2OEWA

Structure of alix/aip1 bro1 domain
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
358
structure length
358
Chain Sequence
b'MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 6-interacting protein
publication title Structural and Biochemical Studies of ALIX/AIP1 and Its Role in Retrovirus Budding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 121
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 2oewA00
3R9MA 3UM2A 2XS1A 3ZXPA 1ZB1A 3UM0A 2R03A 5CRVA 3UM3A 3RAUA 2OEVA 3ULYA 3C3QA 2R02A 2R05A 2XS8A 5CRUA 3UM1A 3C3OA 3C3RA 2OEWA
chains in the Genus database with same CATH superfamily
1V54E 5ENOD 4TRQA 2WXKA 3ZIMA 4I9CA 4BERA 1BLXB 3HXDA 4DJAA 3TG5A 2WQ7A 3J5PA 4G2VA 3MV3B 5DBKA 3ZYMA 2Y0BG 2J07A 2PM6A 3MV2B 3FH7A 3FUIA 1RZ4A 1KLXA 3EU9A 2F8YA 5BXOA 3FTVA 3UXGA 4A1GA 3MGBA 4BX8A 4CT4A 4U96D 1JWGA 2L9BA 2V8SE 3Q5MA 3Q9UC 1NA3A 4B93B 4MRUA 3HVEB 4PS8A 3ZHEA 3G2VA 3E30A 2AJAA 3ZN3A 4CDMA 2WXQA 3UI2A 1IHGA 5T4YA 4J8DA 2EINE 2L0TB 4K0RA 4LCTA 1SA5A 3ZEFA 3UIOC 4J0UA 5AJDA 5LCWJ 3MEKA 3KAEA 1GW6A 5AIJA 5ENRD 1MX2A 4AY5A 2CG2A 3ONLA 1NP7A 4MLPA 4GMRA 2WQHA 2LO6A 3S7JA 2ZISA 1PAQA 3EJNA 3HVEA 2XPZA 4WUYA 4EZJA 4UI9J 5JJ6A 2VYIA 3SFYA 2XZDG 3T8KA 4IRUA 1OY3D 3FUEA 5FQ6A 4DX1A 1LF8A 1TJCA 4EPZA 3JUIA 3ESKA 1IQUA 3GW4A 4GTSA 4ILIA 4HRLA 2FO1E 5C2YA 3DPYA 1A5EA 3TL5A 1UG3A 3NZSA 4ZHBA 3B7SA 1K3ZD 3ZW3A 3LEWA 3MJWA 4GCNA 4CEMA 1N0QA 3PZ1A 4K5AB 5EX0A 4HFGA 2RFAA 3ZVVA 4I6GA 4TXQA 2YNQA 5B3SE 3GYZA 2WXJA 2RD0A 3SGHA 1AWCB 2AWIA 1SZAA 5AN8A 5ANRA 5ITZF 4XZ4A 3CVWA 4G8LA 4QFVA 2QC9A 5LX8A 1JCSA 4UWKA 3IHVA 3CHOA 3EDTB 4JHRA 4P29A 4U0SA 5AQAA 3HYMB 2NXPA 5EILA 3DSSA 3PUKA 3CVXA 3BU8A 4ACLA 3DWLG 3JXIA 1EDUA 2WXPA 3ISMC 3E34A 4CCAA 4OVVA 1FVHA 1X81A 1MX6A 2L6JA 2Y69E 1YCSB 3FFLA 4L9PA 4U8YD 1TNZA 5T3RA 2XCBA 3ULQA 3CK7A 4PH4B 5HRYA 2P9NG 2J4BA 3L08A 3PH0C 3QJZA 4N39A 2XEHA 4N2QA 3ABLE 2ZGGA 4LNGA 1Q2ZA 1OWLA 4WNFA 4HRMB 4G25A 5BPPA 1X5BA 4U63A 3QAQA 2VSNA 4G26A 1N95A 2KBXA 1UOHA 2OVFA 5AJLA 2QFCA 4WWPA 5ANLA 4KZ0A 3E4BA 3LY7A 3BQOA 4I2ZA 4LEUA 4BEPA 3FH8A 2J9QA 3PNTB 5AQ9A 4URKA 3R9AB 3KD7A 1V55E 3IEGA 4DUIA 2PNNA 2VSXE 3N71A 1Y8MA 3FUJA 4J8SA 2DCPA 2WXFA 2XCCA 3KEAA 5A23A 1TJFA 3TGOA 4YVOA 2WB2A 3D9IA 1Z3XA 3PZDA 1N54A 1DCQA 2GRMA 3BG0B 3UTMA 3FTUA 2XPYA 4JXTA 4Q69A 3PZ2A 4U04A 3MA5A 3S7BA 4GA0A 3EHNA 2EIJE 3ML8A 1TN7A 1D9SA 4G1TA 2ETBA 2IOLA 4Y6WA 3AAAC 2H6IA 4DX7D 3ASOE 2LAIA 3AS4A 4CDRA 2PQNA 1SQMA 2A5EA 3D9KA 4DLOA 3C5RA 3L13A 2LUHA 3QWPA 2MHKA 4HXIA 4KBQA 5KWDA 3TWVA 3GZ1A 4J8EA 3ULEG 4GTVA 4YDOA 3TG4A 4N5CA 4ATZD 1BU9A 3C3QA 1OWNA 3MKQA 4ME2A 1EYHA 4B0ZA 4XIFA 3DRAA 2IFUA 2I1KA 2BKKB 3SI5A 2QYUA 1S0PA 5CBOA 2WMOA 3VTYA 1OWMA 4UUCA 5CRVA 3Q9NC 3RAUA 1U3CA 1E8XA 1FT1A 3DXKG 2ZU6B 3CLJA 3DSXA 2J49A 3CEQA 4Q96A 5AQBA 5CERB 1IQRA 4XEIG 5BXUA 5BW8C 3VTXA 1WAO1 1LD8A 4KMOA 2IJGX 3VLEA 2DYRE 3L22A 3NZUA 1O5MA 4WNGA 4A3VA 4HOSA 