2OESA

Msreca-native-ssb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
327
structure length
319
Chain Sequence
QAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 83
structure length 319
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2007-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oesA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oesA01
1TUEA 1G3MA 3W9YA 1T6NA 4XIGS 2JAQA 3C4JA 2F3TA 4F4IA 2ZRIA 1IONA 2IF2A 2WSSA 1S1CA 2P3SA 4Q47A 2BBSA 4LJAA 3JZAA 1VIYA 1XX6A 3QF4A 2ZRBA 2JLUA 3KKPA 1W1WA 2FZLA 2OLJA 4NU0A 4KFUA 1NMZA 1VCIA 3LA6A 5CJPA 2CNWD 4AKIA 2EVWX 2FPKA 2RCNA 3LV8A 3GLIB 4B32A 1Q57A 3PXGA 3TW8B 2W00A 2GEDA 1ZC4A 1AM4D 3SQXA 1Z6GA 4Q4HB 3SBDA 5AWFC 2XNSA 3GLGA 3JVUA 3TK1A 2YWHA 5LD2C 1E99A 4MDFA 1JNYA 2ZU6A 5D3MB 5BN3A 2CHVA 2QPOA 2CK3D 1F60A 3AF1A 1AK2A 2IYVA 2IYWA 3QEJA 1N5IA 3QIAA 1E1RD 1KAGA 3K70B 2ZRPA 2OFXA 1P2TA 1F5NA 1N6RA 1W49A 2B7BA 3NC1C 5AJVB 3DPUA 3U7HB 1E2LA 4JBWA 3C41J 3CNLA 1Z83A 4EFNA 3IIJA 2RKOA 5J4HA 3K0EA 1KI4A 4P4TA 1G7CA 2IUSA 3K1JA 3CH5A 1G18A 3MRSA 2VHCA 3PR1A 4DLZA 1VMAA 3H0KA 4MRNA 4F92B 1TNDA 2FSGA 3W3AA 4HUQA 3SN6A 1WF3A 3DVLA 1CJUC 4NHOA 1A1VA 4EJSB 1X3SA 1TADA 3TSOA 3T34A 4KLZA 1ZMXA 5JFGA 2GK6A 1QG4A 4LX0A 3D3QA 4WBSA 4GMXA 5FOWA 1XEXA 1ZVQA 2C9OA 4W9MC 1N5JA 3ZQ6A 5C18A 4M1YA 4P4SA 3VU9A 4GI7A 1MABB 4Q4JA 4WZAE 2ZVPX 3RSOA 3BOSA 2ZUDA 3UWOA 2GAAA 2BEJA 4JL5A 2VP4A 1G8FA 3NDBB 5JJLA 5HCNA 3W6OA 2AFIE 4P3YA 2ZPTX 4CT5A 2J59A 2BC9A 3ND8A 1MRNA 4XSGA 1GWNA 3REFA 2FFBA 1OXUA 4FXPA 2JASA 1XMIA 2ZJOA 3OAAD 3GJ4A 1R8SA 3RS5A 2ZR7A 421PA 3QXHA 3CZPA 5FPYA 1MOZA 1EFRD 2FH5B 2KB0A 1XEFA 5E7MA 3CBQA 1UAAA 4M0LA 1GNPA 4DB4A 4GPTA 1P9WA 3CX7A 3U6BA 4R98A 5J4YA 3DEFA 2X19A 1ZP6A 4K81B 3K0AB 3RLFA 3AVUA 1W2GA 3TRFA 1KDPA 2B7CA 3GLIA 2QBYB 1E0KA 3PQCA 3FMOB 3NXSA 4JLVA 1XRJA 3R9IA 3AVPA 3CRVA 4WA7A 2XX3A 2CVFA 3TW4A 1G7SA 4BFZA 3W6PA 1R4AA 1RYHA 5JHHB 3ASYA 4OK3A 2WHXA 1JPNA 3Q7PA 5D3MA 2BMFA 2FGKA 2HDNB 3PV0A 2BCGY 1U8AA 5EXPA 1OV4A 3MD0A 4C2TA 4NH0A 4KBGA 2WICA 1G9XA 2AD1A 3U5ZB 1NF3A 2Q6TA 3P1JA 2FWRA 1MR3F 2HLDA 2J9RA 1XJCA 3MUFA 1KY3A 1U0HC 2W2TA 3VHLB 4QNRA 1VCNA 1AKYA 1OYWA 4GNKA 4A92A 3Q3JB 3QPVA 1DO2A 4UNNA 1GAJA 1NVVQ 4RCZA 3NHBA 1QHGA 1YZGA 2AXPA 2WJJA 4IDOA 5TARA 2DCUA 2O8DB 3QPWA 2DPXA 3SZRA 1IJFA 5E7IA 3O8CA 2VF8A 4O3MA 1OFIA 1QF9A 3DHWC 4QBIA 3B7GA 4QBHA 2R6FA 4QBFA 3EC2A 3FTQA 1LV7A 4PC1A 4FCVA 2BEKA 2PH1A 3IO5A 1MABA 3EA0A 5JECA 4UXHA 1U8ZA 1G1MA 2Z6VA 2HT1A 2NTYC 1ZBDA 3KDSE 2JLWA 4PHHA 4JKYA 3G82C 1XCGB 4GP6A 1KY2A 4B71A 1FTSA 2QE7D 2W6ID 2CNWA 1GDDA 2KE5A 3C14C 3BC1A 3SJCA 4N0EA 3P27A 4ERNA 2NO6A 2EU8A 3ZVRA 5DN6A 4RCYA 3V4RA 2NPIA 3N70A 4JKIA 1E9CA 1GRNA 1EFHA 2WKQA 4DC9A 1L4UA 1M34E 2EYUA 3TMKA 2ZI4A 2OHFA 1GKYA 3M1IA 3AM1A 3K0AA 1J2JA 1TX4B 1WBDA 4QHSA 3ICQB 4DJTA 2CK3A 3K8YA 3A1UA 3MWLA 2WVJA 4JVMA 2A7QA 1RC8A 1GIAA 1XTIA 2DFLA 3MCAA 1A5TA 3ONWA 4KXFB 4EPWA 5CDFA 2V3CC 2YZ2A 2FE4A 4D4MA 2GEUA 2FPLA 1CR1A 1TU4A 3LLUA 4JYBA 1DS6A 2CE7A 1ZD8A 2CMKA 3B13B 2MSEB 4V0LA 3KUCA 1CKEA 3SNHA 4JLDA 3F0TA 1GG2A 2V1XA 4UNPA 2SHKA 1CULC 2I4IA 1LVGA 5FOSA 1U81A 2F9MA 2WAXA 2V7QD 2N1BA 4OQLA 1DEKA 3WBKA 1OT3A 4IRUB 4N1AA 5J4VA 1GITA 2ZYTX 1XJQA 3QVVA 3KQKA 2ZTSA 2JJ2A 2ZYWX 4V0ME 3FWYA 4OJKA 5JJIA 1KI8A 3VKWA 1XTRA 2PX0A 4EKDA 1Z5ZA 4II7A 5J4KA 5FI0B 1P2VA 1DADA 2C2HA 4D4LA 1DAEA 4LBWA 1CBUA 5B64A 3EXAA 1IOZA 2VP6A 2C8VA 4BLTA 4FI3C 4MRPA 4Q00A 5F98A 2ODEA 3TAUA 1HQYE 2ZSDA 3L43A 4G5RA 4ZKEA 2ZU0C 2ORIA 4DUGA 4B44A 2ZXUA 1H8EA 2JDID 4MQBA 4Q4AB 1R0XA 1N6OA 3HU2A 4EPTA 1G3RA 3SEAA 4HEJA 3QBVA 2F9LA 2QPAA 4KJZA 1SQ5A 2J45A 1G8PA 1U9IA 4LBYA 4W5HA 1R0ZA 1FNNA 4M1OA 3TUJC 4TYPA 1TU3A 4RD6A 5HZHA 3SR0A 4IW3B 2GVDC 1FFHA 4UKDA 4D6PA 4TQAA 5EXTA 3U7GA 3CWZA 3CRRA 4RZ2A 5F3WB 3AVQA 4ACAA 1OIXA 5CITA 2IYTA 2ZJZA 1AZSC 2VF7A 3BB3A 1JI0A 2CHGA 4FMDB 3GEHA 4AKEA 3AKCA 2D7DA 1LF0A 1GVNB 1OE0A 1ANKA 3KJEA 4DLYA 1AS3A 1DVRA 2EFGA 5FL3A 2XZOA 1HA3A 2IUTA 1LNZA 2OFWA 1UFQA 1OHHD 2YOFA 5LB4A 2IS6A 3GLHE 1JEEA 1Q44A 3VHXA 3FFBA 1IN8A 4PQFA 5EE3A 2G88A 5AK0A 2GCPA 1OFUX 5KYKA 5E7JA 2RH5A 2QTVB 3P32A 1J7KA 2IHBA 2ZE6A 1R5BA 3AB3A 4KI0A 2GTPA 4LV6A 1XNJA 5IDVA 2FEOA 4B3DA 3BORA 5HKKA 5HZKA 5LPNA 2OCYC 4EPYA 1MRSA 5AJXA 2DWQA 2PZGA 2IT1A 3H4MA 1XJ0A 5EE5B 2QU8A 1R5OA 2PCJA 1GNQA 4JL6A 5HPYB 1VPLA 4GFDA 3HPQA 1N5KA 4OHXA 4DLTA 1YZKA 2BMEA 3I5YA 3M6AA 3BH7A 4Q9HA 2W58A 2O8CB 5FPKA 3U3RA 4LYJA 1UBGA 2E1RA 5GJWC 1QHSA 1W0JD 3BWDD 2WJGA 2VLIA 2D7CA 2EFEB 1QG2A 2FN4A 1ZU4A 5TB5A 1LS1A 3GLGE 2OILA 1AA9A 4V03A 2PJRA 1SVLA 3NBXX 2RGGA 5KPDA 1M7HA 3W8RA 1IXZA 4IVQA 4BFTA 2ZJYA 3TQCA 1NVUQ 1T8TA 1UKYA 1PUJA 1Q22A 2B8TA 3I8XA 4C4PA 1SHKA 1UEJA 1G5PA 3MMPA 3VMFA 3THWA 2J7PD 1IQPA 1IXSB 3CNNA 1NN0A 1G4UR 3CIOA 1BYIA 2ZE7A 5H8WA 5FTJA 5C2JB 1G17A 2EFCB 4JLOA 5KSOA 4IOJA 2OBLA 1L8QA 1Q20A 2ZVQX 4MYTA 4DDUA 2QQEA 4TYNA 4ACBA 3QXSA 4ZKDA 5JSZB 3B85A 4TLBA 3A37A 4ASUD 2GWHA 1G5TA 4D2IA 2WWYA 2REXB 5J4LA 4C0QC 3CPJB 4PC7A 3TIFA 2VIIA 4BECA 3WYGA 3K70C 3ZJYA 3MSXA 2HXYA 2WWIA 3FPAA 4XD7D 