F6DA 4TXLA 4BGEA 4TV9B 4PE5B 2B8NA 3FY4A 4RVOA 3THWA 1SNYA 1NUQA 2FDRA 4IINA 1X7WB 3Q0TA 4KKXB 1MUUA 1XZQA 2EWWA 2CK3D 3IUSA 1KZ9A 1JLKA 2GESA 3O8BA 4QPNA 1U90A 1D03A 1RYDA 2FWMX 4IIJF 4UNRA 3UGKA 4K86A 5J3JA 2IXEA 3GH3A 2HWUA 1NHGA 4CM7A 5JYEA 3D6UA 1IN6A 1BFUA 3L93A 2CVZA 4WCFC 2ILTA 5IT9A 5KYWB 4CQMB 1QZZA 2C57A 3BKXA 3UVEA 4EEXA 5EWLB 5TMBA 5J2UF 1DADA 1NSYA 4MHOA 2I7CA 3P9QA 1QRAA 1T6BY 1ZPDA 4N0EA 4AJNA 5FWDA 2R6HA 1WP9A 3EDYA 4PTYA 3U1TA 3ZWBA 3OTOB 3PHCA 1DX4A 3IAXA 3DBOB 2NIPA 5DHTA 4AW9A 4GOXA 5B5SA 1EVEA 3IR7A 3DZCA 4N18A 2AKYA 3GFOA 3P9CA 3YASA 4W6QA 4E07A 1T10A 4B7ZA 2GN2A 1LU9A 1U3WA 2NV2B 4DXDA 4TLCA 1U3GA 2G70A 2P6NA 3I6BA 5J4VA 1U8YA 4B43A 5DHQA 4E5DA 5I3CA 4UNPA 1B26A 3WRWA 1NBEA 1PT8A 2JFYA 1RHRA 3O0DA 4Q9IA 1MVOA 1XEXB 1EUYA 1GNQA 2HLPA 1KEZA 2E21A 3K6KA 4D98A 2VTBA 2OEPA 1EXVA 4E2ZA 1HMPA 4C0XA 1GZUA 4QFCA 5HKAA 2JLBA 1I94B 1SXJA 5FFMA 5IXJA 4XVUA 3FUUA 5HEKA 5C5CA 2PEZA 5ALSA 1MQSA 4UXJA 5SZHB 3T4XA 1J8MF 2CL7X 5GJBA 2OGWA 5K4AA 2PPVA 4HH3C 4YAKA 3F67A 1J6UA 5H8WA 4LRXA 2GAJA 4I3GA 1YL7A 3H1AA 1D7AA 5ER6A 3T3IA 4BAGA 2FDCA 4MSUA 2MYTA 4BLWA 3SR0A 1FU7A 4A73A 3THYB 2VPZA 1TE2A 2ZJ3A 2C4KA 3MRVA 5CITA 5ICFA 1N75A 1T4BA 4N8SA 5KNDH 2LW7A 1PWXA 2OILA 3EFHA 1YC5A 3CX8A 4I50A 5HTKA 4EYKA 1ZKDA 4M0LA 8GPBA 3GR6A 3QTTA 1YD7A 2ZSBA 3NKLA 2CDRA 1XEWY 2O57A 2QLNA 2VBCA 3M9LA 4JN6B 3EPRA 1I7PA 1FRVA 4EW3A 1NGSA 1JHYA 1Q50A 1QBGA 3NTQA 5EJ7A 5K8VA 2CJWB 2PRIA 3NTOA 4AP6A 2WIGA 4J0IA 3IIKA 4QRIA 5KYXB 1SUAA 4HEQA 3UO8B 1ISSA 3JWHA 5DYWA 4PVDA 2QL7A 4WNYA 2VJDA 4QUHA 4XIFA 5CDFE 4FYVA 4HEHA 2EARA 1FSZA 1I13A 4B0OA 1MGPA 1SULA 3KU4A 1VKNA 2PSJA 2P91A 3PGJA 1ZN8A 4MWCA 1AK9A 4M8KA 4NL4H 5TR9A 3SYNA 1TYAE 4EZIA 3U09A 2WWRA 2BWJA 2Q6KA 2FRXA 1PFKA 3VO2A 5CT9A 1A04A 2YV4A 5IEBA 3TSYA 1O9HA 2FK8A 3ABSB 4WAUA 5TV2A 3UH1A 3AETA 2I7DA 3BSFA 4CFSA 2FGJA 1Z2OX 5TLSA 5HFAA 3GLIA 2QIOA 1FCJA 1EAMA 4M49A 4FWBA 4QPCA 1E3WA 2EX4A 5KAPA 2JI8A 4XD7D 4UCQA 4E5NA 3RADC 1HGXA 2PGLA 4FYJA 3RYCA 4FHDA 3CSSA 3WK9A 1E77A 1ZGGA 2BBSA 2JHFA 2A57A 3HI4A 4IOKA 1OBOA 