2OF7A

Structural genomics, the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor a3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
191
structure length
191
Chain Sequence
GLRERKKTRTREAIRAATYGLIRQQGYEATTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLRKALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEVRIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3
rcsb
molecule keywords Putative tetR-family transcriptional regulator
molecule tags Transcription
source organism Streptomyces coelicolor
total genus 64
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2007-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2of7A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2of7A02
3LOCA 2LK2A 2E2IJ 2OERA 1QVUA 1XC5A 2DA6A 2I10A 2COBA 5EYRA 2NVQJ 5D18A 5M5WJ 2W48A 2HXIA 2E2HJ 3CQZJ 3O60A 2HOTA 2Y9YA 4NELA 2AHQA 2M8GX 5D19A 1RKTA 4A3EJ 1UMQA 4A3MJ 2G7SA 4JX4A 1W0TA 4L62A 2ZOZA 5FJ8J 1ORKA 2LY9A 3B6AA 1TWGJ 2R92J 5CW8A 1ETVA 2W53A 1MBFA 2ELKA 3HGYA 3A01B 1IC8A 2ME6A 3LWJA 3WHBA 3LHQA 3LSJA 3VVZA 3ZQFA 1U9OA 1FTTA 1A5JA 3JR9A 1JTYA 3OSFA 1DU6A 2KDZA 5IP6A 4ME9A 3JSJA 1JUMA 2G7GA 3Q0WA 2JK3A 3H0GJ 3JRCA 5DS9A 1TWHJ 4C3HJ 3ON4A 2DA1A 4PXIA 3PM1A 1EF4A 1ZTRA 4C3IJ 2EZHA 3JRAA 4BY7J 5F1JA 5FLMJ 5FMPA 4IHYA 4C3JJ 1K61A 1H88C 4X6AJ 2RHAA 2FQ4A 4UUSA 4ICHA 3Q0UA 1MNMC 2OPTA 2PBXA 2UXOA 1UG2A 4IHVA 3S1RJ 1WI3A 2ID6A 5IYCJ 3IH2A 3F1BA 1D5YA 2H8RA 3I4NJ 1WGXA 5IYBJ 4FE7A 3BR0A 3HKZN 2R5ZA 2GUHA 2E19A 2L7FP 4CGRA 3RH2A 3FIWA 4QSHA 5C4YA 5K7FA 4JL3A 2O9LA 1VNDA 3G1MA 3AQTA 3BQZA 3NNRA 4XRSA 1X58A 2ZB9A 3BR6A 2QWTA 4RBOA 3RZDJ 2NVTJ 1SANA 2DMQA 2M2EA 4NDLA 1SGMA 1GVDA 1MBEA 4Y52J 1WH7A 4J19A 1LFUP 3HOZJ 4AF5A 2MGQA 3IH3A 3ZOBA 2JA8J 1H8AC 3VVXA 1ETXA 1Z77A 2JMWA 3BTLA 5C4XJ 2XGCA 3A03A 1FTZA 3JRHA 2E1OA 3VPRA 3TW7A 1ZR4A 1JKOC 4JKZA 2Y9ZA 5E3MA 1WH5A 5GPCA 5FGLA 3TP3A 3NXCA 4HNVA 2H1KA 3VW1A 1TWFJ 5E3OA 1MH4A 5IYDJ 3BR3A 4EEFG 2L0KA 5JLXA 3ANGA 4A3FJ 3CWRA 3BRUA 3VOXA 2Y0SN 1BW5A 2G3BA 1XG1A 2FX0A 2XRLA 2YS9A 1B72B 3BJBA 1HOMA 3S2DJ 3C2BA 4BY1J 1ETKA 2WGBA 4AUXA 2XDNA 3UKGA 2HKUA 2CQXA 3PO3J 5EGOB 4DYCA 4M3EA 1BL0A 1MBHA 1G2HA 2VKEA 3LSPA 2L9RA 3HOVJ 3E7QA 1FIPA 1JT6A 3VW0A 2WAQN 2XPVA 4JYKA 1AKHB 5EEAA 2OF7A 1AU7A 2ECCA 5J1YA 3JRBA 4A3GJ 3FKIJ 2TCTA 2X48A 4FISA 1U9NA 3KKCA 3BTJA 3MKLA 2GFNA 3GZIA 2R5YB 3JRIA 5F0FA 3GTKJ 1MSFC 1ZR2A 3VUQA 1RESA 2YVEA 3ZQLA 3COLA 3IH4A 2HI3A 3WHCA 2NP3A 3OSGA 3G1LA 2NS8A 1JT0A 4IHWA 2EZLA 2ZOYA 3C07A 2NP5A 4V2FA 5J1RA 4CYCB 2R0QC 2RAEA 1I6HJ 2VUMJ 5K7HA 2WV1A 5FHPA 4D5CA 1GDTA 4A3BJ 1I50J 1ETOA 4D7NA 1UHSA 4W97A 2KT0A 3HDDA 3I4MJ 1TWCJ 4YZEA 3A01A 3HOUJ 3BCGA 3BHQA 1X2MA 2XSDC 5HBUA 3CMYA 1RR7A 2DTZA 3SJMA 1H89C 5HSZA 4S0HB 2EBIA 2NS7A 3JRFA 5EZHA 2LLKA 2IEKA 3B6CA 5FKMA 4DZPA 3L1PA 3ANPA 3PPBA 2G0EA 3ZQIA 3RKQA 3A02A 2QIBA 2NVYJ 1BW6A 3NAUA 4DW6A 2NX4A 1FIAA 4UUTA 4I6ZA 3GBGA 2DG8A 1DU0A 2DA5A 1W0UA 2MG4A 4DYRA 3FK6A 1JTXA 1VF9A 2QOPA 1Y1WJ 2L7ZA 3ZQGA 1WCMJ 3HGGA 5JLWA 2XB5A 4M3FA 4A3KJ 2NVXJ 2PZ9A 1TC3C 2UXIA 2IAIA 5FKLA 1P7IA 1VI0A 3DEWA 5M3MJ 3RZOJ 1K83J 1X2NA 5EG0B 1F36A 3QQAA 5GPAA 4W1UA 1POGA 1OCTC 4A3IJ 2ID3A 1HDDC 5FLVA 1Z0XA 2ZCMA 5IPAA 3O8HA 4GCTA 2CU7A 2LP0A 3HIMA 2WUIA 2P81A 3EGQA 1B8IA 1T33A 2UXHA 1NTCA 2CUEA 2IU5A 3CCYA 4KWAA 5K58A 2QKOA 2REKA 2FJ1A 5FKNA 3LSGA 5IOZA 2HOAA 3QPSA 2CUFA 3S16J 1MH3A 1IDZA 1U78A 2O8KA 4A93J 1UI6A 2O7TA 3DPJA 2MW8A 2HYJA 1F43A 3CJDA 2LR8A 2O7OA 2GENA 3DCFA 2JN6A 3O8GA 5EF6A 5CXIA 4XICA 4QTRA 1P7JA 1JKPC 1HCRA 4AYBN 3RD3A 3JRGA 3HTHA 5C44J 4JX6A 2L7MP 4MXMA 1LE8A 3S15J 4MLOA 3VP5A 5M5YJ 1CQTA 3CRJA 3TP0A 3PO2J 5F0HA 1TWAJ 4B1RA 2UXPA 2TRTA 3VW2A 5D1RA 1ZGWA 2YUSA 5DTDA 1R9TJ 3QKXA 9ANTA 2DA3A 4XRSG 1OCPA 4MK6A 3BTIA 4A3LJ 1BJZA 3S1MJ 3S1NJ 1LFBA 2LVSA 5EZGA 4NN1A 2IBDA 2DMTA 4GFLA 4GCKA 3HE0A 1IGNA 1PUFB 2JA7J 2DA7A 3BNIA 5BNGA 4B3AA 3H3VK 2HOSA 4C2MJ 2XGEA 2HYTA 5C3EJ 3K2AA 4DZJA 4GCLA 3HOYJ 5K7ZA 2R7ZJ 2QTQA 3RQIA 3PASA 1E3OC 2CRGA 1NK2P 3F0CA 5EFYA 2CQQA 2D6YA 5E3LA 3TEDA 2Y2ZA 1IG7A 3GTLJ 3B81A 1QVTA 2M0CA 3BG9A 4BKXA 4FTHA 3Q3SA 4XK4A 4D5FA 1YRNB 2JA5J 5FKOA 2K40A 3QPLA 4I76A 2FBQA 2Y31A 4MIMA 2QCOA 5M3FJ 3K7AJ 5C4JJ 1ETWA 3BR2A 1IJWC 3HOXJ 3GTQJ 4A69C 3NRGA 1MBGA 4JX5A 2GBYA 4QIWN 5HODA 2ZCNA 2K9QA 3S17J 3KNWA 2M9HA 2HQ5A 2LFBA 3GEUA 3M4OJ 1JJ8C 3G1OA 5J1UA 4BBSJ 3KZ9A 3LJLA 3T6NA 3ON2A 2X9DA 1IRZA 1JJ6C 1AHDP 3VOKA 4RDUA 5F27A 5EDNA 1JGGA 4AC0A 4DYQA 3IUVA 4MFEA 2XGDA 3G56A 4UDSA 2Y30A 1MSEC 1JKQC 3NPIA 1BA5A 1ETQA 1HDPA 1RKWA 3CDLA 5E3NA 3HTAA 2LD5A 3BR1A 4IHXA 1XS9A 4M3BA 1OJLA 2HDDA 1JUPA 1GUUA 3V6GA 5AQCA 2DMNA 4XIDA 4D7MA 3BG3A 4A3JJ 5EG0A 1RPWA 1IUFA 1IV6A 4BBRJ 2VI6A 1ZK8A 1O4XA 3M3YJ 4BXXJ 1VFCA 4A3DJ 4ACIA 2PMZN 5F0CA 4MO7A 4L5EA 4UUSB 2QF7A 3G7RA 2XPWA 2JA6J 3BT9A 2K9NA 3FRQA 3ZQCA 5IP7J 2AO9A 4M3DA 3ZQHA 1U8BA 3HTJA 2EZKA 4XRMA 3FISA 1S7EA 3P9TA 2JWTA 2LKXA 1JKRC 4LOCA 4B4CA 3GTOJ 2R5ZB 3MNLA 1OFCX 1HF0A 