3OAWA 5CRUA 4B8CB 5A6CA 2X3MA 1HE8A 3LS8A 4CYMD 1W3BA 2KM4A 4N2SA 3UUXA 3RIBA 2IEJA 5G05C 1PC2A 4GU5A 3Q79A 2I6HA 4G23A 4JHKA 4ANVA 4BFRA 2P9IG 4PDXA 5FJYA 3KEZA 3B7UX 3LCAA 4H7YA 1U2VG 1KT0A 5CMWA 4FLBA 5CCMA 2PQRA 3NB2A 3LYAA 3IXEA 4RG6A 4DK5A 3APDA 3TWXA 3HG0D 4G11A 4AV7A 2YQ8A 3V30A 4GYYA 2OEWA 1IHBA 3UIPC 3D9LA 3ZXPA 1LTXA 5HQ8A 2ZXWE 2PL2A 4RQIA 4WNEA 5KCMA 3ZYKA 2B6CA 3UPVA 3MZLB 5A7DB 1QYMA 4O60A 3QB2A 3ASGA 2I2OA 1BD8A 3FEYA 3B7BA 2C0LA 5AYWD 3FWVA 2FO7A 2RFMA 3PNLB 3FUMA 3LJ3A 2KCLA 4RSYA 4UWGA 3TJPA 1OCCE 1N9AA 1MYOA 3LDZA 4JL0A 4A1SA 4E85A 3CVQA 3CVLA 4HQDA 3Q78A 2VGEA 3G2SA 1WDYA 3QWVA 3SNXA 2M63A 4UWFA 1MHQA 4DLQA 2LXMA 1JCRA 4ILHB 4I1OB 2P9PG 3EHMA 2BEDA 4L2LA 1UN8A 4M7CA 1H6OA 4U0UA 3IHYA 3V2OA 4CGWA 2YINA 3R9MA 1Z5SC 1H6KA 4BT9A 1HG2A 4LNUD 5CHEE 2DVWA 2KXPC 2EQXA 2WXLA 4HNAD 3PREA 3DSWA 1OWPA 5FTPA 3SZ7A 4HOTA 2BKGA 2I1JA 3ML9A 2XGMA 4BTBA 1FT2A 3TWRA 4JB8P 1UW4B 5CEDB 3RRMB 2GRPB 4IULA 2LSUA 1L5JA 4G24A 1INZA 5AENA 2V5FA 5T8IA 1WY6A 3UT8A 4A63B 2JABA 2CHZA 4J8FA 1AP7A 1FVFA 1E8ZA 3RK6A 2DYSE 3G2UA 3Q7AA 5FIOA 3PRZA 4XE0A 3EIQC 3U66A 3UINC 3BG1B 4BT8A 2GRRB 3TWUA 3ASHA 2P2CP 4DX5D 5EYPF 1DNPA 5BNWA 3URZA 3SY2A 5KBAA 2X6JA 3JQ0A 4BY6A 4GMJA 2R17C 3D3MA 3Q15A 3QWWA 2DZOA 4XI0A 3ASDA 4FADA 3DSTA 4DI3A 2XGOA 4IYPA 3JQ1A 2OVBA 1JUQA 3MKRA 5ENSD 4NIKA 3SBSA 5FQ4A 2MOWA 3J5QB 2ONDA 1SA4A 2Y4TA 3NF1A 1NFIE 4HI9A 3PZ3A 3UT7A 1LD7A 4U0ZA 4GMLA 2FEZA 3NQPA 4I9EA 4OAVB 2AXUA 3CVYA 3IKOB 3Q4AB 5ENQD 1QZ2A 4LNBA 2WXMA 2H6FA 5AAOA 3QOUA 4ABNA 3FEXA 2CHWA 3LKUA 5KJKA 3E32A 3FUKA 4A3TA 5G04C 4XKCA 2XQ0A 1G3NB 3Q49B 3UM3A 4JW1A 1IKND 2X6KA 4GPKA 2XS8A 3AS8A 2F37A 4G8KA 2J4DA 5D2MC 4N3BA 5E76A 3S2AA 1KZOA 4UQZA 2GRQB 2BTDA 1UJKA 1HO8A 4UWHA 3ZXSA 2X6HA 4NQ0A 3NOGD 4JC8A 4O1OA 2Y4UA 2DWZA 3ZRHA 3BEEA 1JWFA 5AQ7A 5KNHD 3GZ2A 2X38A 4FU3A 4UWLA 3DEPA 4TV3A 5EIDA 3E37A 3V31A 1YA0A 2AXZA 4I2WA 1E8YA 1S64A 4GTPA 3AG1E 4TXPA 2J8SD 3ABKE 2HO1A 4FJZA 4GTRA 5EYLA 5M72A 1N94A 3LY9A 4OYSA 4YDEA 3AU5A 4GTTA 4CRWA 2IY0C 3BUAA 3FDHA 2C2LA 4HS2A 3JUEA 1N4SA 3VLDA 2Q7FA 2IF4A 3PEUB 1MJ0A 4KXKB 3KSLA 1K1AA 4KVOA 2LXLA 2Y3AA 2GGFA 3RO2A 2V5QC 2XGSA 3UKRG 3HIZA 1HXIA 5CMYA 2X6FA 3PEVB 3P1UA 4JD2G 4AJWA 3DXMG 3EHQA 4GZ6A 5ENNA 1SW6A 4GZDA 2OOEA 2ZIRA 1HS6A 5B1BE 3I3NA 3R7QA 2HYZA 1OCZE 1P5QA 4N5QA 1S63A 2XHEA 4E6HA 4F1PA 5CEAA 5EN5D 3E33A 4C48B 3AU4A 3HXBA 2CG3A 5FZRA 3RRNB 1H6PA 5EDSA 4BSZB 3FTYA 2VQ2A 5JHBA 1WM5A 5JA4D 4JEHA 2OEVA 2VSOE 4YDWA 2FBNA 4KVMA 3X2QE 3AJIA 2L6BA 4BESA 4TUMA 1B89A 2AXVA 3CK8A 1FPPA 3CHMA 2F8XK 1RW2A 2NC9A 3OXFA 2I9CA 4X8QA 3HXCA 3S7FA 4BETA 3IBEA 3I5PA 4L23A 3QARA 2WQ6A 4J7WA 4W9RA 1Y6IA 4EZLA 3MX3A 2BF0X 4F53A 2A5UA 3UM2A 1TNBA 2OCCE 3TWTA 4O6FA 4BSXA 5JJTA 4YNDA 2HM8A 1HG5A 1D8DA 3PUJA 4O1PA 3K9IA 3LVRE 3EHRA 2YHEA 1H19A 5IY5E 4I6EA 1Z6TA 3C3RA 4DRXE 1E90A 3ONKA 5EIBE 3U64A 1PY1A 3JCKC 3HHMA 5H7PA 4EQFA 1DC2A 3RRUA 3PS6A 1KPSB 