4X97A 1ZBDA 4E88A 3U7IA 4LZOA 2BL4A 2PS0A 2W5UA 2O8FA 1QPBA 2J0QA 3A9TA 4L5YA 1IONA 3P9PA 1AXGA 1NY5A 3MA0A 4DSNA 3PTAA 1X9GA 4RLSA 4RQUA 4WK6A 1MX1A 5AXBA 3E8XA 2ISQA 4IHQA 4MIOA 5GONA 4ARAA 3EDQA 4CKXA 5LQCA 3ANNA 3D3EA 2KSQA 3OU7A 1W4AA 5BN4A 1U9CA 5HS4A 1ISPA 1XF1A 2VNAA 3VYRB 2X1MA 2DY1A 5TPZA 1UZLA 3MSCA 4EPRA 5HYVA 3S2GA 2DSTA 5LKRA 2CSXA 4ZRMA 3IQDB 3PK0A 2DG2A 2J3JA 4IJUA 2ZJBA 2IS6A 2FWAA 2M1ZA 4LYAA 3M2TA 2BEVA 3FHCB 4HNRA 4QXPA 4WBXC 5T67A 2JJ1A 4YY3B 4BFUA 3ZWXA 3AY3A 1DAPA 3FROA 4NZNA 4Q1BA 5FTWA 2RHLA 1G3RA 2C98A 1Y9DA 3OCZA 4EG3A 1CQWA 2ZXFA 3AL3A 4RM2A 4RPHA 3UB2A 4FFRA 5F5NA 5CEEA 4GI5A 2Q07A 2ZPTX 1Z9BA 4CVNA 2PRZA 2YS6A 2C8LA 2EG5A 2Y76A 1KOJA 2ZB8A 1IJFA 3AU9A 2VHZA 3P2IA 4FZRA 4YJ3F 2M6KA 4KR7A 4YFYA 2C83A 4A2WA 2BGGA 5DM4A 3WSTA 2DR0A 4P83A 2AUMA 1A1VA 1DG3A 3VHLB 3OMLA 1BKYA 2VRNA 3NOXA 4L8WB 3H5VA 4TM7A 3TM4A 1D6NA 4FZVA 4DT1B 3LFHA 1RW4A 4O2AA 3F6BX 1P2DA 1B2LA 1YONA 1AK1A 4ZAYA 3GL9A 3V32A 4BFXA 4CM5A 5JQGA 3DFIA 1X3LA 4Y67A 3DGFC 2RB4A 1TIPA 1HQCA 1ADYA 3GWZA 2JLXA 4WE3A 2YL2A 3I2IA 3RIYA 3PUHA 3CX7A 3GEIA 1Q0RA 3CF4G 5JSZB 5H7XA 3RS8A 5JJBA 1BU5A 1J5XA 1DJQA 2OBMA 2BKXA 2VHEA 2XE7A 5JBQA 3WDLA 1GPLA 2RBGA 4MWSA 4A10A 3QK7A 4Q3BA 2IEGA 2ZP1A 1WZCA 2FSGA 3TCKA 4OA5A 3R3ZA 1XWIA 2CMGA 5DWVA 4LGVA 3QYPA 5M7EA 4CT0A 1L5NA 1RBQA 4UASA 2PT6A 1FQWA 4ZO6A 3I61A 1YAHA 4CQNA 4C7KA 5EQFA 3BJMA 5KNDD 1MHPA 1R0YA 3UA4A 4QOIA 4QWMA 4TKVB 4CEJA 2UUAB 5JDCC 4NE2A 5DYIA 4I1PA 4B7CA 1YMQA 4WOBA 1XPJA 2ECFA 2OYRA 2XNSA 1H65A 3A6LA 4WK4B 4DY4A 1OAOC 1Q1QA 1TC2A 2E6KA 4JA0A 4WNAB 3ZZMA 2NVBA 1XFAA 2R6CA 3CRZA 3UN1A 2M2IA 3FTQA 4GMFA 4KV9A 4EG8A 2A9QA 2OZVA 2PVSA 3B51X 2JCBA 3KV3O 5D01A 1PRYA 4PG6A 3UJ8A 3R7NA 4HV4A 2JLZA 1HR0B 2HHAA 3P1JA 1SXQA 2P2NA 1J0XO 4JIMA 4M8NE 5DI3A 4QECA 4KAJA 1TJ4A 5FHRA 4FB5A 5C8YB 2BGJA 1JLRA 2YCBA 3KJFA 1NR7A 4AY2A 1CZRA 3NBKA 1AQ6A 5HIJA 3ZOKA 2AQKA 1JPJA 3X1KA 2MIIA 1CKEA 1Z6ZA 4J4TA 1HLFA 3JRXA 4AF7A 3TEMA 1EVQA 4FBGA 1FLNA 3WLPA 3H04A 5JO9A 4EAQA 1RCFA 4Y9UA 1W35A 3Q5GA 2P0YA 3EQ7A 3V8BA 2BJHA 4HDMA 2VSOA 4OLAA