2OEWA

Structure of alix/aip1 bro1 domain
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
358
structure length
358
Chain Sequence
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 6-interacting protein
publication title Structural and Biochemical Studies of ALIX/AIP1 and Its Role in Retrovirus Budding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 121
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 2oewA00
2R02A 3C3OA 3UM1A 2R03A 2XS1A 2OEVA 2OEWA 3RAUA 2R05A 1ZB1A 5CRVA 3C3QA 3R9MA 3UM2A 3UM3A 3C3RA 3UM0A 2XS8A 5CRUA 3ULYA 3ZXPA
chains in the Genus database with same CATH superfamily
4YDYA 4U8VD 2KATA 4U07A 4PS8A 3D9IA 3FTVA 5EIBE 3QB2A 4I2ZA 4CCAA 1O1RA 1SW6A 3PVLA 2KM4A 2ILRA 3BQOA 5M72A 3QWPA 3DEPA 2R17C 5FQ4A 1H6KA 1PY1A 5CBOA 1K3ZD 3ABLE 4KZ0A 3CK7A 4TXPA 1KZOA 4IULA 3OXGA 3LKUA 3L22A 3UT8A 2EINE 3FU3A 2EILE 3V31A 3UM3A 3S2AA 5E75A 4LSZE 5EDSA 3CQCB 3L17A 3ZPJA 3PUJA 2XGMA 1K1AA 4G23A 4BSZB 3P2BA 3RO2A 3CK9A 3EJNA 3JCKC 4GMJA 1DVPA 2WXIA 1N52A 1L5JA 2KC7A 2UY1B 3T8MA 3QK0A 5JA4D 3S7JA 2ONDA 3TXMA 3FH7A 1TNUA 3GZ2A 3NF1A 4CDNA 2WB2A 2Y4TA 3EHMA 1JWGA 2AXZA 2WXQA 4TXQA 2OCCE 2XRZA 3D9HA 2J07A 3C5RA 3ZRHA 1JCRA 4J8EA 5BNWA 3O4ZA 1WG0A 2QFCA 3C72A 3MCXA 2VSOE 2PQNA 4K5AB 2R59A 3DSWA 4GCNA 1KT1A 1OT8A 3ZUVB 5JHBA 2IEJA 5KJMA 4JEUA 5KBAA 4G1TA 4YDWA 1MX4A 1SZAA 1ELKA 4HRNA 2LXMA 4MS6A 4I2WA 1U3CA 4AP2A 3CIAA 2ZISA 3C3OA 1WDYA 4GTRA 3FULA 1D8DA 4CEMA 4V3IA 2AVPA 3L08A 1O1TA 3I4GA 4N5QA 5AJDA 2ZGDA 1MHQA 1OWMA 5EYLA 3ASOE 3Q79A 2KZTA 5DIZA 3EIQC 3SNXA 3B95A 2WM9A 5EX0A 4XIFA 3OTNA 3TWRA 2V5QC 3PS6A 3PZ4A 4XI9A 4A3VA 2NYJA 4BEPA 2C2LA 4B93B 4AIFA 3CLJA 1OCRE 5ANLA 2OV8A 3PH0C 4HNAD 4HI9A 3TAXA 1FT2A 4ZFHA 3G2VA 4F53A 4GMLA 1ELWA 3AS4A 3LVQE 1IYGA 3FWVA 3ZVVA 4HOUA 1OWPA 4JZYA 2LSVA 4YVOA 5JJTA 1SA4A 3OAWA 1OY3D 4GTQA 1FVHA 3UMVA 3FU6A 2ZU6B 3RK6A 2DYRE 2GRLA 5EILA 4PUCA 4XEIG 4AEZC 2V4LA 4GPMA 2PZIA 4LEUA 4RLYA 3WG7E 3L13A 2HE0A 5J90A 4TUMA 4KZCA 4Y6CA 4O6FA 4AOFA 1N4QA 1SZ9A 1BU9A 2E2EA 2VGEA 4A1SA 3ZEFA 4CYMD 5E76A 2IO3C 2WXHA 4I43A 4FLBA 4HBDA 3UIOC 2WXPA 2PM7A 4GU5A 4JHRA 3G2TA 3FTXA 2WMOA 1DCEA 2YHCA 3ZNGA 5G04C 4ANXA 2H6IA 4WWOA 5AN8A 3CVPA 3L16A 2DWZA 4WWPA 4UWGA 3DSVA 3X2QE 3T5VA 3FTSA 2L6JA 2Y3AA 2Q7FA 4CDRA 4JXTA 1UG3A 2CG2A 2UY1A 4MLPA 2A4ZA 4A3TA 3JXJA 3FTYA 1YA0A 1UW4B 5FQ7A 2MOWA 3FUKA 1OCZE 4C48B 3DSSA 2WPVA 1QYMA 1NZNA 2J09A 4TRQA 3SZ7A 3HXEA 3LJNA 4JA9A 3C3QA 2BEDA 3CVQA 4BWRA 2XENA 5BXUA 4UQXA 4U63A 3PREA 4ATZD 3HYMB 5LOZA 4HLEA 3D9OA 4UI9K 1KZPA 2DVWA 4J8DA 1KLXA 4GZ6A 1FPPA 2IF4A 1N4RA 1Y6IA 3KSLA 3FH8A 2H6HA 3ONLA 2P58C 1H2UA 2RKKA 3FUEA 3MZLB 4G25A 1WY6A 4IRUA 4OAVB 1MZCA 2AJAA 4EQFA 3SBTB 3BUAA 5C1DA 5EIDA 3T9KA 3CSFA 2YINA 3UT7A 5EX3A 5ARGA 5ENOD 3SGHA 3FUFA 3ZKJA 2P9SG 4WNFA 4CZ2D 3VTYA 2PM6A 4GTOA 3EU9A 3CHSA 3JUIA 4UWKA 3EHQA 3KD7A 1LF8A 1NL4A 4WNEA 4MKTA 1H6PA 5CMWA 3CHOA 1N0QA 5A7DB 5CHEE 