2GLOA 1IDYA 3BR5A 2ECBA 1QPIA 1FEXA 2D5VA 5DAJA 2F07A 2XB0X 5H9TA 3MN2A 5GP9A 3GTMJ 4GFBA 1RETA 1A6IA 2ME0A 3SDGA 4FCYA 1ETYA 2YU9J 1B8IB 2MSYA 1GV5A 2DG7A 3GTGJ 1UI5A 3EUPA 3S14J 3IV5A 1B72A 3BG5A 2CJJA 2DMUA 4ABZA 1MBJA 3HOWJ 2EZIA 2EH3A 2OI8A 3AQSA 2UXUA 3QBMA 3W6VA 5CXGA 4GFKA 3JRDA 3TW6A 4M6VA 3OOUA 2R93J 2LTPA 1MBKA 3BQYA 2X6OA 4MFDA 1GV2A 5F08A 2DN0A 1Q1VA 3GTJJ 4JP0A 3LSRA 5EGOA 1ITYA 3KKDA 1Y1VJ 2DA2A 1GT0C 2EQRA 2ZCXA 2YVHA 3D1NI 2VKVA 3GTPJ 3VIBA 1I3QJ 2VPRA 2JJ7A 1ENHA 3HB9A 1AKHA 1ZQ3P 4X1EA 3S2HJ 3NARA 1PUFA 1LE8B 1ZKGA 5FKKA 3MVPA 3OIOA 5F04A 2Q24A 2M34A 1APLC 4G12A 1FJLA 2K9SA 3V78A 5HAWA 3LNQA 1QRYA 2DMPA 2R5YA 1HLVA 3Q0VA 5IP9J 4JNNA 3E7LA 4HKUA 3NI7A 3VVYA 3HEFA 4V2GA 1SFOJ 4A3CJ 3BTCA 3SFIA 1WPKA 3HBLA 5J3LA 3S5RA 2DA4A 2NOGA 4FE4A 2B63J 5M5XJ 1JUSA 1T56A 2G7LA 4M3GA 2V57A 4CYCA 3HM5A 1YRNA 2GM4A 2DJNA 2WB1N 3FK7A 4Y7NJ 2HXOA 3HTIA 3JREA 5IOYA 4AC6A 2FD5A 2RASA 2E2JJ 2XPUA 1NK3P 3S1QJ 4IEJA 2N8GA
chains in the Genus database with same CATH superfamily
2E5ZA 1XC5A 2ESHA 3I59A 2I10A 2VBYA 2CS3A 3SXYA 2R7FA 3WE2A 2H8RA 3HL2A 1S3JA 1DP7P 2PG4A 3CQZJ 4C30A 1ZG3A 2EFQA 3W3CA 1MJ9A 3K69A 3KIOA 1YYVA 4RS8A 1DQUA 1UELB 2M8GX 3K9TA 4N0BA 4F93B 1YTYA 4BE1A 1YI2I 3JSPA 3FMSA 3BJOA 1BJAA 4JX4A 1W0TA 4L62A 4R79A 1IN5A 5FJ8J 2LY9A 3FWEA 4E6KG 5DUIA 4U0YA 1TWGJ 1P92A 3K2ZA 3OOPA 1O3RA 1QU3A 2ZC2A 2RGVA 4Y3OA 2XF5A 2W53A 4RLQA 1YFHA 3EDPA 4S04A 2WAFA 2X4HA 3OIPA 3LWJA 3LHQA 2VJIA 1ULYA 3LSJA 3UR3C 4AIJA 3DPUA 4MTDA 3HOSA 2XAHA 2VQCA 4ME9A 1HC8A 3PQJA 3E6MA 2BE5F 4B48A 2WA0A 5IT9Z 1V3FA 1TWHJ 3KZZA 4PXIA 3PM1A 2O3FA 4EJTA 5F1JA 1WJCA 5B66C 2FU4A 3QAHA 4HNUA 4X6AJ 2K3PA 4D9JA 1NHAA 1Z7UA 4ESBA 3AG2H 3Q0UA 4ICHA 4CCOA 3K8PC 4ZH4F 3RYRA 2NOJB 1IW7F 3DBLB 2GXAA 4LG0B 3G73A 1O3TA 3I4NJ 4Q47A 1V5FA 1Z05A 5IYBJ 4AYBA 3HKZN 5HDKA 1SFUA 2R7VA 3AG4H 2L7FP 4F3QA 3RH2A 4QSHA 4ENKA 4M9SA 1VNDA 1KGSA 3G1MA 3NNRA 4ENMA 3LSMA 2ZB9A 4A5NA 4NC8A 2QWTA 1LUJB 5D6EA 2FXAA 1U6GA 2DMQA 4NDLA 1MBEA 3I64A 2MLKA 1WH7A 3HOZJ 1LFUP 1SAUA 3ZOBA 2JA8J 4RGRA 4OMZA 2A68F 3SFZA 2Z9OA 2KRHA 3MEXA 2QYOA 1FP1D 1QQIA 2YR2A 4IPAA 3OIQA 1WH5A 2LRDA 2O0YA 1SMTA 5E20A 2L3DA 3P9CA 2CV1A 3WTWC 1A36A 3VW1A 1OISA 4HLYA 5E3OA 4ZTJA 1ACIA 5IYDJ 4NB5A 4EEFG 3ANGA 3CWRA 2HKOA 1UHMA 2G3BA 1X19A 1KU2A 1TL8A 4U87A 1S5LC 3KP4A 3DEEA 3I9V2 4HF1A 4BY1J 2DFIA 2RNGA 3E1SA 4M71A 2RQPA 1SFEA 1T08B 2JRMA 2XDNA 1QGPA 2X0LA 2ZJRF 3OWTA 1WRJA 5EGOB 2Q0OA 4M3EA 3RTRA 2HZDA 1X3UA 1MBHA 3LSPA 1TQIA 2L9RA 4MQVA 4PDKA 2ZMEA 3NQOA 3NWSA 2BY1A 1FX7A 2R7UA 3CMEI 5EEAA 2DI3A 3ZMZA 5LGNA 1ZGAA 2NXNB 5LD2C 4FASD 4U0WA 4FT8A 4BQOA 1XB4A 4P96A 2R5YB 1MSFC 1VQ5I 3BC8A 1A04A 2YVEA 2V1DA 4I02A 3DLLF 3ZQLA 3CUQA 3E5UA 1JHHA 3V7CA 4ESFA 3OSGA 3KLOA 2GWRA 3CMAI 1WJFA 3QOEA 5CVUA 3RCOA 4IHWA 2X6YA 2NP5A 5ERIA 4NQWA 5B1BH 4CYCB 1OR7A 2F5EA 5DCMB 2DU9A 1DPUA 2VUMJ 2F4MB 2IT0A 3LA7A 3PUBA 3IAS2 5EJCA 4A3BJ 4KNYA 1FZPB 1ETOA 4D7NA 1UHSA 3I59B 4BDZA 2PJRB 3H3UA 3A01A 3HOUJ 3BCGA 3JTHA 3K4LA 3CMYA 1RR7A 2BW3A 2DTZA 1H89C 5HSZA 4S0HB 2EBIA 2NS7A 1SVMA 2LLKA 4BUPA 4WXHA 5FKMA 4ENNA 3MKZA 2QBYA 3ZQIA 2CV2A 1PVEA 3DKWA 2JPBA 2Y75A 2A07F 5LLQA 1TT0A 3NAUA 5GADJ 1DP3A 2QA4I 1ZRFA 4XL9A 4C2TA 2GXBA 1E0EA 1DU0A 2DA5A 2GA1A 1H0MA 4E7LA 4XSZF 3OYLA 3FK6A 1FYMA 2E71A 2XVCA 5LBQA 3SEZA 3ZQGA 3HGGA 1OR7C 2L54A 4B09A 2E60A 1R1VA 2ZFUA 2PI0A 1T38A 2PX9A 2PZ9A 2UXIA 4LIVA 4ENJA 2ETHA 2ZXHA 2IAIA 1PUEE 3HRUA 3RZOJ 1K83J 5EG0B 1F36A 1WJEA 4A3IJ 1HDDC 5FLVA 2OZ6A 1Z0XA 4KMUX 3CP2A 3VWBA 4CCLA 1ZYRF 1TQMA 4CCKA 3EGQA 1W1WE 4Q5SF 2XRNA 2OUMA 4L5IA 2L7KA 4NHJA 4HX8A 4ZDPA 3FDYA 1YIJI 3CJQB 3CCYA 2R7RA 1D0XA 2QKOA 2CW8A 2REKA 1Z7LA 2HOAA 1MH3A 4B43A 1IDZA 2O8KA 3M8EA 2MW8A 3CJDA 1Z1DA 3WU2C 1MGTA 5CXIA 3E6CC 4GDFA 3FHZA 5HDGA 5K5RA 3HIFA 3HHGA 2VIXA 2I8DA 2F48A 5ICFA 2L7MP 2QWWA 2QSHX 3VP5A 2OZUA 2V6CA 2IGOA 3LSKA 2XAGA 3CRJA 1X1CA 1Z21A 3PO2J 5F0HA 3RPQA 1MNEA 3VW2A 3MQ0A 1PP8F 3TOAA 3S32A 1V55H 2ZNYA 5ILUA 2W84A 5E8GA 4EVIA 2YUSA 1I1SA 4G9YA 1ZG1A 4XRSG 4K2EA 4MK6A 4PJLA 1BJZA 1HBXG 2O61A 4UV8A 5EZGA 3LWFA 1W5SA 4GCKA 4I2OA 3CP8A 3OYDA 2JZYA 4CA0A 2QSFX 2AQEA 3DV8A 4CGZA 5BNGA 5EEGA 4UXNA 2XGEA 1O7FA 2UWMA 3MKWB 4A12A 3K2AA 5CVVA 3LA3A 1IF1A 2PMUA 3T8RA 5K7ZA 5HDNA 2GAUA 3CCLI 3ML6A 3D5SC 3HRTA 2FQ3A 1MNDA 3K4MA 3PFYA 3DBRB 3TKYA 1S72I 3F0CA 2KKOA 2D6YA 5HNHA 2LMDA 2ZMEB 3E3VA 2M0CA 2JRTA 1U8RA 1YO5C 1RR8C 1IXSB 3Q3SA 4BJTA 4LFUA 3KP7A 3IL2A 2EV6A 2IP2A 1RZ4A 3U1KA 1K4TA 3G3ZA 1YLFA 1S9HA 2K27A 5DYMA 5FFXA 2D45A 2YVXA 3E97A 2P7CB 3FX3A 2R7SA 4BS9A 3BR2A 3ELKA 4E7ZA 3CUQB 1R23A 1MBGA 2CUZA 3H5NA 2EK5A 2EWNA 4JX5A 3WTYC 2K9QA 1J9IA 2GZWA 1TQPA 2HQ5A 1OYIA 2M30A 5LHGA 1JJ8C 2STWA 1X4PA 2M7AA 2VQGA 3AG1H 3KZ9A 3W6KB 2LNBA 1G3TA 4WK8F 4YIRX 3ERED 1MMGA 2X9DA 1JJ6C 3A1YA 2L4MA 1R49A 1MDMA 5CJ9A 4N4NB 2B7EA 3V42A 4BH9A 5BQTA 6PAXA 2ESNA 3Q9SA 3OYIA 2QEXI 2DYRH 1SD6A 2EIKH 2L2OA 1JKQC 3FXQA 4J01A 2CG4A 2BW3B 1BA5A 3OV8A 