4HATA 3PJRA 3TGPA 2R6CA 3GEEA 1G7TA 4D80A 2QMEA 4PQYA 1L2TA 2HF8A 2BM1A 1G5RA 1VYVA 3GFPA 1E2MA 2NG1A 3HU1A 3O8BA 1XWIA 4URZR 4XSHA 4EJSC 1FUUA 1E9DA 4TMWA 4A36A 1CR4A 2YWGA 4A0GA 1G6OA 1N0UA 4K8OA 3E5HA 4JJZA 2FSHA 3AVYA 1D8TA 3BFVA 1ZM2A 3IKJA 2JDIA 3LQRA 3GLIE 2O8CA 2F43A 1RJ9B 2HJGA 4LWZA 2CCKA 4Q1DA 1PLLA 4FN5A 4LK2A 4NCKA 1E9EA 5CB6A 3JZMA 5L3QB 1J99A 3B1WA 3AF3A 1OH7A 1KSGA 1RVDA 4JVSB 2JLZA 3NH6A 3AP1A 2XXAA 2XOKD 1E2JA 2X2EA 3LXXA 4HB3A 2CXXA 3KFXA 4DCSA 4DLUA 4B48A 2BJWA 2ZRCA 3SYKA 1KK2A 2C5LA 3RC8A 4AG6A 3ZZUA 5BWMA 1XD2A 2X2FA 4BASA 4DT1A 2KJQA 5FPSA 2QMOA 1YZTA 1VG9B 2VHJA 4FWIB 4PXAA 2MMCA 4Q1EA 4EPXA 4Q7LA 2OBMA 121PA 2YJTD 1RRCA 1CJKC 4EUNA 1S3GA 5A4JA 3NBYC 4R7ZA 1NIPA 2D4HA 3GJ0A 1OH6A 4DEYA 3C8UA 4BFYA 2J3EA 5F9FA 4KYIB 4QHYA 1F2TA 3LY5A 2HUPA 2HF9A 4HAYA 5AJYA 1TF7A 4KAXA 4MGKR 4YMSA 3EARA 5JSZA 3WNCA 3RRYA 4G1UC 4IXNA 2WSSD 3LAWA 3QF7A 2QP4A 4Q9IA 4QM7A 1T0JB 1F3OA 1HEIA 4GMDA 2CJWB 3NG1A 5ANRB 4OI0A 5GJBA 2OZEA 2OCBA 2F3RA 3QXCA 3BS4A 4B3FX 1Q3TA 3C5CA 1IN7A 2BVNA 4URXR 5JI2E 1SHZA 2IHYA 5FUVA 4W5JA 4AYXA 4MKIA 2REBA 1LW7A 1QHIA 5TVKA 3UK6A 5B58C 721PA 3LX8A 1FNMA 2GZAA 3EZ7A 1KK3A 2EQBA 2FMXA 2NO9A 521PA 1KNQA 4A15A 4A2WA 2Z0MA 5K8UA 1S8FA 2W6JD 2D06A 4B47A 3OE7D 4ON9A 3I62A 4E22A 1DBSA 1E69A 1W0JA 1EG7A 2K5UA 4PO1A 2FPMA 1UKZA 4WZBE 1PZNA 4HAWA 1Z0AA 3SFVA 2F1IA 3VKHA 3VR5A 1Z63A 2NOAA 4XJXA 5BQ5A 1LS6A 4C7OB 4BPBA 1KDTA 5KOYA 4YC7A 1AGRA 1GRRA 4KO8A 3GJ8A 2B8WA 1RJ9A 3B5JA 3E70C 3OEED 5CDFE 3A8TA 1KZGB 3NBFA 4KBFA 4TTPA 4DXAA 1MV5A 4IVRA 1II8B 1ZJ6A 2FV8A 5L3QA 1Z0FA 1YVDA 2XSZA 3LNCA 3N2EA 4WW0A 4L15A 3CW2A 3TNFA 4MYHA 4M2LA 4OI1A 4FIDA 3OZXA 2J87A 2V8OA 4X8OA 3EPLA 3B9QA 1N6IA 4JLPA 2ZRMA 2IUUA 1TQ6A 4AWXA 1DAHA 3IEUA 4PAQA 4LPKA 3C7KA 1QDEA 2IXFA 4LOAA 2ZAOA 1T3SA 2A3RA 1Z22A 1S2MA 2PX3A 2AX4A 4R9UC 4ZDKA 1EK0A 4PHFA 2Q9AA 1Q1ZA 4LY6A 1P4SA 2AWNA 1OW3B 2KSQA 3I72A 5DI9A 3UG6A 3CH4B 4O2LA 3FMIA 4Q9LA 4XD7A 4HLQB 4PO9A 4BQSA 3GJ6A 4V0MA 4IJMA 4KCGA 3AUYA 4LC1A 1T3HA 4Y0AA 1KI3A 3AVXA 2OUKA 3IO3A 4UNSA 2BJVA 3PEYA 3A4MA 4WVFA 4KFRA 5DYIA 4D0GA 2CJWA 2W2VA 1ESMA 2OCAA 1L4YA 4O2RA 4DDVA 5KUTA 3IDQA 1ZC3A 3H84A 1OJLA 1DAKA 4LV8B 5DYGA 1R2QA 4PAMA 1II9A 3PCRB 1X1RA 2AWOA 3VX3A 4D0LB 4NYJR 3RWMB 2ZSFA 2J0QA 8OHMA 3IILA 2VBCA 5DI3B 4TMVA 2GESA 1SVMA 4CRWB 4C9BA 3KKMA 3RRNA 4Q1FA 4ILEA 4QJ3A 2ORWA 3PFIA 1Z2AA 5DGXA 5AUNB 4CEJB 5LB2A 1EX7A 4B43A 4F4CA 2CLSA 2R8RA 2YHSA 4TL7A 3K70D 4FD2A 2QTFA 4XVQA 3SJAA 4F93B 1NKSA 2ZJAA 3MGCA 2IK8A 1XDBA 2HLDD 1CR0A 2OO7A 3LBIA 5FTLA 1ZYUA 3T1TA 4QGFA 4PPQA 1XEXB 1E1QD 1VG8A 4MH0R 3H1TA 4RY2A 2XTMA 3LBNA 2YINC 3EIQA 2WIAA 3K9LA 5CYOA 3MWKA 4URUR 5E95A 4BWYA 2FNAA 4QOSA 3R7WB 1RW4A 1P2UA 1ZM7A 2F1JA 1KNXA 2H18A 2QMUA 3ZYCA 2O0JA 1E2DA 5JZVA 1XTQA 3EZ9A 821PA 3RNLA 4BUJA 3KX2A 4RZUA 5DLQC 5KSYA 3LVQE 2IS1A 1XB2A 3B8HA 1WQ1R 4TN1A 4Z8XA 3KB2A 4DVGA 1VKJA 2A5YB 1LTQA 1KAOA 1HV8A 1KI1A 1K5GA 1EFTA 2FGJA 2PEZA 1DG3A 1Q1BA 4HAXA 2OBNA 1WRBA 4I1VA 4YMWA 1KSJA 4Q03A 3AVVA 4NMMA 2ZRGA 221PA 1BOFA 1NBMA 5DN6D 1W7AA 2W6JA 1NI3A 3OE7A 2G3YA 2WIBA 2OAP1 2RGNC 4DCVA 2Z83A 3BXZA 2VSOA 3BAFA 2BHRA 5AJWA 5BN5A 1C1YA 1GKUB 4KHZA 3A1SA 3TVDA 2A30A 2JLYA 1U94A 4TMTA 5CLQA 3UIEA 4D26A 1GFIA 1E2GA 1XD9A 2DFTA 2WJYA 2QP3A 3BE4A 5AUQA 5DI3A 2XB2A 1Z6AA 2HEIA 4LPSA 1BKDR 2G1KA 2JIZA 3BK7A 3OEEA 5KDOA 2Q0HA 4E07A 1MT0A 2WKRA 4B6EA 2IYYA 4BFXA 3AGPA 1NRJB 4X8MA 4M1SA 5FTNA 4CEJA 4Z51A 2OLKA 4EPVA 1RZ3A 5D3QA 1RKBA 3R8CA 1W4AA 4PTLA 3ND9A 4LJYA 3LO5A 1KDOA 2QG6A 3GPLA 2JJ2D 4DEXA 1DG1G 4C0JA 1RRPA 3BB1A 2UZ3A 5KNBA 3UATA 1CJTC 4A9AA 1VCMA 5IRCD 3GEIA 3CR8A 2G77B 4U02A 5TV2A 3J81k 4LHYA 4M9ZA 4RD4A 4WIAA 4OQNA 5LBIA 1CJVC 2ODBA 4NZYA 2ODWA 2C78A 3R7WA 1YZUA 3TSZA 4I1SA 4OHVA 4RZ3A 1N6HA 2JLVA 4DCUA 4LBVA 4DUGD 5CLLA 3WMFA 4E5UA 1H8ED 3BD9A 2LWIA 2J46A 4M1KA 1UDWA 3DZDA 4QKQA 4CVNA 1N6LA 4F91B 4XH9B 4D25A 4LHXA 5A5GA 3NTUA 3VR2A 3LW7A 3X1YA 1JB1A 1KYIA 4RD1A 3CB4A 3SJZA 3T1QA 3THXA 1ELOA 2QENA 2PJZA 3NVAA 3SDZA 1DPFA 3WNBA 4A2PA 4DDWA 3NDPA 1HYQA 5CIQA 1A2BA 3PUZA 1KOFA 1V5WA 4B33A 2A5GA 2BMJA 4JJKA 2MMGA 2TMKA 1HUQA 2IXGA 1S96A 4YMUA 1KK1A 4GOJA 3WYAA 2ATXA 2OT3B 1OLOA 2JLRA 5FI1B 3ZIAA 1FL9A 2QAGA 3T12A 3LQQA 1E79A 3SE0A 1FPMA 4NBSA 2WSMA 1KJWA 1XMSA 2GF9A 2ZSAA 4C0HA 4JSTA 1QVAA 1T4GA 2J41A 2ZROA 1ZIOA 4JYCA 2V55B 4QGAA 4G01B 4X8LA 5JRZA 2ZEJA 1KO7A 1SVKA 2CHQA 5AUPB 1DELA 2EWVA 1E1QA 5HKKD 4BFVA 3CPHA 2JA1A 1VCOA 2R65A 2GKSA 3LBHA 3SU8A 3DO6A 3GP8A 1TUIA 1CEEA 4LJ5A 2ZAMA 4PX9A 3V00A 2DB3A 1TEVA 5KDDA 4HLUA 3D7MA 4M53A 1JQLB 3KKNA 3L2OB 1AN0A 3GLFE 4Q1AA 1N3BA 2GXAA 1N2CE 4NYIR 4OHWA 1Z28A 1T8UA 4PANA 4DLVA 4JLKA 4MGYR 1ZUNB 4TYWA 1O3YA 2BOVA 2ZE8A 4NDZA 2GBLA 2IA5A 2BKUA 3EA5A 2ZRFA 2H92A 2R9VA 4URWR 1QRAA 1WDTA 2VA8A 1KZ7B 3HPRA 2QORA 2ERYA 2PL3A 3AGQA 1YR9A 3PEUA 2O8BA 4PC3A 2ORVA 1Z2CA 4MA4A 1OFTA 4EQ6B 5JBQA 3I32A 5B57C 2Q21A 1FOEB 3PIRA 4PPFA 2YC4C 2CL6X 4S2EA 4XWKA 4G5OA 4US0R 1SVWA 1SVSA 3HYRA 5HTKA 4AG5A 4V0KA 4ZCIA 2FDCA 2IYZA 3ZS9A 2BMDA 1E3MA 4TZ6A 5KDLA 2RGBA 1U0JA 