2DYSE 3UM1A 4N2QA 4JD2G 1H0AA 3RJVA 3IHVA 5FINA 2R05A 4F7AA 4I9CA 4HRMB 3MGBA 3AU5A 1SVXA 3APFA 3CHQA 1G3NB 1KPSB 5AQ9A 4LNBA 3VTXA 2X6FA 3EDTB 4EZKA 1E7UA 2ETCA 3Q47B 4JW1A 4GCOA 3EUVA 1N9AA 2PL2A 2LNIA 5J08A 2BF0X 3W9GA 1MX2A 1QQEA 2P9KG 4G26A 4Z68A 4GMRA 1D9SA 2OEVA 4DX7D 2JABA 5LCWC 4BT9A 4O1PA 1B89A 2VSXE 2X6IA 4HQDA 5BPPA 1E8XA 3AG3E 3AJIA 5LP0A 3CHRA 4GTSA 2Y1LE 3HG0D 3CEQA 4LG6A 3LY8A 3O48A 3DPDA 1FT1A 4HFGA 1MJ0A 5ENQD 1INZA 5KJNA 3TG4A 4ACLA 4N3AA 4JB8P 4KXKB 2VGXB 1S63A 2YHEA 4B0ZA 5KNHD 4XKBA 3PRZA 1Z3XA 4PH4B 2LAHA 2FO1E 3CVYA 1HZ4A 5CERB 4DJAA 4JL0A 3PUKA 3MKQB 1RW2A 4DLQA 4LUNU 3UM0A 3V30A 4FHJA 2X6HA 5AJLA 4L9PA 1HXIA 1JCSA 4K03A 1OWNA 1QZ2A 2WXJA 5FQ8A 3HXDA 4BERA 3PZ1A 4DRXE 2IFUA 2DIWA 2WXLA 2EIME 2J49A 1IHBA 3MYVA 5B1BE 2V0PA 2WXOA 4UI9C 3UIPC 4N2SA 4A1GA 3LY9A 2QC9A 2KXPC 2FEZA 4I6EA 3SFZA 4U96D 5G05C 2WMNA 4C0EA 3SF4A 3GW4A 3DXKG 3D9JA 1E8WA 3DEOA 1EPUA 3CV0A 2J9QA 3B7SA 5CCLA 4B89A 2FBNA 4U7EB 3APDA 4X8QA 3ABKE 3ZXPA 2I1KA 3AG2E 4ILGA 4BETA 2GROB 5CEAA 2I9CA 3S7FA 2QYUA 1ELRA 1X81A 4B8CB 2F0YA 2KCVA 1BPOA 2Y4UA 4CGVA 2HO1A 1TNBA 4GZDA 4GAAA 1IQUA 3AS5A 3AAAC 4ILIA 3RRUA 4O60A 3UKUG 1TR4A 3NB2A 2KBXA 1MX6A 4BX8A 4J0UA 1UOHA 4L23A 3QWWA 3RSEG 2XGOA 2PQRA 4L7TA 3DPYA 2QZAA 3R7RA 2LAIA 4F6RD 4TV3A 2E0IA 4RVBA 1K8KG 3E32A 4LNUD 3BG0B 3UI2A 3SQVA 1HE8A 3MKRA 3B13A 3FFLA 3QOUA 3MA5A 3L82A 4RG9A 2VSNA 3KAEA 2J4DA 3OXLA 3I3NA 4XKCA 3VLDA 4JC8A 2A5EA 3GZSA 2XRYA 4NACA 3ZW3A 3CVVA 3HIZA 3FHEA 2BKKB 4EBAG 3SFXA 3Q7AA 3D3MA 3FTUA 4NQ0A 4CDMA 4D10C 3CVLA 3CVWA 4U0ZA 3MV3B 3MEKA 5KJKA 4BY6A 1EF1C 1K1BA 4PS7A 3FH5A 2XPIA 1S70B 3NAWA 3LY7A 1SQMA 2AW6A 4GZ5A 3MJWA 1TNZA 4EBAA 3HDXA 3ZN3A 1ZBPA 1N95A 2VGXA 4GA0A 2MRIA 3FUJA 4KT6B 4CT0A 3RU0A 4JEHA 3UTMA 4WNGA 2DBAA 4J8YA 3SO8A 5A6CA 5FQ6A 2XQ0A 4FU3A 2HR2A 3UQ3A 3RKVA 2WQHA 3MKQA 3LYAA 2LUHA 4HLLA 3CQGB 2GRQB 2J8SD 5KCMA 1H2TC 2RFAA 1N94A 4G8KA 1QBQA 4FP7A 2HYZA 3G2WA 4N39A 3HVEB 4C0MA 3IHYA 2V8SE 4FJZA 4F1PA 3J5PA 2F8XK 3JUEA 2VSYA 1UJKA 2CHZA 3RAUA 1TYQG 3GYZA 3VLEA 3ZYQA 1BI8B 4KMOA 3FUMA 1YCSB 3PNTB 1AWCB 1OWOA 3SY2A 3B7RL 2GRPB 3TG5A 3D9NA 5C2YA 1IXVA 3B7TA 4WUYA 3ZFWA 2GRNB 2VJ8A 2XEEA 2V5FA 3TWUA 4E85A 3MX3A 3TWVA 1XGWA 2HM8A 3ONKA 3JXIA 2LSUA 3PE4A 5JJ7A 1MQSA 5AARA 3U66A 1FVFA 4ABNA 4F3VA 3TXNA 1O5MA 3ZYKA 1TJCA 1TNOA 3PEUB 2I2OA 1TN8A 3UX4A 3J5QB 1NP7A 2PNNA 1BI7B 4RQIA 1OXJA 5BT1A 4GB9A 2P9LG 4FULA 1E96B 2FF4A 4DK5A 1DNPA 1E8YA 3TWSA 4GYWA 4PDXA 5AAOA 1MYOA 3ASGA 1YMPA 1LD8A 5CRUA 3Q7FA 2H6GA 2DZNA 5IY5E 3TWXA 5G04J 4WWNA 1FCHA 1VDYA 2L0TB 2OOEA 3AG1E 4ANWA 4OVVA 1Z5SC 1TN6A 2CHWA 3ABME 3DWLG 2L9BA 3W9FA 4BX9A 4I9EA 3UT4A 3FU0A 2WVIA 3NOCD 4GA2A 4E6HA 5EKQD 3FDHA 3BEEA 3L6AA 3Q73A 3LCAA 3TWTA 1N4SA 3NQPA 2GRRB 1HG2A 1O1SA 2XS1A 1JPLA 3B7BA 2IQCA 4KBQA 3PE3A 3QAQA 4UUCA 2P2CP 3LEWA 1UJJA 3QDNA 4HVBA 1OUVA 2I6HA 3CHPA 4KVMA 3BG1B 3URZA 4AV7A 4UWFA 1OCOE 4PS3A 5CRVA 2ETAA 