2H8WA 1ETQA 1HDPA 1RKWA 2IJLA 2MBFA 2O5RA 4M6YA 4AVZA 1IXRC 5JVTA 5E3NA 3IWZA 3HTAA 1BR2A 2R4GA 2QBYB 5DUKA 1TW2A 4GCVA 3ZMDA 2F5CA 1NG6A 2RKHA 3KX2A 4E7KA 1BR4A 5JR3A 3WGIA 3QPTA 2DMNA 2ZFWA 3KP5A 4XRFA 3DQVC 3N05A 2PQ8A 2WY8Q 1IV6A 4GGGA 2L02A 2VI6A 1A6QA 1ZK8A 2K4BA 2L9SA 2WTEA 1O4XA 4BXXJ 4ACIA 2EV0A 4F55A 5F0CA 3CDHA 2XPWA 2RN7A 1U2WA 3ZCOA 2K9NA 1VQKI 2M5WA 2W7NA 3V7SA 4M9ZA 3AL0B 4ZTFA 2EZKA 4DBQA 2EA2A 1B9NA 3L9FA 1J59A 1AA7A 1X1AA 4CSWA 3GX4X 2C6YA 4KT5C 3BG6A 5K1YA 5BMZA 3PNYA 1IDYA 1XSXA 3FHNA 1QA6A 2F07A 4CO8A 1FWZA 2FE3A 3MN2A 1RETA 4XLHA 3SDGA 3F3XA 2IGNA 3GTGJ 1UI5A 3S14J 1CGPA 3IV5A 4ESJA 1B72A 1LVAA 3TO7A 5HS7A 1RC9A 3BG5A 1LKXA 2OI8A 3VTIA 2UXUA 2H94A 3W6VA 3QPHA 3PFIA 4CYDA 3BZ6A 4WIBA 3TW6A 4M6VA 4MFDA 1GV2A 2DN0A 4JP0A 2DT5A 1MMNA 5TJJA 2DA2A 2R7DA 1A35A 3FMRA 2ZCXA 1T0FA 1I3QJ 3QU3A 4G94A 4I01A 3HB9A 1AKHA 2VJJA 3NARA 3LQRA 3K4CA 5FKKA 3OIOA 1KONA 2QQ9A 4RAFA 2V1NA 1YJWI 2CW0F 2Q24A 1SAXA 4G12A 1IRFA 2WADA 3ULQB 1FJLA 2K9SA 1LVKA 2F5DA 1KZHA 1HLVA 5IP9J 3ZXSA 5KAIC 2J5PA 4BNCA 1YS6A 4HKUA 3NI7A 4XLAA 2KZVA 4CZZA 4MTEA 5H20A 4BEHB 3I0TA 4G7HF 1SFOJ 4A3CJ 2B3WA 3HBLA 5J3LA 4HRIA 4RGXA 3KPHA 3T1BA 5GAGJ 2B63J 2G7LA 1T95A 2ISYA 3GZNB 1YRNA 2R7WA 2BOLA 3FK7A 1FP2A 3ABTA 1BN5A 1OCRH 2FD5A 2QQAA 2RASA 2E2JJ 2XPUA 3OL4A 1W7PD 2IPQX 4IEJA 1R4NB 3ZMVA 1BI3A 3LOCA 2LK2A 4KIFA 4OOIA 2HDCA 2OERA 1JE8A 1QVUA 2DA6A 1U5TB 4LD5A 1KU9A 2COBA 2VBXA 2LY1A 1MD0A 2K5CA 2NVQJ 4L0YB 3QOPA 2HDWA 2ZKZA 4AIDA 1MKMA 3KEQA 1TP4A 5TGTA 1UZCA 3O60A 2HOTA 3H5RA 4NELA 1Z3YA 1BR1A 1SVLA 5D19A 4CHUA 2UZKA 4A3EJ 1UMQA 2DJIA 4UV9A 4CXFA 4PUSA 4A3MJ 5FD6A 4D0PA 4AWXB 1MIJA 1W5TA 1W36C 2ZOZA 1J0RA 1ORKA 2Z99A 1VQNI 3L09A 5B1AH 3TBIA 4XBFA 3HGYA 2FNPA 1IC8A 3KYDB 3U9GA 3WHBA 3LSIA 4Y15A 4HDVA 1OYYA 2V1UA 4KISA 1U9OA 1A5JA 5ED4A 4XR6A 5HLGA 5DDGA 1FOWA 5E1XA 1DU6A 2L9VA 1JUMA 1I6XA 1TNTA 4IO9F 3J7ZI 1MDMB 4DBRA 1UFMA 1R6RA 3VYUB 2HU9A 4XOPA 2XV4S 2DA1A 3KP3A 4C3IJ 2ZXWH 3BWGA 1FOKA 3ASOH 4C3JJ 1K61A 1H88C 4EMSA 3CCMI 2HPIA 3DEUA 2FQ4A 4XN3A 2OPTA 3QP6A 2E7WA 4ITVA 3S1RJ 1WI3A 2KIMA 4IHTA 3S2WA 3IH2A 4A0YA 1BI0A 3WE3A 2HQAA 3BR0A 3BDDA 5CPRB 2F4IA 2R5ZA 2GUHA 3SYTA 1K4SA 4HOBA 5E1ZB 2AS5F 1E2XA 4A2UA 4BHCA 3RPUA 2HTJA 4HA8A 5K7FA 4JL3A 3V8KA 3L2RA 2O9LA 1JI8A 2KZGA 3SWHA 1VQ9I 2PBIA 3ZN0A 5D5WB 2AXTC 3RZDJ 1SANA 5LGUA 2P4WA 3OL3A 3NS4A 3CJRB 1LJ9A 2BHYA 1Z67A 3VVXA 2AQFA 1ON2A 2FUG2 1Z77A 2JUGA 2XGCA 3A03A 1FTZA 1TLHB 1F9NA 2AXLA 3JRHA 2E1OA 1HW2A 3GF2A 4KJZA 1ZR4A 3F6OA 4L9TA 3TP3A 3NXCA 1E3HA 4HNVA 2ELHA 2H1KA 1TWFJ 1MH4A 3K1NA 1QNTA 5CQEA 3VDXA 4AD9A 2B0LA 5D8KB 3QYFA 4XLPF 4YFXF 1USTA 2FX0A 4Q4ZF 2GIZA 3GFLA 1J09A 2YS9A 3AFHA 4OWRB 3L2QA 1B72B 3BJBA 2DXIA 1HOMA 3IAM2 4OIRF 2VPLA 1ETKA 2WGBA 2ZBKA 3K4JA 4CICA 4XORA 5DM6F 2DPDA 2CQXA 3S3MA 1IO2A 5B5EC 4OU0A 4DYCA 3A0BC 1DUXC 1J2XA 2QZ8A 2RREA 1Y0NA 3D0SA 3CCSI 3HOVJ 1EA3A 1HQCA 4L9VA 5BPIA 4ETSA 2HEOA 1LDDA 3QRFF 4JYKA 1KQ9A 1AKHB 3F21A 5HNFA 1AU7A 1QO0D 2ECCA 3CJTB 3JRBA 4A3GJ 3FKIJ 2IXSA 1TZLA 3MKLA 2GFNA 2VOPA 5KAFC 1RESA 2X1CA 2NVUB 2FNAA 1W36D 3E6BA 3COLA 2BVLA 2RC4A 3WHCA 4D1QA 3G71I 1AWCA 1D8KA 4C2UA 3MZHA 3CC2I 2DBBA 1JT0A 3F23A 5J6XA 3OYBA 3I56I 2EZLA 2Z5UA 2ZOYA 1QBJA 2E34A 1OCCH 1HXDA 4PSXA 4CUGA 3KEOA 4NC6A 4DOZA 5K7HA 2WV1A 4D5CA 4N4OB 4MGRA 5J4VA 3JAMK 4DQ2A 1BC7C 4IJAA 1YW8A 3RI4A 4R8HA 4IXAA 3I4MJ 2A6HF 2KPMA 3P7NA 4YIIA 1EH8A 2BXYA 3F6VA 3I71A 3CF5F 5EZHA 1J5YA 2XAQA 4BU2A 5HOOA 4HF2A 2VC1A 2KQRA 2QENA 1UB9A 3OYMA 3DFGA 3H35A 4BYYA 2G0EA 1T6SA 3MD2A 1BIBA 3T5XA 3RKQA 2QIBA 1SVOA 1V4RA 4DW6A 3HC7A 1A31A 1B9MA 3GBGA 2MABA 2DG8A 2EINH 3I4PA 2A05A 1O7LA 2X51A 4XONA 1OCOH 2LREA 3OR1C 1JTXA 2KP6A 2L7ZA 4KN4X 5JLWA 4CCNA 1BI2A 4M3FA 3Q9VA 1RIOH 1QHGA 4HBLA 3W2VA 3G6EI 1TC3C 2QKLB 4KYWA 3CTAA 3DTEA 1LPQA 1YE9A 1VI0A 2L01A 5M3MJ 4E7IA 3ZRGA 3ZP5A 1Q1HA 2FMYA 4BXFA 4GXOA 2ID3A 5CVRA 2ZCMA 5EEHA 4OINF 3RDIA 3HIMA 4LLLA 2P81A 4I7HA 5LFAA 1KQ0A 1FSHA 3CCEI 1WVRA 4E7SA 2CUEA 3WTUC 2EFPA 3DTKA 2IA1A 2A69F 3H1CA 3KYLA 2CUFA 1SD4A 4HPQA 2X1DA 2BVMA 3CO6C 5CYVA 2K02A 2LR8A 2GENA 3O8GA 4EV0A 2EB7A 1P7JA 1JKPC 1I27A 3RQ4A 1TBXA 2V9KA 4Q48A 3IWFA 2DPUA 3RD3A 1FSEA 3LSTA 4UHTA 4JX6A 1LE8A 2P5KA 3EUKL 1KA8A 3ZN1A 1CQTA 4EJOA 1I3AA 2V79A 1G59A 4KICA 4HQEA 3C1DA 2JTVA 1RRJA 2WB1A 5K5OA 1ZGWA 4F52A 4UNOA 2XF7A 4QPQA 1R71A 2DA3A 2NAZA 3BTIA 4A3LJ 2LVSA 1VQOI 3ROUA 2LDUA 4LLGF 5CVJA 2DMTA 4CDGA 4KDPA 4GFLA 1KU3A 4OIQF 1PJRA 2A6EF 1ZRCA 1K6YA 5LRSA 4H4KC 1OKRA 3BNIA 4HF0A 1VTNC 4B3AA 2K85A 4C2MJ 4GCLA 2JVGA 1TT5B 2EPFA 2LKPA 2ZCWA 4KA4A 4BHBA 3RQIA 2QTQA 1YX5A 4YFKF 1MMSA 1WKMA 1XCBA 3H5AA 1NK2P 4BHPA 5EFYA 1I39A 2CQQA 2P5LC 3GFMA 4WXCA 4Y4RA 4UB8C 5DV5A 3DBHB 3BG9A 4V19K 4D5FA 1YW7A 3CUOA 3HUGA 4O6JA 2JA5J 4I76A 4B8XA 2DLLA 2Y31A 5J40A 3BG7A 1D3YA 1QPMA 3DLAA 2GOMA 1SEUA 1R36A 3CJNA 2K7LA 2K4JA 3S17J 3KNWA 1ZH5A 3GEUA 2LFBA 2K86A 3M4OJ 5CLSA 4BACA 1MW7A 3G1OA 4EM0B 4BBSJ 4RB2C 3LJLA 3T6NA 