2OESA

Msreca-native-ssb
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
327
structure length
319
Chain Sequence
QAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
molecule keywords Protein recA
molecule tags Recombination
source organism Mycobacterium smegmatis
total genus 83
structure length 319
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2007-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oesA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oesA01
1OPXA 4BLOA 3A4NA 4Q1CA 1Z22A 5K8UA 2F9LA 3K9NA 4GNKA 5P21A 3MLEA 2H8KA 2VHUA 4ASUD 2HJGA 1GSIA 8OHMA 4A36A 2ORWA 1W47A 2GVDC 2XOKD 2O8FB 1QHYA 1UKEA 5EP1A 5FTNA 5K8IA 1G4UR 1P9RA 4NYJQ 1TU3A 2J41A 3TJZA 4DEXA 4ZCMA 4IRUB 4H9GA 3PJRA 5EXXA 1II0A 2IWHA 2GTPA 4KFUA 2XZLA 4TYYA 4GMXA 3ZGXA 3SHWA 3WMGA 4S2EA 1KOFA 3THXB 4B3GA 1KTVA 2RB4A 2ZS9A 3T1VA 4TYPA 3U4QA 1Q1EA 1RRFA 1SKYB 1ZD8A 2YVUA 4A0FA 4AY2A 1VPLA 3RS3A 1CS4C 1R0XA 1KMHA 3AF2A 1M34E 1KO7A 3HP1A 1ELOA 1ZAKA 3A1VA 3FPAA 3OFNA 4G5SA 5D3MA 1DEKA 2QBYB 2HDNB 3BORA 4UXHA 2CMKA 2CL7X 5KSOA 1KK2A 2DR3A 4BFUA 4KODA 4K81B 5EXTA 5A0FA 3OE7A 2QT0A 5L3SA 4LHZA 5CB8A 2IF2A 2N42A 5FFMA 5JWRA 1ZUHA 2D74A 4B2IA 2O8EB 4HLCA 4DKXA 1P61B 4JT4A 1TQ6A 1Z6XA 3WY9A 4KBGA 4ERNA 1P6XA 3I5YA 3U7GA 2YJTD 1XZPA 5FL7A 3VQTA 2FH5B 3CLVA 1W48A 4FMBB 4U02A 2QAGC 3CB4A 4JS0A 3AVTA 1P2VA 1G8YA 3AVWA 3GEHA 2J7KA 3AGQA 2LKCA 2P6UA 2VP0A 4JLVA 1OXXK 4JLDA 4TQUS 4DIEA 1N25A 1UKVY 4F38A 4TMWA 1L7VC 1NMZA 4A9AA 1OFUX 3RRNA 3QPUA 4IVRA 4YMUA 1II9A 3IILA 5DHAA 4IDOA 1OXVA 3NBFA 3LW7A 1GKYA 2C95A 1OE0A 3UMSA 4MKFA 3T1QA 1RRCA 2TMKA 1AM4D 2BV3A 2VSOA 4FCTA 4I1VA 4QHYA 4QRHA 5FOTA 3VX3A 5DISB 4CEJB 2VPPA 2WWYA 2IYZA 1FNNA 2P0EA 1N5KA 1R5OA 4BFVA 4TT3D 2DWQA 5IF9A 4OK3A 5JBQA 2WSMA 3KUCA 2ZJYA 5DN6D 1W4RA 1TQ2A 4PPNA 4C7OA 1SXJC 4A6XA 4ZO4A 4BE7B 4UNRA 2FF7A 2OFOA 1YR8A 5TVKA 4GL2A 3SN6A 5FL7D 2EFEB 2O8DA 3VNUA 1PUIA 2FNAA 2VHJA 4D80A 2PX0A 3LFUA 1YRBA 3C41J 3JZMA 4DLRA 2JLRA 3D6TB 2ZRGA 4LJYA 2FFQA 2J45A 2VP2A 4PC1A 4JLOA 4Q1EA 4QBFA 4TLEA 2FWRA 2B8WA 1A2KC 2X19A 2WMNB 4M1OA 1H8EA 3AF4A 3B1YA 3LY5A 1G7SA 2ZI7A 3QXHA 4DXAA 4I1SA 1J70A 1N6IA 4G5GA 5GVRA 1FTSA 4L4UA 1TU4A 5EP3A 4PAQA 1GL7A 1K8RA 4CGZA 1N0VC 4A8JB 4HAZA 2HJVA 4XTCS 4B34A 1XXHE 2RGNC 1DAIA 4ZDIA 2ZSEA 2NZ8A 4QKQA 2QP4A 1LF5A 5A5GA 1EWRA 5J4HA 4TLDA 2E1RA 4B33A 4WOPA 2J5XA 4N1AA 4LC1A 1XDBA 4EPTA 1NMXA 1E0KA 1G20E 2QG6A 3KUDA 4MRVA 4ZI3A 4PC3A 3K8YA 3EZ2A 1R0WA 3RHFA 3QE0A 4QBIA 4G0NA 1K5GA 1XD2B 5FUYA 4RFVA 3GMTA 2O52A 3BH0A 4IOLA 1P60A 1WXQA 2DY1A 5L8VA 5DO9A 1SZPA 2BCGY 2GBLC 3CWQA 4XOIA 3U7EB 2IUSA 1P9WA 2RGAA 3PEYA 3RWMB 5GJBA 2QORA 2OXCA 3FB4A 1NG1A 3QXXA 5K8LA 4US1R 1JJ7A 4TZ6A 4DB4A 5BYJA 3QKTA 3QXSA 4R7ZA 1JBKA 4Q7LA 4L9WA 4DLZA 3KQHA 2WM9B 2I1QA 3B82A 1ZP6A 1AIPA 1GAJA 2W6JA 2YWGA 4IJMA 1W4AA 3CF2A 5GJVC 4LYJA 1G4AE 1DE0A 2ERYA 2IXFA 3NIBA 1E2GA 4AC9A 1EX6A 1Q1QA 3ICQB 2QP9X 1FMJA 2HYDA 3AVVA 3A4MA 1XPOA 3NBZC 1TEXA 1RJ9B 3ZZUA 4MH0R 2A5GA 1E98A 3VR1A 2O8CB 1P75A 4LYHA 4PANA 3FKSA 4ITRC 3AB3A 1G3UA 1NKSA 3FMPB 4JMPA 4WZAE 3SE0A 4I81A 2CJWA 4MGIR 5JWOA 3GEEA 5E7MA 4ABYA 3O8DA 1D9ZA 2CL0X 3DM5A 3V9PA 2A5FA 2JJ2A 4AWXA 3L0SA 4LHWA 5L3QA 2AD1A 1FZQA 2IYYA 2VO1A 2RKOA 1WP9A 2JJ1A 5AWFC 2V54A 2OLKA 3Q85A 1D2NA 2IEYA 4JBYA 4UNPA 3ZDQA 4EJSB 5BWMA 3C4JA 3REGA 5JI2E 1CLUA 3EWAA 5LB2A 1ODFA 5JFGA 4Q9LA 3TW8B 4C0BA 3ZIAA 3AP3A 5JSZB 2BC9A 2W6JD 4LV6A 1YZLA 3HYRA 5IRCD 1GDDA 2P5TB 4Q00A 5DLQC 4AYXA 4DVGA 3FTQA 1GRRA 3D7MA 3LNCA 2WJGA 3GLFB 3THWA 4KV9A 1G5RA 4GP7A 4LC0A 3DMDA 2CNWA 3OHMA 5DI9A 5AR1A 1Q20A 4QXAA 2E87A 5G3YA 2CCKA 4OK5A 3TKLA 2ZRFA 4YXWA 2J0VA 2C9YA 4TWZA 3NEJA 3BERA 4XD7A 3N5CA 1DS6A 2ZYUX 1HQYE 2BBSA 4UXIA 1YZUA 3FHTA 2R44A 1AKEA 3WRYC 3B8HA 1MABA 2OG2A 3DEFA 4A8JC 5E3HA 2OSBA 1JJVA 1NLZA 1GWNA 2ZRHA 3QKSB 2JJ2D 2RCNA 1KI1A 3FFAA 3IGFA 4IEEA 2REOA 5DI3A 2FPKA 2JJ1D 5E95A 4A1FA 3TVDA 4R71A 1P62B 3RYTC 3J81k 1W5SA 2GZHA 4NCJA 5JHHB 1P7CA 2DFTA 2QAJA 5FL3A 3ZS8A 5AUNB 2EU8A 2IS2A 3FMFA 2VSFA 4TQ9A 2GF9A 5J4KA 5FI0B 4A2WA 1Z3IX 3AKDA 2WKPA 4EUNA 4RJLA 2DB3A 4LHYA 4PQYA 4PZZA 1NBME 3UXMA 4RZUA 1QDEA 2GZAA 1NSTA 1G8PA 2GKSA 4LCBA 4RZ3A 4XJXA 3A36A 1CR0A 1XBTA 2Q6TA 3WRXC 4JLPA 4QHSA 1TNDA 3ZVMA 1Z6YA 4HAXA 4B6FA 3IEVA 3GPLA 4XTRA 4YXWD 4DWJA 4HYYA 4XD7D 3TW4A 2J0SA 2FJUA 2QSZA 3MD0A 4ACBA 4Q4HB 2D7DA 3GEIA 2IL1A 3KB1A 3GLIE 3NBXX 4HB3A 2GEUA 1M7GA 1NVWQ 3HYTA 3SBEA 3I8SA 4A0RA 4TYNA 2HCJB 2QTFA 1JR3D 3DVLA 3LDAA 4HB2A 1T5IA 4Q7KA 3HR7A 4CF7A 1XX6A 1NY6A 2P2LA 4BZQA 3VHLB 3BD9A 1FP7A 2ZSAA 2ZAMA 4DCNA 1N6LA 3KKQA 4MGYR 2OAQ1 1GM5A 4PQFA 2VBCA 1VG1A 3BIFA 4DLVA 3QG5A 4M0LA 3RC3A 3ADCA 3G5UA 2YWHA 3CNNA 5J47A 3QXJA 1AA3A 1KYIA 1MO4A 2G77B 3U3RA 3EZ7A 1E3MA 3CX7A 3TQFA 1EFRA 4EIWA 1VG8A 3HU3A 1BO6A 4KXFB 4DDUA 2X8AA 5G41A 3U3OA 5KYKA 3CRW1 1XTRA 2KWIA 4HSEA 1IN5A 4QNMA 3EIHA 1QZXA 2ORIA 1G291 2E9SA 4CIDA 1FX0B 2EWWA 1I2MA 4RZ2A 4D2IA 4C30A 2GA8A 2VSXA 4OQLA 2WWWA 3VU9A 1Q57A 2MSCB 3BE4A 3FDIA 3ETLA 4P4SB 1S2MA 4RCYA 4PC6A 4LJ8A 5SZIA 3UWOA 5F3WB 1OIWA 2LKDA 1KAOA 