3QJZA 3NZUA 4OVUA 4K5CA 3D9LA 5EYPF 1YYHA 1OWLA 3BU8A 4EECA 4AJWA 5JJ6A 1TNYA 2X6JA 5ENNA 2XEVA 1H2VC 3T5XA 3HVEA 2CHXA 2GRMA 3L9TA 3ML8A 3UM2A 2IY0C 5HRYA 3DXMG 4LERA 4NRHB 4DI4A 5ANRA 2ZGGA 4ATGA 2AWIA 4HOSA 4O1OA 3CKBA 5CEDB 3ULYA 3ZYMA 4HOTA 1TEZA 3MV2B 1H6OA 4L2LA 2JLBA 3I5PA 1DCQA 3Q9UC 4CT4A 4R7LA 3C98A 4FLHA 5JHAA 1A17A 4YNDA 2EIJE 2X3MA 5FWQA 2ZXWE 1LTXA 4JPSA 4WAFA 1Y8MA 3NOGD 1BLXB 3UPVA 4HI8A 4GZCA 3ULQA 2C0LA 3NBNB 3G2UA 5BV1A 1D8EA 3CR3A 2GW1A 3LDZA 3SHFA 2FO7A 4ZHBA 2IOSA 3UINC 2NC9A 4JA7A 3RRMB 1S64A 1NFIE 4K5BA 4EZLA 4U8HA 5D66A 2DZOA 4DX2A 3DSTA 5ENRD 2LXLA 3Q5MA 4U8YD 1JCQA 5ENPD 3ASFA 3TJPA 5LCWJ 5LX8A 5H7PA 2FULA 3FTZA 4UQZA 2VYIA 5AENA 4J8SA 5FT9A 2Y69E 4C9BB 2XZTG 4OYSA 2R02A 1HH8A 4YVQC 1ZU2A 3TL5A 4HORA 5CMYA 2A5UA 5ARFA 2WXMA 1U3DA 4GYOA 2X6KA 3FEYA 5BW8C 1V55E 4DUIA 2AXVA 3PEVB 5BV0A 4Y6WA 1EYHA 5T8IA 3PDNA 1IKND 2BTDA 3ENEA 4ILHB 5FZSA 3F6QA 1N4PA 2XEHA 5FZRA 5AQBA 1LD7A 3ISMC 3V79K 2XCCA 4K0RA 2QYJA 3NZSA 2XGSA 3FP3A 3UXGA 1JUQA 4IYPA 3Q4AB 4FJYA 1N11A 2P9UG 3HXCA 4OAUC 1V54E 4G8LA 4BESA 3AU4A 1NA0A 1KT0A 2OVFA 2IONA 4UI9J 1UN9A 5ENSD 4TXRA 3ASHA 3Q78A 3LPZA 2WXKA 4JHJA 4U04A 5D0OD 3SD5A 5G05J 3K9IA 3JQ0A 4TUUA 4GTVA 4XZ4A 1OCCE 3QNKA 2Y0BG 5AQAA 4AXHA 1E7VA 4XI0A 3PZ2A 3QKYA 4FC8A 3S7BA 5FIOA 4HOQA 4F1SA 4LCTA 3V2XA 3G2SA 4NURA 2WXFA 1IHGA 4J8FA 4UWHA 4EHMA 5HQ8A 5KJLA 2CFZA 2EQXA 4I6GA 1HF8A 4DX5D 4Q69A 2OEWA 1HU3A 3FEXA 4YDOA 5CBNA 5BXOA 4Q96A 1N54A 3CVUA 4QQIA 1HX8A 4I6JA 3IKOB 3D9PA 3PZ3A 1E8ZA 3ZGQA 1HS6A 4GTPA 2ETBA 5EN5D 5B1AE 1Z6TA 2MHKA 2M63A 1TN7A 4BFRA 3EHNA 3IXEA 2AXUA 3ZHEB 3B7UX 3FUDA 3IBEA 2BUGA 3LVRE 3AG4E 3HXFA 3HRAA 3SFYA 1S0PA 4DX6D 3LS8A 3DRAA 3DSUA 4CGWA 4L1BA 5A23A 4U0SA 4I1AA 2L6BA 5DBKA 2F8YA 3FU5A 4GZ3A 1NI1A 4AVXA 4N3CA 1E90A 3ASDA 4JHKA 2R2LA 4P29A 3FTWA 4B94A 3E34A 5G2NA 5KWDA 4KVOA 3U3WA 3APCA 2QY7A 2FI7A 4BSXA 2R03A 3KS2A 1AP7A 1U2VG 3TWQA 4I17A 1DC2A 3Q75A 2IOLA 3I4RB 5LFAA 3ZXSA 3TWWA 3EIJA 2XHEA 2WXGA 3P1UA 1BD8A 4GTTA 4H7YA 1RZ4A 2XPYA 4RSYA 4ME2A 3LJ3A 3GZ1A 1UN8A 3D9KA 3PZDA 5T4YA 2J08A 3Q49B 3E30A 4JVSA 2L0IA 2VGYA 1QNFA 2YNQA 2XZDG 4WNDA 4DLOA 3JQ1A 1SA5A 2B6CA 2VTBB 4H7XA 3U4TA 1P5QA 3HXBA 4NIKA 3IEGA 4MRUA 1Q2ZA 2VQ2A 2P9PG 3RRNB 5AIJA 1IQRA 4N3BA 3ZYLA 3CVNA 1X5BA 3U9WA 1HG5A 5FTPA 3KEZA 3VLFA 3ZIMA 4L2YA 3ESKA 1JWFA 3IV0A 2P9NG 2J4BA 3QWVA 2NXPA 4APFA 3CVXA 4A55A 4UQYA 4GPKA 3N71A 2F37A 3OXFA 5FJYA 3ML9A 2IU1A 3T8KA 2WQ7A 4DI3A 3JYSA 3FUHA 4ANUA 4A63B 3S7DA 4AY6A 1XNFA 4HRLA 3QC1A 1GW6A 4DX1A 4J6IA 3Q9NC 3HHMA 4N5CA 2YQ8A 5HI7A 1HFAA 1WM5A 5CCMA 1ZB1A 3PNLB 4DPRA 2CFUA 2BKGA 5D2MC 2XCBA 4APOA 3ESLA 4URKA 2WXNA 3SBSA 3RO3A 3WXXA 5G55A 4FA6A 2XS8A 3SI5A 2C0MA 1W3BA 3CKCA 3ZHEA 4GTMA 4LNGA 2KCKA 2OVBA 4KYOB 4FHKA 3R9AB 3UKRG 4I1MA 3E4BA 5CECB 4G11A 2UWJG 2H6FA 4GA1A 4QFVA 3C3RA 3KEAA 5ENTD 4XE0A 3E37A 3Q15A 3D9MA 3FY4A 4B8AA 5KNGA 2KCLA 1H19A 2ZIRA 2IO2C 3FUIA 4GYYA 