1T98A 2PMZA 3WTZA 1OCZH 4JQFA 1IRZA 2FF4A 4I09A 4M6XA 4C2MA 5E18F 3LAJA 2W1OA 5EDNA 1SFXA 2FEZA 2YX7A 4DVYP 5LGTA 2Y30A 4WWCA 1MSEC 3V8LA 1UCRA 3JTGA 1ERDA 3CDLA 3VSLA 1R22A 1SMYF 2E1NA 1S7AA 2DT6A 3BR1A 3RKWA 4IHXA 1XS9A 2R3SA 1OJLA 1ZLKA 1R1TA 2JUCA 1IZ1A 4FX4A 2HDDA 4IQJA 3L2VA 3LFKA 1TNSA 1V5EA 2E36A 1IAWA 3WG7H 2VE9A 1Y56A 4D7MA 3CCQI 4ZDLA 2QM3A 4DJAA 5IT9K 4BBRJ 4XKBA 3HXLA 1WZ2A 2X6XA 2PJPA 1G8XA 1VFCA 1VQ4I 2KHMA 4L9NA 4MO7A 2QF7A 4XLFA 3BT9A 2OBPA 2VJ5A 2ZJPF 3ZQCA 2MFZA 4R1HA 2FSWA 1PDNC 3VB2A 2F5FA 2XKPA 1X1PA 3V4GA 2E7XA 1S7EA 2DT7B 4IKFA 2JWTA 1JKRC 4AM3A 4LOCA 4BQQA 1DDNA 3DPLC 1LEBA 3ZQ7A 5GAHJ 3T8TA 3MNLA 2A2FX 3RIRA 3WTXC 1XX5A 4UUVA 3J81K 2F6CA 2BYVE 1MMDA 1XDUA 2WBMA 3AKZA 1YHQI 2LSOA 3GZ5A 5DAJA 2GXGA 1H9GA 3BCBA 4OAZA 4FCYA 1ETYA 2QGUA 2XC7A 2MSYA 1GV5A 5KVRA 2ZJQF 2DG7A 2B9SA 3EUPA 5L3DA 2ELJA 2FJI1 2DK5A 4RAZA 2CH0A 3HSFA 4ABZA 2ACJA 3BCAA 1YOVB 4RM2A 1K79A 3HOWJ 3AQSA 1Z6TA 2BHZA 5CVIA 1WI9A 3OOUA 4RB0A 1L0OC 1MBKA 2LTPA 2X6OA 3BQYA 5F08A 3GTJJ 3E5QA 2MYSA 3H36A 1Y1VJ 1QZYA 1GT0C 1BC8C 1X3WB 4LITA 1DGRM 2EQRA 3F22A 2YVHA 2VKVA 2HVSA 2COMA 2JJ7A 3GZ6A 2PMHA 1PUFA 1LE8B 1ZKGA 1IN6A 2YU3A 5F04A 1W7PA 3F8NA 3CO7C 3EUHC 1E3PA 5HAWA 1XCVA 4QPOA 4HNTA 4U88A 1W5CC 1WWXA 4TV7A 3BPXA 3RSNA 3SEQA 5FD5A 2EJRA 3SFIA 3OY9A 3GEZA 1KQ8A 3E0JB 4EQQA 3S5RA 2W25A 4RA2A 2DA4A 5D8LB 2NOGA 5D5UB 3WU0A 2VKHA 1JUSA 1T56A 5A2QZ 1H9TA 5LHIA 4A0XA 2V57A 3HM5A 4LJZF 1BIAA 2MLGA 2DJNA 4EM2A 5IOYA 3B02A 4C9YA 1VQ8I 2OCCH 3CCJI 3S1QJ 3IP4B 2JSPA 3BROA 1K78A 3EUAA 2OJED 1N75A 3S93A 5D18A 5KNLA 4L5JA 2W48A 2HQRA 2HXIA 2E2HJ 1MZBA 1AOYA 3GFJA 2ISZA 4NQWB 4IX7A 2Y9YA 2AHQA 3ABKH 4M73A 2HR3A 2MC4A 1IN8A 2BV6A 4RAGA 2G7SA 2F2EA 4CH7A 4A0ZA 2FOWA 4U7BA 1G3WA 3B6AA 2R92J 5CW8A 4ZYHA 2KL4A 1ETVA 4U7DA 3A01B 2ME6A 3ZQFA 3K70C 3W6JB 1FTTA 1JTYA 1R7JA 2MD0A 3JSJA 2KRCA 1TW3A 4NUBA 3Q0WA 2JK3A 3TOBA 4F91B 2VC0A 4PFPA 4RGUA 4P1WA 4C3HJ 3ON4A 3PUFA 1RUOA 1EF4A 2EZHA 2R7XA 4BY7J 5FLMJ 4IHYA 2EILH 4IOAF 1SFKA 3V7RA 3PSIA 4UUSA 1MNMC 4XLEA 3SZPA 3U1DA 2PBXA 3T0YA 3L7WA 2ID6A 3QWLA 1D0YA 3R61A 3O6BB 1N25A 5IYCJ 3F1BA 2DFFA 4HSRA 5HS8A 1G3YA 4IRGA 2Y0SA 3ESWB 4YELA 1WGXA 2XAFA 4ASNA 3MZYA 3WU1B 3AAFA 5FFZA 3FXUA 4CGRA 5KCMA 1ZAOA 3DKYA 4E7HA 4II2A 5C4YA 1UHWA 4P9FA 2RDPA 2MA3A 4MEXF 3BQZA 4XRSA 1X58A 1HKTA 2MC3A 3BR6A 4GYGA 4LK0F 3DP7A 4FETA 5F6FA 4XQFA 4HQMA 3CMMA 2UV1A 3A2KA 3SZTA 3IH3A 1GLNA 4HW0A 1H8AC 1ETXA 3BTLA 2OAZA 3KP2A 2HS5A 5C4XJ 2KLOA 3VPRA 2A61A 2V9VA 1LQ1A 1JKOC 1DGWY 3TO6A 5E3MA 1P2FA 3C3WA 5GPCA 5ILSA 4RM3A 4Z6YA 2RQQA 3S3OA 3BR3A 2L0KA 2VBZA 3HRMA 4O3MA 1IN7A 3VOXA 5LEKA 4B44A 2BY3A 2FOKA 3S2DJ 1DPRA 3LA2A 5E8IA 3W2WA 1IRGA 3H3ZA 3PNVA 2RNJA 1D1AA 4AUXA 3FBIB 3UKGA 2HQNA 4G6TB 1FPQA 5BOXA 2ZNZA 2EV5A 2CYYA 2VODA 3HYIA 4PJ0C 2KIUA 1JXSA 1G2HA 2VKEA 3E7QA 1KYZA 1JT6A 1FYLA 2WAQN 2XPVA 2M3AA 4FQGA 2OF7A 3ZMUA 1W7PB 5L3BA 3ABLH 4ZDOA 2YSRA 3GZIA 2DOAA 3S8PA 3JRIA 3GTKJ 5F1RA 3RKXA 4IHSA 3GXOA 4HX7A 3G2BA 3I5UA 2HPMA 3IH4A 2CSOA 1LEAA 2HI3A 5J4YA 3K6GA 3R0JA 1YW9A 2FMLA 2NS8A 3KLNA 5GAEJ 4I0AA 3PIPF 1BI1A 3FZVA 2OTLI 4XKWA 2J5OA 2R0QC 5FLXK 3K70D 2HOEA 2RAEA 1I6HJ 1XMXA 3M7GA 4RMNA 3LSHA 2OV7A 4LG3A 1X1BA 5DM7F 3HOTA 1KU7A 4ON0A 3HDDA 5LEJA 1TWCJ 1MMAA 2XASA 3L2CA 2VQHA 3BHQA 4YZEA 1X2MA 4KITB 2XSDC 5HBUA 1TTYA 3SJMA 1JGSA 2D2WA 3TMOA 2P6TA 1S29A 1R5HA 4E4HA 5L3EA 1I1GA 3CLQA 3L1PA 1YJ9I 2M87A 2VXDA 2E1MC 4ZYGA 3PPBA 3C2HA 2Y69H 1BBYA 1BOAA 4MQ9F 3DU5A 4F92B 3A02A 2NVYJ 3V8JA 4HDUA 2M4GA 4UUTA 1HKQA 4I6ZA 1VZ0A 3A0HC 2TDXA 4A5MA 3F8FA 2LKSA 4B3XA 4BGDA 2MG4A 3ECHA 4DYRA 5JHUA 1VF9A 2QOPA 1Y1WJ 1WCMJ 2XB5A 3FMQA 1EV7A 1Y0UA 1T39A 4BQAA 3DU6A 2VN2A 3NWTA 1Z3XA 2D1HA 1B1BA 5BS6A 3MWMA 5FB2A 1B59A 5GPAA 1OCTC 1POGA 1USSA 3F8BA 3KZYA 2EA4A 2Y48A 4A6DA 4XN0A 4GCTA 4Y13A 5ICCA 2CU7A 1FT9A 3CDIA 1PP7U 3SZGA 1T33A 4YIFA 3TDUC 2WAEA 1T8IA 3F9KA 1ZG5A 5FRNA 5K58A 2FJ1A 4HYEA 1ZHFA 3LSGA 2O03A 3S16J 3VODA 2V26A 4P5OA 1U78A 4A93J 2O7TA 4BDYA 3WG9A 1F43A 2DAOA 4ZZLA 4II3A 2O7OA 5HVQC 3DCFA 1XMAA 2P8TA 4KIGA 5EF6A 4QTRA 1UJ8A 4DIQA 1X1DA 3GW2A 4AYBN 3JRGA 3HTHA 5C44J 1HA8A 2R7OA 4MLOA 5M5YJ 2IS2A 2HFHA 3R0AA 2HYGD 3FM3A 4OD4A 3TP0A 3WTTC 2KRFA 4RB3C 1TWAJ 2TRTA 3KP6A 5JVGF 1HW5A 1RI7A 5D1RA 4G6DA 5DTDA 1R9TJ 2BXZA 4PCQA 1OCPA 3HSEA 1FOXA 2QQ8A 3EQLF 1LFBA 3C18A 4I98B 2IBDA 2DFEA 3DKXA 2G7HA 3IUOA 1EJ9A 4CCJA 1OMIA 3HPGA 3MMYB 2A3SA 4YRVA 2HYTA 3KZIC 2DYSH 2KJBA 3GMEA 2DQLA 2H6BA 3B73A 2DODA 4GYIA 4KIBA 1D1BA 3PASA 3BZCA 1E3OC 2CGPA 3J80K 2MH9A 1F4KA 3TO9A 2E35A 1NG7A 4BJ5C 1IG7A 3B81A 1XGNA 3ABUA 1QVTA 3HTUA 4HG2A 2HYFA 1ONVA 2LF7A 5J8CA 1XPXA 1YRNB 2M4KA 3QPLA 3QYEA 3BJAA 2FBQA 3GLLA 1GXQA 3FXRA 1WQ2A 4MIMA 2H6CA 2O6GE 3GWZA 1WJAA 4S05A 5M3FJ 3OR2C 3ERMA 2QKMB 1G4DA 3BY6A 4QIWN 2ZCNA 1EH7A 2GBYA 1U0JA 4ZZDA 4RB1A 3X2QH 2PJRA 4BQNA 3BZKA 4YG2F 5J1UA 3DXJF 2OTJI 1SD5A 2UXNA 3ON2A 3OMYA 2O8XA 3VOKA 1WJ5A 5IT3A 3IRQA 3CCVI 1R5ID 2DQRA 