5FTMA 1Z06A 4QJ5A 4PHGA 1FMJA 4V0NA 2EWWA 2LKCA 3CNOA 4LCBA 4P32A 2FZ4A 2QPTA 2V9PA 2FA9A 3FHCB 2A9KA 3IUYA 3QEOA 4LJ9A 4US1R 4JBXA 3K0FB 3WRXC 6Q21A 1PV4A 1K8RA 3KXLA 4DLSA 1E98A 4KVAA 2ZYVX 1OB2A 2G0NA 4JVLA 4I4LA 2FU5C 1VHTA 2WWXA 4OBEA 2BCJQ 4XVRA 4YONB 2WAYA 5DHFA 3W90A 4OYHA 1GTVA 1ZW6A 1CXZA 4D82A 4DIEA 4Z1MD 1ZNXA 3ZZ0A 3AF0A 1C4OA 1NG9A 2VP5A 1NIJA 4IDQA 2Z43A 3B2EA 1E9FA 4YQFA 2W2XA 4UXIA 3FKQA 3GFTA 1NLYA 2LCFA 2QAJA 4C30A 3SHFA 1ONBA 3VR6A 4YXWA 1OFHA 2XJ4A 4Q1CA 5J40A 4LV5B 2ZRJA 1U0LA 1VECA 1G41A 4LUCA 3ECCA 1Z6TA 3K0CA 1ZUHA 5DSZA 3ETLA 4JMPA 1JEDA 3L0IB 3CONA 3EG5A 2ZRNA 5KSZA 2V6IA 4DZZA 1TQDA 2PT5A 3GQBA 4MRRA 3IPYA 1TQ2A 3BB4A 1CLUA 3R8FA 3THWB 1YZLA 3NEYA 3HR7A 2BM0A 4C0AC 4UXJA 4TLAA 5FR1A 5G40A 1CIPA 4H1UA 3B1ZA 4HAVA 4M21A 4TTQA 1X8LA 2O52A 4A6XA 2WPDA 2QN6A 1F6BA 5HE9A 4LJ8A 3O8RA 4LSGA 2IBMA 2XZPA 3O47A 4EQ6A 2ZSEA 1MO3A 4U7DA 5EE9A 4YMVA 1LY1A 3RAPR 4URYR 1JXMA 3B1XA 5BYJA 4PO8A 2C9YA 4PR0A 1WXQA 2VHUA 3PEVA 5JWHA 4D81A 1A4RA 1RPZA 1U2RA 1TL7C 4DIDA 4F4JA 1JR3E 3A6PC 5EE0A 3EPHA 2YOHA 5JWOA 2IS4A 2IYRA 4RVCA 1FZQA 4XTCS 1NKTA 1Y3AA 4F7WA 2ZS7A 3Q85A 3TSWA 2Q3HA 1YZNA 3K0FA 5FPHA 1AGPA 2N42A 4MRSA 2VYFA 2NZ8A 3RSLA 2FX3A 4K46A 3GJ7A 4GZLA 5SZKB 1TMKA 4L16A 2FG5A 1K6MA 1KSHA 2ANBA 4Q66C 2GZDA 4RZXA 1T5IA 1Z0JA 5TXGA 4IOMA 1R8QA 3QG5A 3VR4A 1UBEA 1CP2A 2R6GA 2IWHA 4QM6A 5CIWA 4ZI3A 2VSXA 2F43B 3PUYA 4URVR 2Q9CA 1NBME 2WM9B 1P7CA 4LBZA 5H68A 4A8JA 1NP6A 4A6PA 4OQFA 1QBKC 2XXAB 2QSYA 4G5GA 2YC2C 2GK7A 4WXRA 5JS8A 4DBLC 2GCOA 2DBYA 3V4FA 3VNUA 1N6KA 4PPGA 3ZVLA 3TJZA 1ZUIA 2ZJ2A 3KJIA 1E0SA 3AP2A 4ESVA 1G291 4A1FA 4CIDA 3TKLA 3CX8A 1D2EA 1XD2B 3A36A 1QZXA 4M9XA 4DT1B 5L3SB 4BRWA 1U90A 2XSZD 4TT3D 3TQFA 1AS0A 4JS0A 2AL7A 4B74A 1DAIA 1PLJA 5KNDA 1HTWA 1GKIA 1C9KA 5DO9A 3TUIC 3W6NA 4IFEA 1VIAA 2Z4RA 2O8EB 1N5LA 2ZS8A 3D6TB 1F2TB 1YQTA 3X2SA 4IOLA 4XWOA 1Q1EA 2QAGC 4Q7MB 2H5EA 1E2EA 2J5XA 2IXEA 2OCPA 2ONJA 1XPUA 3L0PA 1ZCBA 4P4UA 1ESNA 3RHFA 3FMFA 2PMDA 1LF5A 5F2EA 4BFUA 2PZFA 3MFYA 1G4AE 1NMXA 1B23P 3ADCA 4NONA 4NYJQ 3GMTA 4ZDWA 4DCTA 4HLDA 2G83A 1MO5A 1AA3A 3EWAA 1MO6A 1NLZA 3MWYW 3CPEA 2AFHE 4O25A 4EPRA 1GZSA 2VHQA 2VH5R 2ZRLA 2CL7X 3RS0A 4TZ0A 2NMVA 4I1UA 4HAZA 4ABYA 1YRBA 3BIFA 5FL7D 3GLFB 3KZ1E 1IN6A 4IOKA 3RABA 4A2QA 4Z1MA 5EJEA 2YKGA 5GJCA 2AR7A 2VP0A 2ZI6A 2IL1A 4U00A 5KU1A 2BKEA 3BH6A 2O0HA 1OXTA 1VDZA 4EDHA 1RRFA 2DWOA 4B2PA 2GETA 4N0DA 4HLUC 3PUXA 3T1OA 3P20A 2NO1A 5GVRA 3CRW1 3KQUA 3ADKA 3B9PA 4FCTA 1I2DA 4PAOA 3EZ6A 4Q18A 2OXRA 4LC0A 4AC9A 1EXMA 2DWPA 4CZ2A 4RJLA 5A0FA 4QG7A 3U7EB 4MGZR 2GBLC 1E4VA 4B2LA 4R2IA 1FP7A 2I1VB 2PMKA 3K09A 3BRWD 3KKOA 4BFWA 1EFCA 3PEWA 4PSKA 1LFDB 2AK3A 4HDCA 5EE1A 4YLGA 3U2QA 1SULA 4Z54A 1P61B 4MKGA 3UPUA 2EFDB 2VPPA 1NLFA 2V1UA 1E2HA 3CRMA 3A4LA 1E9RA 4F38A 5BN4A 1E96A 1WCV1 2W0SA 1P60A 2C96A 3M0EA 5L3SA 2BWJA 2G0TA 1JPJA 4AIIA 4C0LA 4HB2A 2GJSA 5CB8A 3LFUA 2P5SA 4L8GA 3CUEF 1T3LA 2GEVA 1I4TD 5FTKA 2QL6A 1SVIA 3VX4A 3LW8A 4ZDIA 3S1AB 1NN1A 3L8YA 1NNEA 5KPJA 2ZSBA 2QT0A 1JR3D 2O8EA 2HT6A 3SS8A 4TMKA 1KJYA 2XJ9A 2H7VA 1TTTA 1ZIPA 2FF7A 1Z07A 1FW6A 2OV2A 2DY1A 2C98A 3W5JA 1ZCAA 3AQ4A 3IGFA 1KI9A 1FUKA 1AKEA 3OF5A 5JEDA 1CS4C 2FFQA 5HE8A 2DHRA 1NN5A 4Q4LA 3A58B 1Z8FA 3K9HA 5J47A 3WMGA 1HURA 1XBTA 4A0HA 1A2KC 4M9QA 2QEQA 2V4ZA 1DOAA 5CM9C 3ADDA 4HDOB 1KO5A 4LI0A 3NWJA 1YKSA 3DM5A 4A0FA 1NBMD 4LYHA 1XU4A 3K9NA 5EUQB 4ZPXA 2PLFA 3GLFA 1KHTA 2IYUA 1JXOA 4IDHA 2C03A 2CLCX 2ZRKA 4JLJA 3SQWA 3DOEA 2IX3A 3K0SA 2P6RA 2XNDA 3B1VA 3AV0B 3DZ8A 4QC2A 3I4LA 3FGNA 3HWSA 5JI3E 3K0CC 3BERA 1W5SA 5EXXA 2YNMA 3CF2A 5FR2A 1NVWQ 2OFOA 1VTKA 1U9IC 3RVBA 5CM8B 5GVSA 3IHWA 1Z0KA 1AZTA 1G3UA 2JIZD 2ZYUX 3B78A 4NCHA 2IF0A 3AEZA 1W48A 1LB1B 3OIWA 4OI2A 3ZGXA 3QQ5A 5JEEA 4TT3A 1XXHB 4FMCB 1O87A 3LXRA 4BLSA 4JT4A 1H8HA 2PZEA 4GT1A 2NGRA 3HU3A 4RD0A 4B76A 2HCJB 4ARZB 3AVWA 4NYMR 2BBTA 4L5BA 3AH8A 4QJ4A 2O0KA 3TUZC 5P21A 3OEHD 4ZV4A 1ZAKA 5JHGB 4AI6A 3EZ2A 1KSFX 3LWNA 4GBMA 1UDXA 1R7RA 4B34A 3LH5A 3CLVA 4BZPA 1YE8A 3K53A 4TL9A 2ZRDA 4POAA 4FINA 3RANA 1UM8A 3IHLA 4OHYA 1HH4A 2XTZA 2XTNA 3S1AA 2QQ0A 3T15A 3WHLA 4XTRA 5BYKA 4GOXA 2RGCA 3QXXA 1SXJE 5IK2D 1N6NA 5J5CA 3WYFA 4JBYA 2J0UB 4DLXA 1RRGA 3OFND 2QTHA 4P31A 4HZUB 3PITA 3L82B 3TH5A 2BDTA 1JAHA 1E9BA 2W0MA 5G3YA 3RWOA 3MAAC 5FL7A 3REGA 2KI5A 3NC0C 1OSNA 1S3SA 2FJUA 1DAFA 1E2IA 2VEDA 3SYNA 4TQ9A 1YR6A 1G8GA 1UPTA 1YHNA 4BLOA 2QM8A 4NCNA 4GZMA 3AKDA 4JLNA 4UNQA 4PC6A 1G19A 1R10A 1Z0IA 4RFSB 1GL6A 2CLDX 1J90A 1R5NA 1BMFA 3CF0A 4JSYA 2MSCB 4HUTA 4Z8YA 4A8JC 3L0SA 3Q8XB 4AYWA 4EFLA 1Y63A 4PZZA 3GCGA 3FFAA 2OESA 2IYSA 4H1VA 4JL8A 4KFTA 1AQYA 4A82A 5K8TA 2ZJBA 3QE0A 3ZIAD 2ZE5A 1JJ7A 4BE7B 1W0KD 4OI4A 1P9NA 4DLWA 2ONKA 2EW1A 4RKFA 1E79D 5UKDA 5CYPA 3THOA 3EZFA 1NJFA 1PVOA 4L4UA 4TLDA 3QY0A 4QXAA 4LJ4A 1G8YA 3VFDA 4AK9A 4DSTA 1P2SA 2ZREA 4NYIQ 3BBPA 1OXVA 4TTRA 2DFNA 3SBEA 3I92A 2WJHA 2ZQ5A 1XXHA 1ZD1A 2DFKB 4TMZA 1P73A 1DAMA 1E2FA 1ZD9A 2GXUA 3CKLA 3PVSA 4ARZA 2FFHA 4O0MA 1A7JA 1N25A 1XEWX 1NN3A 2ASEA 4P33A 2QRNA 4S35A 4U5XA 1JR3A 3ZD7A 