2OF5A

Oligomeric death domain complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
91
structure length
91
Chain Sequence
HILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Death domain assembly mechanism revealed by crystal structure of the oligomeric PIDDosome core complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Death domain-containing protein CRADD
total genus 26
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2007-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2of5A00
4EWIA 4RHWE 1CY5A 4D8OA 2MPCA 2NSNA 2KM6A 1E3YA 4ZBWA 3EZQA 2YU0A 2HM2Q 4JQWA 2KN6A 3CRDA 4P4HI 1N3KA 3YGSP 3KATA 4A2WA 3CL3A 1WXPA 2YGSA 4I16A 2N83A 2GF5A 3T6PA 3MOPK 4DWNA 2IB1A 2MS7A 4E9MA 1DDFA 4F44A 3MOPA 4O9FA 1PN5A 2P1HA 2DBFA 4O9LA 2OF5A 2N80A 1DGNA 1E41A 1NGRA 4F42A 1CWWA 1A1ZA 4O6XA 2M5VA 3QF2A 1WH4A 4M9SA 4O7QA 3LQQA 2N7ZA 2YQFA 4LWDA 2B1WA 1UCPA 2A9IA 4QOBA 4UZ0A 4NQKA 2NZ7A 2DBDA 2DBGA 2VGQA 2O71A 4N1KA 2L6AA 1FADA 4IZAB 2F1SA 4P4HA 4A2QA 2MB9A 2D96A 4JUPA 1ICHA 1C15A 3YGSC 2BBRA 4M9ZA 1D2ZA 1Z6TA 4RHWA 2LWEA 2N1FA 2A5YB 3J63A 4IZ7B 1WMGA 2N97A 2MN4A 1A1WA 2DO9A 2OF5H 2N00A 2BBZA 4FH0A 2NAQA 1D2ZB 2YVIA 3EZQB 2MS8A 4N1LA 3J6JA 3LQRA 2G7RA 4IZ5E 2LWDA 3MOPG 2LS7A 2L9MA 2DBHA 1YGOA 4M9XA 4N1JA
chains in the Genus database with same CATH superfamily
4EWIA 4RHWE 1CY5A 4D8OA 2MPCA 2NSNA 2KM6A 1E3YA 4ZBWA 3EZQA 2YU0A 2HM2Q 4JQWA 2KN6A 3CRDA 4P4HI 1N3KA 3YGSP 3KATA 4A2WA 3CL3A 1WXPA 2YGSA 4I16A 2N83A 2GF5A 3T6PA 3MOPK 4DWNA 2IB1A 2MS7A 4E9MA 1DDFA 4F44A 3MOPA 4O9FA 1PN5A 2P1HA 2DBFA 4O9LA 2OF5A 2N80A 1DGNA 1E41A 1NGRA 4F42A 1CWWA 1A1ZA 4O6XA 2M5VA 3QF2A 1WH4A 4M9SA 4O7QA 3LQQA 2N7ZA 2YQFA 4LWDA 2B1WA 1UCPA 2A9IA 4QOBA 4UZ0A 4NQKA 2NZ7A 2DBDA 2DBGA 2VGQA 2O71A 4N1KA 2L6AA 1FADA 4IZAB 2F1SA 4P4HA 4A2QA 2MB9A 2D96A 4JUPA 1ICHA 1C15A 3YGSC 2BBRA 4M9ZA 1D2ZA 1Z6TA 4RHWA 2LWEA 2N1FA 2A5YB 3J63A 4IZ7B 2XV9A 1WMGA 2N97A 2MN4A 1A1WA 2DO9A 2OF5H 2N00A 2BBZA 4FH0A 2NAQA 1D2ZB 2YVIA 3EZQB 2MS8A 4N1LA 3J6JA 3LQRA 2G7RA 4IZ5E 2LWDA 2MJMA 3MOPG 2LS7A 2L9MA 2DBHA 1YGOA 4M9XA 4N1JA
chains in the Genus database with same CATH topology