4Q01A 1UKYA 3CRMA 1JXOA 4EQ6A 2B8TA 4Q4LA 1IN4A 3FYHA 3PCRB 5GVSA 2A5YB 2IS1A 3RABA 4M53A 3P26A 4B75A 4V0KA 2QRZA 4LV8B 3C5CA 1ZCBA 1VG0B 5H68A 4CYMA 4Q1FA 4QM6A 2IA5A 4AG6A 2NO6A 1BIFA 3Q8XB 2VHCA 5HZKA 1CR4A 1U8YA 2XJ9A 3CPHA 4OHVA 2YZ2A 4TN1A 2HUPA 3MWKA 4HLQB 3DDCA 4MGKR 3C5HA 3GQBA 2N46A 1TF2A 1YE8A 1MO3A 2VEDA 2XAUA 1ZC4A 4KLZA 1HT1E 3LQRA 2DWOA 1JECA 1N0WA 1KO8A 1YZGA 1FW6A 4LBYA 3QKRB 4HEJA 3W90A 4L15A 3AUYA 4QGAA 2VF7A 4FCWA 1XCMA 1UADA 2ZEJA 4CRWB 3ASZA 3Q5EA 3UIEA 3C8UA 2MSDB 1F2UA 5FPSA 2YWFA 2AD5A 4QJ5A 3QEOA 5J40A 3QBTA 3T35A 2ASEA 5CJ2A 2OAP1 4RZXA 3I5XA 1KI9A 4EPXA 2GJ8A 2REBA 1EFHA 3QEJA 2ZJOA 4B6EA 2PZEA 5AUQA 1AN0A 2QPOA 2XTZA 5AJVB 4QBGB 2QTHA 2IS4A 2FA9A 2P6RA 4Q4HA 3NTUA 3GFTA 3SI7A 3K09C 3GLHA 1U81A 1F60A 1E9AA 2DBYA 4WZ6A 4Q1AA 4TL6A 3S1AB 4XSHA 1OLOA 5KUTA 2YINC 1DAHA 1GNQA 2NMVA 4KJZA 2J87A 4B3FX 3I4LA 1N5LA 2JASA 5JHGB 4AG5A 4W5JA 1X1RA 2C99A 1RIFA 1WF3A 2WMOB 2FOLA 1D9XA 5C46F 2NTYC 2QZ4A 3VTKA 3KB2A 2ZRKA 2CL6X 3SS8A 2FMXA 1HE1C 1ZM2A 2DYKA 2RGCA 3U6BA 3SEAA 5AJWA 2CE7A 1KAGA 4AYTA 1CJKC 4ESHA 1KI2A 4ESVA 2O8BB 4TLBA 5AUPB 1E2EA 1EXMA 4JBWA 3X1XA 3T1TA 4ZIRB 4P3YA 3AVXA 2CBZA 3ICEA 3BXZA 2Q3MA 2C9CA 1TL7C 1FX0A 3IBYA 2ATVA 3KJIA 3LLUA 4JLBA 4KCGA 4Q4AA 4RD2A 3O8RA 2WTUA 1EG7A 1E2HA 2OCYC 1G3RA 2C03A 3B1VA 4EPYA 2ECKA 4Z51A 4GPTA 4B3CA 3AH8A 2HYIC 1TADA 1AS0A 4FN5A 4X8MA 1FTNA 3RNLA 3IHLA 2QGZA 1EFCA 3QF7A 3QNUA 4URUR 4QC2A 3P4XA 5JJIA 3OEED 1KK3A 2Z83A 1YR9A 2CHQA 1QF9A 3PUYA 1RE0A 1JALA 4GMDA 4U7DA 1E9EA 3DKPA 4HATA 1G41A 2BBWA 2AWNA 3EW9A 3RS5A 5B64A 5EE3A 5J5CA 1E0SA 1XF9A 1E32A 1XTQA 4V03A 4TL8A 2IYWA 1R5NA 1D6JA 1DELA 2OBMA 1WB9A 1OIXA 2WHXA 2ZJAA 1RYFA 2O5VA 3H1TA 2VP5A 1XJ0A 1GUAA 4LBZA 2OEPA 4LI0A 1NG9A 1W0KD 1ZYUA 1FNMA 3WMEA 4NYMQ 3VKWA 3BB1A 3U4QB 1GVNB 3IO3A 4M2LA 4ACAA 4AKEA 2JATA 2QPAA 4MYUA 1CJVC 3X1DA 4RKEA 1ZNYA 5EE1A 5CJPA 1QBKC 2PMDA 4D6PA 5D3MB 5KDOA 2V1UA 4DIDA 3MWLA 1HT2E 1YKSA 2BBTA 2JDIA 3LO5A 2F1JA 2WPDD 1Y63A 2OZEA 5G53C 4M1TA 4ZDWA 1TUIA 2XB4A 3DHWC 4W7SA 4FWTA 2A5JA 4HDOB 5L3SB 1KNXA 4WIAA 5KNDA 2Z43A 1LVGA 3K9LA 1R10A 4JKIA 2O0KA 4GFDA 3VKGA 4B73A 2GF0A 5HKKA 3MMPA 3HR8A 2BWJA 3CF6R 2G83A 3EPJA 1UPTA 4B47A 2GXQA 1ZUIA 4V02A 3UATA 2OILA 2OM2A 2IS6A 1KSHA 1T0JB 2CHGA 3NHBA 2FN4A 2C04A 5BYKA 1NVUQ 5HE8A 3U61B 1IN8A 2W0SA 2AK2A 2LWIA 4TLAA 3R9IA 4B3BA 2G1JA 4G3XA 2V7QA 1T91A 4R2HA 3SYNA 2VP6A 3SFZA 2ZRLA 2AK3A 4BFXA 5AUOB 4Q19A 2PBRA 3GLGE 2JDID 1KDPA 5IDVA 1O3YA 1WRBA 1C4OA 4PXAA 2J7PA 4BLRA 1LTQA 1YR6A 4NCIA 2H18A 4EKDA 1Q1BA 4OKSA 1HE8B 2QN6A 3EA5A 1Z8FA 3ZVNA 1E99A 1U9IA 2XX3A 3TVTA 1BOFA 3KQLA 1WA5A 2D7CA 4PSAA 3T15A 4A92A 3GP8A 2O8DB 2ZRDA 3P32A 1Z07A 4G5OA 3I72A 1CJMA 1AZTA 2WWIA 2YOHA 4HI0E 2AFIE 2PCLA 4PHTA 3UWKA 2Q9BA 2QQ0A 2CCGA 3K9GA 1QVAA 1P9NA 3U44A 1VCNA 2QA5A 4GSYA 2R6FA 3LWNA 4BFTA 3A1TA 5EXPA 3Q72A 4JVNA 2W2VA 1DG1G 2V7QD 4AIIA 1UBEA 1CULC 1W0JA 1KSGA 2F3TA 2EW1A 3B60A 1NN1A 3BB4A 2GXAA 1FPMA 2D06A 4LJ7A 5E7IA 1VCMA 2CK3A 1KKLA 2WOOA 1GFIA 3QF4A 4M1SA 4OI2A 3ASYA 4IXMA 5JCPA 1OW3B 3NBYC 4YMTA 1UBCA 4URWR 3IO5A 1G1MA 4PHGA 2DFNA 5GJWC 1ZCAA 3SQWA 4DB2A 1N6OA 4HAVA 5J4YA 4QL3A 2OESA 2UVQA 4C0SA 4BEBA 4NHOA 1J2JA 3U6KA 3I1FA 2OHFA 3K1JA 2ZI6A 2GRJA 4WAUA 1Z5ZA 1W1WA 4BFZA 3ONWA 2DCUA 2Z4RA 3LBNA 3AEZA 3KTAA 1KZGB 1YZQA 5FBQB 1SVKA 1N6RA 2GJ9A 3T1OA 5C2JB 2O0JA 4YMWA 2OCBA 3KL4A 1CU1A 1KKMA 1M8PA 2G1KA 2YYZA 5SZHB 5IT5A 4TTRA 4G5RA 4YMVA 1UAAA 5ANRB 1SXJE 3M6AA 4X8HA 4ZPXA 4NCNA 5DHFA 2BJWA 3REFA 3AKEA 2WICA 1DAGA 3WP0A 2OBLA 4GRAA 1KDTA 2CK3D 2GCOA 2ZR9A 1PV4A 2QMOA 3PIRA 2G88A 1R8QA 1SVLA 4ZCLA 3ZZTA 1S3SA 5EUQB 1NVVR 1RPZA 4KLNA 2NIPA 4Q5IA 2EWVA 4BLQA 621PA 3I8XA 4MRNA 2J0QA 1GL9B 1IHUA 3OESA 4JSYA 1WBDA 4II7A 1R6BX 4A0GA 3OFND 3NDBB 3DOEA 3KQKA 2OFWA 4O2LA 3QENA 4Q9KA 1XD8A 3SJCA 4JYCA 4D0GA 3WBJA 3E2IA 1UM8A 5JI3E 4HAUA 4R98A 2EFCB 1Z06A 1SGWA 4UNNA 4DDTA 4LJ4A 3PEWA 2Z5FA 3TRFA 3OE7D 3X1WA 1X1SA 2CJWB 2GILA 3BFVA 4OI0A 1VKJA 2JA1A 4YQFA 1E2PA 2ZI3A 3H86A 1SKYE 3R9XA 1Z6GA 2PEZA 3PEVA 5CITA 3ND9A 4B2LA 4OK6A 3VAAA 3H84A 5L3QB 4JJZA 1EX7A 1F6BA 5J4LA 3T5DA 1DOAA 1OH7A 1GNPA 2YC2C 1GL6A 4X8LA 521PA 4D0LB 4TMKA 2ATXA 1F3OA 2KBFA 4L16A 1OXUA 4Q18A 1KSJA 3RRZA 2ZU0C 3RSOA 3W3ZB 4B2PA 3UG6A 4QOSA 4P0TA 721PA 1B0UA 2UZ3A 2VTKA 1R8SA 3THWB 4M1KA 1Q3TA 4MRPA 1TF5A 4QNRA 4JBXA 5CK4A 1JNYA 4DSTA 3CNOA 3R9WA 1T6NA 1A5TA 3C16C 4IOJA 1UKZA 1SVSA 1WMSA 2NPIA 3VR2A 4NCKA 1W2GA 1MABB 4F4JA 3VR5A 1L2TA 4C0JA 3K70B 5KHOC 5CIQA 3JZAA 1NN5A 3CWZA 1J7KA 1KY2A 4PFSA 1E79A 5DI3B 3TLXA 2BCJQ 4PHFA 1YJ5A 3W8NA 821PA 3DM9B 2ODBA 3RANA 1E2QA 1EWQA 2RGNA 4Q9IA 2WVJA 5CYPA 1S1MA 5LPNA 3Q3JB 3UPUA 1M1YE 3ZH9B 1XP8A 4A0HA 1D2MA 1E9FA 1OH8A 1P3JA 2A3RA 2WJIA 3RS4A 1H8ED 3KKNA 4C4PA 4TSFA 5FTKA 3Q7PA 5H1YA 4KSCA 2QMEA 2MMGA 2BHRA 4B74A 5EE9A 4ZI2A 1JPJA 4W5WA 1VHLA 3C7KA 3FFBA 5FOVA 2WV9A 3VX4A 5A4JA 3VFDA 3CONA 1H8HA 2B7CA 2OE2A 1W36D 1OF1A 1IY0A 2J9RA 4W5HA 3P1JA 2HEIA 3P20A 3CIOA 4Z1MA 3ZD7A 4NYIR 3U60B 3MUFA 3B78A 2GBLA 2XZOA 1MRSA 3MG9A 4N0DA 4DSNA 2K5UA 4ZKDA 4XVQA 2FGKA 4QJ3A 