4ACKA 4F3VA 5ENTD 4NACA 4DI4A 3OXGA 1OXJA 2XS1A 3PZ4A 4CT0A 3U4TA 4UI9C 2KZTB 4CGVA 3KSQA 4YDYA 1H2UA 4GPMA 1YMPA 3APCA 3B95A 3ZKJA 5CCLA 5EKQD 2R2LA 4ANWA 4AOFA 2QY7A 1QQEA 2CFUA 3CIAA 4GAAA 1ZU2A 2R5SA 2QZAA 4UQXA 3NBNB 2VTBB 3Q47B 1EF1C 2DBAA 4JPSA 1JPLA 2YHCA 2PM7A 1ELRA 3WG7E 3APFA 3S7DA 3NOCD 2E0IA 4RVBA 3UT4A 3SFXA 4JA9A 1XGWA 3CHSA 4WNDA 4HB5A 3SBTB 4C0MA 2IOSA 5FT9A 1OT8A 3CK9A 2KZTA 4GB9A 5FZSA 5JHAA 4C9BB 4Q94A 3CHQA 4AVXA 3ESLA 4DPRA 4PUCA 4FULA 5D0QD 3B7TA 4M3OA 1KZPA 2HE0A 1E7VA 1HU3A 3U3WA 1N11A 4FHKA 4WWNA 2WXIA 5KNGA 3QDNA 4AP2A 2BUGA 2H6GA 4RG9A 2XEEA 3CHPA 3B13A 1MQSA 5AARA 5D0OD 2H6HA 1N4RA 4GYOA 5FZQA 4ILGA 3FULA 4BWRA 5J90A 4IN3B 3FTWA 4JZYA 3UQ3A 4GZ5A 4N3CA 4GTOA 2WXHA 3L17A 3CSFA 4I43A 2FF4A 1O1TA 4GA1A 4JEUA 4HORA 3DBSA 4KYOB 1TNYA 1ELKA 2J09A 2XRZA 1S70B 4LSZE 3ZU7B 3V2XA 4XKBA 3D9NA 4XX5A 3FTSA 4K5CA 5G55A 5FWQA 4EBAA 5KJNA 1K8KG 4WWOA 3D9MA 2KATA 3D9JA 2AW6A 1ZB1A 2WPVA 5ARGA 2PZIA 1WG0A 2MRIA 3RO3A 3ABME 3ENEA 4XI9A 3GZSA 2FULA 3SD5A 3SO8A 1HH8A 4EZKA 4GTQA 4QQIA 3MYVA 1U3DA 2WXRA 3ZYLA 3PVLA 1E8WA 3ZUVB 4EECA 3PDNA 4HOUA 1VDYA 5JMND 3ZYQA 4D10C 3ASFA 1TYQG 5G05J 4YVQC 3FY4A 4JHJA 4Y6CA 2DIWA 3TXMA 3SHFA 3EU5A 4ANXA 3CVNA 5FQ7A 1ELWA 3NAWA 1D8EA 3D9OA 3TWWA 2WVIA 3HDXA 3UKUG 4R7LA 3PE3A 5E75A 3DPDA 2FI7A 2IQCA 3LVQE 1NA0A 4H7XA 3LJNA 3T5VA 4OVUA 5D66A 1TN8A 3FP3A 1BI7B 4APOA 2MYOA 3O4ZA 5BV0A 3SQVA 2RKKA 2ETAA 2JEKA 4U07A 1Z3YA 2J08A 4KT6B 4PS7A 5EX3A 3W9FA 4GA2A 4ATGA 3CVUA 3MCXA 3CV0A 1A17A 2LNIA 2R02A 3AG3E 3W9GA 3C3OA 4F7AA 5B1AE 3Q75A 3B7RL 2IO2C 3I4RB 2NSZA 4GYWA 3CKBA 5DIZA 3DEOA 3JXJA 2AVPA 3ASNE 1KT1A 4FHJA 2P9LG 1NZNA 5CECB 3CR3A 2GW1A 2ILRA 4U8HA 4B94A 5G2NA 4MBGA 3WXXA 2XZTG 3FUDA 2XEVA 5FINA 1JCQA 2VGYA 4GZ3A 2JLBA 3G2WA 3TAXA 3RU0A 2R59A 2F0YA 5J08A 4HOQA 2HR2A 1XNFA 3T5XA 2KC7A 4PS3A 1N4PA 4FJYA 2ZGDA 3FTZA 1UN9A 1HF8A 3LPZA 3CVPA 2GROB 3QKYA 3EUVA 1TEZA 1OWOA 3ZFWA 5ARFA 3UMVA 3CQGB 3V79K 1TNOA 1H2TC 3AG4E 3P2BA 4HI8A 3FUFA 4F1SA 4L2YA 3FUHA 1BPOA 2KCVA 3U9WA 1EPUA 1N0RA 3EIJA 4AEZC 2IU1A 5HS0A 1IXVA 4NURA 4FC8A 4TUUA 3VLFA 3T8MA 5KJMA 3JYSA 1TN6A 1IYGA 5JJ7A 3L82A 3CGHA 4I1AA 4OAUC 1K1BA 2XENA 4UQYA 5ENPD 3Q73A 4I17A 1BI8B 3KS2A 3G2TA 4F6RD 2V4LA 4HVBA 3FU3A 3MKQB 4V3IA 4JA7A 2V4HC 1OUVA 2ETCA 5BT1A 5C1DA 5KJLA 4U8VD 2B0OE 4HRNA 2EIKE 3CVVA 2V0PA 2CFZA 3ZNGA 2VSYA 3CKCA 5HKPA 5LFAA 3FTXA 3CSTA 2UY1B 5BUZA 2EIME 2C0MA 2KCKA 3ZGQA 3UM0A 2R03A 1QBQA 3FH5A 4KZCA 4NRHB 4DX2A 1N4QA 4EHMA 3LY8A 2WMNA 1FCHA 2X6IA 3ULYA 3RKVA 3C72A 1OCOE 4U7EB 3IV0A 3Q7FA 4J6IA 4MS6A 1DVPA 3LXUX 4I6JA 3L16A 3L9TA 4FA6A 3CHRA 3CQCB 1OCRE 1O1SA 3QNKA 3UM1A 4DX6D 3ZPJA 1TR4A 4AY6A 5G04J 3FHEA 2GRLA 2XPIA 4N3AA 3L6AA 1NL4A 4UI9K 4B8AA 3FU6A 4Z68A 2P9SG 3C98A 2NYJA 2UY1A 5LCWC 5CBNA 4HBDA 1MX4A 3D9HA 1TNUA 2UWJG 3HXFA 4B89A 3QK0A 2L0IA 2GRNB 4CDNA 4GZCA 2IONA 4K03A 3F6QA 3HXEA 4TXRA 2WXOA 4LRZA 2P9UG 2LSVA 2QYJA 2R05A 