4BT8A 3CHMA 4ANVA 3ZU7B 2GGFA 2RFMA 1WAO1 2B0OE 3U64A 3CGHA 4MBGA 3DSXA 3EHRA 4YDEA 4XX5A 4FADA 4BTBA 4AM9A 2I1JA 4M7CA 5HKPA 4G24A 2NSZA 5BUZA 3E33A 3TGOA 2LO6A 3L54A 2IJGX 4Q94A 2R5SA 5ITZF 4EPZA 3EU5A 4M3OA 1NA3A 3QARA 2CG3A 4U95D 5AYWD 3R9MA 3RIBA 1EDUA 4J7WA 2X38A 2P9IG 4BTAA 4U0UA 5T3RA 2EIKE 2KZTB 1HO8A 4RG6A 4W9RA 4UWLA 2WXRA 4I1OB 2MYOA 3DBSA 1PC2A 3V2OA 3FUNA 2WQ6A 5AQ7A 4EZJA 3LXUX 3KSQA 1A5EA 4CRWA 3CSTA 4AY5A 1Z3YA 1TJFA 2RG8A 3CK8A 4HS2A 5HS0A 4HB5A 2JEKA 4IN3B 4LRZA 5D0QD 1N0RA 5B3SE 3AS8A 4G2VA 2DCPA 4HXIA 5JMND 2VTBA 1PAQA 3R7QA 2RD0A 4ACKA 3ASNE 2V4HC 3ULEG 5FZQA 2XPZA 3UUXA
chains in the Genus database with same CATH topology
4JIOA 2R02A 3C3OA 3UM1A 2R03A 2XS1A 2OEWA 2OEVA 3RAUA 2R05A 1ZB1A 5CRVA 3C3QA 2OEXA 3R9MA 3UM2A 2OJQA 3UM3A 3C3RA 3UM0A 2XS8A 5CRUA 3ULYA 3ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R02 A;  3C3O A;  3UM1 A;  2R03 A;  2XS1 A;  2OEV A;  2OEW A;  3RAU A;  2R05 A;  1ZB1 A;  5CRV A;  3C3Q A;  3R9M A;  3UM2 A;  3UM3 A;  3C3R A;  3UM0 A;  2XS8 A;  5CRU A;  3ULY A;  3ZXP A; 
#chains in the Genus database with same CATH topology
 4YDY A;  4U8V D;  2KAT A;  4U07 A;  4PS8 A;  3D9I A;  3FTV A;  5EIB E;  3QB2 A;  4I2Z A;  4CCA A;  1O1R A;  1SW6 A;  3PVL A;  2KM4 A;  2ILR A;  3BQO A;  5M72 A;  3QWP A;  3DEP A;  2R17 C;  5FQ4 A;  1H6K A;  1PY1 A;  5CBO A;  1K3Z D;  3ABL E;  4KZ0 A;  3CK7 A;  4TXP A;  1KZO A;  4IUL A;  3OXG A;  3LKU A;  3L22 A;  3UT8 A;  2EIN E;  3FU3 A;  2EIL E;  3V31 A;  3UM3 A;  3S2A A;  5E75 A;  4LSZ E;  5EDS A;  3CQC B;  3L17 A;  3ZPJ A;  3PUJ A;  2XGM A;  1K1A A;  4G23 A;  4BSZ B;  3P2B A;  3RO2 A;  3CK9 A;  3EJN A;  3JCK C;  4GMJ A;  1DVP A;  2WXI A;  1N52 A;  1L5J A;  2KC7 A;  2UY1 B;  3T8M A;  3QK0 A;  5JA4 D;  3S7J A;  2OND A;  3TXM A;  3FH7 A;  1TNU A;  3GZ2 A;  3NF1 A;  4CDN A;  2WB2 A;  2Y4T A;  3EHM A;  1JWG A;  2AXZ A;  2WXQ A;  4TXQ A;  2OCC E;  2XRZ A;  3D9H A;  2J07 A;  3C5R A;  3ZRH A;  1JCR A;  4J8E A;  5BNW A;  3O4Z A;  1WG0 A;  2QFC A;  3C72 A;  3MCX A;  2VSO E;  2PQN A;  4K5A B;  2R59 A;  3DSW A;  4GCN A;  1KT1 A;  1OT8 A;  3ZUV B;  5JHB A;  2IEJ A;  5KJM A;  4JEU A;  5KBA A;  4G1T A;  4YDW A;  1MX4 A;  1SZA A;  1ELK A;  4HRN A;  2LXM A;  4MS6 A;  4I2W A;  1U3C A;  4AP2 A;  3CIA A;  2ZIS A;  3C3O A;  1WDY A;  4GTR A;  3FUL A;  1D8D A;  4CEM A;  4V3I A;  2AVP A;  3L08 A;  1O1T A;  3I4G A;  4N5Q A;  5AJD A;  2ZGD A;  1MHQ A;  1OWM A;  5EYL A;  3ASO E;  3Q79 A;  2KZT A;  5DIZ A;  3EIQ C;  3SNX A;  3B95 A;  2WM9 A;  5EX0 A;  4XIF A;  3OTN A;  3TWR A;  2V5Q C;  3PS6 A;  3PZ4 A;  4XI9 A;  4A3V A;  2NYJ A;  4BEP A;  2C2L A;  4B93 B;  4AIF A;  3CLJ A;  1OCR E;  5ANL A;  2OV8 A;  3PH0 C;  4HNA D;  4HI9 A;  3TAX A;  1FT2 A;  4ZFH A;  3G2V A;  4F53 A;  4GML A;  1ELW A;  3AS4 A;  3LVQ E;  1IYG A;  3FWV A;  3ZVV A;  4HOU A;  1OWP A;  4JZY A;  2LSV A;  4YVO A;  5JJT A;  