2ZANA 2E87A 4KODA 3OIUA 2UKDA 4Q48A 1VYUA 3OIYA 4GDFA 2P5TB 1IM2A 3IIMA 2OG2A 1W2HA 3LX5A 3UMSA 4E09A 1X1SA 4NCIA 2BBOA 3CRQA 2VHTA 3ICEA 5EP4A 3GJXC 1PJRA 1RIFA 2H57A 1N6PA 1X8JA 3THXB 1J8MF 1S4QA 3H86A 1XD8A 1XFAA 4GL2A 2NPFA 1FTNA 2CE2X 3GFOA 2W83A 1U98A 3QKRB 3U6KA 4UQOA 4BLQA 3U4QA 2J0UA 1A82A 1QHHB 4QHTA 4TMXA 4HZUA 2NIPA 3U3MA 1UBFA 2GZHA 3WNDA 5CK4A 2XAUA 3KFVA 1NY6A 1QHYA 1Z47A 1US8A 1JR6A 2IC5A 3M4YA 2BBWA 1AIPA 3IQWA 3ZZTA 1S9DA 1YR7A 5EP1A 2N46A 1DO0A 1BO6A 4LGMA 2QMHA 2QAGB 4KYUA 1WB9A 1KIMA 3QSYA 3IIKA 1DE0A 3DKVA 3TE6A 2ZUBA 3R9WA 3Q5EA 1Z29A 4RFSA 5EZ6B 2JJ8A 5DHAA 1M1YE 1E2PA 2HYIC 2IYXA 1G64A 4UJ5A 1VG0B 5ELXA 1XMVA 3AKEA 2WZQA 2ZRHA 3K09C 3NKVA 4ZIRA 2GDJA 1HY3A 1JBKA 1KMHA 3U60B 2GXQA 2A5FA 1GILA 3U3OA 1XTKA 3P4XA 1P62B 2ZETA 1OIVA 4MGIR 5C4GB 4EFMA 3VTKA 1CR2A 1HT1E 1YRAA 1W36D 1FQKA 2BV3A 3TR5A 1FP6A 1CU1A 1MH1A 4KSBA 3OEHA 3TAHA 3FOZA 5F9HA 5FFMA 1KK0A 4YDSA 1SKQA 2VTKA 4FWTA 3EX7C 3I1FA 3UKDA 1JALA 4LDJA 4M8NE 4AKGA 5CK5A 1Z6XA 1G16A 2WWGA 3OESA 1SXJD 2J7KA 4ZO4A 1E2NA 4YXWD 4FCWA 4BGDA 4NCJA 3SOPA 2GXSA 3B1YA 5IK2A 3QJYA 5EQTA 1H65A 2AKAB 3ASZA 4QL3A 3OFNA 1JJVA 2IEZA 3AF2A 5AR1A 1D2NA 3LVRE 4B75A 2O8BB 5FOTA 4US2R 3X1ZA 5G41A 4TWZA 2RHMA 1COWD 3DMDA 1W44A 3NHAA 2NZJA 4LJ6A 5G3ZA 2ZI3A 2AKYA 3QKRA 4CT4B 4DSNA 3IPXA 1QHHA 2WJIA 5FOXA 1M7GA 1TEXA 4IHQA 1GP2A 2C99A 1II0A 1E0AA 5L3VA 1GOTA 3DM9B 2C9CA 2WPDD 1G7RA 4WXPA 4MDEA 2Q3FA 2AHOA 2JLSA 3X1DA 2GJ8A 2WWFA 4C2UA 4DSUA 1W0KA 2RHDA 4GOKA 3U44B 4LZZA 4TLCA 2F7SA 2IEYA 3T1VA 2D74A 2ZI9A 2HXSA 4LHWA 3D8BA 4OKSA 1X8KA 2JJ1A 5CJ2A 1TF2A 1W36B 4TL8A 4QGGA 4Q7KA 621PA 3NH9A 3I3SR 3I61A 5DNYB 1DAGA 3Q7QA 1CJMA 3RS4A 4Q4HA 1IHUA 4TL6A 1N0WA 2RMKA 3IBYA 4Q01A 4IFBA 1UADA 3ZD6A 1WMSA 2OM2A 1KDRA 2OXCA 3H2YA 1SXJB 5K8LA 1RYFA 3WY9A 3PENA 1YJ5A 1SZPA 5FH9A 2DYKA 3QXJA 3OHMA 4GRAA 5FUXA 4FW9A 3WMEA 4BEBA 3U61B 1ZINA 3IEVA 4CEHB 2WOJA 1BS1A 1CTQA 4PC2A 1Z3IX 2WJVA 3T35A 4G3XA 2AXNA 3ADBA 4UJ3A 1ZM4A 2X8AA 1XEWY 5KO2A 4DDTA 1YU9A 4Q7JB 2ZR9A 3LD9A 3PUWA 4HB0A 1KTVA 3CZQA 4EJSA 4L9WA 4KSCA 3DL0A 2ZR0A 1M6NA 4MKHA 2IYLD 2ZUCA 4NKRA 1NL3A 2CEAA 1ZNYA 1E2QA 4YDHB 1SKYB 2Z5FA 3I5XA 3TR0A 3QKTA 1P72A 4RKEA 2JCSA 3EIEA 4Q19A 5FPTA 2VSFA 1IN5A 2B92A 4KVGA 2R2AA 1I4LD 4PZYA 1BIFA 1X86B 4JZKA 4QFMA 5H1YA 4V0OA 3GJ3A 5FBQB 3RS2A 1TQ4A 3CWQA 3U44A 1CF4A 3MJRA 3F8TA 4PSAA 1E32A 1WE2A 2EYQA 1D9ZA 3AVOA 2ZJ8A 3KJHA 3SFZA 5AUOB 3ZVMA 5KHOC 1ZNZA 4ESHA 2P6UA 2CVHA 4NP6A 2AD5A 4X8HA 5L3RA 1NG1A 1NJGA 3R20A 2QBYA 4DLRA 2OEPA 4IVPA 1E1RA 1XP8A 2YV5A 1QHNA 2PEYA 4BLPA 2IS2A 4KFSA 3ZH9B 5JRJA 4AD8A 2GNOA 4C3ZA 1UF9A 1WA5A 1SGWA 3TLXA 4A8JB 4OQMA 1XF9A 2OSBA 2VP9A 5LDDC 3ZS8A 2R44A 2O8FB 1FX0B 1FQJA 1KGDA 1D5CA 2GJKA 1SXJA 4JLAA 3T61A 3CF6R 1W4CA 4TSFD 4PQRA 3F3YA 5K8IA 1TAGA 2P65A 3WP0A 1HE1C 2GCOB 3QENA 5L8VA 3RC3A 2ZIAA 3K9GA 3X1XA 2ZITA 1EESA 1P9RA 4R2HA 4CEHA 2BIFA 3AUXA 2WWWA 3CX6A 3EWSA 4KV9A 4QGHA 4XWAA 4QBGB 2QROA 3QI2A 3Q5DA 1COWA 2P67A 1ZU5A 2P2LA 1D9XA 4FMBB 4B3GA 4LYFA 1ODFA 2QI9C 3GJ5A 4C0KA 2O8DA 2Y8EA 3LDAA 3DMNA 1CRQA 1D6JA 4RD2A 4ZCMA 3TBKA 2WOOA 3A1TA 4D4KA 3L0OA 2H17A 3RDPA 1Q1QA 1ETUA 1F48A 1KO4A 1M74A 2ATVA 2D3WA 3MLEA 1FMLA 3FMPB 2FSIA 2KWIA 3Q72A 3QNUA 2VQSA 1NSFA 1U99A 3N5CA 3OAAA 4ITRC 4WOPA 3UG7A 4A0RA 1XXHE 3GD7A 2D62A 2ZRAA 5HCIA 1EFRA 3VAAA 3LLMA 4TQUS 2PCLA 2GHIA 1IY0A 3VKGA 5B2ZA 4BRUA 3RS3A 4MITA 4PPNA 4M1WA 5BXQC 2C04A 3EPKA 1YR8A 3BGWA 1D2MA 3A1VA 2XGJA 4B3XA 2YWEA 3CM0A 2J0SA 2XZLA 2I1QA 1Q21A 1Q3HA 2V6JA 3BFKA 5SZIA 2B6HA 2RAPA 1T5LA 1L7VC 2RGXA 1HT2E 2DR3A 4PZLA 4LJ7A 3UMFA 3TVTA 4WZ6A 4HLCA 1JAIA 3HDTA 3QVUA 4NL4H 5FBVB 3WXMA 2C77A 2ZS9A 2WMNB 3T5GA 3JVVA 2J0VA 3F5FA 2YOGA 1G3QA 2NO7A 1T0HB 2YVUA 4GP7A 4IKEA 4L9SA 2KBEA 2Q9BA 2ANCA 3KB1A 4NYMQ 4QNMA 2XNDD 3B6EA 1F2UB 3W5IA 3ZDQA 2O8FA 1FX0A 3THYB 4Y0VA 4DCNA 4B3BA 4OK5A 2GA8A 4KLNA 1ZM9A 4MRVA 1S9HA 1W5TA 4HAUA 3G0HA 4CYMA 4AKHA 4DB2A 3NIBA 3BJIC 1YZQA 5LD2B 4MKFA 3E2IA 3PUVA 2OE2A 1M7BA 4CDGA 3QKSB 3C15C 5JLJA 5JJKA 4CW7A 2L0XA 2G9NA 1TF5A 4J0QA 2QZ4A 3BH0A 4W7SA 5M04A 2D2FA 3KTAB 4FMDF 4RFVA 1KI6B 1H8HD 1KI7A 3RYTC 4RD3A 2UVQA 1OH8A 4PFSA 4B35A 5EP3A 3NBZC 1XPOA 5FBLB 2GVZC 2QE7A 1S0UA 2P6NA 2IW3A 2W6IA 3RRZA 4Q4AA 1GSIA 3C16C 4HI0E 1W46A 3EASA 1WP9A 4A4DA 1NVVR 2JLXA 4Q1BA 5IT5A 2JATA 2WKPA 5B30A 3W8NA 4I1OA 1ZNWA 5EUMA 2XEXA 2IWRA 3PG5A 1E9AA 4Q5IA 2B21A 5FOVA 5JS7A 3ZQJA 1KI2A 2ODNA 3UWKA 3KQLA 1EWRA 1I4DD 5JCZA 1B0UA 1TPZA 2CBZA 2A2ZA 2D2EA 3G5UA 4HYYA 4Q9JA 3T5DA 1IAQA 2WWHA 3AP3A 5FOUA 1IBRA 4NE2A 1U8YA 2ZM5A 1XMJA 5DIFA 2P0EA 3SHWA 3R9XA 2JLQA 5IHPA 4MYCA 1GRQA 3MG9A 1GL9B 2ZJ5A 4TSFA 4M9SA 1AS2A 2F1HA 4TLEA 2V7QA 5GJVC 1BMFD 3AVTA 1KJZA 2QGZA 3QKUA 3EW9A 3UMRA 3WHKA 3HJNA 5G53C 1F2UA 1I2MA 4JIMA 2GRJA 3FKSD 3THYA 5C4MA 2WV9A 4MUBA 2FEMA 3O8DA 4G0NA 1OIWA 2X1VA 3B60A 1GL7A 3HP1A 3BFXA 1PLKA 2RGNA 2HYDA 1RFLA 3FHTA 2R62A 3I73A 1AJEA 4HSEA 1J8YF 2QRZA 4G5QA 1W4RA 3QG1A 3QKSA 3W34A 2FOLA 2AK2A 2PT7A 5FUWA 1IY1A 1SVOA 2C95A 3U3JA 3KTAA 2GJAA 1JQJC 1E9SA 4HZIA 1KI6A 2QA5A 