5FGMA 3GFIA 1FMVA 3ISPA 1IUYA 4PGHA 2CMPA 2F4OB 2DOEA 2XSJC 2XGDA 2NRAC 3G56A 4UDSA 3OYGA 1YQAA 2W82A 3NPIA 1QZZA 4QLCU 3IKTA 1G6NA 3NEUA 2PN6A 5H6QA 3TQNA 4LLNA 2D1VA 4LGWA 2OQGA 3H0DA 1GUUA 3OYCA 2V1XA 4A3JJ 5EG0A 2L4AA 2DDAA 1RPWA 3K4KA 4PJMA 2A5WA 4AU7A 1I5ZA 2JT1A 4A3DJ 2PMZN 4L5EA 3G7RA 2RV8A 2ICWG 2CW7A 4RAYA 3K1PA 3OYEA 1U8BA 3ZQHA 5D6FA 3HTJA 2VASA 3AG3H 3FISA 3P9TA 2LKXA 3LMMA 5TRDA 3PIOF 3J81Z 4P9UA 3S3NA 2R5ZB 2VONA 1IV8A 1OFCX 2XGXA 4UB6C 1HF0A 2GLOA 4L0ZB 4NC7A 3BR5A 3F8MA 4ANJA 1QPIA 1FEXA 2D5VA 4Z2YA 5FRMA 2XF6A 1NH3A 2QUFA 2VE8A 1J75A 5H9TA 3L00A 5GP9A 3GTMJ 3C7JA 3FKJA 1U3EM 4AIKA 4XKVA 2W4SA 4BJ6C 2X6WA 2CJJA 1MBJA 2EZIA 2OD5A 1IRXA 3KE2A 2WC2A 3BPVA 1R58A 3PL8A 3O3KA 3BOQA 2DO7A 2Z3YA 4LB6B 1ZR2A 1ITYA 4F7ZA 3LSRA 1KYWA 4E70A 3ONQA 1VQ6I 4XKCA 3VYRB 3RPUD 4PK4A 3K10A 5CKTA 5HLIA 1N78A 3GTPJ 2W85A 4G6QA 3VIBA 4EGZA 2VPRA 1ENHA 2DCEA 5K5QA 3OS0A 3MVPA 3CZ6A 2P0WA 3OYAA 2M34A 4WCGA 1APLC 1UAAA 3VFZA 1VQMI 3V78A 3H9JA 4Y33A 1QRYA 2DMPA 2DW4A 5H2FC 2ZXJA 5ILVA 3Q0VA 3LNQA 4FHTA 3C2GA 3ZPLA 3E7LA 4JNNA 3VSKA 4J00A 3FBNB 2CWEA 3I55I 5M5XJ 3J7YJ 2XDVA 4M3GA 3D5RC 3N4MA 4G7OF 3A4CA 2GM4A 2A5YB 4KUMA 5L3CA 4Y7NJ 2HXOA 2IVMA 3JREA 4AC6A 4IZZA 3DPTA 2VL8A 2HTSA 2N8GA 2E2IJ 3SQNA 1Z91A 5EYRA 3JCUC 2FBKA 1XN7A 3UNGC 2XUBA 2MD5A 2Z33A 4OIPF 5M5WJ 1F5TA 2XIGA 3ECOA 2V9PA 2M8EA 2IGKA 4P55A 3OS2A 1Y8QB 2CQNA 3COAC 4KT6A 1RKTA 4HV5A 1LB2A 2ZSHB 3G4SI 2IGMA 4ZYEA 2FBIA 2H27A 4BXUA 2VT2A 1YITI 3BP8A 3K1MA 3RJPA 1YIOA 3HKZA 2HZTA 1MJBA 1MBFA 2ELKA 2QVOA 3WGGA 3E6DA 4XLCA 5DEQA 4JBAA 1SD7A 3H9QA 5HLTA 2ZMEC 3VVZA 3JR9A 4ZYDA 2JSCA 4M74A 3OSFA 3F72A 2BZTA 4GO1A 2KDZA 5IP6A 5JI6A 4NNJA 2IW5A 2G7GA 3WGHA 3QP5A 3H0GJ 3JW4A 1GXPA 3JRCA 1C0WA 5DS9A 2IS6A 3WODF 2P7VB 3R60A 2IS1A 1V54H 1ZTRA 2ZSIB 3CUQC 5HS9A 3JRAA 2E1CA 3CC7I 2M0MA 2XKOA 5AIPA 5FMPA 3M9AA 3SDBA 5DD4A 1LDJA 3K4NA 2RHAA 3CCUI 2DFHA 2YPRA 5B3SH 2UXOA 2DK8A 2DOFA 1UG2A 1P4WA 4IHVA 1UG0A 1WSUA 5KHDA 1D5YA 1J7KA 4FE7A 4LIUA 2E19A 4Y17A 3EUHA 3I58A 3FIWA 3LL7A 5DCFA 4BAYA 1HW1A 2KFDA 1ZARA 3AQTA 4CZCA 4BE2A 1CF7A 1V5GA 1ZELA 3DF8A 2GQQA 4RBOA 2NVTJ 1QZEA 4L9JA 1RUNA 2M2EA 5AIQA 5IY5H 1SGMA 1GVDA 2WWYA 4Y52J 4J19A 4AF5A 1YG2A 2MGQA 4QWQA 1O3SA 1E17A 1PYVA 2JMWA 3R4KA 4XM3A 4UVAA 1FNNA 2OC6A 1HSTA 3TW7A 4JKZA 2Y9ZA 3R6SA 4WXDA 5FGLA 3I53A 2I5UA 3OYKA 5JLXA 3F8CA 4A3FJ 4OIOF 3BRUA 2Y0SN 1BW5A 2ADUA 1XG1A 2K9MA 3AL0C 2XRLA 3EPZA 1VQPI 2CFOA 5D5XB 5E17F 2IA0A 3C2BA 3LFUA 3CD6I 1XDSA 2Z1DA 3K0LA 1O57A 4A6EA 3HHHA 2HKUA 1XSDA 3PO3J 1WHUA 2GOXB 2Q1ZB 3PSFA 4PJNA 1OQYA 2K3FA 2NNNA 1S6LA 3HTSB 4BEHA 1X3ZB 1BL0A 2BEOA 1OLTA 3HSRA 1FIPA 3KYCB 3VW0A 4RGSA 2KIQA 1F1ZA 1LNWA 2R7QA 3OYNA 2KISA 1XGSA 4XNFA 1ZRDA 5J1YA 2W57A 2VJ4A 2TCTA 2X48A 4FISA 1U9NA 2JVHA 3KKCA 3BTJA 2M7BA 2LBFA 4HEA2 4DGWB 2KIFA 5F0FA 5GTIC 3VUQA 3M1CA 2VXZA 1IXCA 3MAJA 2P5VA 4HX4A 2V4JC 3CCRI 3IRRA 1U5TA 3RYPA 4BL0B 2NP3A 1D5VA 3DWLE 3G1LA 3FF5A 5FLXZ 5J47A 2XROA 4L18B 3LAPA 3C07A 4V2FA 5J1RA 3HUGB 1S7OA 4LK1F 4IL6C 4N9HA 4BE0A 4NBQA 3FXMA 3VOEA 5CQGA 3FM5A 5FHPA 2KDOA 2XAJA 3FXOA 3GYHX 3HZJA 1B6AA 5D5VB 1GDTA 2JPCA 1I50J 5F64A 2PFBA 2HNHA 5FO5A 1QHHD 2LH9A 2X1EA 4W97A 4E7JA 2KT0A 3U21A 2QSGX 3EYYA 4M9XA 1R00A 2L9NA 5BPDA 2DTRA 4KMFA 3JRFA 1N77A 4RLFA 3D5LA 2IEKA 3B6CA 4DZPA 3ANPA 2ZJ2A 4G7ZF 1WJDA 1YS7A 4LMYA 4KFCA 2CO5A 3ZQQA 3GO5A 1BW6A 1R4MB 3H92A 2VLAA 4IQ4A 2NX4A 1FIAA 3RKYA 1GVJA 3ASNH 1YJNI 4XMYA 1U5TC 5E1WA 1LFPA 3TDZC 1M1EB 2Y0MA 4IRVA 2BY2A 1P4XA 1EH6A 4PJJA 1W0UA 3M07A 5AONA 5KK1A 2L5QA 2EIMH 2MH2A 2LOOA 4HZFA 2X85A 4A3KJ 2NVXJ 2LC2A 4FX0A 3HPHA 4JK1X 3ZGKA 4B47A 5FKLA 1ZLJA 2HVRA 1GHCA 1P7IA 3DEWA 1X2NA 2WV0A 1FYKA 3QQAA 1D0ZA 2E5NA 4W1UA 5IPAA 5E79C 3O8HA 3DTIA 2Q8KA 2LP0A 1K7AA 2WUIA 1P4AA 3KCCA 3GCMA 1B8IA 2NNYA 2CV0A 4X0GA 4EJVA 2UXHA 1NTCA 1ODDA 4PGGA 2IU5A 4KWAA 4PFOA 1ON1A 4XLNF 4U0VA 5FKNA 5IOZA 1Y8RB 2R7TA 4GRIA 2ZO4A 3QPSA 3ZMTA 1UI6A 3DPJA 4H0EA 2HYJA 2Q2EA 3CESA 5GTHC 1IN4A 2JN6A 1FBQA 1CF7B 2BGCA 4XICA 1R5GA 3BLYA 4MNUA 2BY0A 4IF4A 1HCRA 1O3QA 2BBYA 2FRHA 3VYSB 2K9LA 3QODA 4MXMA 3S15J 1ZN2A 1BOBA 3GLXA 3IC7A 3M8FA 3P9KA 4B1RA 2UXPA 2Z16A 3E5XA 4CCMA 1Y39A 4UVBA 3QKXA 4WX9A 5ICGA 9ANTA 3MFKA 4OAYA 4N9IA 4EJUA 3S1MJ 3S1NJ 4NN1A 1EKEA 3I3LA 3HE0A 1IGNA 3P9IA 1PUFB 2JA7J 1FOYA 4M72A 2WY7Q 4U9LA 2DA7A 3GVAA 4XOTA 3H3VK 2HOSA 5HLHA 5C3EJ 4DZJA 2UXXA 2VOOA 3EETA 3HOYJ 3J80Z 2R7ZJ 2F5VA 5L3FA 1WFXA 4EM1A 5DD8A 4I99C 2IS4A 5L3GA 1FC3A 4LB5A 2CRGA 1K6OA 2OU2A 3MCZA 1MJAA 3HRSA 5E3LA 3TEDA 2Y2ZA 3ZR8X 3GTLJ 1L3LA 5ICEA 4BKXA 4DNCA 3TGNA 1G3SA 4XSXF 4FTHA 2PLYA 4XK4A 3J7AY 5FKOA 2K40A 2QLZA 3JAMZ 1X4OA 5A2QK 2A6TA 2QCOA 4IRHA 1B4AA 2H1LA 2LBFB 2ZXIA 5D4SA 1XD7A 3K7AJ 5C4JJ 1ETWA 1ZGJA 3Q5FA 1K78B 1IJWC 3HOXJ 3PQKA 3GTQJ 4A69C 3NRGA 5HODA 3P5JA 5D4RA 3VYTB 4HSTA 5H6RA 3ZMSA 1FY7A 2M9HA 1R1UA 3PJRA 3CC4I 1FBSA 1T0FC 4HAMA 3HG9A 4O5VA 3CF2A 3GUDA 3OYFA 3FXKA 4MHGA 1P9QC 5LRRA 1FBUA 1AHDP 3OYJA 