1SA4 A;  3OAW A;  1OY3 D;  4GTQ A;  1FVH A;  3UMV A;  3FU6 A;  2ZU6 B;  3RK6 A;  2DYR E;  2GRL A;  5EIL A;  4PUC A;  4XEI G;  4AEZ C;  2V4L A;  4GPM A;  2PZI A;  4LEU A;  4RLY A;  3WG7 E;  3L13 A;  2HE0 A;  5J90 A;  4TUM A;  4KZC A;  4Y6C A;  4O6F A;  4AOF A;  1N4Q A;  1SZ9 A;  1BU9 A;  2E2E A;  2VGE A;  4A1S A;  3ZEF A;  4CYM D;  5E76 A;  2IO3 C;  2WXH A;  4I43 A;  4FLB A;  4HBD A;  3UIO C;  2WXP A;  2PM7 A;  4GU5 A;  4JHR A;  3G2T A;  3FTX A;  2WMO A;  1DCE A;  2YHC A;  3ZNG A;  5G04 C;  4ANX A;  2H6I A;  4WWO A;  5AN8 A;  3CVP A;  3L16 A;  2DWZ A;  4WWP A;  4UWG A;  3DSV A;  3X2Q E;  3T5V A;  3FTS A;  2L6J A;  2Y3A A;  2Q7F A;  4CDR A;  4JXT A;  1UG3 A;  2CG2 A;  2UY1 A;  4MLP A;  2A4Z A;  4A3T A;  3JXJ A;  3FTY A;  1YA0 A;  1UW4 B;  5FQ7 A;  2MOW A;  3FUK A;  1OCZ E;  4C48 B;  3DSS A;  2WPV A;  1QYM A;  1NZN A;  2J09 A;  4TRQ A;  3SZ7 A;  3HXE A;  3LJN A;  4JA9 A;  3C3Q A;  2BED A;  3CVQ A;  4BWR A;  2XEN A;  5BXU A;  4UQX A;  4U63 A;  3PRE A;  4ATZ D;  3HYM B;  5LOZ A;  4HLE A;  3D9O A;  4UI9 K;  1KZP A;  2DVW A;  4J8D A;  1KLX A;  4GZ6 A;  1FPP A;  2IF4 A;  1N4R A;  1Y6I A;  3KSL A;  3FH8 A;  2H6H A;  3ONL A;  2P58 C;  1H2U A;  2RKK A;  3FUE A;  3MZL B;  4G25 A;  1WY6 A;  4IRU A;  4OAV B;  1MZC A;  2AJA A;  4EQF A;  3SBT B;  3BUA A;  5C1D A;  5EID A;  3T9K A;  3CSF A;  2YIN A;  3UT7 A;  5EX3 A;  5ARG A;  5ENO D;  3SGH A;  3FUF A;  3ZKJ A;  2P9S G;  4WNF A;  4CZ2 D;  3VTY A;  2PM6 A;  4GTO A;  3EU9 A;  3CHS A;  3JUI A;  4UWK A;  3EHQ A;  3KD7 A;  1LF8 A;  1NL4 A;  4WNE A;  4MKT A;  1H6P A;  5CMW A;  3CHO A;  1N0Q A;  5A7D B;  5CHE E;  2DYS E;  3UM1 A;  4N2Q A;  4JD2 G;  1H0A A;  3RJV A;  3IHV A;  5FIN A;  2R05 A;  4F7A A;  4I9C A;  4HRM B;  3MGB A;  3AU5 A;  1SVX A;  3APF A;  3CHQ A;  1G3N B;  1KPS B;  5AQ9 A;  4LNB A;  3VTX A;  2X6F A;  3EDT B;  4EZK A;  1E7U A;  2ETC A;  3Q47 B;  4JW1 A;  4GCO A;  3EUV A;  1N9A A;  2PL2 A;  2LNI A;  5J08 A;  2BF0 X;  3W9G A;  1MX2 A;  1QQE A;  2P9K G;  4G26 A;  4Z68 A;  4GMR A;  1D9S A;  2OEV A;  4DX7 D;  2JAB A;  5LCW C;  4BT9 A;  4O1P A;  1B89 A;  2VSX E;  2X6I A;  4HQD A;  5BPP A;  1E8X A;  3AG3 E;  3AJI A;  5LP0 A;  3CHR A;  4GTS A;  2Y1L E;  3HG0 D;  3CEQ A;  4LG6 A;  3LY8 A;  3O48 A;  3DPD A;  1FT1 A;  4HFG A;  1MJ0 A;  5ENQ D;  1INZ A;  5KJN A;  3TG4 A;  4ACL A;  4N3A A;  4JB8 P;  4KXK B;  2VGX B;  1S63 A;  2YHE A;  4B0Z A;  5KNH D;  4XKB A;  3PRZ A;  1Z3X A;  4PH4 B;  2LAH A;  2FO1 E;  3CVY A;  1HZ4 A;  5CER B;  4DJA A;  4JL0 A;  3PUK A;  3MKQ B;  1RW2 A;  4DLQ A;  4LUN U;  3UM0 A;  3V30 A;  4FHJ A;  2X6H A;  5AJL A;  4L9P A;  1HXI A;  1JCS A;  4K03 A;  1OWN A;  1QZ2 A;  2WXJ A;  5FQ8 A;  3HXD A;  4BER A;  3PZ1 A;  4DRX E;  2IFU A;  2DIW A;  2WXL A;  2EIM E;  2J49 A;  1IHB A;  3MYV A;  5B1B E;  2V0P A;  2WXO A;  4UI9 C;  3UIP C;  4N2S A;  4A1G A;  3LY9 A;  2QC9 A;  2KXP C;  2FEZ A;  4I6E