1NY5A 1GUAA 5TDHA 4IEEA 2QY9A 3X1WA 2CDNA 4I99A 2YWFA 2GF0A 1M2OB 4BEJA 1XZQA 2XB4A 2A5JA 1OXXK 4QRHA 1UEIA 3KQNA 1OF1A 1N0VC 5DISB 3V9PA 1EWQA 3FE2A 4LRWA 1J70A 3FVQA 3SI7A 4TYYA 1KO8A 1OYYA 4CEIB 3AF4A 2ZI5A 2G1JA 1IXRC 2O5VA 1OKKD 3FDIA 2NO0A 5C1BA 2R6DA 3SC3A 3EIHA 1W47A 1W36C 5IF9A 3FHOA 2V54A 3N2IA 4CF7A 1OHHA 3SYLA 1Z6YA 1VYTA 2R6AA 4JLBA 2NQ2C 1VG1A 4JVNA 1E2KA 2X77A 1P3JA 4ZDJA 2XITA 1MKYA 2JGNA 3KXKA 3EAQA 4GSYA 1R0WA 4LHZA 1WBBA 1OXSC 1Q12A 1ZM3A 4XOIA 4LHVA 4P0TA 3CO5A 1SXJC 2EFHB 2RB4A 1Z0DA 2GJ9A 1M8PA 4V02A 3WBJA 4EIWA 2A5DA 2I3BA 5EZ5A 1MO4A 4JLMA 5E4FA 3ZVNA 2QM7A 3FB4A 4N3NA 2AN9A 4HDQB 5FBWB 4YMTA 1PUIA 3WP1B 1IN4A 1XTSA 2RGAA 2H1LA 4OK6A 5HR5A 4W5WA 5TMPA 5GADl 2GCNA 4CGZA 1NVXQ 1G21E 3Q9LA 2WTUA 4XVUA 5H70A 1OH5A 2F6RA 2Z4SA 1EX6A 3EPJA 3LRPA 4M1TA 5DH9A 2VL7A 3VR3A 1XTJA 2QUZA 4C0SA 3QUSA 2ZI7A 2QSZA 4RSGA 3UXMA 1R6BX 2YYZA 5C46F 2E9SA 2QP9X 3NEJA 1QVRA 3VQTA 4C0BA 3IBGA 1KO1A 4B73A 1T9HA 1HE8B 2VO1A 1Z08A 3KL4A 4BLRA 4M22A 5EP2A 1QHXA 2WBLC 2REOA 4AY2A 4B2IA 3T06B 1KKLA 1W4BA 5DE3A 4M4SA 4AURA 3FYHA 3KJGA 1G8HA 2HCBA 3HYTA 4E03A 2J7PA 3B82A 2PLRA 3A1WA 3RS7A 3GLHB 1UKEA 4DKXA 5BW8A 3KQHA 5JMTA 4BFSA 3U7FB 1G20E 2CCJA 3U4QB 2GILA 2WMOB 2UZIR 4LYAA 1NMYA 3CR7A 1GNRA 1IY2A 3DOFA 3IQXA 4JT2A 5EXSA 4EAQA 1GM5A 4DRZA 1US8B 2ECKA 4ZCLA 4CEIA 2J1LA 4Q21A 2MSDB 4PSVA 3I8SA 4IDPA 4IEIA 4ASUA 3MJHA 1BH2A 3A4NA 1HQCA 3DDCA 4D4JA 1KMQA 1UKVY 2CCGA 4I81A 5E3HA 2F55A 3P4YA 1S1MA 3MWJA 3QF4B 3W3ZB 1EGAA 2KBFA 1G3IA 4OL0A 4DSOA 2F1RA 2H8KA 1T91A 4H9GA 2IYQA 4D0NA 2H16A 2FSFA 1ZRHA 1IJEA 3E1SA 1E4YA 2QT1A 5FBRB 4ZIRB 4MUAA 1XCPA 3FKSA 1KMHB 4HB4A 4KITB 3VNVA 1XPRA 2JEOA 4KU4A 3GLGB 1XZPA 2HJVA 4PHTA 4IXMA 1SKYE 1RE0A 1E0JA 4TYQA 4FMCF 2RGDA 4BZQA 4NTZA 3U3KA 4Q02A 2JJ1D 5KNCA 1DTSA 4AYTA 1X6VA 5KSPA 1Q0UA 3QOFA 4UNRA 4B6FA 4Q9KA 1AQUA 1UJ2A 3WRYC 2A78A 3UANA 3AKYA 3RRMA 1OPXA 4OJQA 5JCPA 1JECA 2Q3MA 1DARA 3KKQA 4WAUA 2CL0X 4DWJA 4OQXA 3QPUA 3VR1A 1G6HA 4G5SA 4BZXA 2GAOA 4MYUA 4B3CA 1OB5A 2XOKA 2VP2A 2QNRA 3SJBA 1KKMA 1E94E 4C7OA 2ERXA 1P5ZB 4R71A 2OAQ1 3ZLJA 4OHZA 1NSTA 3OIVA 4HUQB 5AJZA 1R0YA 5SZJA 4IDNA 4M1MA 5SZHB 4DHEA 1P6XA 3DKPA 2HV8A 1EFUA 1II8A 1P75A 1XCMA 3P26A 1E6CA 1VHLA 3C5HA 5FUYA 1OKKA 1K5DA 3KXIA 4P4SB 3VU9B 5JWRA 2RGEA 4Q4JB 1V43A 2LKDA 3HR8A 2G6BA 3D31A 3GLHA 5TY0A 3EC1A 4ZI2A 2PBRA 3QBTA 4NPHA 1CRPA 3KUDA 2VRWA 3L8ZA 1BYUA 2QGNA 1UBCA 5KTYA 2FFAA
chains in the Genus database with same CATH superfamily
3ZE7A 4BE9A 5ALGA 2WIDA 4ZQIA 3RYIB 3WGJA 3C4JA 1Q5PA 4EB6A 1A9PA 2OWDA 2CVOA 4UHKA 4U2CA 4FFDA 1YFZA 4GC5A 4JYZA 1S1CA 1ESDA 4GM0A 1VL6A 2NSDA 5JYCA 3QSGA 4H1HA 3RC2A 2YJ5A 2C4NA 4QQKA 3BJMA 1DGQA 2EG5A 5GM1A 3WMRA 3COVA 3O1JC 2ZRBA 2H3EA 2JIDA 2PPVA 2JLUA 4NU0A 1TVMA 3J7TA 4KFUA 1NMZA 4X1OA 1QCCA 3K94A 5DCWA 1VCIA 3HRIA 5CJJA 3RAGA 1VHQA 3Q8WA 1NQ5A 1G42A 3WAKA 2W6QA 5M34A 4EMBA 1U4SA 5F12A 1ZC4A 1AM4D 1KR5A 3OPXA 3SBDA 2D54A 5M2QA 3DA8A 4B6SA 2XNSA 1QZ3A 3JVUA 3O9ZA 1C4WA 1R15A 1QFMA 4M7OA 1X15A 1E99A 4N5MA 4TS1A 3UXYA 4BJ6A 1M2GA 1P7WA 2ZU6A 1ECGA 1PFQA 2CVZA 3LQ1A 3ZDCA 1R9NA 2H4FA 1IN1A 5F9MA 4ZCRA 3O8QB 1LX7A 4EEZA 1Z88A 4Z4HA 1AO3A 1S7CA 1N5IA 3GFSA 3KBOA 1R4MA 1KAGA 3GXOA 1LX6A 2X0NA 3KT0A 4IX9A 2B7BA 4O5OA 4WN9A 3NC1C 1LK0A 1C8VB 3DPUA 1I5RA 2IOYA 1NWCA 3ACBA 3C41J 2ZM6B 3U7HB 3WB0A 3IIJA 4MUHA 4CUKA 1KI4A 4LNUA 1HGXA 3I6IA 1J97A 3K1JA 4YJHB 2IH5A 3MRSA 3OETA 2AZMA 3Q9NA 1VMAA 3H0KA 4MRNA 3AR5A 3MM4A 5ERGB 2ZXFA 4ZCPA 3SICE 3ETCA 4OOEA 1L7DA 4EQZA 1OX4A 1S2NA 2FSGA 3C3YA 2IKQA 2VZ0A 1WF3A 5DK6A 1C30B 1GRCA 2JFNA 1P74A 2XMQA 4ND8B 1RWPA 3RFVA 4DCMA 3DE6X 1X3SA 4JUBA 3TSOA 2Q50A 4KLZA 5JFGA 2QUJA 2EJWA 3FZYA 1K0FA 1QG4A 3AW8A 2XUDA 4GX2A 3D3QA 4ANFA 5A2GA 1XO1A 3ONNA 1N57A 4CNBA 1N5JA 3AG6A 2B82A 5C18A 3KWFA 3VU9A 4QFBA 4PGGA 4WZAE 2ZVPX 1W4ZA 2WDZA 4KRGA 1NUAA 1BU8A 3AQIA 1SB9A 2NQ8A 1DBQA 2JFHA 2BEJA 4C4OA 2VP4A 1G8FA 4CV1A 2VJBA 4P7FA 5HCNA 2NYAA 2H0QA 4ZOEA 3BZBA 3ZXXA 2QVXX 4BNIA 4IM7A 3Q6IA 3SM9A 1HNNA 4YGXB 1L9XA 4AJHA 2WM8A 3LI2A 4DLKA 2DUMA 2JASA 3GJ4A 4G0VA 2ZR7A 1T43A 3CZPA 5A71A 1MOZA 3UAVA 3PUHA 5E7MA 4UFOA 3EXG2 3TLKA 3CBQA 4BMCA 1GNPA 3G6KA 3JASA 2PH7A 4GPTA 3CINA 4DB4A 4R98A 3TDKA 5J4YA 4GSLA 3TSAA 4K81B 2WT8A 3DSRA 5KYWA 3PPIA 2HPZA 3UK1A 1A9XB 1B74A 1BGXT 1VMIA 3HUDA 2BRUC 3K5HA 2HHLA 2QUBA 3NXSA 4DABA 1C3LA 2R66A 5ILGA 2LVBA 3TW8A 2BFMA 4EG1A 1XRJA 2Q0XA 3CRVA 3NCHA 3R9IA 4RA6B 1QM5A 4F85A 5KTKA 2XX3A 3PSHA 3DWEX 3GOQA 2RE8A 1PK9A 1R4AA 1PJZA 1ZKDA 2G5GX 2PE5A 1P5RA 5FJIA 3A1DA 5E4JA 1Y6RA 2HFJA 5JHHB 4GM1A 1CUZA 2WHXA 1M1ZA 1MAWA 4I50B 3G0OA 4KMRA 4BGVA 4AKHA 3KZMA 2BCGY 4OU5A 1F0PA 5EXPA 1ISIA 1NQOA 1OV4A 3KEQA 2WP0A 3WLPA 1VIMA 3VR4H 1OVMA 4GPZA 4KBGA 3A0RB 1U8UA 1WEHA 2WICA 3N74A 1G9XA 1Q2XA 3HFGA 4Q9NA 3RU7A 4ZEOA 1IDOA 3NT5A 3PJEA 3GC6A 4NFLA 4RK1A 5FF9A 3MGGA 2OSVA 4CHGA 5A7FA 2HLDA 2J9RA 4R6XA 1ULTA 2AYYA 2W4IA 4L4RA 2A9QA 3G5LA 4L0QA 3VHLB 4AS3A 4A92A 1DO2A 4YB8A 1GAJA 1FYWA 1NVVQ 3KL2A 3KLMX 4IH9A 1YZGA 4XXHA 5K8JB 4ZODA 3QPWA 2DPXA 4L8YA 4H6WA 4CLEA 