4A55A 3AS5A 1H2VC 2VGXB 3TWQA 4L7TA 3I4GA 2IO3C 3FU0A 3D9PA 3R7RA 4C0EA 2LAHA 2Y1LE 3O48A 1HX8A 3PE4A 1HZ4A 2P58C 2XRYA 4GCOA 3OXLA 5LP0A 4ZFHA 4BTAA 1NI1A 2WXNA 5LOZA 2WXGA 3T9KA 4GTMA 1H0AA 2E2EA 2A4ZA 3QC1A 3TWSA 5HI7A 4APFA 2RG8A 3SFZA 5FQ8A 5BV1A 1QNFA 3OTNA 4CZ2D 3UX4A 4AM9A 4RLYA 4HLEA 4EBAG 4BX9A 4HLLA 2P9KG 4I1MA 4WAFA 3AG2E 1HFAA 4MKTA 3DSUA 1N52A 3FU5A 1SVXA 2VGXA 4K5BA 2VJ8A 3FUNA 1DCEA 2DZNA 1E7UA 4LUNU 4AXHA 1O1RA 1YYHA 3HRAA 2WM9A 4LG6A 1ZBPA 2OV8A 3DSVA 3RJVA 4J8YA 4LERA 1UJJA 2CHXA 4FP7A 2VTBA 3SF4A 3ZHEB 4U95D 4JVSA 1MZCA 3RSEG 3TXNA 4FLHA 2EILE 3L54A 1SZ9A 4L1BA 1E96B 4AIFA 4ANUA
chains in the Genus database with same CATH topology
3R9MA 3UM2A 2XS1A 3ZXPA 1ZB1A 3UM0A 2R03A 5CRVA 3UM3A 3RAUA 2OEVA 3ULYA 3C3QA 2R02A 2R05A 2XS8A 5CRUA 2OJQA 3UM1A 3C3OA 3C3RA 2OEXA 4JIOA 2OEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9M A;  3UM2 A;  2XS1 A;  3ZXP A;  1ZB1 A;  3UM0 A;  2R03 A;  5CRV A;  3UM3 A;  3RAU A;  2OEV A;  3ULY A;  3C3Q A;  2R02 A;  2R05 A;  2XS8 A;  5CRU A;  3UM1 A;  3C3O A;  3C3R A;  2OEW A; 
#chains in the Genus database with same CATH topology
 1V54 E;  5ENO D;  4TRQ A;  2WXK A;  3ZIM A;  4I9C A;  4BER A;  1BLX B;  3HXD A;  4DJA A;  3TG5 A;  2WQ7 A;  3J5P A;  4G2V A;  3MV3 B;  5DBK A;  3ZYM A;  2Y0B G;  2J07 A;  2PM6 A;  3MV2 B;  3FH7 A;  3FUI A;  1RZ4 A;  1KLX A;  3EU9 A;  2F8Y A;  5BXO A;  3FTV A;  3UXG A;  4A1G A;  3MGB A;  4BX8 A;  4CT4 A;  4U96 D;  1JWG A;  2L9B A;  2V8S E;  3Q5M A;  3Q9U C;  1NA3 A;  4B93 B;  4MRU A;  3HVE B;  4PS8 A;  3ZHE A;  3G2V A;  3E30 A;  2AJA A;  3ZN3 A;  4CDM A;  2WXQ A;  3UI2 A;  1IHG A;  5T4Y A;  4J8D A;  2EIN E;  2L0T B;  4K0R A;  4LCT A;  1SA5 A;  3ZEF A;  3UIO C;  4J0U A;  5AJD A;  5LCW J;  3MEK A;  3KAE A;  1GW6 A;  5AIJ A;  5ENR D;  1MX2 A;  4AY5 A;  2CG2 A;  3ONL A;  1NP7 A;  4MLP A;  4GMR A;  2WQH A;  2LO6 A;  3S7J A;  2ZIS A;  1PAQ A;  3EJN A;  3HVE A;  2XPZ A;  4WUY A;  4EZJ A;  4UI9 J;  5JJ6 A;  2VYI A;  3SFY A;  2XZD G;  3T8K A;  4IRU A;  1OY3 D;  3FUE A;  5FQ6 A;  4DX1 A;  1LF8 A;  1TJC A;  4EPZ A;  3JUI A;  3ESK A;  1IQU A;  3GW4 A;  4GTS A;  4ILI A;  4HRL A;  2FO1 E;  5C2Y A;  3DPY A;  1A5E A;  3TL5 A;  1UG3 A;  3NZS A;  4ZHB A;  3B7S A;  1K3Z D;  3ZW3 A;  3LEW A;  3MJW A;  4GCN A;  4CEM A;  1N0Q A;  3PZ1 A;  4K5A B;  5EX0 A;  4HFG A;  2RFA A;  3ZVV A;  4I6G A;  4TXQ A;  2YNQ A;  5B3S E;  3GYZ A;  2WXJ A;  2RD0 A;  3SGH A;  1AWC B;  2AWI A;  1SZA A;  5AN8 A;  5ANR A;  5ITZ F;  4XZ4 A;  3CVW A;  4G8L A;  4QFV A;  2QC9 A;  5LX8 A;  1JCS A;  4UWK A;  3IHV A;  3CHO A;  3EDT B;  4JHR A;  4P29 A;  4U0S A;  5AQA A;  3HYM B;  2NXP A;  5EIL A;  3DSS A;  3PUK A;  3CVX A;  3BU8 A;  4ACL A;  3DWL G;  3JXI A;  1EDU A;  2WXP A;  3ISM C;  3E34 A;  4CCA A;  4OVV A;  1FVH A;  1X81 A;  1MX6 A;  2L6J A;  2Y69 E;  1YCS B;  3FFL A;  4L9P A;  4U8Y D;  1TNZ A;  5T3R A;  2XCB A;  