3N2IA 1BS1A 1CEEA 1GOTA 1ZNXA 4KFTA 1P4SA 2RAPA 2ZU6A 1BKDR 3AGPA 1EK0A 4V0NA 3NC0C 1CIPA 1NJGA 4XSGA 1XXHA 3W5IA 1KO4A 1SVOA 5DH9A 4TMXA 3IDQA 1E2DA 3PUXA 3RAPR 1G6HA 2WWHA 2C98A 1E1QA 3ADKA 4TSFD 2RGEA 3DO6A 3F0TA 2IX3A 2GHIA 3CPEA 2XTNA 2V55B 3U3KA 5DSZA 4BFYA 2V9PA 4CZ2A 4G1UC 3UG7A 3RWOA 5CIWA 4TLCA 4WZBE 2NG1A 1PZNA 3L0OA 1JR3E 2H92A 4XWOA 3LLMA 3D8BA 1SKQA 1P73A 2FG5A 3KQUA 4TYWA 5JRZA 3O47A 2ZUCA 3AQ4A 4M9ZA 5EXSA 4MYCA 3VR4A 4IDNA 3WMFA 3VU9B 5BN5A 2R6DA 2YKGA 1P5ZB 2D4HA 2EYUA 2G3YA 2YHSA 3L82B 4I99A 2UKDA 5DYIA 5CDFE 1NMYA 1W4CA 4WVFA 2F43A 2H57A 3H4MA 3W9YA 2IYUA 3MFYA 4EQ6B 3N2EA 4A15A 1Q12A 5G3ZA 3FKSD 3R7WA 3NH9A 1VG9B 1I2DA 5TARA 2OCPA 3EIEA 2CE2X 1E1QD 2QM7A 1RZ3A 2O0HA 3U2QA 3O8CA 3A8TA 2QTVB 4NTZA 3OAAA 2GXUA 1AA9A 4FW9A 2ZSDA 4MYTA 2BVNA 4XH9B 1IXZA 1FMLA 4QBHA 1YQTA 3QVVA 2ZPTX 1LNZA 1RVDA 2F9MA 5HZHA 5C4MA 1MH1A 4M8NE 3ZIAD 1GRNA 1CRQA 5LD2B 2PZGA 2YC4C 1VMAA 3L43A 1E94E 4G01B 4BFWA 2IUUA 2Z0MA 5JECA 1JR6A 3TR5A 3A1SA 1M74A 5IK2A 2D3WA 2AR7A 1SVIA 1S9HA 1NP6A 2CNWD 1F2UB 2QPTA 3I73A 3VR3A 4LHVA 3LV8A 1W44A 1KZ7B 4Y0AA 2BEJA 3SJAA 5C1BA 3W6PA 4I4LA 4NMMA 1W5TA 2CCJA 5FUXA 1E2IA 3BFKA 2KJQA 1XEXA 1G7TA 3GLHB 3K70D 3E70C 5KDDA 1KI6A 5EJEA 2ZR7A 4D4JA 1XJQA 4V0OA 3TNFA 5UKDA 2QU8A 5FH9A 1MKYA 3VNVA 2PL3A 4GBMA 4NH0A 2CHVA 2ZVQX 3ZVLA 1FOEB 3GLFE 1CP2A 3WHKA 1N0UA 4TMVA 4DSOA 4FXPA 5FPKA 1QHHA 3EC2A 1UEIA 5LB4A 4LJ6A 4B44A 4PZYA 5AK0A 1G3QA 1QHSA 2FV8A 2FZ4A 3QY0A 4MQBA 2FSIA 4KVAA 3QIAA 3TSZA 1VCOA 2X77A 4DHEA 2J0UA 2QT1A 4US0R 1AQUA 1OH5A 1WQ1R 2XTMA 1N6HA 5IK2D 4Q7MB 3IEUA 4U5XA 2ERXA 4DLTA 5H8WA 3QVUA 4EFLA 2ZROA 5FBLB 2PMKA 1NL3A 1HQCA 4EJSC 3GJ3A 1T0HB 1NBMA 2QE7A 4AKHA 3TUJC 1NJFA 3PVSA 2CVHA 2Z4SA 2ZYTX 3BS4A 2QNRA 2BMJA 3A37A 3KZ1E 2ZE6A 4Q4AB 1G9XA 4TTPA 1SVMA 2IC5A 2KBEA 4RD6A 3SNHA 3CZQA 1AQYA 2A9KA 3OIYA 1D2EA 3NG1A 4TYQA 1QVRA 5JEEA 1UF9A 1Y3AA 4PR0A 2ZIAA 5SZJA 4C0QC 4ILEA 4QGHA 2OV2A 4EPRA 3RLFA 1X8LA 1NY5A 1XEFA 2JIZA 2BKUA 2C78A 3CKLA 3F5FA 1CXZA 3NXSA 5C4GB 4U00A 2JJ8A 4IKEA 2I1VB 2IF0A 3L0IB 1HY3A 5SZKB 4P4UA 3EC1A 421PA 3GLIA 3RVBA 2WWFA 2OBNA 1OSNA 4OHZA 2WJJA 2HT6A 5F2EA 1OV4A 1E2NA 1SHKA 1ZM9A 3GJ6A 2ZJ5A 3TGPA 2ZS8A 5KOYA 2QMUA 3BK7A 1CR2A 3PUVA 1T9HA 1ZRHA 4OI1A 3FOZA 2NO1A 1EFRD 2R9VA 5FI1B 3HU2A 3HPRA 3QJYA 1DPFA 3AVPA 3LRPA 4OJKA 2JLXA 3A58B 3CZPA 3B1WA 4FCVA 1JB1A 2Q3HA 1JQLB 5EZ6B 1CJUC 2R6CA 1II8A 3EZFA 4HLDA 4CEHB 4UJ5A 3AUXA 1U99A 2WWXA 3SOPA 4KVGA 5FBRB 2HXYA 3KKPA 4NKRA 1CKEA 5JS8A 1G16A 4KBFA 3I3SR 5LD2C 2NOAA 4NE2A 4DLSA 3TH5A 1R2QA 4A4DA 4F91B 1YU9A 3M4YA 4A6PA 1K5DA 2A2ZA 2JIZD 3UKDA 3K0FA 3DOFA 1U8ZA 4BWYA 4A82A 3Q5DA 4BECA 3BFXA 4JKYA 1JAIA 1TPZA 2OFXA 1UBGA 1G8FA 3CRRA 3LXXA 4OBEA 4RKFA 4BPBA 3B2EA 2BDTA 3W8RA 1S1CA 4M9SA 2AWOA 2FGJA 3AVYA 1AGPA 3BJIC 5JZVA 5HE9A 4BZPA 3X1YA 5HCNA 3THYA 4BFSA 2ZRBA 4B71A 1XU4A 2ZJZA 3W6NA 1U2RA 3HJNA 2VQSA 3D3QA 3EARA 2WKRA 3A6PC 1US8A 4FD2A 2NPFA 3K09A 1U90A 4OI4A 1E1RA 2ZI4A 3THOA 3TMKA 4F7WA 2XB2A 1VHTA 4DDWA 2QEQA 1X8KA 4PO1A 3NEYA 1VYUA 1GKIA 1MO6A 5E7JA 4PPQA 2QQEA 1S8FA 1TUEA 1E0AA 3QQ5A 3SYKA 1X86B 5EE0A 4ON9A 5F9HA 2IHYA 2EVWX 3OEHA 5GJCA 4GOJA 1I4DD 1KNQA 1OFIA 1Q21A 2I3BA 3F3YA 1YRAA 2W0MA 1PVOA 4PTLA 1Q3HA 4EFNA 1CF4A 2BKEA 4JIMA 5JCZA 3PITA 4M4SA 5HTKA 1HEIA 2RGBA 1N6KA 1MRNA 2BJVA 3K0CA 2ZQ5A 1XCGB 4HZUA 5KPJA 1E4VA 3CM0A 5EE5B 1XCPA 1XNJA 3CBQA 3L0PA 3N70A 4TTQA 2R2AA 3T06B 2BMEA 5JJLA 2IK8A 4KYUA 1M7HA 4KYIB 5KTYA 3ZQ6A 2ZTSA 1NSFA 3OIUA 1KI3A 4POAA 1Z28A 1KJZA 2ZRPA 3K0AA 2DWPA 4FMCB 4KFSA 3WNDA 4UNSA 4KSBA 1F48A 4WXRA 4EPVA 3CF0A 4KO8A 1DAMA 4LJ9A 1IONA 3IBGA 4P31A 4V0ME 1LW7A 3U44B 4DLXA 1PLKA 5JEDA 1K6MA 4RVCA 4PQRA 1N2CE 3MJHA 4PO8A 2ANBA 3B7GA 1A82A 2VP4A 1RC8A 5EZ5A 1J8MF 2V6JA 5FTJA 4YDSA 3D31A 3CO5A 2HF9A 4LBWA 1OT3A 4NONA 2C2HA 1E2LA 4WBSA 3IIJA 2QENA 4LZZA 4JT2A 2ZUBA 1IY2A 4UQOA 1KMQA 1Z6TA 2YOGA 5F98A 4HAWA 2XZPA 4M1YA 3QF4B 4M1MA 2ZRJA 2A7QA 1IM2A 2GCNA 4Y0VA 5TV2A 1ZINA 4EAQA 2ZJ8A 2C77A 3L8ZA 4CEHA 3CR7A 1A1VA 2MSEB 2Y8EA 2FSFA 2QL6A 4YLGA 3KJEA 4D82A 2DPXA 1OYYA 3TUIC 5FTMA 1OYWA 3MAAC 1E9SA 1KI7A 2CLSA 2VYFA 3B1ZA 4LRWA 3KQNA 3EG5A 5CLQA 4Q9HA 3I92A 2H16A 1JAHA 1VYVA 4D81A 3KTAB 4E22A 2AL7A 3QBVA 2ZJBA 3G0HA 3NVAA 2JLSA 1NN3A 2XJ4A 4US2R 1DAKA 3K53A 3PUZA 2FEMA 4JL8A 4PZLA 1G8HA 2N1BA 3B13B 1TAGA 1XPRA 4RFSA 4O25A 4D4LA 2GCOB 2IUTA 3WP1B 1TEVA 1JEEA 4XWAA 2BIFA 1TQ4A 1MOZA 1UFQA 3R20A 4DC9A 1D8TA 3QPWA 1NLFA 3CW2A 3W34A 4CEIA 4PSKA 2NO9A 2PJZA 2QROA 4HUQA 1IAQA 1XJCA 4OQXA 3IPYA 2D62A 1YZTA 1DARA 1OJLA 4UKDA 2FFHA 4FMDB 2GEVA 4LGMA 5HCIA 4EDHA 4RD4A 2QAGB 4L9SA 3GJ4A 2XXAA 3CX8A 3HU1A 4DCSA 3WNCA 3CUEF 3R8FA 4LYAA 2JAQA 3QOFA 2SHKA 4GDFA 1XRJA 3PG5A 1XEWY 2QI9C 1NN0A 5LBIA 3VR6A 2QM8A 1I4TD 1KHTA 1JQJC 4ASUA 1YVDA 3CRQA 1RRPA 1VIAA 1G17A 2XOKA 1W7AA 4HLUC 1G18A 3EX7C 1AK2A 1LS1A 4IXNA 1F2TA 5HKKD 5FR1A 4O2RA 2WJYA 4UXJA 3I32A 4H1VA 3TE6A 4J0QA 1U0HC 4LV5B 5HR5A 3LVQE 2CLCX 2G6BA 3KXLA 2VIIA 1AGRA 3FMOB 2EFGA 1G21E 3EIQA 3AKCA 5BQ5A 1T8UA 3BH6A 2ZXUA 1KI4A 2W6IA 1AKYA 1SXJB 4RD0A 4X8OA 4AK9A 