2Y67A 1IJFA 4O3MA 4UC0A 5HJEA 4YT4A 2QWXA 3WB9A 4RKWA 4YT2A 3U80A 1WHTA 3VHQA 4KK4A 5EZSA 2R4UA 4NZNA 3FTQA 5EGSA 3U5TA 3N8KA 4FCVA 3SZUA 3H11A 4IPTA 1MABA 3AUJB 3DBRA 3L18A 4DJAA 2W43A 2O9JA 4MLCA 3BD7A 2PV0A 1ZA2A 4O4HA 3TLBA 3ZLVA 4G5XA 3W78A 4E11A 5CA1F 2JLWA 4MJXA 1UXJA 3KZCA 3LXUX 1VLVA 2I62A 3G82C 4TWAA 1BMQA 3BHIA 1FTSA 1Y48E 1C3JA 3OQVA 1ISGA 2R2GA 4GYYA 4MI9A 3S81A 1E62A 1PN3A 3C14C 4KQ2A 3LT5A 1T35A 2HSDA 4GKAA 4N0EA 3TBFA 1IXKA 5HVNA 4Z53A 5DLEA 3PQDA 1W35A 3B52X 3ZVRA 5JATA 2EF1A 4UCFA 3N70A 4G56A 4JKIA 1JKMA 4YRCA 5E1DA 3SIRA 1IM5A 4DC9A 3JQBC 1Q91A 3D3WB 3L7JA 5C7IO 4ISCA 1ZL0A 3UMMA 2C2OA 1Y4SA 2FR0A 2A1UB 2GPSA 1EVEA 2XMSA 4H27A 4OVKA 3TMKA 3TLCA 3AM1A 2FZWA 3K0AA 3FH0A 3FDXA 3MWFA 1BC5A 5AVQA 1DJLA 1JWLA 3ICQB 2JIQA 3AILA 1EE2A 4HRVA 3MWLA 3A1UA 4W5RA 3VHXB 3DZIA 4EVRA 3G1WA 3ONWA 3HJTA 3PQ3A 4NU5A 4AJ1A 4EPWA 2YZ2A 4C2AA 2ZR8A 1YB7A 3O94A 4JYBA 4LEIA 5T6MA 4D4MA 1NXQA 1DS6A 1T1EA 3HI6A 1ZD8A 1AD2A 1UT8A 1FFBA 1T4DA 2GBFA 2VZLA 3KUCA 1CKEA 3HVRA 4EZEA 1HE4A 3C1UA 4I5EA 2H9YA 3HO6A 5FAKA 1GG2A 3ELBA 3I6QA 1ZRMA 3TR6A 4MB6A 4UTVA 3U1VA 4N5IX 1GT91 1H22A 1O6GA 2HHCA 3PGJA 3S1LA 3KOZA 1L4LA 1B8OA 5LP6B 4E4RA 1CS0A 4EKEA 3C5VA 1GITA 3V8EA 2JHPA 2Y99A 3OD5A 2X6RA 3ET4A 5G0UA 3WSTA 5DM4A 5JJIA 1JL3A 1KI8A 1KORA 2A0WA 2PX0A 3TIXB 4EKDA 1JHMA 5FI0B 2C9DA 4YUZA 3WBFA 4GSKA 3T3OA 3QE4A 4LBWA 4FBLA 2V3WA 2D8AA 4HOYA 4Y9RA 5EVCA 5B64A 2WF7A 4I5FA 2NUBA 3EXAA 1IOZA 2B1IA 4FI3C 4MRPA 4Q00A 2QN8A 3BPSA 3EGEA 4AMVA 7REQA 4ZGGA 3SG0A 1M33A 1SQ0A 3O0DA 3HRKA 4DUGA 4CR7A 3JR3A 1R0XA 2X4GA 4NOLA 2F90A 3NRBA 1C80A 3MINB 1G1AA 1NUQA 2AMJA 2SECE 1ZISA 1NW6A 1G8PA 1S7GA 3IKVA 2QKYA 2JH9A 4D3XA 1QNFA 3H1EA 1UP7A 4RD6A 2OXIA 2O2HA 3PR2B 5D5HA 4ZVMA 3F5SA 1PR6A 1FFHA 2GVDC 4EW2A 4D6PA 4TQAA 5ALWA 5EXTA 4IKPA 4YV7A 3PQ8A 4JWTA 1DSSG 4RZ2A 3ZJ4A 2CZGA 4U2GA 5F3WB 5CITA 1IPEA 1AZSC 1D07A 1EFVB 2VF7A 3IPLA 3ECAA 3OO0A 3BB3A 5CA0A 1NSYA 4DIKA 4RIFA 4OMCA 1MORA 3GEHA 4QUGA 3UAGA 3O91A 5MN5A 3H5VA 2CD7A 1OE0A 2HIHA 2BT4A 4YP5A 3HJFA 1DHRA 1I1NA 5ADHA 3J81A 1J7JA 2XZOA 1N8SA 5KREA 1UFKA 2OFWA 3ZOZA 1Q50A 3VPXA 4C6HA 1B6GA 1U0TA 2IS6A 2AF4C 3GLHE 1JEEA 3I04M 4DV1B 1W5FA 1GNLA 1Q14A 1VJCA 4C05A 5TX7A 1Y7IA 5CH8A 2ZJ6A 1SY7A 4MW5A 2P9CA 4EYKA 4MP6A 5AK0A 5AW6A 5LOVB 3DE2X 5JDCC 2RH5A 2QTVB 1YFKA 2ZE6A 4QATA 1X39A 2D2IA 2G71A 1QJ4A 4KI0A 3WB2A 3ZNPA 2O7QA 1RM5A 4AX4A 4DQUA 1W94A 2FWPA 3KOOA 1EUDB 2RBGA 3G1TA 3WLOA 5LPNA 2OCYC 3EG9A 3KVOA 5TPWB 1QG0A 4ZDKA 2FQXA 1B2LA 2FN3A 2PZGA 4KXWA 5IJ0B 3HC7A 1LBEA 2P6PA 1SKAA 2OZLA 2WU4A 4YY3B 2FQ1A 3CX4A 4KWHA 3FMGA 4CMEA 3AIOA 5ITZA 2C2XA 4HN9A 3W6UA 3ESBA 4V1CB 4FB4A 4Q9HA 5I4CA 2W58A 1QX4A 2O8CB 3QU5A 5C3UA 3VDRA 2E1RA 4WBXC 1QHSA 1W0JD 2XUOA 2ZJ7A 3BWDD 3WYEA 4B0OA 2VQ6A 1U3UA 2D7CA 1ZU4A 5TB5A 3LU1A 4LSWA 3STWA 4DJJA 1L6IA 4V03A 2PJRA 2YHUA 3ZWYA 2O50A 2XOEA 3OLQA 1M7HA 3W8RA 1PYDA 4QIHA 2RHCA 2GHTA 1IXZA 2P2YA 3INGA 2FXIA 3I9KA 3T7AA 4BFTA 2NTNA 3PWZA 3AY6A 4I19A 3AESB 5CPBA 2Q27A 3I8XA 1OC2A 1JFFA 1QORA 3JQ8A 4FKBA 4MEAA 3RJ9A 1JYEA 1NYLA 1UEJA 3LECA 1L0BA 1XGKA 2XRMA 2PRKA 1IXSB 1WP4A 2BGJA 2P69A 1E7YA 4ZHQB 5IT9A 3K1YA 2HRBA 1NN0A 2ETXA 2ORED 3S2IA 1GAXA 3Q7RA 3B12A 3UH1A 5KSOA 3KUXA 1K0UA 1PNTA 4GI1A 2J3HA 4X64B 4BQQA 2JFUA 2OBLA 5CP8A 4JODA 5CPFA 2ZVQX 4O2BA 4ACBA 3ORHA 4F0JA 1IG0A 4A7PA 2H06A 4BKUA 1J8FA 3B85A 5T4HA 3ZZNA 2GWHA 1G5TA 2JGAA 3R09A 2NZ2A 3SR3A 2WWYA 1CK4A 4L1KA 1GQFA 4L7VA 3TIFA 3ORRA 1AN9A 3K70C 3MSXA 5LQCA 1ZD4A 1OYOA 1QGYA 1ZH6A 2PBLA 2PS0A 3P5SA 3F78A 4FE3A 2O20A 4XD7D 5B3JA 3PJRA 3TGPA 3LP6A 3ODGA 3EXIB 2P75A 5CYGA 1NC1A 3LQ2A 4KRXA 2IBSA 5HA5A 1Q77A 2VBIA 3AETA 5K1ZA 3V1YA 3HU1A 5JAPA 4HDSA 1FMCA 4M6WB 3BULA 1AKMA 4LXGA 1VC2A 3EYWA 2O2XA 3SC4A 4TMWA 5E0KB 3AEXA 4A0GA 1SK8A 5HMMA 5KNCD 5D3ZA 3RJMA 5KHOC 1T3ZA 3JPYA 1QRDA 5KWVA 1BGVA 2HQ1A 1EK6A 2FSHA 3K5PA 3BFVA 3WWCA 3LQRA 1KF0A 3U4CA 2RAUA 1JF8A 3GUHA 5KI6A 2C2ZA 4MP8A 1JKJB 1RJ9B 1FA9A 3ZDDA 1U9ZA 3A27A 1L6RA 2FW6A 4Q1DA 4X1KA 1IB0A 2I99A 1M34B 3KKEA 2IHJA 3Q40A 4EDFA 1UOPA 4EUEA 1Z16A 5L3QB 5IULC 1KSGA 2NPOA 4MYDA 2AC4A 2AMLA 2H08A 4M0CA 4B4KA 2X2EA 4HB3A 4DCSA 2YVLA 1GT6A 1NV8A 4DLUA 4B48A 1XDDA 4C4XA 2VDNB 3THSA 4LJRA 1S4MA 1DLJA 3MIIA 2TSYB 3H2GA 3OC0A 4HVLA 1M83A 4ZICA 1QTRA 4BASA 4H3VA 4O5AA 1E3SA 3ZZ1A 2EKZA 2IIPA 4OBXA 4EY3A 2QMOA 3L8GA 4GZ5A 1B15A 2VHJA 2IX9A 1XZFA 4FWIB 1WXFA 4JOSA 5FBHA 4KNYA 4EPXA 5FPPA 4YCNA 1FFSA 1GGHA 4LA4A 4NEGA 5A4JA 2YXNA 1NIPA 2D4HA 3GJ0A 2XMBA 4IGFA 1OH6A 2QDXA 2QTBA 3C8UA 3GUUA 4QJBA 4BFYA 4KYIB 2RGYA 4QHYA 4E3WA 2HUPA 3BWMA 3DP7A 1TF7A 5I8PA 1L7BA 2FUG1 1FVFA 2OUIA 3RRYA 5KCMA 2PQ2A 2XCRB 2WD7B 5E1MA 2JLBA 2WSSD 1EFKA 3NS7A 3QF7A 4JAVC 3DLCA 4QM7A 1F3OA 2GAJA 4B7ZA 1DCMA 2ZIUB 1R6VA 2OZEA 3OFSA 5KZMB 2OCBA 3C5CA 3SF8A 3MYRA 5ALMA 1JS1X 1M2KA 2P9HA 3MFQA 5B58C 3D7LA 2G25A 3LX8A 3A6EA 3IVAA 4I66A 5K09A 3UJNA 4ZI5A 2NO9A 521PA 1KNQA 1K8XB 1Z4OA 2D0OB 4A2WA 1IBLB 3KHUA 2B6NA 4B47A 1WKVA 3ZV5A 1W0JA 3WJ7A 2D1RA 1EG7A 2K5UA 2XCIA 4JOCA 3JQAB 4OJTA 1XCOA 2AB0A 4PO1A 1X7YB 