2LG4A 2OQRA 4EATA 2G9WA 4RDUA 4EGYA 5F27A 3LQQA 1VQ7I 1JGGA 2PFVA 4AC0A 3L2UA 3O2PE 3L2WA 4DYQA 3WTVC 2JA2A 4MFEA 1FLIA 3IUVA 2VB6A 2JQ7A 2HWVA 3KEYA 4U9NA 1P6RA 2FA5A 1LDKB 3H9GA 4ZC3A 2CFXA 2LD5A 3KFWX 4M3BA 3I54A 4LG0A 4IVNA 4KN7X 5J8FA 1JUPA 2EFWA 2M45A 1YX3A 3OS1A 5AQCA 3MZ8A 3V6GA 3U2RA 4XIDA 3VEPA 1W4MA 3BG3A 1BM9A 1IUFA 2W24A 1XGOA 5TISC 3M3YJ 4WF2A 4IRIA 2LY2A 4UUSB 3J7AO 2JA6J 3FRQA 2RVCA 5IP7J 3K4BA 2FBHA 1XTAA 2B1EA 2AO9A 4M3DA 2G7UA 4XRMA 2IA2A 4I0BA 1WJBA 2EFNA 4B4CA 3GTOJ 2HGCA 4G8XA 3N97A 2YX4A 4JOMA 3FXJA 1XSVA 2QQBA 2ECBA 2Z2SB 1Z9CA 1HKSA 2V6EA 3CLOA 4HLXA 2HKXA 2XAUA 2XB0X 2GA2A 1OYWA 1Z6RA 4GFBA 2GIVA 1A6IA 2ME0A 4YFNF 2EFOA 2YU9J 1B8IB 1D1CA 2DDBA 2CQKA 2HVQA 2KJCA 4YEJA 2VQLA 3OYHA 2VKDA 3MKYB 2M1BA 1Y6IA 2EIJH 4AIHA 3FXLA 1XMKA 1T2KA 2DMUA 1ZREA 2PEXA 2EH3A 2WAQA 2ZY9A 5JFRA 3QBMA 1JHFA 5CXGA 2OA4A 3ABMH 4GFKA 4EJWA 3JRDA 3SHFA 3BJ6A 3W2AA 2UUZA 1REPC 2STTA 3QYBA 2R93J 4IOCF 4UY8I 2Q2EB 1Q1VA 3EYIA 5EGOA 2W00A 1D8JA 3KKDA 1FMWA 5JHFA 4MEYF 1SC7A 3D1NI 1STZA 2LYCA 3NRVA 2CQ7A 3PNTA 1XGMA 1ZQ3P 4X1EA 3S2HJ 2XHKA 2NYXA 5LHHA 2P6SA 3IHUA 1OPCA 4AVPA 1HSJA 2LF8A 3KETA 4ZJZA 3REOA 5FROA 3HJEA 2R5YA 3QU6A 2OCEA 3VVYA 3HEFA 4HV6A 4V2GA 3BTCA 1WPKA 3M1EA 2KMUA 3M8JA 4FE4A 2IRFG 3WTSC 4UVCA 1VQLI 3JSOA 4OD5A 4CYCA 1RNLA 2H09A 4ZYAA 2CUJA 2E1MB 2VBWA 2V7FA 2WB1N 4PZJA 5DCMA 4OMYA 1S8NA 4PSWA 2NS0A 2VT3A 3TL4X 3IKVA 1NK3P 3HTIA
chains in the Genus database with same CATH topology
3LOCA 2LK2A 2E2IJ 2OERA 1QVUA 1XC5A 2DA6A 2I10A 2COBA 5EYRA 2NVQJ 5D18A 5M5WJ 2W48A 2HXIA 2E2HJ 3CQZJ 3O60A 2HOTA 2Y9YA 4NELA 2AHQA 2M8GX 5D19A 1RKTA 4A3EJ 1UMQA 4A3MJ 2G7SA 4JX4A 1W0TA 4L62A 2ZOZA 5FJ8J 1ORKA 2LY9A 3B6AA 1TWGJ 2R92J 5CW8A 1ETVA 2W53A 1MBFA 2ELKA 3HGYA 3A01B 1IC8A 2ME6A 3LWJA 3WHBA 3LHQA 3LSJA 3VVZA 3ZQFA 1U9OA 1FTTA 1A5JA 3JR9A 1JTYA 3OSFA 1DU6A 2KDZA 5IP6A 4ME9A 3JSJA 1JUMA 2G7GA 3Q0WA 2JK3A 3H0GJ 3JRCA 5DS9A 1TWHJ 4C3HJ 3ON4A 2DA1A 4PXIA 3PM1A 1EF4A 1ZTRA 4C3IJ 2EZHA 3JRAA 4BY7J 5F1JA 5FLMJ 5FMPA 4IHYA 4C3JJ 1K61A 1H88C 4X6AJ 2RHAA 2FQ4A 4UUSA 4ICHA 3Q0UA 1MNMC 2OPTA 2PBXA 2UXOA 1UG2A 4IHVA 3S1RJ 1WI3A 2ID6A 5IYCJ 3IH2A 3F1BA 1D5YA 2H8RA 3I4NJ 1WGXA 5IYBJ 4FE7A 3BR0A 3HKZN 2R5ZA 2GUHA 2E19A 2L7FP 4CGRA 3RH2A 3FIWA 4QSHA 5C4YA 5K7FA 4JL3A 2O9LA 1VNDA 3G1MA 3AQTA 3BQZA 3NNRA 4XRSA 1X58A 2ZB9A 3BR6A 2QWTA 4RBOA 3RZDJ 2NVTJ 1SANA 2DMQA 2M2EA 4NDLA 1SGMA 1GVDA 1MBEA 4Y52J 1WH7A 4J19A 1LFUP 3HOZJ 4AF5A 2MGQA 3IH3A 3ZOBA 2JA8J 1H8AC 3VVXA 1ETXA 1Z77A 2JMWA 3BTLA 5C4XJ 2XGCA 3A03A 1FTZA 3JRHA 2E1OA 3VPRA 3TW7A 1ZR4A 1JKOC 4JKZA 2Y9ZA 5E3MA 1WH5A 5GPCA 5FGLA 3TP3A 3NXCA 4HNVA 2H1KA 3VW1A 1TWFJ 5E3OA 1MH4A 5IYDJ 3BR3A 4EEFG 2L0KA 5JLXA 3ANGA 4A3FJ 3CWRA 3BRUA 3VOXA 2Y0SN 1BW5A 2G3BA 1XG1A 2FX0A 2XRLA 2YS9A 1B72B 3BJBA 1HOMA 3S2DJ 3C2BA 4BY1J 1ETKA 2WGBA 4AUXA 2XDNA 3UKGA 2HKUA 2CQXA 3PO3J 5EGOB 4DYCA 4M3EA 1BL0A 1MBHA 1G2HA 2VKEA 3LSPA 2L9RA 3HOVJ 3E7QA 1FIPA 1JT6A 3VW0A 2WAQN 2XPVA 4JYKA 1AKHB 5EEAA 2OF7A 1AU7A 2ECCA 5J1YA 3JRBA 4A3GJ 3FKIJ 2TCTA 2X48A 4FISA 1U9NA 3KKCA 3BTJA 3MKLA 2GFNA 3GZIA 2R5YB 3JRIA 5F0FA 3GTKJ 1MSFC 1ZR2A 3VUQA 1RESA 2YVEA 3ZQLA 3COLA 3IH4A 2HI3A 3WHCA 2NP3A 3OSGA 3G1LA 2NS8A 1JT0A 4IHWA 2EZLA 2ZOYA 3C07A 2NP5A 4V2FA 5J1RA 4CYCB 2R0QC 2RAEA 1I6HJ 2VUMJ 5K7HA 2WV1A 5FHPA 4D5CA 1GDTA 4A3BJ 1I50J 1ETOA 4D7NA 1UHSA 4W97A 2KT0A 3HDDA 3I4MJ 1TWCJ 4YZEA 3A01A 3HOUJ 3BCGA 3BHQA 1X2MA 2XSDC 5HBUA 3CMYA 1RR7A 2DTZA 3SJMA 1H89C 5HSZA 4S0HB 2EBIA 2NS7A 3JRFA 5EZHA 2LLKA 2IEKA 3B6CA 5FKMA 4DZPA 3L1PA 3ANPA 3PPBA 2G0EA 3ZQIA 3RKQA 3A02A 2QIBA 2NVYJ 1BW6A 3NAUA 4DW6A 2NX4A 1FIAA 4UUTA 4I6ZA 3GBGA 2DG8A 1DU0A 2DA5A 1W0UA 2MG4A 4DYRA 3FK6A 1JTXA 1VF9A 2QOPA 1Y1WJ 2L7ZA 3ZQGA 1WCMJ 3HGGA 5JLWA 2XB5A 4M3FA 4A3KJ 2NVXJ 2PZ9A 1TC3C 2UXIA 2IAIA 5FKLA 1P7IA 1VI0A 3DEWA 5M3MJ 3RZOJ 1K83J 1X2NA 5EG0B 1F36A 3QQAA 5GPAA 4W1UA 1POGA 1OCTC 4A3IJ 2ID3A 1HDDC 5FLVA 1Z0XA 2ZCMA 5IPAA 3O8HA 4GCTA 2CU7A 2LP0A 3HIMA 2WUIA 2P81A 3EGQA 1B8IA 1T33A 2UXHA 1NTCA 2CUEA 2IU5A 3CCYA 4KWAA 5K58A 2QKOA 2REKA 2FJ1A 5FKNA 3LSGA 5IOZA 2HOAA 3QPSA 2CUFA 3S16J 1MH3A 1IDZA 1U78A 2O8KA 4A93J 1UI6A 2O7TA 3DPJA 2MW8A 2HYJA 1F43A 3CJDA 2LR8A 2O7OA 2GENA 3DCFA 2JN6A 3O8GA 5EF6A 5CXIA 4XICA 4QTRA 1P7JA 1JKPC 1HCRA 4AYBN 3RD3A 3JRGA 3HTHA 5C44J 4JX6A 2L7MP 4MXMA 1LE8A 3S15J 4MLOA 3VP5A 5M5YJ 1CQTA 3CRJA 3TP0A 3PO2J 5F0HA 1TWAJ 4B1RA 2UXPA 2TRTA 3VW2A 5D1RA 1ZGWA 2YUSA 5DTDA 1R9TJ 3QKXA 9ANTA 2DA3A 4XRSG 1OCPA 4MK6A 3BTIA 4A3LJ 1BJZA 3S1MJ 3S1NJ 1LFBA 2LVSA 5EZGA 4NN1A 2IBDA 2DMTA 4GFLA 4GCKA 3HE0A 1IGNA 1PUFB 2JA7J 2DA7A 3BNIA 5BNGA 4B3AA 3H3VK 2HOSA 4C2MJ 2XGEA 2HYTA 5C3EJ 3K2AA 4DZJA 4GCLA 3HOYJ 5K7ZA 2R7ZJ 2QTQA 3RQIA 3PASA 1E3OC 2CRGA 1NK2P 3F0CA 5EFYA 2CQQA 2D6YA 5E3LA 3TEDA 2Y2ZA 1IG7A 3GTLJ 3B81A 1QVTA 2M0CA 3BG9A 4BKXA 4FTHA 3Q3SA 4XK4A 4D5FA 1YRNB 2JA5J 5FKOA 2K40A 3QPLA 4I76A 2FBQA 2Y31A 4MIMA 2QCOA 5M3FJ 3K7AJ 5C4JJ 1ETWA 3BR2A 