2FFBA 1NF3A 1EGAA 1B23P 1EFUA 4IOMA 4HZIA 2GK7A 3RSLA 4E09A 2CLDX 3RS7A 4BASA 4GZLA 1P2TA 2IHBA 4QM7A 1JXMA 4IHQA 1AS3A 2KE5A 1IY1A 2ZE8A 4NYIQ 1QHXA 3LW8A 2YNMA 1E2FA 1W36B 1MO5A 5KSZA 1GTVA 4C2UA 1N5JA 1GKUB 2PCJA 2ORVA 2R65A 1L4UA 2J7PD 1XD9A 4N3NA 3QI2A 2IYRA 1DO0A 3SU8A 4JL5A 4BUJA 4Q9JA 4YONB 3FWYA 3RC8A 1E9DA 2WAYA 1ZM7A 3AP2A 4Z8YA 1KI8A 3GLGA 3DZ8A 4ZCIA 3PEUA 4Q1DA 5CK5A 3VHXA 3KFXA 4BEJA 2ZYWX 2IWRA 1E0JA 2ZVPX 3IQXA 1BH2A 2NO7A 2KB0A 2GK6A 1Z47A 1OFHA 1RW4A 3U3MA 4URVR 2ZI5A 3DZDA 1XB2A 1S9DA 3IPXA 2W6ID 1NIPA 4JYBA 1GILA 4Q02A 4NU0A 4M1WA 4Q4JA 4OQNA 2D2EA 3MWYW 1ZNWA 5IHPA 1W0JD 5H70A 1Z6AA 2NO0A 3RRMA 2XNDA 1E9RA 2PEYA 1OB2A 1J99A 1UDXA 1Q1ZA 2VHTA 3EZ6A 3PV0A 3LBIA 4URXR 1U0JA 3ZLJA 4G5QA 1T3LA 4BQSA 1D5CA 5GADl 1X6VA 5TY0A 2QRNA 4DSUA 3QG1A 4QGGA 2ZM5A 3BBPA 4TT3A 3EPKA 2OCAA 2QGNA 2ZE5A 5C18A 1A7JA 5DN6A 2ZI9A 2BM0A 1R0YA 3CPJB 4D26A 5CLLA 1DVRA 2QAGA 2R6AA 1F5NA 1HUQA 4FMCF 2IEZA 5EQTA 3KJGA 3LXRA 4ARZA 5CM9C 2AKAB 4C2TA 1X3SA 4E07A 1CTQA 1CJTC 5LDDC 1SHZA 1XXHB 4TZ0A 1JEDA 2OXRA 1S3GA 5DGXA 4HUTA 2YV5A 221PA 1LF0A 2J3EA 4LJ5A 4MDEA 4DT1A 4YDHB 4GI7A 2AHOA 4QG7A 3K9HA 4NYMR 3IHWA 1VCIA 3IKJA 1KO1A 1ANKA 3TSOA 2XNDD 3NKVA 4BGDA 3LX5A 3TUZC 2A5DA 3WBKA 1ZUNB 2PX3A 1J90A 1G64A 1Z2CA 1ZBDA 1ZU5A 2JGNA 2B92A 3QUSA 2GXSA 2IYVA 1NNEA 5KPDA 3LD9A 1SXJA 2W00A 2WOJA 3ZJYA 1TMKA 2OT3B 3SJBA 5B58C 1OXTA 4OQMA 2J46A 3L8YA 1Z08A 4MKHA 4RD1A 2HT1A 4Q47A 3B1XA 3EZ9A 1IQPA 2WBLC 1UEJA 3GJXC 5KO2A 1M6NA 4TMTA 2REXB 5KSYA 4Z54A 3BWDD 3NWJA 1G6OA 4LK2A 2F43B 1C9KA 1OKKA 2WIBA 3GJ8A 2QY9A 2DHRA 2GETA 4IDHA 3BH7A 4B32A 3R7WB 1FQKA 4DBLC 1ESNA 1Z0FA 1IN6A 2GVZC 3NH6A 2J1LA 1KSFX 2RGGA 1W36C 3A4LA 4DJTA 3OZXA 3CNLA 1Z0KA 2AFHE 2O8FA 1KK0A 1VTKA 4NPHA 3IQWA 1ZMXA 2CEAA 1W2HA 5D3QA 3ZYCA 4OHXA 1DO2A 3TBKA 1GG2A 2A30A 1UJ2A 4KFRA 3TIFA 1H65A 2FU5C 5J4VA 5TXGA 3W3AA 4HAYA 1IJFA 1AZSC 2ODNA 3LH5A 3THXA 2GJAA 4DZZA 3RS2A 1QHNA 1SXJD 3L2OB 1G5TA 4PAOA 4DCUA 2R62A 1R5BA 1E96A 1R0ZA 3CRVA 4JLAA 2AX4A 4FMDF 3U3JA 5CM8B 5L3VA 3KDSE 2ZREA 3KKOA 1M2OB 2RH5A 2FEOA 4OHWA 3EPHA 1I4LD 1NI3A 5FBWB 2ZITA 4F4IA 2QBYA 2PT5A 5FUWA 4WXPA 2IW3A 1HURA 1OKKD 1ESMA 1SULA 3GJ0A 4IFBA 4JL6A 1HYQA 1L8QA 5JRJA 1XEWX 2WJVA 2ZYVX 1ONBA 2LCFA 4K8OA 5JS7A 3M1IA 4IVQA 4IW3B 4K46A 1W49A 2HLDA 1GNRA 1EFTA 5BN4A 4LSGA 1KO5A 1T3SA 1XEXB 3RS0A 3B85A 3NDPA 1T3HA 1KI6B 5FPYA 2O8EA 3WXMA 3G82C 4GOXA 2F6RA 2IXGA 5B57C 3KFVA 1E79D 3FHCB 5TDHA 2P6NA 4M9XA 3MGCA 1ZIPA 2B6HA 4B76A 3WHLA 1XMJA 1WDTA 121PA 4NYJR 3E5HA 1QHHB 3ND8A 3QKUA 1FQJA 3BOSA 2GJSA 3V00A 1RKBA 4TQAA 3RRYA 5K8TA 2JLYA 2NGRA 3SFVA 4MYHA 2W2TA 3PR1A 1IXSB 1QHIA 3BAFA 4PC7A 1X8JA 4Q66C 2J0UB 4Q03A 4H1UA 3KXIA 4NP6A 2C96A 3NC1C 4FI3C 1PJRA 1KDOA 1YHNA 2GAAA 5EUMA 2Z6VA 1V43A 4LOAA 4BLPA 1H8HD 4AURA 3SYLA 2BMDA 2FX3A 4S35A 4CEJA 4Z1MD 3LVRE 4WW0A 3ZQJA 4OJQA 1GITA 4QFMA 3VMFA 2ZANA 2PZFA 1YR7A 2HLDD 3K0EA 5FOWA 2Q0HA 4FWIB 4DEYA 1ZIOA 3F8TA 5KDLA 2EYQA 4LHXA 1S0UA 2ODWA 1RRGA 4I1UA 4MUBA 4R2IA 4C0AC 3TAHA 1XFAA 3W5JA 5AJYA 3WYGA 4O0MA 3V4RA 2VH5R 4PAMA 4XWKA 1S4QA 1G5PA 4EPWA 2AXPA 3X1ZA 3ADDA 2Q21A 4URZR 2F3RA 3GFPA 2VP9A 4O3MA 5JLJA 3GLIB 2GEDA 4PHHA 2W58A 3ADBA 4DCTA 2QUZA 3SQXA 2RGDA 1KDRA 3P27A 4PSVA 2QP3A 1NVXQ 3CH4B 4FIDA 3KJHA 1N6PA 4TMZA 2ZSBA 2QMHA 1XMVA 3UMRA 3K70C 2P67A 2F1IA 2Q9AA 5KNCA 4CDGA 5CYOA 2AXNA 2OUKA 2XEXA 1TF7A 2NQ2C 3A1WA 3CR8A 1CBUA 4L5BA 2GJKA 2ODEA 5FPHA 5FBVB 1E9CA 4Q21A 4A8JA 3GJ5A 4BLTA 1UBFA 3TSWA 4DLYA 4JLKA 1II8B 1NLYA 3EWSA 4B3XA 1W4BA 2FDCA 5AJXA 5DYGA 2G0TA 2UZIR 1ZD1A 4NL4H 3Q7QA 4OQFA 4ZDKA 5TMPA 1EESA 2ZRIA 4NDZA 2ZS7A 4OL0A 1JR3A 4IDPA 3ZVRA 4NBSA 3K0FB 1G3MA 1DADA 1A4RA 2EQBA 2HXSA 2WJHA 1U98A 2C8VA 4KAXA 4C0KA 1XD2A 4HB4A 2WAXA 1HTWA 1Z29A 4LBVA 4KU4A 5FTLA 4MUAA 3BRWD 3AVUA 3BC1A 3SJZA 4HB0A 4C9BA 4JLMA 4LJAA 3UK6A 2FZLA 2AKYA 1IXRC 4P4TA 5CDFA 1KGDA 2GESA 3THYB 1E69A 2B21A 1DAEA 4P32A 1QG4A 4TL7A 2XNSA 2XGJA 2H1LA 3OAAD 4XVUA 1Q0UA 3T12A 2P65A 4N0EA 1ZNZA 2V1XA 3AKYA 4OHYA 2XITA 1G19A 1BMFA 3U5ZB 2ANCA 1E6CA 1US8B 3KXKA 2ZRMA 1ETUA 4Q1BA 3EXAA 1IJEA 4LYFA 1YZNA 2VA8A 2GWHA 1FP6A 2VLIA 1BYIA 4PX9A 1Z0AA 2ZSFA 4JVSB 2H5EA 2B7BA 4DDVA 1QRAA 5BXQC 1E2JA 4CT4B 2EFHB 1FUUA 4QJ4A 1SVWA 4Q7JB 4B48A 4M9QA 3CX6A 4MRRA 3MRSA 1RJ9A 4M22A 3WYFA 1IN7A 2IT1A 4MA4A 3T5GA 2O8CA 1W46A 4IDQA 1MV5A 3FHOA 3U7FB 2ZUDA 2X1VA 4AD8A 1DG3A 3RDPA 1IBRA 4D25A 2F55A 1ZW6A 4NZYA 1HA3A 3I62A 4HZUB 2CDNA 1OHHA 5ELXA 5FUVA 2BEKA 1FUKA 2R6GA 4JZKA 1KJYA 4R9UC 4B43A 3H2YA 5KU1A 4EJSA 3OF5A 4DCVA 1XPUA 1OIVA 2EFDB 3K0AB 1GP2A 2IYTA 1BMFD 1XWIA 2FSHA 2GZDA 2HCBA 3HDTA 4NCHA 4RCZA 1LFDB 4RSGA 4CW7A 5JSZA 3LA6A 4F92B 4BRWA 1NKTA 2BMFA 2F7SA 4PC2A 1E9BA 2GDJA 4KI0A 4IVPA 3P4YA 3GLFA 4JSTA 4CVNA 3GLHE 4KITB 4MKIA 1YZKA 4OYHA 1JI0A 4RD3A 4UNQA 4ZV4A 5AJZA 5DIFA 3FMIA 3DL0A 1G8GA 2V8OA 1JPNA 1NBMD 2OO7A 2QE7D 3AP1A 2G0NA 5EP4A 3DKVA 2V3CC 3B9QA 2IYLD 5KNBA 1XZQA 1OH6A 2I4IA 3OIVA 3K0SA 4GZMA 1OHHD 4RY2A 1QG2A 3PUWA 3HWSA 3QKSA 2DFKB 3IIMA 3GD7A 2AN9A 2FFAA 4LX0A 2JCSA 4AKGA 1ZM3A 2WKQA 1GRQA 2A78A 4EFMA 