A;  3SFZ A;  4U96 D;  5G05 C;  2WMN A;  4C0E A;  3SF4 A;  3GW4 A;  3DXK G;  3D9J A;  1E8W A;  3DEO A;  1EPU A;  3CV0 A;  2J9Q A;  3B7S A;  5CCL A;  4B89 A;  2FBN A;  4U7E B;  3APD A;  4X8Q A;  3ABK E;  3ZXP A;  2I1K A;  3AG2 E;  4ILG A;  4BET A;  2GRO B;  5CEA A;  2I9C A;  3S7F A;  2QYU A;  1ELR A;  1X81 A;  4B8C B;  2F0Y A;  2KCV A;  1BPO A;  2Y4U A;  4CGV A;  2HO1 A;  1TNB A;  4GZD A;  4GAA A;  1IQU A;  3AS5 A;  3AAA C;  4ILI A;  3RRU A;  4O60 A;  3UKU G;  1TR4 A;  3NB2 A;  2KBX A;  1MX6 A;  4BX8 A;  4J0U A;  1UOH A;  4L23 A;  3QWW A;  3RSE G;  2XGO A;  2PQR A;  4L7T A;  3DPY A;  2QZA A;  3R7R A;  2LAI A;  4F6R D;  4TV3 A;  2E0I A;  4RVB A;  1K8K G;  3E32 A;  4LNU D;  3BG0 B;  3UI2 A;  3SQV A;  1HE8 A;  3MKR A;  3B13 A;  3FFL A;  3QOU A;  3MA5 A;  3L82 A;  4RG9 A;  2VSN A;  3KAE A;  2J4D A;  3OXL A;  3I3N A;  4XKC A;  3VLD A;  4JC8 A;  2A5E A;  3GZS A;  2XRY A;  4NAC A;  3ZW3 A;  3CVV A;  3HIZ A;  3FHE A;  2BKK B;  4EBA G;  3SFX A;  3Q7A A;  3D3M A;  3FTU A;  4NQ0 A;  4CDM A;  4D10 C;  3CVL A;  3CVW A;  4U0Z A;  3MV3 B;  3MEK A;  5KJK A;  4BY6 A;  1EF1 C;  1K1B A;  4PS7 A;  3FH5 A;  2XPI A;  1S70 B;  3NAW A;  3LY7 A;  1SQM A;  2AW6 A;  4GZ5 A;  3MJW A;  1TNZ A;  4EBA A;  3HDX A;  3ZN3 A;  1ZBP A;  1N95 A;  2VGX A;  4GA0 A;  2MRI A;  3FUJ A;  4KT6 B;  4CT0 A;  3RU0 A;  4JEH A;  3UTM A;  4WNG A;  2DBA A;  4J8Y A;  3SO8 A;  5A6C A;  5FQ6 A;  2XQ0 A;  4FU3 A;  2HR2 A;  3UQ3 A;  3RKV A;  2WQH A;  3MKQ A;  3LYA A;  2LUH A;  4HLL A;  3CQG B;  2GRQ B;  2J8S D;  5KCM A;  1H2T C;  2RFA A;  1N94 A;  4G8K A;  1QBQ A;  4FP7 A;  2HYZ A;  3G2W A;  4N39 A;  3HVE B;  4C0M A;  3IHY A;  2V8S E;  4FJZ A;  4F1P A;  3J5P A;  2F8X K;  3JUE A;  2VSY A;  1UJK A;  2CHZ A;  3RAU A;  1TYQ G;  3GYZ A;  3VLE A;  3ZYQ A;  1BI8 B;  4KMO A;  3FUM A;  1YCS B;  3PNT B;  1AWC B;  1OWO A;  3SY2 A;  3B7R L;  2GRP B;  3TG5 A;  3D9N A;  5C2Y A;  1IXV A;  3B7T A;  4WUY A;  3ZFW A;  2GRN B;  2VJ8 A;  2XEE A;  2V5F A;  3TWU A;  4E85 A;  3MX3 A;  3TWV A;  1XGW A;  2HM8 A;  3ONK A;  3JXI A;  2LSU A;  3PE4 A;  5JJ7 A;  1MQS A;  5AAR A;  3U66 A;  1FVF A;  4ABN A;  4F3V A;  3TXN A;  1O5M A;  3ZYK A;  1TJC A;  1TNO A;  3PEU B;  2I2O A;  1TN8 A;  3UX4 A;  3J5Q B;  1NP7 A;  2PNN A;  1BI7 B;  4RQI A;  1OXJ A;  5BT1 A;  4GB9 A;  2P9L G;  4FUL A;  1E96 B;  2FF4 A;  4DK5 A;  1DNP A;  1E8Y A;  3TWS A;  4GYW A;  4PDX A;  5AAO A;  1MYO A;  3ASG A;  1YMP A;  1LD8 A;  5CRU A;  3Q7F A;  2H6G A;  2DZN A;  5IY5 E;  3TWX A;  5G04 J;  4WWN A;  1FCH A;  1VDY A;  2L0T B;  2OOE A;  3AG1 E;  4ANW A;  4OVV A;  1Z5S C;  1TN6 A;  2CHW A;  3ABM E;  3DWL G;  2L9B A;  3W9F A;  4BX9 A;  4I9E A;  3UT4 A;  3FU0 A;  2WVI A;  3NOC D;  4GA2 A;  4E6H A;  5EKQ D;  3FDH A;  3BEE A;  3L6A A;  3Q73 A;  3LCA A;  3TWT A;  1N4S A;  3NQP A;  2GRR B;  1HG2 A;  1O1S A;  2XS1 A;  1JPL A;  3B7B A;  2IQC A;  4KBQ A;  3PE3 A;  