1E6MA 1Y6JA 3OX1A 3NYQA 1SRRA 2VH2A 3A2KA 3VKHA 3H0CA 3VR5A 1NM5A 2ISSD 2O6LA 5IYZF 2XEDA 1O5OA 3NNNA 1RWKA 2YQ4A 3KHKA 4LDQA 3OD1A 2FEPA 1NQVA 3MJFA 4C7OB 3NP9A 1LNQA 5AXCA 1N4AA 1TA4A 5FQOA 4RL4A 1IWOA 3QVWA 3UN1A 3B5JA 2CNKA 5IC6A 1IHDA 1HL3A 3OEED 5CDFE 3NBFA 1MAHA 4R16A 1II8B 2HSJA 1BW9B 1Z0FA 2FQYA 4G9BA 3AFHA 5A9SA 5KWIA 2QLFA 4ZOCA 2O2IA 3KOXA 4L15A 3WLIA 4DMRA 1FS5A 4WY2A 3D2BA 4M2LA 4EA9A 1ZN7A 2G72A 1R0CA 2V8OA 5PNTA 5JZBA 3EPLA 3QHAA 4INPA 4JLPA 4OM7A 3W3AD 4DKJA 3GEBA 1PR1A 1UBKS 4JA0A 2IUUA 4AWXA 5BVHA 1XTTA 1U7PA 5EJAA 4OYLA 2GHRA 2XI4A 3G9ZA 4QFDA 4O33A 5K20A 1QDEA 3E7DA 3EAFA 2IXFA 2QXUA 2HDOA 2VC2B 3IESA 3R5TA 5JCJA 2ES4A 4EYGA 4NOJA 4WUTA 5IBRA 2AX4A 1ZXLA 3RVSA 3CUKA 4S0XA 1PGNA 4NICA 2E85A 5EXEA 2D4AA 1ATIA 1JJIA 4E2YA 3TNDA 1DKUA 1TECE 1BE6A 1EK0A 1H4VB 1PFUA 3ORFA 4PHFA 4J76A 4LY6A 3OUZA 5ICFA 2ADOA 2AWNA 2KSQA 4MWZA 3OP1A 1BE8A 4H7DA 4JC8A 5C31A 3UG6A 4YUXA 5JROA 4WLVA 4Q9LA 1V25A 4XD7A 4HLQB 3MYYA 1VL5A 2LP4Y 3GJ6A 4NBKA 4NQZA 3BF7A 2QL5A 1U0EA 3AVXA 4RTOA 4JI1B 3IO3A 2BJVA 3PEYA 3O4RA 5FWNA 4WVFA 1SBZA 4KFRA 1YHYA 4BV2A 5A06A 4JYAB 1PI3A 1EXDA 1L4YA 2Y0EA 4LWOA 1BCSB 1DUSA 3EOZA 2PLAA 3NONA 4K6HA 3W4IA 3SX2A 3IDQA 3T7DA 2JAXA 1A2OA 4CMEC 3H84A 2J3IA 1L4BA 3WZ2A 4GW3A 2VUUA 1R2QA 4XCVA 1F9EA 5TJ9A 3S2YA 2WUDA 4WLEA 4WLOA 4IP0A 1XNQB 4M36A 5JS1A 4NYJR 2J0QA 2GO1A 1IUPA 3IILA 3E3NA 2OD9A 3I6ZA 4FHGA 1JG1A 4QU0A 4X71A 4MJ7A 2AG8A 4ETWA 2K6GA 3WL7A 5JVDF 4Q1FA 4NU6A 1R4NA 1MQSA 3TW6A 4QJ3A 4GQAA 3E2PA 1MF7A 1Z2AA 5DGXA 4KIUA 2VDJA 1NFQA 2XDQA 4HGNA 5LNK6 2BFCA 4TX1A 4AUMA 1BQEA 2WT9A 3Q9SA 4DRXA 3PPYA 4QT0A 5BMVF 3Q7SA 1N2GA 4REMA 1FVXA 3HWWA 2XTJA 3KQWA 4DT1B 1PG5A 3M49A 2IEAA 2LE0A 1N1MA 2QTFA 4XVQA 3SJAA 2ZJAA 2CMDA 3SVTA 4GWGA 2XUKA 3DBIA 1ZYUA 1Z5GA 2P6OA 3ABSB 3LZDA 2WJAA 5BURA 4MH0R 3QUAA 1QHFA 1Z0UA 5CT6A 3IULA 5CNIA 2I4NA 5KKAA 4FFPA 4URUR 1E5DA 5E95A 1E5QA 3N07A 4KPFC 1P2UA 2F1JA 4Q4CA 1FEZA 2QMUA 2CFSA 2YH2A 2IQIA 3OTIA 2EHDA 3FBTA 5JZVA 1O9BA 1RCUA 3LG2A 2O7NA 3OQJA 5HF6A 1C3EA 4BBPA 3KX2A 1DCFA 2R5WA 4QODA 2ZQYA 2IS1A 3KAKA 3B8HA 4MO2A 4UOZA 2R3SA 4MV1A 3EXFA 1UMKA 2Q3BA 5K0NA 5EIWA 3SJ7A 4IDBA 5B3JC 1I8TA 1NRIA 2BH9A 2EW2A 4X1IB 1KI1A 3SQOA 4YMWA 1CQJA 1DG3A 1L7RA 1QJCA 2JZNA 4Q03A 1QK3A 2VQEB 2O1EA 2ZRGA 5FEUA 4IDDA 3AVVA 5JPDA 3ZWMA 1ZWLA 3T95A 5JSFA 1NBMA 4N3BA 1PWZA 3Q9UA 5DN6D 2C1XA 4L07A 2RJOA 4URFA 1H69A 1L7OA 2WIBA 2YJ3A 3LCRA 2RGNC 2P9JA 4K8RB 3WSVA 1EP3B 2Z83A 3ZHZA 4D43A 4DCVA 3JTEA 3R1IA 1H3EA 3UB3A 2COUA 4JSRA 4S12A 4M0EA 1C1YA 1GKUB 4KHZA 1QYWA 4YH1A 3ZQUA 5JYEA 2J9XB 3LKDA 5ES3A 3LY9A 4G8JA 2XE8A 2GD6A 3L46A 1L5WA 3WKEA 4ZTUB 4RUKA 1F7UA 2P8JA 3KR0A 1E2GA 5EPUA 2WJYA 5EHQA 4CLDA 2IHNA 4HUJA 3U7IA 2HEIA 2IVZA 1BKDR 3D6JA 2JIZA 3OEEA 3IVXA 1DTWA 2Q4DA 3R2JA 3A7DA 3HXLA 4LZWA 3RGGA 2I1WA 4WV3A 3AGPA 4BP3A 2Y9MB 3RKRA 2IZOA 4X8MA 4C0WA 4LFAB 3HXKA 2JGKA 4EZIA 3WDLA 4I9UA 1A8PA 4MVCA 2OWEA 4CT0A 1WOMA 3K6SA 3R6DA 2OVFA 4GMFA 4YV0A 1G59A 4JJGA 5BUSA 4KZKA 4LJYA 2QG6A 4R7GA 3A0UA 2AUTA 2J31A 4I1IA 1J25A 1W581 3HYCA 4LWPA 3INTA 5GY7A 3ZCPA 1V2HE 2UZ3A 4RNCA 2WFLA 2EFYA 3GEIA 1VI2A 3CNHA 4LRTB 3ZZMA 2ZZNA 4AZ0B 4F8YA 1V8PA 4MV9A 4N7BA 4RPGA 4WIAA 4OQNA 5LBIA 5CGQB 4OHBA 2Z1DA 3R7WA 5ECGC 3RV3A 1I2BA 3MQ4A 2W2KA 3OUUA 4RZ3A 3UUWA 3SBOA 3K71B 5CLLA 3WMFA 4EB8A 1JEQA 2ZUTA 2FMKA 3WDSA 1WUTA 1N9KA 1K2WA 1UK8A 3H3XA 3KT8A 3SGLA 3FIJA 3P2JA 4F1JA 4XJVA 4LHXA 2UYQA 3FN4A 3I8OA 5IJWA 5HXAA 4LF4B 2BE7A 3PQ5A 2ACVA 1KYIA 1TVKB 5EERA 3CB4A 4FW8A 3SJZA 2BM8A 1E4EB 1KFJB 3B3AA 3V8BA 3NDPA 2NXJA 4KLRA 5CIQA 3AIIA 2Y1WA 1A72A 3KSZO 1RPNA 3EDCA 3L07A 1J5XA 4LCEA 3ZXYA 2A5GA 3CBGA 4G1BA 2JGEA 2XUIA 4JJKA 1SU7A 4AO8A 2MMGA 1ZVJA 1XRSB 3MTAA 2IXGA 3IUQA 2VCHA 1C9DB 2C97A 3ENVA 3OA0A 4O1IA 3BFPA 3KVVA 4P7GA 2QVLA 4PZAA 2GF2A 4IIJB 4YYEA 3GNSA 2AG6A 1E8MA 2BFDB 1CY6A 1CE8B 1TCCA 4M98A 5FI1B 1NM5C 4E14A 5A0TA 3HJBA 5I5GA 3MSCA 1THZA 1V7ZA 3MB8A 4W8OA 5JLAA 1E7QA 3ROQA 3CFYA 4KQWA 4BVLA 1TJYA 1UT5A 3C43A 1FPMA 3DVSX 5AMXA 4P92A 4S2UA 1QS0A 2YUTA 3GJTA 3DBOB 2OGZA 4JSTA 3OCXA 3JZIA 2J41A 2VZEA 1VPTA 4HXEB 4QNNA 1ZIOA 4AM8A 2V55B 5FLYA 1P6UA 4AJIA 4HX9A 4G01B 4ZAZA 3EZLA 3V4OA 3ZW8A 4EY8A 2BLNA 5EEHA 1HQDA 4GF5A 1A0OA 2NU9A 2C0PA 4O2AB 4BNLA 1QQBA 3GG2A 4DPLA 4DA4A 1MFZA 4DG8A 2EWVA 1KRHA 1DXHA 3L49A 4S1OA 1T4CB 3CZ4A 4CM4A 1K3FA 3E82A 3G8BA 3M1LA 2HA6A 3QUQA 4AMUA 4F04A 3P0HA 2HU7A 4EW6A 1BA3A 2YRFA 1TUIA 4F4FA 1SVNA 1FDIA 2DB3A 4IUDS 2YS6A 5EVJA 1GUBA 1T1SA 1IK4A 2ZTLA 4IXDA 2MOKA 2XVYA 3R5FA 1XEAA 4DJFC 3SOOA 1T8SA 5ALHA 3E9RA 3KKNA 3L2OB 2VYVD 1PL7A 3I2YX 5H82A 5CX1B 5IP5A 3WDKA 3VVBA 4MV7A 1N2CE 4PANA 4OHWA 4K40A 1PKEA 3W5HA 2IDZA 1FNCA 5JANA 2YN4A 3AR7A 1NT2A 3MXOA 1V48A 1GZ4A 1I6MA 1KGSA 1DI0A 1VBFA 2GBLA 2ZE8A 3QTBA 4TZKA 1LC3A 2FETA 4RESA 4RACA 2G8LA 3EA5A 1NP3A 1QH1B 2IZ6A 1QRAA 2VA8A 4OJYA 4Y1GA 3HPRA 5FNVF 3PEUA 4NATA 4OLBA 3MUNA 4PC3A 2ZGVA 3QX8A 1OFTA 4LMPA 4YNBA 3GDOA 5JBQA 2P91A 2ODTX 2VYND 4IHAA 4Z1OA 5LLSA 1DJQA 3AFMA 4NG4A 5C81A 1NBOA 1KPGA 2JEZA 5D5QA 3TO5A 4DQ0A 1L7AA 