1T8TA 2VHQA 1XTSA 4A2QA 3T61A 2JLWA 1XTKA 3O8BA 3W6OA 3AF3A 1DAFA 2JLVA 4F4CA 2WWGA 3TR0A 4XIGS 2FE4A 5FPTA 2DFLA 1RFLA 3C14C 3MWJA 3TQCA 4HDQB 1ZC3A 6Q21A 3B5JA 3ZD6A 4L8GA 2BM1A 4LUCA 3QPVA 3A1UA 4RFSB 1WBBA 1S96A 1PUJA 5JWHA 4AYWA 2PLRA 2ZE7A 5B2ZA 2X2FA 1BYUA 2ZETA 2JLQA 1L4YA 3B6EA 2W2XA 1N3BA 2WSSA 4AKIA 3T34A 4CEIB 4AI6A 1RYHA 4LWZA 1E2KA 4LDJA 1VECA 4HUQB 2W83A 2RHMA 3AF1A 2P5SA 2YWEA 3FVQA 1UDWA 4KHZA 1A2BA 1Q22A 3AV0B 2PT7A 2C5LA 4XVRA 1N6NA 5B30A 4LPSA 1Z0DA 2RMKA 2PH1A 2XXAB 4WA7A 1N5IA 3EAQA 1DBSA 2PLFA 3TK1A 1KK1A 4Q48A 3SBDA 4CT5A 4DRZA 1Q44A 2KSQA 4Z8XA 1KY3A 4C0HA 1MT0A 3NHAA 3OEEA 4QHTA 1GIAA 4MKGA 3AF0A 4DUGA 1Z63A 2HV8A 3AVQA 2WZQA 4I1OA 5DE3A 1P2UA 1TTTA 3K0CC 4JLNA 1F2TB 2FSGA 2VRWA 2RGXA 1LY1A 1Z0JA 2ZJ2A 3GJ7A 4DLUA 5BN3A 1CR1A 1XTJA 2V4ZA 4B3DA 2H17A 3WNBA 5JMTA 1COWA 1QHGA 3ZZ0A 1CRPA 1PLLA 1R4AA 3HPQA 1XMIA 1J8YF 1XTIA 2FPMA 1W0KA 1OXSC 4MGZR 1U8AA 4DLWA 1E1RD 3PQCA 3PXGA 3DPUA 2IYSA 2X2EA 3B9PA 2WSSD 1E4YA 4D4KA 2CVFA 3H0KA 4YMSA 5TB5A 1ZU4A 4M21A 5EP2A 4P4SA 5JJKA 3E1SA 1O87A 3LQQA 2G9NA 1Z0IA 1LV7A 3SR0A 2VL7A 3JVUA 3OEHD 1ZVQA 5FOUA 5KSPA 5HPYB 1AS2A 1NVVQ 2ONJA 3OIWA 2H7VA 2JLZA 4JVMA 1Z2AA 3PENA 1ZJ6A 1SQ5A 2C9OA 2HF8A 2WPDA 4A2PA 4D4MA 3VKHA 1NIJA 4TL9A 4DUGD 3EPLA 4E03A 4IEIA 2IBMA 3LX8A 2F1HA 2NZJA 3GCGA 3SC3A 3U7HB 1Z83A 4ZDJA 1R7RA 2ZAOA 3IIKA 1IOZA 3GLGB 2IYQA 4C3ZA 2PJRA 3QSYA 4PPFA 2BBOA 3C15C 1VYTA 1COWD 4JLJA 3M0EA 2XSZA 2JEOA 3ZS9A 2OLJA 1G7CA 4ZKEA 4FINA 3MSXA 4GT1A 2ZRNA 4IFEA 3QKRA 5G40A 1TX4B 3EASA 4Q4JB 5E4FA 1KMHB 5M04A 4URYR 2Q9CA 3SHFA 2ZRCA 2ONKA 2V6IA 1P72A 3X2SA 1ZM4A 2IXEA 2F1RA 2ZRAA 3FKQA 2KI5A 3Q9LA 4V0MA 1GZSA 4IOKA 4LPKA 4B35A 1U94A 1LB1B 3QXCA 4E5UA 4GP6A 4JJKA 5DNYB 2D2FA 3AVOA 3WYAA 1P2SA 5L3RA 3BGWA 2ZR0A 4YC7A 3BB3A 3UANA 3I61A 4C0LA 3KX2A 2CXXA 4W9MC 3S1AA 2GCPA 1KIMA 4BZXA 3UMFA 4GOKA 5FOSA 1VIYA 1WCV1 4ARZB 1M7BA 2Q3FA 3ECCA 1VDZA 2XSZD 1OFTA 3FE2A 5F9FA 3DMNA 1C1YA 1E2MA 3MJRA 2MMCA 3CH5A 1DTSA 4JVLA 1PLJA 3LBHA 1U0LA 1WE2A 3FGNA 3JVVA 4DT1B 2VF8A 1OB5A 4MDFA 5FOXA 1NRJB 3V4FA 4V0LA 1ZD9A 2QSYA 2YOFA 4D0NA 1T5LA 2J59A 2L0XA 3R8CA 2RHDA 1AJEA 4MRSA 4BRUA 2O8BA 1U9IC 1G3IA 1V5WA 5CB6A 2BOVA 3LAWA 1FL9A 2P3SA 3TAUA 4ZIRA 2R8RA 1FFHA 2WIAA 2JLUA 3MCAA 4BLSA 2IYXA 4HDCA 5FR2A 4PPGA 1HV8A 4HLUA 4F93B 3PFIA 1XMSA 3SDZA 3KKMA 1MR3F 4MITA 2GAOA 4QGFA 1KJWA 2GNOA 3EA0A 4C7OB 4P33A 3IUYA 4LY6A 1T4GA 2FPLA 3GFOA 1HH4A 4PO9A 3AM1A 1TQDA 1G7RA 1LS6A 5BW8A 4UJ3A 3SZRA
chains in the Genus database with same CATH superfamily
4UCWA 5KYNA 1OPXA 4BLOA 1WF6A 2YW2A 3A4NA 1UT5A 2QN3A 2A0FA 2GN8A 3LHFA 1U02A 2P91A 4JN6B 1ENOA 2I2BA 2YNMC 4GNKA 1X2BA 4GAEA 4XB1A 1DIHA 5AM4A 4A36A 2VHUA 1VLQA 2HJGA 2QVBA 3AJAA 4MWSA 3R7DA 4ASUD 3L06A 2WJAA 4MPRA 2V7WA 5I9SA 5LZ7A 1QHYA 1UKEA 1J56A 2FPGA 2JFQA 3KBBA 3L9XA 4J2HA 3WJ1A 1AOXA 2J41A 5EXEA 3TJZA 1ZIDA 4DEXA 1A8QA 4H9GA 2EL7A 3PJRA 4O2AB 5EXXA 2CMHA 1QVWA 2GTPA 3RI3A 1RQXA 1TLLA 2XQKA 3KL2A 1CUZA 1VJGA 5FUMA 5G0WA 3OZRA 3SHWA 1WD5A 1EZZA 1CDEA 4UM8B 4S2EA 4G85A 3FYUC 4DDHA 3GYGA 1VE9A 4TYPA 5AD1A 5F2NA 3G5AA 3O6VA 3U4QA 2YVUA 1T9BA 1FFWA 3UJCA 2Q4BA 4J4HA 1E3WB 3RS3A 4B82A 5I01A 2PKYX 4WCDA 1KMHA 5DLDA 3QE4A 1WZCA 1OLUB 4BNLA 4IFIA 3HP1A 3D81A 4EOGA 2Y0CA 3FPAA 4ZZ0A 1XTBA 4LZAA 4EZBA 2VYQA 1MDBA 4BX9A 3BORA 4UXHA 1G21A 2CMKA 3FNRA 1QRUA 2VJLA 3ZNQA 2VTBB 1KK2A 3LPMA 4F06A 5HP4A 2Q5LA 2CLHB 2Z4TA 4K81B 1QIJA 1RMYA 2A1UA 2XQIA 2HUNA 4INZA 5EXTA 3WQRA 1J97A 4E1VA 2AH5A 3OHSX 2ZTMA 4MS3B 1RQ2A 4R68A 5SY9A 2IF2A 1OASA 4ZQCB 1JT2A 1TAHA 1ZUHA 2D74A 1I94B 3VDRA 4B2IA 5HA5A 2O8EB 3RVDA 1PQYA 4G37A 4PPYA 4DKXA 2AR9A 5JU6A 4CL2A 1Z6XA 3CLRD 1QK5A 4ERNA 3H5AA 5K3FA 3AJDA 4D98A 3B9BA 5JH7A 2YJTD 3O4RA 4TT8A 4R0VA 3V5NA 3I6ZA 1Q74A 1A9ZA 2FH5B 3CLVA 5KWEA 1M2VA 4FMBB 2CFCA 3LGXA 4QUHA 1U28A 3KFLA 3CB4A 2QUBA 4DRXA 6YASA 1BG6A 4NHEA 2QW8A 2AR0A 3E9NA 3GEHA 3AVWA 2J7KA 3D0QA 1XF1A 4N0PA 2JI8A 4W5NA 3EVBA 2EBUA 3U7JA 1YI1A 2N0SA 3KB6A 3ZHRA 1BEEA 2I99A 4TMWA 1RVV1 1NMZA 2VJQA 3DDZX 4A9AA 4ZN6A 3RHSA 4J4TA 4J3NA 2HFJA 2RIPA 3SZMA 4IDOA 2VPXA 1KR5A 4MRAA 2X9NA 4RHEA 5EIHA 2QYTA 4ZYVA 1X15A 3OJWA 2BFFA 1WKCA 1AM4D 2QL7A 3HL0A 4FDTA 2ZKLA 4XB2A 5LZ8A 3RYIB 3VX3A 2IU0A 5J2TA 4J6EA 4CEJB 2JGRA 1PS9A 4RE5A 3VSBA 1YVRA 3I5MA 1LPPA 3C3MA 3GEBA 5FEMA 3HQ4O 4G1BA 3SYTA 2CLKB 3U9LA 3C3EA 3IMFA 1TA9A 1BVYF 4OK3A 2WSMA 5F1OA 3S2YA 5AW6A 3NP9A 5AVZA 1G66A 4UNRA 3JZIA 3T38A 4M0CA 1P5FA 1W34A 3DWGA 5FL7D 3RVRA 3SN6A 5A5EA 3OM0A 5L45A 3AVVA 2O8DA 3PRJA 4J2OA 2VHJA 1BEZA 3L46A 4NU5A 4D80A 1LLFA 3Q41A 3M1AA 5K7SA 3GBSA 3LFUA 1PR3A 2Q8QA 3C41J 3JZMA 4DLRA 2JLRA 2XGMA 3OE4A 1IHXA 3NYRA 2D0OB 4E2ZA 4PC1A 3DOHA 4Q1EA 5CB4A 1NPTO 4ZGWA 2OZLB 5IT9A 1E20A 2WMNB 2D1QA 1H8EA 1L4GA 1X92A 2XB9A 5E2AA 3IUEA 4ND7A 1M76A 4D9KA 1H9AA 3ZU2A 4DXAA 1XZBA 1J70A 2X23A 1X80B 5JATA 3D5EA 4J0KA 3H4TA 2XMDA 2V6BA 4G5GA 1XN1A 1MX9A 1ZOPA 5LYJF 1O1YA 2PM8A 2O3JA 1V39A 3GT0A 4R1UA 1TU4A 5I4KA 2YVQA 3B6ZA 2UYYA 1B3RA 4QFDA 4C3ZA 4M36A 1GL7A 2ICAA 4AKSA 4CGZA 3M6UA 4AX4A 3Q8LA 1A0OA 2HJVA 2I2XB 