3QAQ A;  4UUC A;  2P2C P;  3LEW A;  1UJJ A;  3QDN A;  4HVB A;  1OUV A;  2I6H A;  3CHP A;  4KVM A;  3BG1 B;  3URZ A;  4AV7 A;  4UWF A;  1OCO E;  4PS3 A;  5CRV A;  2ETA A;  3QJZ A;  3NZU A;  4OVU A;  4K5C A;  3D9L A;  5EYP F;  1YYH A;  1OWL A;  3BU8 A;  4EEC A;  4AJW A;  5JJ6 A;  1TNY A;  2X6J A;  5ENN A;  2XEV A;  1H2V C;  3T5X A;  3HVE A;  2CHX A;  2GRM A;  3L9T A;  3ML8 A;  3UM2 A;  2IY0 C;  5HRY A;  3DXM G;  4LER A;  4NRH B;  4DI4 A;  5ANR A;  2ZGG A;  4ATG A;  2AWI A;  4HOS A;  4O1O A;  3CKB A;  5CED B;  3ULY A;  3ZYM A;  4HOT A;  1TEZ A;  3MV2 B;  1H6O A;  4L2L A;  2JLB A;  3I5P A;  1DCQ A;  3Q9U C;  4CT4 A;  4R7L A;  3C98 A;  4FLH A;  5JHA A;  1A17 A;  4YND A;  2EIJ E;  2X3M A;  5FWQ A;  2ZXW E;  1LTX A;  4JPS A;  4WAF A;  1Y8M A;  3NOG D;  1BLX B;  3UPV A;  4HI8 A;  4GZC A;  3ULQ A;  2C0L A;  3NBN B;  3G2U A;  5BV1 A;  1D8E A;  3CR3 A;  2GW1 A;  3LDZ A;  3SHF A;  2FO7 A;  4ZHB A;  2IOS A;  3UIN C;  2NC9 A;  4JA7 A;  3RRM B;  1S64 A;  1NFI E;  4K5B A;  4EZL A;  4U8H A;  5D66 A;  2DZO A;  4DX2 A;  3DST A;  5ENR D;  2LXL A;  3Q5M A;  4U8Y D;  1JCQ A;  5ENP D;  3ASF A;  3TJP A;  5LCW J;  5LX8 A;  5H7P A;  2FUL A;  3FTZ A;  4UQZ A;  2VYI A;  5AEN A;  4J8S A;  5FT9 A;  2Y69 E;  4C9B B;  2XZT G;  4OYS A;  2R02 A;  1HH8 A;  4YVQ C;  1ZU2 A;  3TL5 A;  4HOR A;  5CMY A;  2A5U A;  5ARF A;  2WXM A;  1U3D A;  4GYO A;  2X6K A;  3FEY A;  5BW8 C;  1V55 E;  4DUI A;  2AXV A;  3PEV B;  5BV0 A;  4Y6W A;  1EYH A;  5T8I A;  3PDN A;  1IKN D;  2BTD A;  3ENE A;  4ILH B;  5FZS A;  3F6Q A;  1N4P A;  2XEH A;  5FZR A;  5AQB A;  1LD7 A;  3ISM C;  3V79 K;  2XCC A;  4K0R A;  2QYJ A;  3NZS A;  2XGS A;  3FP3 A;  3UXG A;  1JUQ A;  4IYP A;  3Q4A B;  4FJY A;  1N11 A;  2P9U G;  3HXC A;  4OAU C;  1V54 E;  4G8L A;  4BES A;  3AU4 A;  1NA0 A;  1KT0 A;  2OVF A;  2ION A;  4UI9 J;  1UN9 A;  5ENS D;  4TXR A;  3ASH A;  3Q78 A;  3LPZ A;  2WXK A;  4JHJ A;  4U04 A;  5D0O D;  3SD5 A;  5G05 J;  3K9I A;  3JQ0 A;  4TUU A;  4GTV A;  4XZ4 A;  1OCC E;  3QNK A;  2Y0B G;  5AQA A;  4AXH A;  1E7V A;  4XI0 A;  3PZ2 A;  3QKY A;  4FC8 A;  3S7B A;  5FIO A;  4HOQ A;  4F1S A;  4LCT A;  3V2X A;  3G2S A;  4NUR A;  2WXF A;  1IHG A;  4J8F A;  4UWH A;  4EHM A;  5HQ8 A;  5KJL A;  2CFZ A;  2EQX A;  4I6G A;  1HF8 A;  4DX5 D;  4Q69 A;  2OEW A;  1HU3 A;  3FEX A;  4YDO A;  5CBN A;  5BXO A;  4Q96 A;  1N54 A;  3CVU A;  4QQI A;  1HX8 A;  4I6J A;  3IKO B;  3D9P A;  3PZ3 A;  1E8Z A;  3ZGQ A;  1HS6 A;  4GTP A;  2ETB A;  5EN5 D;  5B1A E;  1Z6T A;  2MHK A;  2M63 A;  1TN7 A;  4BFR A;  3EHN A;  3IXE A;  2AXU A;  3ZHE B;  3B7U X;  3FUD A;  3IBE A;  2BUG A;  3LVR E;  3AG4 E;  3HXF A;  3HRA A;  3SFY A;  1S0P A;  4DX6 D;  3LS8 A;  3DRA A;  3DSU A;  4CGW A;  4L1B A;  5A23 A;  4U0S A;  4I1A A;  2L6B A;  5DBK A;  2F8Y A;  3FU5 A;  4GZ3 A;  1NI1 A;  4AVX A;  4N3C A;  1E90 A;  3ASD A;  4JHK A;  2R2L A;  4P29 A;  3FTW A;  