3ULQ A;  3CK7 A;  4PH4 B;  5HRY A;  2P9N G;  2J4B A;  3L08 A;  3PH0 C;  3QJZ A;  4N39 A;  2XEH A;  4N2Q A;  3ABL E;  2ZGG A;  4LNG A;  1Q2Z A;  1OWL A;  4WNF A;  4HRM B;  4G25 A;  5BPP A;  1X5B A;  4U63 A;  3QAQ A;  2VSN A;  4G26 A;  1N95 A;  2KBX A;  1UOH A;  2OVF A;  5AJL A;  2QFC A;  4WWP A;  5ANL A;  4KZ0 A;  3E4B A;  3LY7 A;  3BQO A;  4I2Z A;  4LEU A;  4BEP A;  3FH8 A;  2J9Q A;  3PNT B;  5AQ9 A;  4URK A;  3R9A B;  3KD7 A;  1V55 E;  3IEG A;  4DUI A;  2PNN A;  2VSX E;  3N71 A;  1Y8M A;  3FUJ A;  4J8S A;  2DCP A;  2WXF A;  2XCC A;  3KEA A;  5A23 A;  1TJF A;  3TGO A;  4YVO A;  2WB2 A;  3D9I A;  1Z3X A;  3PZD A;  1N54 A;  1DCQ A;  2GRM A;  3BG0 B;  3UTM A;  3FTU A;  2XPY A;  4JXT A;  4Q69 A;  3PZ2 A;  4U04 A;  3MA5 A;  3S7B A;  4GA0 A;  3EHN A;  2EIJ E;  3ML8 A;  1TN7 A;  1D9S A;  4G1T A;  2ETB A;  2IOL A;  4Y6W A;  3AAA C;  2H6I A;  4DX7 D;  3ASO E;  2LAI A;  3AS4 A;  4CDR A;  2PQN A;  1SQM A;  2A5E A;  3D9K A;  4DLO A;  3C5R A;  3L13 A;  2LUH A;  3QWP A;  2MHK A;  4HXI A;  4KBQ A;  5KWD A;  3TWV A;  3GZ1 A;  4J8E A;  3ULE G;  4GTV A;  4YDO A;  3TG4 A;  4N5C A;  4ATZ D;  1BU9 A;  3C3Q A;  1OWN A;  3MKQ A;  4ME2 A;  1EYH A;  4B0Z A;  4XIF A;  3DRA A;  2IFU A;  2I1K A;  2BKK B;  3SI5 A;  2QYU A;  1S0P A;  5CBO A;  2WMO A;  3VTY A;  1OWM A;  4UUC A;  5CRV A;  3Q9N C;  3RAU A;  1U3C A;  1E8X A;  1FT1 A;  3DXK G;  2ZU6 B;  3CLJ A;  3DSX A;  2J49 A;  3CEQ A;  4Q96 A;  5AQB A;  5CER B;  1IQR A;  4XEI G;  5BXU A;  5BW8 C;  3VTX A;  1WAO 1;  1LD8 A;  4KMO A;  2IJG X;  3VLE A;  2DYR E;  3L22 A;  3NZU A;  1O5M A;  4WNG A;  4A3V A;  4HOS A;  3OAW A;  5CRU A;  4B8C B;  5A6C A;  2X3M A;  1HE8 A;  3LS8 A;  4CYM D;  1W3B A;  2KM4 A;  4N2S A;  3UUX A;  3RIB A;  2IEJ A;  5G05 C;  1PC2 A;  4GU5 A;  3Q79 A;  2I6H A;  4G23 A;  4JHK A;  4ANV A;  4BFR A;  2P9I G;  4PDX A;  5FJY A;  3KEZ A;  3B7U X;  3LCA A;  4H7Y A;  1U2V G;  1KT0 A;  5CMW A;  4FLB A;  5CCM A;  2PQR A;  3NB2 A;  3LYA A;  3IXE A;  4RG6 A;  4DK5 A;  3APD A;  3TWX A;  3HG0 D;  4G11 A;  4AV7 A;  2YQ8 A;  3V30 A;  4GYY A;  2OEW A;  1IHB A;  3UIP C;  3D9L A;  3ZXP A;  1LTX A;  5HQ8 A;  2ZXW E;  2PL2 A;  4RQI A;  4WNE A;  5KCM A;  3ZYK A;  2B6C A;  3UPV A;  3MZL B;  5A7D B;  1QYM A;  4O60 A;  3QB2 A;  3ASG A;  2I2O A;  1BD8 A;  3FEY A;  3B7B A;  2C0L A;  5AYW D;  3FWV A;  2FO7 A;  2RFM A;  3PNL B;  3FUM A;  3LJ3 A;  2KCL A;  4RSY A;  4UWG A;  3TJP A;  1OCC E;  1N9A A;  1MYO A;  3LDZ A;  4JL0 A;  4A1S A;  4E85 A;  3CVQ A;  3CVL A;  4HQD A;  3Q78 A;  2VGE A;  3G2S A;  1WDY A;  3QWV A;  3SNX A;  2M63 A;  4UWF A;  1MHQ A;  4DLQ A;  2LXM A;  1JCR A;  4ILH B;  4I1O B;  2P9P G;  3EHM A;  2BED A;  4L2L A;  1UN8 A;  4M7C A;  1H6O A;  4U0U A;  3IHY A;  3V2O A;  4CGW A;  2YIN A;  3R9M A;  1Z5S C;  1H6K A;  4BT9 A;  1HG2 A;  4LNU D;  5CHE E;  2DVW A;  2KXP C;  2EQX A;  2WXL A;  4HNA D;  3PRE A;  3DSW A;  1OWP