1BN6A 2RGNC 4IS3A 4WJKB 3K0HA 3K2BA 3ZHUA 4OX9Y 2FWBA 2QK4A 3GEMA 1SHTX 4CMEC 3KD2A 4I46A 4U2EA 2XCIA 5HKAA 3G8DA 5J4HA 3HFSA 1F51E 1T3ZA 2G67A 3BAZA 2J5XA 3QNMA 3SHTA 5J2UF 1LC3A 1XDBA 4B3IA 3JQAA 3TSYA 4ZI3A 1VPWA 1G20E 1DC5A 4DMUB 3H2IA 4PC3A 1JSCA 5I9BA 1ACMA 1JSZA 4HQ6A 2VJPA 3K8YA 2YBDA 4KW7A 4XARA 1PNTA 3DC2A 1O96A 2G1UA 5FUYA 4U7PB 3LPLA 4BZPA 3BRCA 3GMTA 5FDFA 3L5KA 4IOLA 2NU9B 2OG1A 2POCA 5L8VA 5L40A 3CWQA 4GKKB 4CIBA 3U7EB 2IU3A 4AMVA 1UWCA 2IUSA 2C88A 3TLYA 2DWCA 1T2VA 3RWMB 3FB4A 1NG1A 3JQCA 4YRQA 1Q77A 4DW8A 4TZ6A 2G7ZA 3AR6A 3ZCPA 5DHTA 4QYSA 5FLXA 2CV0A 4DB4A 1LNSA 1E7WA 1OX4B 3QKTA 3SXJA 4Q7LA 2C5BA 4L9WA 3NZEA 2I65A 3OTQA 1SELA 4JVOA 4YB8A 3KQHA 3GH1A 2Q46A 4RW0A 4RF3A 4HS4A 1TT5A 1AIPA 1GAJA 1ZP6A 5AI6A 4ND8B 4AS3A 4P7BA 3R4CA 1AV7A 1TU0A 4PZDA 4LYJA 5GJVC 1G4AE 5LUBA 5TIIA 3OTIA 4JWTA 1E8NA 2Q4DA 1NOKA 3PRYA 3UGKA 4E88A 4JQSA 1EX6A 3HVIA 3ICQB 1SH7A 1YUBA 3ABQB 4PVCA 1HDIA 2QM3A 2ZBVA 3A4MA 1NW8A 3O4GA 3OX4A 5K4AA 3TE7A 1XPOA 4LIPD 3STVA 1D2HA 3R7AA 4HRYA 5HF8A 1MAUA 3TCKA 1HC7A 4B7AA 2D2IA 2A5GA 3OMXA 4MH0R 4EMTA 1KFKB 4H3SA 1P75A 2I2AA 3ICPA 3JU3A 1CEQA 3AB3A 4PANA 3NGXA 1U8XX 2OHJA 5E1MA 1WETA 3EVEA 1U8CB 2DVMA 3KKZA 3SE0A 4C0WA 2XCOA 4MGIR 5KYYA 2R4UA 3UICA 5I3ZA 2MOKA 5E7MA 4RGBA 5SZHB 1G5IA 3O8DA 2BLNA 2JJ2A 4L3VA 3MHTA 4NY1A 3QFFA 3ROKA 1T15A 1J24A 1YVUA 2RKOA 2JJ1A 3EH2A 3QMMA 1CFZA 2OLKA 3Q85A 4EJSB 2HHJA 3GU3A 1LU9A 1C7JA 4HNVA 4MLDA 5BWMA 1KORA 3C4JA 1QU2A 4GZ3A 2JBAB 3NBQA 3R40A 3GZ4A 2NU8A 3WFJA 4I14A 3HYCA 3AP3A 3EXEB 3ZDAA 2BC9A 2W6JD 1SOAA 3AI2A 3TB4A 1XYVA 4AJ4A 1KZ9A 4Q00A 2P3OA 4A3SA 2GRUA 3DTVA 1HYGA 3FTQA 1D2RA 3R0VA 3D7MA 4FP9A 2P62A 2WJGA 4W1RA 2QLMA 1VLJA 3THWA 5CAEB 1G5RA 1N4DA 1X39A 4J1TC 5DI9A 4B9EA 1M75A 2Q3BA 4QXAA 2CCKA 5AI5A 1EBFA 3IAAA 1C7ZA 1H2XA 3WK4A 4IIUA 1Y1KE 1H3NA 4JJ6A 4C3VA 2RG1A 3PPYA 3NEJA 4GNRA 4Q7EA 5B3JA 4WLNA 4CMHA 1XLVA 3EBOA 5IZCC 2RARA 4XGQA 1AKEA 2C9ZA 4ZCQA 3M4JA 1Z7BA 4F2GA 5A9RA 3PSHA 3M4XA 2QHXA 2Z5GA 3V7FA 3EQ9A 1CUYA 5JMOA 2RCNA 2VBFA 3FFAA 4FQ7A 4GL4A 1CUEA 4A1FA 3LDHA 4P7KA 2WYVA 4XYMA 5K3CA 1Z62A 3H13A 4EG0A 1FRZA 2IKSA 2XCUA 4IH9A 2DFTA 5FL3A 2IS2A 2OXTA 3UJAA 2I71A 3NONA 3AEXA 3KU1A 4JEHA 3EFEA 2PH7A 3E1KA 3PGLA 3U4GA 2EFYA 1Y5LA 4BO7A 5BWLA 5FI0B 2XHZA 3I9JA 5FBKA 1D8AA 5JAHA 4WCFC 5TEWA 1QAQA 4K8RB 1O4WA 3KLNA 4KN6A 4CI0B 1EP2B 4LHYA 2DB3A 3ZK7A 1CQWA 1H9BA 3UXMA 3WQSB 3TQTA 1EGHA 2GZAA 4IZHA 3ZW7A 2K7FA 1J22A 1G8PA 4IEFB 1GZDA 5TX7A 2R1TA 3A36A 2ACEA 1D0IA 1KEVA 1QQAA 3ES9A 5F7OA 1SWWA 1GR0A 3G2HA 4HAXA 5F7ZA 3S29A 4XPZA 3UFXA 3OBIA 5ALKA 5HQ3B 1IY9A 3ENKA 3ZXUB 4HEHA 4XTRA 4YXWD 1CERA 4NCXA 4GPEA 5IYZB 2FJUA 5B1YA 3F7NA 4HX5A 4ACBA 4ARIA 4N40A 3TL6A 5INTA 4OAQA 5SYAA 2P9HA 4Q4HB 1L4LA 3SQDA 2D7DA 3MTJA 4BWGA 1U8TA 3LF2A 3GIWA 3SBEA 4PTZA 1L4EA 1Z45A 1I13A 3TKYA 4L72A 3GT4A 2J32A 2IYPA 2OGSA 4BS9A 3ITNA 2P79A 3ELBA 1H2WA 1KY4A 2ID4A 5REQB 4L8WB 2OK7A 4CF7A 1XX6A 1XA4A 2GN1A 2AQKA 2PPLA 2VYNA 1ZGGA 4MINA 3VHLB 3BD9A 3ESCA 3TFOA 2P75A 1FP7A 4WMLA 1BVRA 7REQA 2ZSAA 4C07A 2O1WA 1J2UA 3H5LA 2OAQ1 1M2JA 2I6UA 4JENA 4DM4A 2LE0A 3TIIA 3JW8A 1GM5A 2LUOA 1OWOA 1D1SA 3GCWA 3QIVA 4UU8A 3GV0A 5GM1A 4DLVA 2CLIB 4YPFA 4MV8A 1WUHS 4P53A 4RPJA 2Q1TA 3ADCA 3Q8MA 3OT4A 3WZLA 2YWHA 3M6WA 4EF4A 4JI8B 5DULA 1HE2A 3X43A 3W79A 1DBPA 2B1IA 2G77B 1X7YA 2EZUA 5HRAA 4FFMA 4DY6A 1BE6A 3V55A 4WBNA 3P52A 3OFSA 1BO6A 5H83A 2I8AA 1J8FA 4G9EA 3ZTTA 1IBKB 4O4JB 1IN5A 1YB6A 4CF4A 4TVSA 1YCDA 2JBWA 4DGSA 1QZXA 4PG8A 5CH8A 4DR2B 4YAUA 2X4GA 2MCFA 1FX0B 3JD2A 4ITUA 4QFCA 3DA8A 4BKMA 5B4VA 2Q2WA 4C30A 2VSXA 4MB0A 3U19A 2J6IA 3BE4A 3FDIA 1U8UA 3IAFA 2WG2A 3JRNA 4PAWA 1CW2B 2QLLA 5D1HA 3GRRA 1T8SA 2XD9A 4IMIB 4RSRA 1NATA 4KO1S 5DTMA 1MFZA 2BR3A 1XNGA 1BDBA 2BN4A 2EJWA 3KCNA 4LOIA 3B3QA 1GCUA 4MMXB 1KAOA 2CDCA 5C34B 1UKYA 2HGZA 3DBHA 4K9DA 4EQ6A 2B8TA 1QFYA 4CLOB 1LSOA 2R79A 3P9YA 3MTDA 3H05A 3PCRB 5LQUA 2A5YB 5FI5A 2IS1A 1RAEA 3DL2A 4M53A 3OKFA 3QU2A 5LU9A 1X0VA 1DHTA 3AYXB 4LJSA 4I1RA 4NJOA 1Z5GA 3F6SA 2IA5A 2XYHA 1BIFA 2GYVA 1CY1A 2AT1A 1DTWB 3Q8XB 3ZLUA 1U8YA 4KH1A 3T9AA 4OHVA 5DHRA 3ZHSA 3SXPA 1C1HA 3QVTA 1LWOA 3VJLA 4MGKR 4EW1A 4X45A 2DLDA 3IAUA 4ZT4A 5AM5A 1GUZA 2C3YA 1M2HA 1DFIA 1MO3A 4MV0A 2UYOA 4NPAA 4KLZA 1KDVA 1RJEA 3V2IA 3HGTA 3HBAA 4HNRA 1VE5A 3FOCA 4TLLB 2YXDA 2UVDA 4WLUA 2C5AA 1WS6A 2PWAA 5CNJA 4P58A 2VF7A 3I4FA 4FCWA 1XCMA 4CQMB 1BMQA 3V1MA 1UADA 2DG2A 3D4IA 4NZNA 3I0MA 5EG5A 1B1AA 3A6HA 3C8UA 1F2UA 3FHJA 3N58A 1UFKA 2C82A 2YZ7A 3WNQA 2EG5A 2L82A 4Q3KA 2OCXA 3V32A 4O59O 3STUA 2I7XA 1KI9A 3QA9A 1ABFA 1VA5A 4E32A 3L77A 3QEJA 4EPXA 1ST3A 1FS4A 2EZTA 4EI2A 2QTHA 4R8RA 5C3UA 3DBRB 3NTUA 1TCVA 3PD0A 3ZHZA 2WIDA 2PZAA 4QA9A 3PA8A 1U81A 2BEVB 2OVBA 3P2JA 1NI5A 4I7EA 4ZVUA 3SXUB 1F60A 3TOCA 1FNBA 3HO8A 2HX1A 3PQDA 4EO7A 1XVUA 4Q1AA 4TL6A 4ND5A 4XSHA 2XKJE 1WCIB 4JR0A 4ZT3A 3PTAA 2R5FA 1DAHA 4ANFA 4AXXA 5JYCA 1GXSB 4D8WA 1N5LA 3MCUA 1OI7A 3N0RA 1V11A 2FOLA 1D9XA 2ZYAA 5C46F 3H7AA 3DJFA 2NTYC 2XE7A 3VI4B 1YS7A 3SS8A 2IYNA 2F4VB 3S2UA 5AKLA 2Q49A 3OU2A 1C0KA 3STXA 5AQEA 