1IJWC 3HOXJ 3GTQJ 4A69C 3NRGA 1MBGA 4JX5A 2GBYA 4QIWN 5HODA 2ZCNA 2K9QA 3S17J 3KNWA 2M9HA 2HQ5A 2LFBA 3GEUA 3M4OJ 1JJ8C 3G1OA 5J1UA 4BBSJ 3KZ9A 3LJLA 3T6NA 3ON2A 2X9DA 1IRZA 1JJ6C 1AHDP 3VOKA 4RDUA 5F27A 5EDNA 1JGGA 4AC0A 4DYQA 3IUVA 4MFEA 2XGDA 3G56A 4UDSA 2Y30A 1MSEC 1JKQC 3NPIA 1BA5A 1ETQA 1HDPA 1RKWA 3CDLA 5E3NA 3HTAA 2LD5A 3BR1A 4IHXA 1XS9A 4M3BA 1OJLA 2HDDA 1JUPA 1GUUA 3V6GA 5AQCA 2DMNA 4XIDA 4D7MA 3BG3A 4A3JJ 5EG0A 1RPWA 1IUFA 1IV6A 4BBRJ 2VI6A 1ZK8A 1O4XA 3M3YJ 4BXXJ 1VFCA 4A3DJ 4ACIA 2PMZN 5F0CA 4MO7A 4L5EA 4UUSB 2QF7A 3G7RA 2XPWA 2JA6J 3BT9A 2K9NA 3FRQA 3ZQCA 5IP7J 2AO9A 4M3DA 3ZQHA 1U8BA 3HTJA 2EZKA 4XRMA 3FISA 1S7EA 3P9TA 2JWTA 2LKXA 1JKRC 4LOCA 4B4CA 3GTOJ 2R5ZB 3MNLA 1OFCX 1HF0A 2GLOA 1IDYA 3BR5A 2ECBA 1QPIA 1FEXA 2D5VA 5DAJA 2F07A 2XB0X 5H9TA 3MN2A 5GP9A 3GTMJ 4GFBA 1RETA 1A6IA 2ME0A 3SDGA 4FCYA 1ETYA 2YU9J 1B8IB 2MSYA 1GV5A 2DG7A 3GTGJ 1UI5A 3EUPA 3S14J 3IV5A 1B72A 3BG5A 2CJJA 2DMUA 4ABZA 1MBJA 3HOWJ 2EZIA 2EH3A 2OI8A 3AQSA 2UXUA 3QBMA 3W6VA 5CXGA 4GFKA 3JRDA 3TW6A 4M6VA 3OOUA 2R93J 2LTPA 1MBKA 3BQYA 2X6OA 4MFDA 1GV2A 5F08A 2DN0A 1Q1VA 3GTJJ 4JP0A 3LSRA 5EGOA 1ITYA 3KKDA 1Y1VJ 2DA2A 1GT0C 2EQRA 2ZCXA 2YVHA 3D1NI 2VKVA 3GTPJ 3VIBA 1I3QJ 2VPRA 2JJ7A 1ENHA 3HB9A 1AKHA 1ZQ3P 4X1EA 3S2HJ 3NARA 1PUFA 1LE8B 1ZKGA 5FKKA 3MVPA 3OIOA 5F04A 2Q24A 2M34A 1APLC 4G12A 1FJLA 2K9SA 3V78A 5HAWA 3LNQA 1QRYA 2DMPA 2R5YA 1HLVA 3Q0VA 5IP9J 4JNNA 3E7LA 4HKUA 3NI7A 3VVYA 3HEFA 4V2GA 1SFOJ 4A3CJ 3BTCA 3SFIA 1WPKA 3HBLA 5J3LA 3S5RA 2DA4A 2NOGA 4FE4A 2B63J 5M5XJ 1JUSA 1T56A 2G7LA 4M3GA 2V57A 4CYCA 3HM5A 1YRNA 2GM4A 2DJNA 2WB1N 3FK7A 4Y7NJ 2HXOA 3HTIA 3JREA 5IOYA 4AC6A 2FD5A 2RASA 2E2JJ 2XPUA 1NK3P 3S1QJ 4IEJA 2N8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOC A;  2LK2 A;  2E2I J;  2OER A;  1QVU A;  1XC5 A;  2DA6 A;  2I10 A;  2COB A;  5EYR A;  2NVQ J;  5D18 A;  5M5W J;  2W48 A;  2HXI A;  2E2H J;  3CQZ J;  3O60 A;  2HOT A;  2Y9Y A;  4NEL A;  2AHQ A;  2M8G X;  5D19 A;  1RKT A;  4A3E J;  1UMQ A;  4A3M J;  2G7S A;  4JX4 A;  1W0T A;  4L62 A;  2ZOZ A;  5FJ8 J;  1ORK A;  2LY9 A;  3B6A A;  1TWG J;  2R92 J;  5CW8 A;  1ETV A;  2W53 A;  1MBF A;  2ELK A;  3HGY A;  3A01 B;  1IC8 A;  2ME6 A;  3LWJ A;  3WHB A;  3LHQ A;  3LSJ A;  3VVZ A;  3ZQF A;  1U9O A;  1FTT A;  1A5J A;  3JR9 A;  1JTY A;  3OSF A;  1DU6 A;  2KDZ A;  5IP6 A;  4ME9 A;  3JSJ A;  1JUM A;  2G7G A;  3Q0W A;  2JK3 A;  3H0G J;  3JRC A;  5DS9 A;  1TWH J;  4C3H J;  3ON4 A;  2DA1 A;  4PXI A;  3PM1 A;  1EF4 A;  1ZTR A;  4C3I J;  2EZH A;  3JRA A;  4BY7 J;  5F1J A;  5FLM J;  5FMP A;  4IHY A;  4C3J J;  1K61 A;  1H88 C;  4X6A J;  2RHA A;  2FQ4 A;  4UUS A;  4ICH A;  3Q0U A;  1MNM C;  2OPT A;  2PBX A;  2UXO A;  1UG2 A;  4IHV A;  3S1R J;  1WI3 A;  2ID6 A;  5IYC J;  3IH2 A;  3F1B A;  1D5Y A;  2H8R A;  3I4N J;  1WGX A;  5IYB J;  4FE7 A;  3BR0 A;  3HKZ N;  2R5Z A;  2GUH A;  2E19 A;  2L7F P;  4CGR A;  3RH2 A;  3FIW A;  4QSH A;  5C4Y A;  5K7F A;  4JL3 A;  2O9L A;  1VND A;  3G1M A;  3AQT A;  3BQZ A;  3NNR A;  4XRS A;  1X58 A;  2ZB9 A;  3BR6 A;  2QWT A;  4RBO A;  3RZD J;  2NVT J;  1SAN A;  2DMQ A;  2M2E A;  4NDL A;  1SGM A;  1GVD A;  1MBE A;  4Y52 J;  1WH7 A;  4J19 A;  1LFU P;  3HOZ J;  4AF5 A;  2MGQ A;  3IH3 A;  3ZOB A;  2JA8 J;  1H8A C;  3VVX A;  1ETX A;  1Z77 A;  2JMW A;  3BTL A;  5C4X J;  2XGC A;  3A03 A;  1FTZ A;  3JRH A;  2E1O A;  3VPR A;  3TW7 A;  1ZR4 A;  1JKO C;  4JKZ A;  2Y9Z A;  5E3M A;  1WH5 A;  5GPC A;  5FGL A;  3TP3 A;  3NXC A;  4HNV A;  2H1K A;  3VW1 A;  1TWF J;  5E3O A;  1MH4 A;  5IYD J;  3BR3 A;  4EEF G;  2L0K A;  5JLX A;  3ANG A;  4A3F J;  3CWR A;  3BRU A;  3VOX A;  2Y0S N;  1BW5 A;  2G3B A;  1XG1 A;  2FX0 A;  2XRL A;  2YS9 A;  1B72 B;  3BJB A;  1HOM A;  3S2D J;  3C2B A;  4BY1 J;  1ETK A;  2WGB A;  4AUX A;  2XDN A;  3UKG A;  2HKU A;  2CQX A;  3PO3 J;  5EGO B;  4DYC A;  4M3E A;  1BL0 A;  1MBH A;  1G2H A;  2VKE A;  3LSP A;  2L9R A;  3HOV J;  3E7Q A;  1FIP A;  1JT6 A;  3VW0 A;  2WAQ N;  2XPV A;  4JYK A;  1AKH B;  5EEA A;  2OF7 A;  1AU7 A;  2ECC A;  5J1Y A;  3JRB A;  4A3G J;  3FKI J;  2TCT A;  2X48 A;  4FIS A;  1U9N A;  3KKC A;  3BTJ A;  3MKL A;  2GFN A;  3GZI A;  2R5Y B;  3JRI A;  5F0F A;  3GTK J;  1MSF C;  1ZR2 A;  3VUQ A;  1RES A;  2YVE A;  3ZQL A;  3COL A;  3IH4 A;  2HI3 A;  3WHC A;  2NP3 A;  3OSG A;  3G1L A;  2NS8 A;  1JT0 A;  4IHW A;  2EZL A;  2ZOY A;  3C07 A;  2NP5 A;  4V2F A;  5J1R A;  4CYC B;  2R0Q C;  2RAE A;  1I6H J;  2VUM J;  5K7H A;  2WV1 A;  5FHP A;  4D5C A;  1GDT A;  4A3B J;  1I50 J;  1ETO A;  4D7N A;  1UHS A;  4W97 A;  2KT0 A;  3HDD A;  3I4M J;  1TWC J;  4YZE A;  3A01 A;  3HOU J;  3BCG A;  3BHQ A;  1X2M A;  2XSD C;  5HBU A;  3CMY A;  1RR7 A;  2DTZ A;  3SJM A;  1H89 C;  5HSZ A;  4S0H B;  2EBI A;  2NS7 A;  3JRF A;  5EZH A;  2LLK A;  2IEK A;  3B6C A;  5FKM A;  4DZP A;  3L1P A;  3ANP A;  3PPB A;  2G0E A;  3ZQI A;  3RKQ A;  3A02 A;  2QIB A;  2NVY J;  1BW6 A;  