4B94 A;  3E34 A;  5G2N A;  5KWD A;  4KVO A;  3U3W A;  3APC A;  2QY7 A;  2FI7 A;  4BSX A;  2R03 A;  3KS2 A;  1AP7 A;  1U2V G;  3TWQ A;  4I17 A;  1DC2 A;  3Q75 A;  2IOL A;  3I4R B;  5LFA A;  3ZXS A;  3TWW A;  3EIJ A;  2XHE A;  2WXG A;  3P1U A;  1BD8 A;  4GTT A;  4H7Y A;  1RZ4 A;  2XPY A;  4RSY A;  4ME2 A;  3LJ3 A;  3GZ1 A;  1UN8 A;  3D9K A;  3PZD A;  5T4Y A;  2J08 A;  3Q49 B;  3E30 A;  4JVS A;  2L0I A;  2VGY A;  1QNF A;  2YNQ A;  2XZD G;  4WND A;  4DLO A;  3JQ1 A;  1SA5 A;  2B6C A;  2VTB B;  4H7X A;  3U4T A;  1P5Q A;  3HXB A;  4NIK A;  3IEG A;  4MRU A;  1Q2Z A;  2VQ2 A;  2P9P G;  3RRN B;  5AIJ A;  1IQR A;  4N3B A;  3ZYL A;  3CVN A;  1X5B A;  3U9W A;  1HG5 A;  5FTP A;  3KEZ A;  3VLF A;  3ZIM A;  4L2Y A;  3ESK A;  1JWF A;  3IV0 A;  2P9N G;  2J4B A;  3QWV A;  2NXP A;  4APF A;  3CVX A;  4A55 A;  4UQY A;  4GPK A;  3N71 A;  2F37 A;  3OXF A;  5FJY A;  3ML9 A;  2IU1 A;  3T8K A;  2WQ7 A;  4DI3 A;  3JYS A;  3FUH A;  4ANU A;  4A63 B;  3S7D A;  4AY6 A;  1XNF A;  4HRL A;  3QC1 A;  1GW6 A;  4DX1 A;  4J6I A;  3Q9N C;  3HHM A;  4N5C A;  2YQ8 A;  5HI7 A;  1HFA A;  1WM5 A;  5CCM A;  1ZB1 A;  3PNL B;  4DPR A;  2CFU A;  2BKG A;  5D2M C;  2XCB A;  4APO A;  3ESL A;  4URK A;  2WXN A;  3SBS A;  3RO3 A;  3WXX A;  5G55 A;  4FA6 A;  2XS8 A;  3SI5 A;  2C0M A;  1W3B A;  3CKC A;  3ZHE A;  4GTM A;  4LNG A;  2KCK A;  2OVB A;  4KYO B;  4FHK A;  3R9A B;  3UKR G;  4I1M A;  3E4B A;  5CEC B;  4G11 A;  2UWJ G;  2H6F A;  4GA1 A;  4QFV A;  3C3R A;  3KEA A;  5ENT D;  4XE0 A;  3E37 A;  3Q15 A;  3D9M A;  3FY4 A;  4B8A A;  5KNG A;  2KCL A;  1H19 A;  2ZIR A;  2IO2 C;  3FUI A;  4GYY A;  4BT8 A;  3CHM A;  4ANV A;  3ZU7 B;  2GGF A;  2RFM A;  1WAO 1;  2B0O E;  3U64 A;  3CGH A;  4MBG A;  3DSX A;  3EHR A;  4YDE A;  4XX5 A;  4FAD A;  4BTB A;  4AM9 A;  2I1J A;  4M7C A;  5HKP A;  4G24 A;  2NSZ A;  5BUZ A;  3E33 A;  3TGO A;  2LO6 A;  3L54 A;  2IJG X;  4Q94 A;  2R5S A;  5ITZ F;  4EPZ A;  3EU5 A;  4M3O A;  1NA3 A;  3QAR A;  2CG3 A;  4U95 D;  5AYW D;  3R9M A;  3RIB A;  1EDU A;  4J7W A;  2X38 A;  2P9I G;  4BTA A;  4U0U A;  5T3R A;  2EIK E;  2KZT B;  1HO8 A;  4RG6 A;  4W9R A;  4UWL A;  2WXR A;  4I1O B;  2MYO A;  3DBS A;  1PC2 A;  3V2O A;  3FUN A;  2WQ6 A;  5AQ7 A;  4EZJ A;  3LXU X;  3KSQ A;  1A5E A;  4CRW A;  3CST A;  4AY5 A;  1Z3Y A;  1TJF A;  2RG8 A;  3CK8 A;  4HS2 A;  5HS0 A;  4HB5 A;  2JEK A;  4IN3 B;  4LRZ A;  5D0Q D;  1N0R A;  5B3S E;  3AS8 A;  4G2V A;  2DCP A;  4HXI A;  5JMN D;  2VTB A;  1PAQ A;  3R7Q A;  2RD0 A;  4ACK A;  3ASN E;  2V4H C;  3ULE G;  5FZQ A;  2XPZ A;  3UUX A; 
#chains in the Genus database with same CATH homology
 4JIO A;  2R02 A;  3C3O A;  3UM1 A;  2R03 A;  2XS1 A;  2OEW A;  2OEV A;  3RAU A;  2R05 A;  1ZB1 A;  5CRV A;  3C3Q A;  2OEX A;  3R9M A;  3UM2 A;  2OJQ A;  3UM3 A;  3C3R A;  3UM0 A;  2XS8 A;  5CRU A;  3ULY A;  3ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...