4FILA 4G5OA 1BGWA 2AHRA 5GIOE 4F1WA 2YZNA 1SVWA 4LVCA 1I94B 4AG5A 4KBYA 3W5SA 2FDCA 1MX9A 3N3AC 4QU5A 1UH5A 3NAMA 2RGBA 1LDNA 4E4YA 2R87A 5DBEX 1T2EA 5JNVA 1QLJA 4QJ5A 4X85A 5H7XA 1JDJA 1GDHA 3INYA 5CA1A 3ER9A 2EWWA 3CNOA 2C3PA 4LCBA 4DV6B 5G02A 2BI7A 6PFKA 4KQXA 3IUYA 4FMPA 2FA9A 3FHCB 3AL3A 2WKWA 3O4JA 4DNPA 5I5EA 1JQ5A 4TWRA 4DTIA 1PV4A 1UXKA 4BE4A 3KXLA 3L40A 2QE6A 1T2AA 3GT3A 4IIVA 2IV7A 5F5LA 3RRXA 3DYBA 3IEPA 5FBKA 3UAXA 4F9EA 2X7HA 1G2OA 4MS3B 3ZU4A 2VDRB 4I4LA 4UULA 3HNOA 4XVRA 2EZ8A 1AQNA 5DHFA 1K6EA 3JZFA 2VVTA 3I5AA 4OYHA 5EKTA 4Q37A 3RUEA 4FNGA 1ZW6A 3LUDA 2XRZA 3DGFC 3NPMA 3ZZ0A 3RBZA 1C4OA 5JAHA 2VP5A 2PGNA 1U3FA 2FEAA 1YQUA 4UXIA 1SK9A 2XKKA 1NLYA 2LCFA 3QKIA 1YDGA 4C30A 4G25A 2CMHA 4YXWA 5BWOA 1OFHA 2XJ4A 1WW2A 4LV5B 1ESCA 1VECA 1G41A 1KYXA 4U5QA 2XYRA 1ZUHA 1TCUA 2BFBA 4PINA 4TMFA 3RYCB 3I53A 1P1FA 4NRDA 2MWMA 3PC8C 3EG5A 3ADPA 5A1JA 4MR7A 2SNIE 1TQDA 3GQBA 1ZK0A 3UH0A 3N05A 3IPYA 4C6SA 3RSQA 3ZBTA 4S04A 4H0CA 1ZUNA 1IEVA 1YZLA 3HR7A 3RKSA 1JEYB 5FR1A 2M2IA 4MR8B 3IOYA 1ENYA 1CIPA 2R751 2B8EA 2DZDA 2VNHA 3NXKA 4UMVA 4BXOA 2Y71A 4BO5A 3C7DB 3A6JA 3H6KA 1J0CA 3D2CA 1U04A 3M7IA 3PE4A 4GKBA 5BQOA 1UXOA 2YIMA 3IDAA 2QN6A 1OAKA 4FHCA 2PX5A 4HAIA 1NMQA 3DEZA 5I3CA 7MHTA 2AZTA 1YCHA 1HT3A 4X54A 5IEJA 2ZUSA 3TPZA 1MO3A 4QD3A 4YMVA 1SCIA 2AI2A 1YV9A 4Q34A 3DFFA 3DLBA 1APBA 1BWRA 2VHUA 4TKLA 1BA2A 3QELA 4D81A 1GV0A 2ZAIA 1U2RA 2PQMA 2VPYA 4HMOA 3SLGA 4F4JA 1Y9DA 2H1SA 3DQQA 4IILA 4Q24A 1GA6A 2VNKA 2YOHA 2VRCD 3EW7A 3GFRA 3HCEA 3PNKA 4ZQCB 2PMWB 3GT7A 3SVZA 4XTCS 4MKXA 4HDNA 3DE4X 3EEFA 1EFPB 3R3HA 1IEWA 3M70A 4FEYA 4K3VA 4M0KA 4NOMA 4UUBA 1YB4A 1D04A 2GEJA 2GM9A 2AMFA 3K0FA 4YEDA 1X92A 4NBRA 5CT5A 3WNQA 3TECE 3K30A 3FR8A 2IODA 3PFCA 5JXJA 4ZMRA 5FO0A 4XKJA 3R5KA 1IBSA 2PZ8A 1TMKA 2FG5A 2WWRA 1Q84A 2GZDA 2R86A 3GVXA 4O1HA 4IOMA 1R8QA 2JC3A 3KLBA 1JH8A 1K75A 5FYQA 3GEMA 1D0VA 5A0VA 3QWAA 5CIWA 5BRJA 4N8EA 2VSXA 3HUFA 4URVR 4ROTA 2DPMA 1P7CA 2XODA 4F8JA 4GGOA 2VYVA 1NP6A 4A6PA 4L2IB 2VAWA 2GLUA 4AY5A 2JKZA 3EHDA 5L6MB 4WBNB 4U6QA 5ITSA 3IP6A 4FHDA 2ZBUA 5DM0A 1M5UA 5IEBA 2P4QA 2YC2C 4WXRA 5JS8A 4RXUA 2GCOA 5AJUA 4DBLC 3DCJA 3TIIA 3KETA 4L27A 2ZT5A 1TYZA 3VVMA 3KJIA 1GKKA 3JSAA 3SR4A 3X1MA 4DLAA 3TKLA 1XD2B 1O5TA 3KXDA 9MHTA 1YNSA 2FZVA 2V7EA 5KYNA 2H65A 3TQFA 3ZKWB 4BP9A 3AU8A 3AUAA 1OROA 2BEVB 3KQYA 4WTOA 2VUIB 4RGVA 2ISQA 1ZUWA 2Q2WA 3WNZA 5CCXA 3DE3X 2O3TA 5JJBA 5JUWA 2RH8A 2ODPA 2V96A 2Z4RA 4KWTA 1JDZA 1N5OX 4BLVA 2O8EB 1N5LA 2J8ZA 3VAZA 1DX4A 1F2TB 2FZ5A 1EBBA 2O2ZA 2X5NA 3DO8A 1Z34A 4Q7MB 3FSGA 2A92A 4LE0A 2IXEA 2PUWA 2D5CA 1X38A 2PZJA 3L0PA 3LDUA 1E77A 2WHYA 3FCXA 1ESNA 2WP8J 3RHFA 3UW1A 1K9SA 1VL8A 5EMMA 3MJDA 3AR8A 2VNSA 1YT5A 4HLDA 4RF5A 5SYAA 3D4OA 2XAAA 3I9V1 3OJFA 1AA3A 4JGIA 3OPNA 2YCLA 4JUIA 1Y6GA 1L5HB 1DINA 2VH5R 3RS0A 2JHAA 3P9XA 4DCOA 3HQ4O 3NVKI 2H31A 1FDRA 1ZCZA 2VPZA 1JDPA 3NNSA 3BRSA 3CH7A 3GLSA 1IN6A 2B7LA 3F6CA 3RABA 4HX5A 4A2QA 5BUZA 5EJEA 2YKGA 4L0CA 4U00A 2IL1A 1T1JA 1SCBA 1HSZA 3EGWA 1PT7A 2M6RA 4TXJA 1WZEA 4NAHA 4RPIA 3AB8A 4I1PA 5I9MA 5HFNA 3WL5A 3Q3GE 2CDAA 3QLJA 3PUXA 2BFEB 1CRWG 1XVLA 1MVLA 3CSSA 3P20A 2RKWA 3N2NA 4NARA 4J0DA 3CRW1 3MEQA 2WZBA 4CKCB 4D9GA 4PAOA 4UBOA 3JWHA 1XELA 4N12A 3Q6NA 4W5OA 2X42A 4RJLA 3DL2A 1GAQA 4AWAA 4MGZR 1E1NA 1JDSA 1P0CA 2GBLC 4B2LA 1FP7A 3AHFA 2I1VB 1SHLA 2J09A 4IS3A 5FO1A 3DYVA 3GLKA 3PEWA 2JI6A 4HDCA 1CDDA 3HUTA 4OJMX 5ESXA 3SPXA 3TRIA 3VPHA 1P61B 4MKGA 2XVZA 4F7DA 1XZCA 1RNLA 1WQ3A 2EFDB 4HZGA 2OZPA 2EJCA 1JDBC 2VPPA 2J5BA 2B36A 1E3IA 3A4LA 3CRMA 4MNTA 5FCDA 3S0JA 4U7WA 1E96A 1PT8A 4HHEA 3OY2A 2DM6A 1YK0A 1A9ZA 2VHWA 3AIMA 1H9BA 1DCKA 2I91A 5BSFA 2C2GA 5L3SA 2BWJA 2G0TA 4LOLA 2P9FA 1V4BA 1KYWA 3TFQA 4AIIA 2OB1A 4C0LA 4F3TA 4EJ2A 1YGPA 2GEVA 3RSHA 1LFAA 3C6YA 3RBXA 4ZDIA 3E03A 3LW8A 2J33A 4J1QA 1EVIA 4J8PA 4KACA 5AVSA 4C89A 3ESYA 4C6RA 1NJSA 1FLDA 3KYCA 2QT0A 3LZCA 1UPCA 1M8GA 2HT6A 1A8SA 4H7HA 4QQNA 4I4CA 4QJIA 4TMKA 1NT4A 4W1QA 4KH0A 3SS8A 4E31A 3KSAC 3URKA 2DY1A 2VRCA 3W5JA 1ZCAA 4JI6B 2LCIA 3MWDA 1HTBA 4AROA 3VGPA 5JV5A 1AKEA 4E5MA 5ICMA 2BHTA 1MC8A 3DAOA 3TTTA 3CGWA 2XR1A 5DBOA 5KOIA 5CB4F 5GAJA 1NN5A 5ERXA 3A58B 3PX2A 2JFQA 1YZHA 5TIIA 4ZI7F 1HURA 4CKBA 1X9GA 4A0HA 3MGAA 1DOAA 5CM9C 5KNDD 4CFZA 4HDOB 4O6VA 2WUVA 4F72A 5MN6A 4ZCSA 3N0RA 4DMUB 3ZWCA 3PL5A 1O96A 3HKDB 4G0XA 4OXIA 1M6HA 3DE1X 1XU4A 4YPVA 1FDVA 1XR3A 1WB6A 3C8ZA 3M4JA 3PI7A 4XUEA 1KAMA 3JRNA 5TS2A 2ZRKA 3TW0A 3Q1LA 4XD2A 3K0SA 1MIOB 2XNDA 4KXQA 3GPDG 1MV8A 2PL5A 1YRQA 3AV0B 3DZ8A 4L78A 1WXWA 2XVXA 4GLOA 4EMTA 4UUNA 2F8SA 3MMSA 4IHJB 2FTKE 3HWSA 3TQTA 3O31A 2P11A 3DDUA 2HL6A 3FZGA 4RF2A 5EXXA 4OHRA 1NVWQ 3EZGA 4Z0HO 2OFOA 1JMKC 2OOKA 2Z8YM 3OCYA 1H0HA 4LSZA 4WXHA 4EWLA 5LC1A 4B1FA 3IHWA 1WCIA 2RGUA 3B78A 1K2VN 2ZT8A 1W48A 1X7GA 5EUCA 1RAEA 4FQ8A 2CVQA 4HN4B 4P53A 4H0NA 3ZGXA 3BMXA 5TF4A 1XXHB 3OEWA 4RPLA 1A9OA 2PANA 3LXRA 1H8HA 3NNDA 3ZGYA 4JX8A 2II6A 1GAWA 4KOAA 2HCJB 5JY1A 1A50B 2B4QA 2GS9A 4RIHA 1E1MA 1Y6FA 3AH8A 6REQB 3W1WA 4IFTA 5P21A 3U17A 1P44A 3EZ2A 2G82A 4EKIA