4EWIA 4RHWE 1CY5A 4D8OA 2MPCA 2NSNA 2KM6A 1E3YA 4ZBWA 3EZQA 2YU0A 2HM2Q 4JQWA 2KN6A 3CRDA 4P4HI 1N3KA 3YGSP 3KATA 4A2WA 3CL3A 1WXPA 2YGSA 4I16A 2N83A 2GF5A 3T6PA 3MOPK 4DWNA 2IB1A 2MS7A 4E9MA 1DDFA 4F44A 3MOPA 4O9FA 1PN5A 2P1HA 2DBFA 4O9LA 2OF5A 2N80A 1DGNA 1E41A 1NGRA 4F42A 1CWWA 1A1ZA 4O6XA 2M5VA 3QF2A 1WH4A 4M9SA 4O7QA 3LQQA 2N7ZA 2YQFA 4LWDA 2B1WA 1UCPA 2A9IA 4QOBA 4UZ0A 4NQKA 2NZ7A 2DBDA 2DBGA 2VGQA 2O71A 4N1KA 2L6AA 1FADA 4IZAB 2F1SA 4P4HA 4A2QA 2MB9A 2D96A 4JUPA 1ICHA 1C15A 3YGSC 2BBRA 4M9ZA 1D2ZA 1Z6TA 4RHWA 2LWEA 2N1FA 2A5YB 3J63A 4IZ7B 2XV9A 1WMGA 2N97A 2MN4A 1A1WA 2DO9A 2OF5H 2N00A 2BBZA 4FH0A 2NAQA 1D2ZB 2YVIA 3EZQB 2MS8A 4N1LA 3J6JA 3LQRA 2G7RA 4IZ5E 2LWDA 2MJMA 3MOPG 2LS7A 2L9MA 2DBHA 1YGOA 4M9XA 4N1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EWI A;  4RHW E;  1CY5 A;  4D8O A;  2MPC A;  2NSN A;  2KM6 A;  1E3Y A;  4ZBW A;  3EZQ A;  2YU0 A;  2HM2 Q;  4JQW A;  2KN6 A;  3CRD A;  4P4H I;  1N3K A;  3YGS P;  3KAT A;  4A2W A;  3CL3 A;  1WXP A;  2YGS A;  4I16 A;  2N83 A;  2GF5 A;  3T6P A;  3MOP K;  4DWN A;  2IB1 A;  2MS7 A;  4E9M A;  1DDF A;  4F44 A;  3MOP A;  4O9F A;  1PN5 A;  2P1H A;  2DBF A;  4O9L A;  2OF5 A;  2N80 A;  1DGN A;  1E41 A;  1NGR A;  4F42 A;  1CWW A;  1A1Z A;  4O6X A;  2M5V A;  3QF2 A;  1WH4 A;  4M9S A;  4O7Q A;  3LQQ A;  2N7Z A;  2YQF A;  4LWD A;  2B1W A;  1UCP A;  2A9I A;  4QOB A;  4UZ0 A;  4NQK A;  2NZ7 A;  2DBD A;  2DBG A;  2VGQ A;  2O71 A;  4N1K A;  2L6A A;  1FAD A;  4IZA B;  2F1S A;  4P4H A;  4A2Q A;  2MB9 A;  2D96 A;  4JUP A;  1ICH A;  1C15 A;  3YGS C;  2BBR A;  4M9Z A;  1D2Z A;  1Z6T A;  4RHW A;  2LWE A;  2N1F A;  2A5Y B;  3J63 A;  4IZ7 B;  1WMG A;  2N97 A;  2MN4 A;  1A1W A;  2DO9 A;  2OF5 H;  2N00 A;  2BBZ A;  4FH0 A;  2NAQ A;  1D2Z B;  2YVI A;  3EZQ B;  2MS8 A;  4N1L A;  3J6J A;  3LQR A;  2G7R A;  4IZ5 E;  2LWD A;  3MOP G;  2LS7 A;  2L9M A;  2DBH A;  1YGO A;  4M9X A;  4N1J A; 
#chains in the Genus database with same CATH topology