A;  5FTP A;  3SZ7 A;  4HOT A;  2BKG A;  2I1J A;  3ML9 A;  2XGM A;  4BTB A;  1FT2 A;  3TWR A;  4JB8 P;  1UW4 B;  5CED B;  3RRM B;  2GRP B;  4IUL A;  2LSU A;  1L5J A;  4G24 A;  1INZ A;  5AEN A;  2V5F A;  5T8I A;  1WY6 A;  3UT8 A;  4A63 B;  2JAB A;  2CHZ A;  4J8F A;  1AP7 A;  1FVF A;  1E8Z A;  3RK6 A;  2DYS E;  3G2U A;  3Q7A A;  5FIO A;  3PRZ A;  4XE0 A;  3EIQ C;  3U66 A;  3UIN C;  3BG1 B;  4BT8 A;  2GRR B;  3TWU A;  3ASH A;  2P2C P;  4DX5 D;  5EYP F;  1DNP A;  5BNW A;  3URZ A;  3SY2 A;  5KBA A;  2X6J A;  3JQ0 A;  4BY6 A;  4GMJ A;  2R17 C;  3D3M A;  3Q15 A;  3QWW A;  2DZO A;  4XI0 A;  3ASD A;  4FAD A;  3DST A;  4DI3 A;  2XGO A;  4IYP A;  3JQ1 A;  2OVB A;  1JUQ A;  3MKR A;  5ENS D;  4NIK A;  3SBS A;  5FQ4 A;  2MOW A;  3J5Q B;  2OND A;  1SA4 A;  2Y4T A;  3NF1 A;  1NFI E;  4HI9 A;  3PZ3 A;  3UT7 A;  1LD7 A;  4U0Z A;  4GML A;  2FEZ A;  3NQP A;  4I9E A;  4OAV B;  2AXU A;  3CVY A;  3IKO B;  3Q4A B;  5ENQ D;  1QZ2 A;  4LNB A;  2WXM A;  2H6F A;  5AAO A;  3QOU A;  4ABN A;  3FEX A;  2CHW A;  3LKU A;  5KJK A;  3E32 A;  3FUK A;  4A3T A;  5G04 C;  4XKC A;  2XQ0 A;  1G3N B;  3Q49 B;  3UM3 A;  4JW1 A;  1IKN D;  2X6K A;  4GPK A;  2XS8 A;  3AS8 A;  2F37 A;  4G8K A;  2J4D A;  5D2M C;  4N3B A;  5E76 A;  3S2A A;  1KZO A;  4UQZ A;  2GRQ B;  2BTD A;  1UJK A;  1HO8 A;  4UWH A;  3ZXS A;  2X6H A;  4NQ0 A;  3NOG D;  4JC8 A;  4O1O A;  2Y4U A;  2DWZ A;  3ZRH A;  3BEE A;  1JWF A;  5AQ7 A;  5KNH D;  3GZ2 A;  2X38 A;  4FU3 A;  4UWL A;  3DEP A;  4TV3 A;  5EID A;  3E37 A;  3V31 A;  1YA0 A;  2AXZ A;  4I2W A;  1E8Y A;  1S64 A;  4GTP A;  3AG1 E;  4TXP A;  2J8S D;  3ABK E;  2HO1 A;  4FJZ A;  4GTR A;  5EYL A;  5M72 A;  1N94 A;  3LY9 A;  4OYS A;  4YDE A;  3AU5 A;  4GTT A;  4CRW A;  2IY0 C;  3BUA A;  3FDH A;  2C2L A;  4HS2 A;  3JUE A;  1N4S A;  3VLD A;  2Q7F A;  2IF4 A;  3PEU B;  1MJ0 A;  4KXK B;  3KSL A;  1K1A A;  4KVO A;  2LXL A;  2Y3A A;  2GGF A;  3RO2 A;  2V5Q C;  2XGS A;  3UKR G;  3HIZ A;  1HXI A;  5CMY A;  2X6F A;  3PEV B;  3P1U A;  4JD2 G;  4AJW A;  3DXM G;  3EHQ A;  4GZ6 A;  5ENN A;  1SW6 A;  4GZD A;  2OOE A;  2ZIR A;  1HS6 A;  5B1B E;  3I3N A;  3R7Q A;  2HYZ A;  1OCZ E;  1P5Q A;  4N5Q A;  1S63 A;  2XHE A;  4E6H A;  4F1P A;  5CEA A;  5EN5 D;  3E33 A;  4C48 B;  3AU4 A;  3HXB A;  2CG3 A;  5FZR A;  3RRN B;  1H6P A;  5EDS A;  4BSZ B;  3FTY A;  2VQ2 A;  5JHB A;  1WM5 A;  5JA4 D;  4JEH A;  2OEV A;  2VSO E;  4YDW A;  2FBN A;  4KVM A;  3X2Q E;  3AJI A;  2L6B A;  4BES A;  4TUM A;  1B89 A;  2AXV A;  3CK8 A;  1FPP A;  3CHM A;  2F8X K;  1RW2 A;  2NC9 A;  3OXF A;  2I9C A;  4X8Q A;  3HXC A;  3S7F A;  4BET A;  3IBE A;  3I5P A;  4L23 A;  3QAR A;  2WQ6 A;  4J7W A;  4W9R A;  1Y6I A;  4EZL A;  3MX3 A;  2BF0 X;  4F53 A;  2A5U A;  3UM2 A;  1TNB A;  2OCC E;  3TWT A;  4O6F A;  4BSX A;  5JJT A;  4YND A;  2HM8 A;  1HG5 A;  1D8D A;  3PUJ A;  4O1P A;  3K9I A;  3LVR E;  3EHR A;  2YHE A;  1H19 A;  