4YP1A 4C22A 2H4JA 1XUOA 3U6BA 2UYCA 5DM70 3D4OA 5C8YA 3ZWQA 4U2KA 2D8MA 2I80A 5AJWA 2HPAA 5AVOA 3ZE7A 2QBYA 2CE7A 4WKNA 1MDFA 3OPMA 1KI2A 4FFLA 1Y6RA 5TQ2A 3HI6A 1EFAA 1DCKA 1VJCA 2G40A 1EGMB 5BNFA 4BNDA 2AMFA 3ICEA 3AVXA 3LT5A 3SLKA 1V3TA 1TL7C 4GM0A 2RKWA 3U7IA 2VOJA 3FWKA 3OT1A 4YDRA 4Q4AA 2DUNA 5K8JB 2OBBA 1T1RA 2OCYC 4KO3S 2BGWA 4KQFA 4B7CA 4EPYA 4Z51A 1FDOA 4IY1A 5T3YA 1Z5PA 1J0CA 4UASA 4EVQA 5HS4A 1QHFA 2Q5EA 2YN0A 5AXBA 1RWPA 5HHTA 1XVIA 3O4FA 1DC8A 1PTJA 3ZX5A 9MHTA 1G2OA 1YRLA 3D6VA 2YFKA 2VDOB 2QNBA 3OEED 1P4RA 4FNAA 5CU7A 1M6EX 4F2PA 3CNQS 1I4OA 5AI0A 3U62A 3O3OB 3EPRA 4BMOB 4U5QA 1E9EA 1FVXA 1NW4A 3TLGB 4U7DA 3DYVA 3ZJ5A 3DR5A 4HATA 2IFTA 1LDEA 5AP9A 3EW9A 3RS5A 4PCLA 3HN2A 5E1OA 5B64A 3SS7X 1XF9A 4BXOB 1BXGA 3OCZA 4EJSC 4V03A 4HHEA 4TRMA 5HIMA 1J2YA 3D8TA 2IYWA 3A6FA 3OPXA 2OBMA 1ISGA 2VVTA 3T7SA 3S28A 4H2DA 2PA0A 3HCAA 1DCMA 5A04A 3DXYA 3NASA 1NZJA 3Q7EA 4X84A 5GM2A 2QJFA 1FNMA 3WMEA 4UATA 3VKWA 1PR0A 5LQAA 2N47A 1GVNB 4QDZA 4U7WA 2QPAA 4M0MA 3WLRA 2B4TO 2W71A 1TKRA 2B8NA 4RKEA 2O7NA 3BIWA 3IQDB 1LI4A 2A84A 4KACA 1U0GA 3WLSA 3H5IA 4TVBA 3DCYA 2UUAB 3AO0B 3OURA 1YKSA 3HE3A 3RYFB 1TTPB 2DPHA 3KVRA 1ONPA 3QFCA 3GDGA 3ELDA 3RJMA 4ZV7A 5IXJA 1V1MB 4ZDWA 1TUIA 2B2NA 1VJ0A 2R87A 3RVJA 3OZDA 1Y9AA 1KGSA 5FUQA 5L3SB 4KMMA 3OZFA 3RCBA 1S7GA 1LVGA 5I9NA 5KKNB 4C4OA 3EVTA 1R4MA 4JKIA 2J6HA 2VG8A 3L8MA 1K6JA 1L7MA 1QOZA 2HF2A 1GARA 2XDQA 1P7WA 1BX1A 2X8JB 4E51A 2BWJA 3LX4A 4QYIA 4MPTA 2B83A 4Y1GA 4LCEA 3F9CA 1U3TA 4NZOA 3IB3A 1T4CB 4L0MA 4GYYA 1B42A 4B47A 3I6IA 4Z4HA 1Y4SA 5HQTA 4IO0A 5EEHA 2WHPA 3EG9A 2Q99A 1ADFA 4YQZA 2C04A 3I0ZA 5A7FA 4B3HA 4Z9XA 2HU2A 1TYEB 3U61B 4EITA 4GZ6A 5DJ5A 5CVDA 5CFMA 2C57A 3LT0A 5EN4A 2VWPA 3L6CA 4CQMD 1CHDA 2V7QA 1TM3E 4Z4IA 1IATA 4R2HA 2YDXA 1TKAA 1UZUA 2JI6A 3SFZA 4BNXA 3GLQA 2ZRLA 2AK3A 1KDYA 3CU5A 4UBKA 5A4FS 3LKBA 4Q19A 2YMQA 1RYMA 5DASA 4LNHA 3RC7A 2JDID 1H0KA 1KDPA 3RU3A 1YJAA 5CA1A 2LTAA 1C4OA 2JAPA 4PXAA 4BLRA 5COQA 2JI9A 1ID8A 2C4UA 3BTSA 4MS4B 2RGYA 4KDCA 3GRAA 4YH1A 3HCPA 5JSKA 4PZ0A 3TVTA 1YQQA 3P5BA 2FUNB 1RWOA 5HCIA 2DULA 5IG2A 4B3RB 1P33A 4EH1A 3SX0A 4J0IA 2BEUA 2ZRDA 3P32A 4LQLA 2QTMA 2XUKA 3ULKA 2WSIA 4HI0E 3JQBA 2WWIA 4QVKA 4EYQA 4JEMA 3GT3A 2JGFA 1WLSA 3BA6A 2QQ0A 3C6MA 1VB3A 2CCGA 3K9GA 3NEPX 5KU7A 3U44A 1VCNA 4GSYA 4ZVQA 3TB6A 4I50B 4ZMBA 1MJFA 1OUMA 4JYMA 4PYMA 2BY4A 4TOIA 2PYZA 4D46A 5HJ7A 1Q7GA 5EXPA 3DLBA 1IPEA 1L4BA 4BPRA 1DG1G 4MJ3A 2VUSA 3ZTYA 1UBEA 1GYPA 1IEXA 2ODTX 5KB3A 3EGDB 4BL5A 2EW1A 1IDOA 5LMCA 4FKZA 1NN1A 4O4HF 4ED9A 3A05A 1UPUA 5E7IA 1VCMA 1YQGA 4D44A 1KKLA 2VK1A 2FRVA 4RZSA 1PJLA 1C3VA 3WGUA 1WTAA 5AK3A 2G28A 5JCPA 1BWSA 3V8MA 4YMTA 1LDMA 2CNKA 1FYEA 4URWR 3IO5A 4RO0A 1QKIA 2OYRA 2X0DA 5IABA 4PHGA 1NBOA 2NO5A 3CVUA 2R8ZA 1ZCAA 3SQWA 5F9MA 4PZUA 4FJ0A 4DYVA 4RGYA 3OQMA 3ZCUA 2YQ5A 4IJKA 1MNAA 5CCEA 5K0GA 4UM5A 1MD9A 1J2JA 5FO0A 1ESDA 3GDOA 1EMDA 3I1FA 5D3KA 4YTEA 3SM3A 1NVEA 5FOQA 4HWTA 4BFZA 3H5RA 3C6QA 2CFIA 3AEZA 4QRIA 4OQYA 4UDOA 4R6XA 2GJ9A 2CVOA 3LBYA 1GKLA 5C2JB 1BQ3A 2GB4A 3BXPA 2OCBA 4BBZA 2G1KA 2WYWA 3A9RA 3GFBA 4OLBA 1CUSA 2IUFA 4TTRA 4BIIA 4B2YA 2PS9A 3DWIA 2HQ1A 2VDWB 5A02A 1OXBB 1WOYA 1UAAA 1M5UA 4NCNA 1UKBA 2G0AA 1SHJA 3SDBA 3T41A 3REFA 3AKEA 2VTDA 3DS8A 5EKUA 4YP7A 3T0FA 4BZWA 2Y93A 5BMVF 1SEPA 1A3CA 1IYZA 3TN7A 2GM3A 1QIFA 3WX0A 3B9RA 4WGGA 3W06A 2NQTA 2D54A 3H8JA 1R8QA 2WM3A 3EQ7A 3PIRA 3USZA 4J29A 1S3SA 1WXEA 4KVZA 3GLSA 3KPVA 4GLOA 3W1VA 2WFAA 4BB5A 1F8YA 2NIPA 1MB2A 3CKMA 2ZBQA 2EWVA 4QGSA 621PA 2LCIA 3OZWA 2PH5A 1J2TA 4JSYA 2YIMA 2BFEB 2FE1A 3A6LA 4N5HX 3WLNA 4ESEA 3RV4A 2PGAA 5U1PA 3OFND 5H3HA 4KQJA 4X44A 1UXKA 3TXYA 1XD8A 5IBQA 4JYCA 2HQOA 3B48A 1B8UA 1PWZA 5GZ1A 1UM8A 3ZDCA 4ZYTA 5AVWA 4M87A 1Z5WA 2EFCB 1F4LA 3C1AA 1Z06A 1SGWA 3EK2A 3H9QA 3HACA 4EVIA 4LJ4A 1WUTA 5IN5A 1M34A 2VDQB 2ZIWB 3Q3VA 5HM6A 2CJWB 3ISTA 3L8EA 1RLOA 5JXWA 4LZOA 1AE1A 4KQWA 1BDMA 3OFVA 2AA3A 4UEOA 2HJRA 4ZYYA 5L3QB 1WHTB 2PQMA 3A3OA 1YS4A 2QN9A 3QXGA 1DBIA 5J4LA 4B6GA 3T5DA 4RIEA 4NOKA 1OJ7A 4HNSA 1FYXA 1ADJA 3DZIA 3ZOZA 3GNLA 3AEQB 4M88A 4TMKA 2QS9A 3RHZA 4BNFA 1JE1A 4Q18A 5CM2Z 1KSJA 4NFHA 3RRZA 1BXRA 3N1UA 5AHRA 2PXAA 4NF2A 3UG6A 3CBGA 3DE4X 5AW7A 4AP5A 3H42B 1QH1A 4MVWA 4AUMA 2NU7B 2C61A 3DEJA 4QOSA 3D59A 4P0TA 3V4ZA 4DE5A 1M5TA 2IVZA 1R8SA 1GV1A 4M1KA 1KAMA 2OOSA 2FJ0A 4ZVNA 2CWDA 5I8PA 3GAAA 1Z0SA 2LP4Y 5DBHX 1VL2A 3H5VA 1TF5A 3H2ZA 4ENQA 3ZK9A 3P0RA 1W93A 1LI7A 1E8DA 4R3UC 3UMCA 3WHIA 5CYGA 3K1AB 4DSTA 3MWDB 2Q28A 4WERA 2YMPA 4M49A 1A5TA 1CF2O 1UKZA 1WMSA 3T3MB 4QPNA 5I4BA 1CVLA 3CW8X 2P27A 2UZ4A 1E5DA 4JR2A 1QG0A 4QQ8A 1PQUA 4MUIA 5IAEA 5JPCA 1HXHA 1J1ZA 1PF7E 3OY2A 5CIQA 3KXPA 1NM5A 1NN5A 2BRUC 1J7KA 2G9ZA 2YVAA 1E79A 1XRPA 3HA3A 3K5IA 4DV3B 1CV2A 3KR1A 1WZEA 4OX9B 2P6MA 4E70A 4Y2XA 1SXPA 2PUAA 4CV0A 1E2QA 3RTCA 2RGRA 3P94A 5IP5A 4GG1A 1KVSA 5EWMB 1RQNA 2DKNA 3WR5A 4AVYA 3QU4A 1ML4A 3R7BA 3DLAA 3Q3JB 1RKVA 1N9ZA 1XZDA 2ZDQA 3EQZA 5EQDA 3ZH9B 3UPUA 5A03A 1NASA 1JPVA 5FYQA 4ETIA 1GU0A 1PK7A 2W6OA 3GCZA 4K28A 4BQOA 4HDSB 4NNPA 5CJJA 1ES9A 3W9SA 4BP1A 