 4EWI A;  4RHW E;  1CY5 A;  4D8O A;  2MPC A;  2NSN A;  2KM6 A;  1E3Y A;  4ZBW A;  3EZQ A;  2YU0 A;  2HM2 Q;  4JQW A;  2KN6 A;  3CRD A;  4P4H I;  1N3K A;  3YGS P;  3KAT A;  4A2W A;  3CL3 A;  1WXP A;  2YGS A;  4I16 A;  2N83 A;  2GF5 A;  3T6P A;  3MOP K;  4DWN A;  2IB1 A;  2MS7 A;  4E9M A;  1DDF A;  4F44 A;  3MOP A;  4O9F A;  1PN5 A;  2P1H A;  2DBF A;  4O9L A;  2OF5 A;  2N80 A;  1DGN A;  1E41 A;  1NGR A;  4F42 A;  1CWW A;  1A1Z A;  4O6X A;  2M5V A;  3QF2 A;  1WH4 A;  4M9S A;  4O7Q A;  3LQQ A;  2N7Z A;  2YQF A;  4LWD A;  2B1W A;  1UCP A;  2A9I A;  4QOB A;  4UZ0 A;  4NQK A;  2NZ7 A;  2DBD A;  2DBG A;  2VGQ A;  2O71 A;  4N1K A;  2L6A A;  1FAD A;  4IZA B;  2F1S A;  4P4H A;  4A2Q A;  2MB9 A;  2D96 A;  4JUP A;  1ICH A;  1C15 A;  3YGS C;  2BBR A;  4M9Z A;  1D2Z A;  1Z6T A;  4RHW A;  2LWE A;  2N1F A;  2A5Y B;  3J63 A;  4IZ7 B;  2XV9 A;  1WMG A;  2N97 A;  2MN4 A;  1A1W A;  2DO9 A;  2OF5 H;  2N00 A;  2BBZ A;  4FH0 A;  2NAQ A;  1D2Z B;  2YVI A;  3EZQ B;  2MS8 A;  4N1L A;  3J6J A;  3LQR A;  2G7R A;  4IZ5 E;  2LWD A;  2MJM A;  3MOP G;  2LS7 A;  2L9M A;  2DBH A;  1YGO A;  4M9X A;  4N1J A; 
#chains in the Genus database with same CATH homology
 4EWI A;  4RHW E;  1CY5 A;  4D8O A;  2MPC A;  2NSN A;  2KM6 A;  1E3Y A;  4ZBW A;  3EZQ A;  2YU0 A;  2HM2 Q;  4JQW A;  2KN6 A;  3CRD A;  4P4H I;  1N3K A;  3YGS P;  3KAT A;  4A2W A;  3CL3 A;  1WXP A;  2YGS A;  4I16 A;  2N83 A;  2GF5 A;  3T6P A;  3MOP K;  4DWN A;  2IB1 A;  2MS7 A;  4E9M A;  1DDF A;  4F44 A;  3MOP A;  4O9F A;  1PN5 A;  2P1H A;  2DBF A;  4O9L A;  2OF5 A;  2N80 A;  1DGN A;  1E41 A;  1NGR A;  4F42 A;  1CWW A;  1A1Z A;  4O6X A;  2M5V A;  3QF2 A;  1WH4 A;  4M9S A;  4O7Q A;  3LQQ A;  2N7Z A;  2YQF A;  4LWD A;  2B1W A;  1UCP A;  2A9I A;  4QOB A;  4UZ0 A;  4NQK A;  2NZ7 A;  2DBD A;  2DBG A;  2VGQ A;  2O71 A;  4N1K A;  2L6A A;  1FAD A;  4IZA B;  2F1S A;  4P4H A;  4A2Q A;  2MB9 A;  2D96 A;  4JUP A;  1ICH A;  1C15 A;  3YGS C;  2BBR A;  4M9Z A;  1D2Z A;  1Z6T A;  4RHW A;  2LWE A;  2N1F A;  2A5Y B;  3J63 A;  4IZ7 B;  2XV9 A;  1WMG A;  2N97 A;  2MN4 A;  1A1W A;  2DO9 A;  2OF5 H;  2N00 A;  2BBZ A;  4FH0 A;  2NAQ A;  1D2Z B;  2YVI A;  3EZQ B;  2MS8 A;  4N1L A;  3J6J A;  3LQR A;  2G7R A;  4IZ5 E;  2LWD A;  2MJM A;  3MOP G;  2LS7 A;  2L9M A;  2DBH A;  1YGO A;  4M9X A;  4N1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...