5IY5 E;  4I6E A;  1Z6T A;  3C3R A;  4DRX E;  1E90 A;  3ONK A;  5EIB E;  3U64 A;  1PY1 A;  3JCK C;  3HHM A;  5H7P A;  4EQF A;  1DC2 A;  3RRU A;  3PS6 A;  1KPS B;  4ACK A;  4F3V A;  5ENT D;  4NAC A;  4DI4 A;  3OXG A;  1OXJ A;  2XS1 A;  3PZ4 A;  4CT0 A;  3U4T A;  4UI9 C;  2KZT B;  4CGV A;  3KSQ A;  4YDY A;  1H2U A;  4GPM A;  1YMP A;  3APC A;  3B95 A;  3ZKJ A;  5CCL A;  5EKQ D;  2R2L A;  4ANW A;  4AOF A;  2QY7 A;  1QQE A;  2CFU A;  3CIA A;  4GAA A;  1ZU2 A;  2R5S A;  2QZA A;  4UQX A;  3NBN B;  2VTB B;  3Q47 B;  1EF1 C;  2DBA A;  4JPS A;  1JPL A;  2YHC A;  2PM7 A;  1ELR A;  3WG7 E;  3APF A;  3S7D A;  3NOC D;  2E0I A;  4RVB A;  3UT4 A;  3SFX A;  4JA9 A;  1XGW A;  3CHS A;  4WND A;  4HB5 A;  3SBT B;  4C0M A;  2IOS A;  5FT9 A;  1OT8 A;  3CK9 A;  2KZT A;  4GB9 A;  5FZS A;  5JHA A;  4C9B B;  4Q94 A;  3CHQ A;  4AVX A;  3ESL A;  4DPR A;  4PUC A;  4FUL A;  5D0Q D;  3B7T A;  4M3O A;  1KZP A;  2HE0 A;  1E7V A;  1HU3 A;  3U3W A;  1N11 A;  4FHK A;  4WWN A;  2WXI A;  5KNG A;  3QDN A;  4AP2 A;  2BUG A;  2H6G A;  4RG9 A;  2XEE A;  3CHP A;  3B13 A;  1MQS A;  5AAR A;  5D0O D;  2H6H A;  1N4R A;  4GYO A;  5FZQ A;  4ILG A;  3FUL A;  4BWR A;  5J90 A;  4IN3 B;  3FTW A;  4JZY A;  3UQ3 A;  4GZ5 A;  4N3C A;  4GTO A;  2WXH A;  3L17 A;  3CSF A;  4I43 A;  2FF4 A;  1O1T A;  4GA1 A;  4JEU A;  4HOR A;  3DBS A;  4KYO B;  1TNY A;  1ELK A;  2J09 A;  2XRZ A;  1S70 B;  4LSZ E;  3ZU7 B;  3V2X A;  4XKB A;  3D9N A;  4XX5 A;  3FTS A;  4K5C A;  5G55 A;  5FWQ A;  4EBA A;  5KJN A;  1K8K G;  4WWO A;  3D9M A;  2KAT A;  3D9J A;  2AW6 A;  1ZB1 A;  2WPV A;  5ARG A;  2PZI A;  1WG0 A;  2MRI A;  3RO3 A;  3ABM E;  3ENE A;  4XI9 A;  3GZS A;  2FUL A;  3SD5 A;  3SO8 A;  1HH8 A;  4EZK A;  4GTQ A;  4QQI A;  3MYV A;  1U3D A;  2WXR A;  3ZYL A;  3PVL A;  1E8W A;  3ZUV B;  4EEC A;  3PDN A;  4HOU A;  1VDY A;  5JMN D;  3ZYQ A;  4D10 C;  3ASF A;  1TYQ G;  5G05 J;  4YVQ C;  3FY4 A;  4JHJ A;  4Y6C A;  2DIW A;  3TXM A;  3SHF A;  3EU5 A;  4ANX A;  3CVN A;  5FQ7 A;  1ELW A;  3NAW A;  1D8E A;  3D9O A;  3TWW A;  2WVI A;  3HDX A;  3UKU G;  4R7L A;  3PE3 A;  5E75 A;  3DPD A;  2FI7 A;  2IQC A;  3LVQ E;  1NA0 A;  4H7X A;  3LJN A;  3T5V A;  4OVU A;  5D66 A;  1TN8 A;  3FP3 A;  1BI7 B;  4APO A;  2MYO A;  3O4Z A;  5BV0 A;  3SQV A;  2RKK A;  2ETA A;  2JEK A;  4U07 A;  1Z3Y A;  2J08 A;  4KT6 B;  4PS7 A;  5EX3 A;  3W9F A;  4GA2 A;  4ATG A;  3CVU A;  3MCX A;  3CV0 A;  1A17 A;  2LNI A;  2R02 A;  3AG3 E;  3W9G A;  3C3O A;  4F7A A;  5B1A E;  3Q75 A;  3B7R L;  2IO2 C;  3I4R B;  2NSZ A;  4GYW A;  3CKB A;  5DIZ A;  3DEO A;  3JXJ A;  2AVP A;  3ASN E;  1KT1 A;  4FHJ A;  2P9L G;  1NZN A;  5CEC B;  3CR3 A;  2GW1 A;  2ILR A;  4U8H A;  4B94 A;  5G2N A;  4MBG A;  3WXX A;  2XZT G;  3FUD A;  2XEV A;  5FIN A;  1JCQ A;  2VGY A;  4GZ3 A;  2JLB A;  3G2W A;  3TAX A;  3RU0 A;  2R59 A;  2F0Y A;  5J08 A;  4HOQ A;  2HR2 A;  1XNF A;  3T5X A;  