4C4PA 4KQKA 4TSFA 4UQLA 5FTKA 2WU8A 2D0PB 4PYKA 1GPLA 5H1YA 3ANSA 2OCIA 2QMEA 3SC2B 1GZ7A 4B74A 1BHSA 1JPJA 1ECFA 1X1TA 1VHLA 3T94A 3C7KA 3CY6A 5FOVA 4BV3A 3VFDA 1XL0A 1GA6A 3T9CA 5ITWA 2B7CA 4BU1A 2VR1A 3LL4A 4UHJA 1OF1A 1IY0A 1OVGA 4FGZA 3HUTA 3FYSA 4RFLA 2CD7A 2Q4RA 2PYIA 3CZMA 3MUFA 2GBLA 2Q2NA 3LYUA 3N0XA 1MRSA 3D7SA 2YV4A 3UQZA 5A3RA 3PFFA 5LOVB 3OMWA 3PJEA 2FQXA 1FX1A 3IBTA 2GTHA 4Y6OA 1ZNXA 1Y5IA 4KFTA 4G63A 3UK7A 2RAPA 1BKDR 1QFSA 3AGPA 3VV3A 1EK0A 1O54A 2ZWPA 3AOEA 4BE4A 3A0RB 3O7WA 4XSGA 2QRMA 4W5TA 2X9LA 2VPIA 2Z8XA 3W5IA 1KO4A 1KL7A 2HSWA 5F21A 3CLTC 3KKEA 4HDRB 5AJTA 2ON6A 2Z09A 4J43A 3FW1A 5JYEA 1VIMA 4ROTA 3C3DA 2I2CA 1CZKA 4S1WA 1GG8A 1TTQB 2XTNA 2QF7A 3QSGA 2E89A 5AFSA 5CDGA 4EATA 2PH3A 3VDMA 1EUYA 4ZHQF 3EEBA 5CIWA 4WDQA 1EJ2A 4WZBE 1NC1A 2PZLA 4Q3CA 1JR3E 1X3LA 2H92A 1R3UA 1WNTA 1U1GA 1VKHA 1ZWLA 2B99A 1EDEA 2K2QB 3D8BA 3NS7A 4IV5A 1KBZA 4XDGA 1K92A 4YT8A 2NV6A 5JRZA 3KQUA 3AIOA 2FN9A 1MPXA 4MYCA 4EI7A 4IDNA 1DP4A 3QKIA 4JQOA 4D9FA 4MI1A 3HCWA 3RHTA 1P5ZB 5AM0A 2G3YA 2IVFA 5FD8A 5EC8A 2Z9CA 3U7QA 4L5IA 2QWXA 2ZGVA 5C37A 4EY3A 4TS9A 3AHIA 3D7NA 4P3PA 4BO1A 1C1DB 1U1DA 2VHZA 4G09A 5EJIA 5AM2A 3GUZA 1XWFA 3TZCA 3N6XA 2EERA 3HRHA 1Q12A 4H7DA 3FKSD 1YK1A 3UOGA 4ER5A 3KOYA 4S1VA 1XLTC 4KE6A 5CT5A 4GOMD 2UVPB 1I2DA 1VKNA 3C4VA 3W6UA 3LHKA 5JVDB 2CE2X 1QB8A 2GN4A 1E1QD 3PLNA 5ER6A 4QLBA 5LZ2A 2PPVA 1RQGA 1V7CA 2A4MA 1DJPA 1PU2A 3NTRA 5DNWA 5BQFA 5JASA 1NYTA 3Q0TA 2ZW9A 3A8TA 4G8CA 5DTJA 1IZ0A 1G1AA 2GGSA 1AA9A 4MQ4A 4ECEA 1IXZA 1FMLA 4GI2A 1CS0B 4LYEA 4AJNA 3TZEA 5ALOA 1JMKC 3DD5A 2Q5HA 2R6JA 3QVVA 4JK3A 1RVDA 1QCCA 2C29D 4XLZA 3M33A 1GRNA 2CJFA 1RR6A 3EFOA 3HJCA 3O0TA 4HDKB 1JGTA 2QU7A 1QLJA 3I9OA 3L6DA 5G0UA 1ZH8A 4FLEA 2IUUA 1V8OA 4DCMA 3UAOA 4FGWA 5M29A 1YSCA 2WDZA 4K6CA 3L7JA 1XTUA 3SAJA 3A7EA 2AOTA 3ONFA 3QEMA 2Y99A 5IK2A 2AR7A 3VPHA 2AE2A 1S9HA 1NP6A 1UDAA 3ZKWA 3PE3A 4QODA 2VTEA 3PQ4A 4LHVA 4E0BA 3PC7A 4EGCB 3GVPA 1NJ8A 1XO1A 2G1PA 5I8ZA 3GF4A 3HEAA 3HXOA 3HJFA 1UDRA 3W6PA 2D1YA 1Q7EA 1WDMA 2GZSA 2MYPA 3CEMA 2ZWIA 5JYDA 4N6NA 4GPAA 1GY8A 1L5MA 1KMIY 4FIZA 1Y1TA 4TTIA 4DMKA 4CQLA 1PVDA 1MORA 3IQFA 4F7DA 1XEXA 3LVFO 1U5AA 1XROA 2IYFA 3ZH2A 1KI6A 4E5VA 4N54A 1CWUA 2XDAA 3N2KA 1YZ3A 4D4JA 1OZHA 1QIMA 4MAAA 1L0BA 5UKDA 2QU8A 3T7JA 2PL3A 3LCJA 1BW9B 2CHVA 4NH0A 4CM3A 5F33A 1T1IA 1GSOA 1SCJA 2WTNA 3H2SA 2ZBGA 4RQTA 4I5IA 3EC2A 3UCXA 5FPKA 1OROA 4EELA 1QP0A 4LJ6A 4B44A 4DPLA 3MCTA 2FV8A 5DNEA 1HLGA 2PMCA 2C5GA 4KN9S 2B1JA 3QIAA 3JZFA 1KFCB 1O97D 2ZZNA 4BVFA 2X77A 1Z6ZA 1AQJA 4DHEA 4ZMSA 3OKPA 4US0R 1AQUA 4E5MA 2Q29A 3OJXA 1ZJWA 4GE3A 3R0JA 4Q7MB 5FIUA 1DU4A 5IANA 1AZWA 2BGMA 1IULA 2CVPA 4HF7A 5HW0A 3GA0A 3SOZA 2H31A 5IVKA 1J00A 1EX1A 1Y37A 1L7DA 4EEXA 2QE7A 3TNLA 3VVLA 3PVSA 4V0RA 2Z4SA 5G1PA 2RHLA 3D7LA 3A37A 4BN5A 1A9SA 3KZ1E 1KOLA 4GSKA 3RRXA 1K3TA 4UVGA 3FCEA 4BHTA 3DHVA 3OIYA 4TKUB 2WMDA 3MMSA 1ZRNA 1UF9A 4PR0A 1A4XA 4UDXX 3WLHA 3EXHB 1L5FA 4C0QC 3MTGA 3TQQA 3NDIA 1N7GA 1VSVA 1XEFA 2JIZA 2WU4A 1CLEA 4QX6A 1SBTA 4U00A 1LI5A 2EP5A 4NDAA 1U65A 2HIAA 1M8FA 3ZXXA 3PUHA 2VS1A 1HY3A 3VKUA 4P4UA 3DVSX 3R5XA 3IP6A 1I7QB 3PYLA 1YQXA 1CZOA 3ZWYA 2MWMA 4OHZA 1X38A 2I34A 2WJJA 1OV4A 4KXXA 3GJ6A 2XXJA 3TGPA 3HCEA 1DCTA 2ZS8A 1Z73A 3BK7A 4EA7A 3PUVA 3BSWA 1ZRHA 3K8QA 4CM9D 5ESRA 3ZCXA 5BSKA 5FI1B 3LNTA 3OTWA 1PT5A 4XGIA 3LRPA 3AVPA 3PDWA 2JLXA 2QD3A 3TBHA 1WZIA 2OXIA 4OBXA 1JB1A 1GQOA 5BR4A 1JQLB 2R2GA 4P54A 1II8A 3EZFA 4MV5A 4CEHB 4UJ5A 3AUXA 4N82A 2VQ6A 2EGGA 3CKYA 1PG5A 3FVTA 1OFGA 1TKBA 2PGNA 1GZHB 4Y8VA 5JYBA 2FPXA 2HXYA 5K99A 1CKEA 1NMQA 3WL5A 6PFKA 2HBRA 5JS8A 1ABBA 2NOAA 3FDXA 4NE2A 5I4IA 5K8CA 5F12A 3TH5A 3A3YA 3JARA 4F91B 4PQGA 1YU9A 5EMMA 1X74A 2B8EA 5LNK1 1UL1X 3KQMA 1MX3A 2H1HA 3HFRA 3L6UA 2I4NA 4XB6B 3K0FA 4AMGA 3ZWKA 1FJXA 3T5MA 2I4LA 4BWYA 1AQNA 1PZXA 4MW7A 1QR6A 4H0NA 4EQZA 2ZXFA 1O9HA 3SBOA 4YMGA 4JKYA 1JAIA 2I2FA 2CLFB 1U7TA 1TPZA 3LXXA 5BSRA 4OBEA 1EQAA 2CC2A 2OV6A 3B2EA 1JU3A 2O2GA 3D5TA 3LCMA 4Q3LA 4YBRA 4F1WA 1LZLA 4G23A 4M9SA 4O4LB 1UH5A 2AWOA 2Z1MA 4UAGA 3H11B 5JZVA 3AVYA 1FLDA 1GGKA 1P3DA 1U9YA 2FWNA 5AHOA 2HA5A 5HE9A 3T9FA 2WUDA 3ZDXB 1RXEA 4BFSA 5FORA 4QDXA 3TSCA 5DK6A 2AOVA 1VGVA 2JCBA 4IMPA 1YZFA 4P98A 1JL3A 4GKJB 1OI4A 3HJNA 2G70A 1UMBB 4LSWA 4M7RA 3UJHA 3VM6A 2XYVA 3CG0A 5AKJA 4INOA 3K09A 4KRYA 1U90A 3GPDG 5BSWA 2VCEA 2DPGA 2ZI4A 3H1PA 3L18A 5FBHA 4FR5A 4NMWA 3TMKA 1VHTA 3Q1LA 4DDWA 1X8KA 1NU8A 2Q5OA 2HF7A 2BEWB 3UJ8A 1FIUA 1MO6A 1I3CA 4H27A 1TUEA 4KR3A 3KJZA 3NCHA 4JI7B 1MRZA 1X86B 3DBOB 2FVXA 3PNLA 4LYGA 1TLFA 5AO9A 5K05A 3RSHA 1FF9A 4NVRA 1J25A 4UD2A 1CK4A 3MINB 3WSWA 4HYEA 4ISBA 1C3XA 1NKVA 1TJ4A 2PWYA 5G0VA 3F3YA 1DDGA 3JQ8B 3SICE 3V2HA 4ZGBA 1Q3HA 1RSZA 3A70A 4UVEA 4JXZA 1CF4A 3PITA 2JVJA 1ZH2A 3JAKB 4KGXA 3EDRA 1N6KA 1V5FA 1KR2A 2NT4A 3N2ZB 4AQ7A 1AK1A 4WOBA 3FPSA 2VWGA 2J9YB 3PZRA 4HZUA 5ES4B 4CLXA 2YJGA 3E7PA 3COVA 4NE9A 5JJLA 1P0QA 3L0PA 4RLHA 4TS4A 1NQVA 1M7HA 1O2DA 2V74B 5KTYA 3QYPA 1T1EA 4Y18A 5F1PA 1I6LA 3GRKA 3EOBI 1U7ZA 2P8JA 3I2KA 1KI3A 3LCUA 4YJ3B 3ZI7A 4X9XA 2ZRPA