2KC7 A;  4PS3 A;  1N4P A;  4FJY A;  2ZGD A;  3FTZ A;  1UN9 A;  1HF8 A;  3LPZ A;  3CVP A;  2GRO B;  3QKY A;  3EUV A;  1TEZ A;  1OWO A;  3ZFW A;  5ARF A;  3UMV A;  3CQG B;  3V79 K;  1TNO A;  1H2T C;  3AG4 E;  3P2B A;  4HI8 A;  3FUF A;  4F1S A;  4L2Y A;  3FUH A;  1BPO A;  2KCV A;  3U9W A;  1EPU A;  1N0R A;  3EIJ A;  4AEZ C;  2IU1 A;  5HS0 A;  1IXV A;  4NUR A;  4FC8 A;  4TUU A;  3VLF A;  3T8M A;  5KJM A;  3JYS A;  1TN6 A;  1IYG A;  5JJ7 A;  3L82 A;  3CGH A;  4I1A A;  4OAU C;  1K1B A;  2XEN A;  4UQY A;  5ENP D;  3Q73 A;  4I17 A;  1BI8 B;  3KS2 A;  3G2T A;  4F6R D;  2V4L A;  4HVB A;  3FU3 A;  3MKQ B;  4V3I A;  4JA7 A;  2V4H C;  1OUV A;  2ETC A;  5BT1 A;  5C1D A;  5KJL A;  4U8V D;  2B0O E;  4HRN A;  2EIK E;  3CVV A;  2V0P A;  2CFZ A;  3ZNG A;  2VSY A;  3CKC A;  5HKP A;  5LFA A;  3FTX A;  3CST A;  2UY1 B;  5BUZ A;  2EIM E;  2C0M A;  2KCK A;  3ZGQ A;  3UM0 A;  2R03 A;  1QBQ A;  3FH5 A;  4KZC A;  4NRH B;  4DX2 A;  1N4Q A;  4EHM A;  3LY8 A;  2WMN A;  1FCH A;  2X6I A;  3ULY A;  3RKV A;  3C72 A;  1OCO E;  4U7E B;  3IV0 A;  3Q7F A;  4J6I A;  4MS6 A;  1DVP A;  3LXU X;  4I6J A;  3L16 A;  3L9T A;  4FA6 A;  3CHR A;  3CQC B;  1OCR E;  1O1S A;  3QNK A;  3UM1 A;  4DX6 D;  3ZPJ A;  1TR4 A;  4AY6 A;  5G04 J;  3FHE A;  2GRL A;  2XPI A;  4N3A A;  3L6A A;  1NL4 A;  4UI9 K;  4B8A A;  3FU6 A;  4Z68 A;  2P9S G;  3C98 A;  2NYJ A;  2UY1 A;  5LCW C;  5CBN A;  4HBD A;  1MX4 A;  3D9H A;  1TNU A;  2UWJ G;  3HXF A;  4B89 A;  3QK0 A;  2L0I A;  2GRN B;  4CDN A;  4GZC A;  2ION A;  4K03 A;  3F6Q A;  3HXE A;  4TXR A;  2WXO A;  4LRZ A;  2P9U G;  2LSV A;  2QYJ A;  2R05 A;  4A55 A;  3AS5 A;  1H2V C;  2VGX B;  3TWQ A;  4L7T A;  3I4G A;  2IO3 C;  3FU0 A;  3D9P A;  3R7R A;  4C0E A;  2LAH A;  2Y1L E;  3O48 A;  1HX8 A;  3PE4 A;  1HZ4 A;  2P58 C;  2XRY A;  4GCO A;  3OXL A;  5LP0 A;  4ZFH A;  4BTA A;  1NI1 A;  2WXN A;  5LOZ A;  2WXG A;  3T9K A;  4GTM A;  1H0A A;  2E2E A;  2A4Z A;  3QC1 A;  3TWS A;  5HI7 A;  4APF A;  2RG8 A;  3SFZ A;  5FQ8 A;  5BV1 A;  1QNF A;  3OTN A;  4CZ2 D;  3UX4 A;  4AM9 A;  4RLY A;  4HLE A;  4EBA G;  4BX9 A;  4HLL A;  2P9K G;  4I1M A;  4WAF A;  3AG2 E;  1HFA A;  4MKT A;  3DSU A;  1N52 A;  3FU5 A;  1SVX A;  2VGX A;  4K5B A;  2VJ8 A;  3FUN A;  1DCE A;  2DZN A;  1E7U A;  4LUN U;  4AXH A;  1O1R A;  1YYH A;  3HRA A;  2WM9 A;  4LG6 A;  1ZBP A;  2OV8 A;  3DSV A;  3RJV A;  4J8Y A;  4LER A;  1UJJ A;  2CHX A;  4FP7 A;  2VTB A;  3SF4 A;  3ZHE B;  4U95 D;  4JVS A;  1MZC A;  3RSE G;  3TXN A;  4FLH A;  2EIL E;  3L54 A;  1SZ9 A;  4L1B A;  1E96 B;  4AIF A;  4ANU A; 
#chains in the Genus database with same CATH homology
 3R9M A;  3UM2 A;  2XS1 A;  3ZXP A;  1ZB1 A;  3UM0 A;  2R03 A;  5CRV A;  3UM3 A;  3RAU A;  2OEV A;  3ULY A;  3C3Q A;  2R02 A;  2R05 A;  2XS8 A;  5CRU A;  2OJQ A;  3UM1 A;  3C3O A;  3C3R A;  2OEX A;  4JIO A;  2OEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...