3NAU A;  4DW6 A;  2NX4 A;  1FIA A;  4UUT A;  4I6Z A;  3GBG A;  2DG8 A;  1DU0 A;  2DA5 A;  1W0U A;  2MG4 A;  4DYR A;  3FK6 A;  1JTX A;  1VF9 A;  2QOP A;  1Y1W J;  2L7Z A;  3ZQG A;  1WCM J;  3HGG A;  5JLW A;  2XB5 A;  4M3F A;  4A3K J;  2NVX J;  2PZ9 A;  1TC3 C;  2UXI A;  2IAI A;  5FKL A;  1P7I A;  1VI0 A;  3DEW A;  5M3M J;  3RZO J;  1K83 J;  1X2N A;  5EG0 B;  1F36 A;  3QQA A;  5GPA A;  4W1U A;  1POG A;  1OCT C;  4A3I J;  2ID3 A;  1HDD C;  5FLV A;  1Z0X A;  2ZCM A;  5IPA A;  3O8H A;  4GCT A;  2CU7 A;  2LP0 A;  3HIM A;  2WUI A;  2P81 A;  3EGQ A;  1B8I A;  1T33 A;  2UXH A;  1NTC A;  2CUE A;  2IU5 A;  3CCY A;  4KWA A;  5K58 A;  2QKO A;  2REK A;  2FJ1 A;  5FKN A;  3LSG A;  5IOZ A;  2HOA A;  3QPS A;  2CUF A;  3S16 J;  1MH3 A;  1IDZ A;  1U78 A;  2O8K A;  4A93 J;  1UI6 A;  2O7T A;  3DPJ A;  2MW8 A;  2HYJ A;  1F43 A;  3CJD A;  2LR8 A;  2O7O A;  2GEN A;  3DCF A;  2JN6 A;  3O8G A;  5EF6 A;  5CXI A;  4XIC A;  4QTR A;  1P7J A;  1JKP C;  1HCR A;  4AYB N;  3RD3 A;  3JRG A;  3HTH A;  5C44 J;  4JX6 A;  2L7M P;  4MXM A;  1LE8 A;  3S15 J;  4MLO A;  3VP5 A;  5M5Y J;  1CQT A;  3CRJ A;  3TP0 A;  3PO2 J;  5F0H A;  1TWA J;  4B1R A;  2UXP A;  2TRT A;  3VW2 A;  5D1R A;  1ZGW A;  2YUS A;  5DTD A;  1R9T J;  3QKX A;  9ANT A;  2DA3 A;  4XRS G;  1OCP A;  4MK6 A;  3BTI A;  4A3L J;  1BJZ A;  3S1M J;  3S1N J;  1LFB A;  2LVS A;  5EZG A;  4NN1 A;  2IBD A;  2DMT A;  4GFL A;  4GCK A;  3HE0 A;  1IGN A;  1PUF B;  2JA7 J;  2DA7 A;  3BNI A;  5BNG A;  4B3A A;  3H3V K;  2HOS A;  4C2M J;  2XGE A;  2HYT A;  5C3E J;  3K2A A;  4DZJ A;  4GCL A;  3HOY J;  5K7Z A;  2R7Z J;  2QTQ A;  3RQI A;  3PAS A;  1E3O C;  2CRG A;  1NK2 P;  3F0C A;  5EFY A;  2CQQ A;  2D6Y A;  5E3L A;  3TED A;  2Y2Z A;  1IG7 A;  3GTL J;  3B81 A;  1QVT A;  2M0C A;  3BG9 A;  4BKX A;  4FTH A;  3Q3S A;  4XK4 A;  4D5F A;  1YRN B;  2JA5 J;  5FKO A;  2K40 A;  3QPL A;  4I76 A;  2FBQ A;  2Y31 A;  4MIM A;  2QCO A;  5M3F J;  3K7A J;  5C4J J;  1ETW A;  3BR2 A;  1IJW C;  3HOX J;  3GTQ J;  4A69 C;  3NRG A;  1MBG A;  4JX5 A;  2GBY A;  4QIW N;  5HOD A;  2ZCN A;  2K9Q A;  3S17 J;  3KNW A;  2M9H A;  2HQ5 A;  2LFB A;  3GEU A;  3M4O J;  1JJ8 C;  3G1O A;  5J1U A;  4BBS J;  3KZ9 A;  3LJL A;  3T6N A;  3ON2 A;  2X9D A;  1IRZ A;  1JJ6 C;  1AHD P;  3VOK A;  4RDU A;  5F27 A;  5EDN A;  1JGG A;  4AC0 A;  4DYQ A;  3IUV A;  4MFE A;  2XGD A;  3G56 A;  4UDS A;  2Y30 A;  1MSE C;  1JKQ C;  3NPI A;  1BA5 A;  1ETQ A;  1HDP A;  1RKW A;  3CDL A;  5E3N A;  3HTA A;  2LD5 A;  3BR1 A;  4IHX A;  1XS9 A;  4M3B A;  1OJL A;  2HDD A;  1JUP A;  1GUU A;  3V6G A;  5AQC A;  2DMN A;  4XID A;  4D7M A;  3BG3 A;  4A3J J;  5EG0 A;  1RPW A;  1IUF A;  1IV6 A;  4BBR J;  2VI6 A;  1ZK8 A;  1O4X A;  3M3Y J;  4BXX J;  1VFC A;  4A3D J;  4ACI A;  2PMZ N;  5F0C A;  4MO7 A;  4L5E A;  4UUS B;  2QF7 A;  3G7R A;  2XPW A;  2JA6 J;  3BT9 A;  2K9N A;  3FRQ A;  3ZQC A;  5IP7 J;  2AO9 A;  4M3D A;  3ZQH A;  1U8B A;  3HTJ A;  2EZK A;  4XRM A;  3FIS A;  1S7E A;  3P9T A;  2JWT A;  2LKX A;  1JKR C;  4LOC A;  4B4C A;  3GTO J;  2R5Z B;  3MNL A;  1OFC X;  1HF0 A;  2GLO A;  1IDY A;  3BR5 A;  2ECB A;  1QPI A;  1FEX A;  2D5V A;  5DAJ A;  2F07 A;  2XB0 X;  5H9T A;  3MN2 A;  5GP9 A;  3GTM J;  4GFB A;  1RET A;  1A6I A;  2ME0 A;  3SDG A;  4FCY A;  1ETY A;  2YU9 J;  1B8I B;  2MSY A;  1GV5 A;  2DG7 A;  3GTG J;  1UI5 A;  3EUP A;  3S14 J;  3IV5 A;  1B72 A;  3BG5 A;  2CJJ A;  2DMU A;  4ABZ A;  1MBJ A;  3HOW J;  2EZI A;  2EH3 A;  2OI8 A;  3AQS A;  2UXU A;  3QBM A;  3W6V A;  5CXG A;  4GFK A;  3JRD A;  3TW6 A;  4M6V A;  3OOU A;  2R93 J;  2LTP A;  1MBK A;  3BQY A;  2X6O A;  4MFD A;  1GV2 A;  5F08 A;  2DN0 A;  1Q1V A;  3GTJ J;  4JP0 A;  3LSR A;  5EGO A;  1ITY A;  3KKD A;  1Y1V J;  2DA2 A;  1GT0 C;  2EQR A;  2ZCX A;  2YVH A;  3D1N I;  2VKV A;  3GTP J;  3VIB A;  1I3Q J;  2VPR A;  2JJ7 A;  1ENH A;  3HB9 A;  1AKH A;  1ZQ3 P;  4X1E A;  3S2H J;  3NAR A;  1PUF A;  1LE8 B;  1ZKG A;  5FKK A;  3MVP A;  3OIO A;  5F04 A;  2Q24 A;  2M34 A;  1APL C;  4G12 A;  1FJL A;  2K9S A;  3V78 A;  5HAW A;  3LNQ A;  1QRY A;  2DMP A;  2R5Y A;  1HLV A;  3Q0V A;  5IP9 J;  4JNN A;  3E7L A;  4HKU A;  3NI7 A;  3VVY A;  3HEF A;  4V2G A;  1SFO J;  4A3C J;  3BTC A;  3SFI A;  1WPK A;  3HBL A;  5J3L A;  3S5R A;  2DA4 A;  2NOG A;  4FE4 A;  2B63 J;  5M5X J;  1JUS A;  1T56 A;  2G7L A;  4M3G A;  2V57 A;  4CYC A;  3HM5 A;  1YRN A;  2GM4 A;  2DJN A;  2WB1 N;  3FK7 A;  4Y7N J;  2HXO A;  3HTI A;  3JRE A;  5IOY A;  4AC6 A;  2FD5 A;  2RAS A;  2E2J J;  2XPU A;  1NK3 P;  3S1Q J;  4IEJ A;  2N8G A; 
#chains in the Genus database with same CATH topology
 2E5Z A;  1XC5 A;  2ESH A;  3I59 A;  2I10 A;  2VBY A;  2CS3 A;  3SXY A;  2R7F A;  3WE2 A;  2H8R A;  3HL2 A;  1S3J A;  1DP7 P;  2PG4 A;  3CQZ J;  4C30 A;  1ZG3 A;  2EFQ A;  3W3C A;  1MJ9 A;  3K69 A;  3KIO A;  1YYV A;  4RS8 A;  1DQU A;  1UEL B;  2M8G X;  3K9T A;  4N0B A;  4F93 B;  1YTY A;  4BE1 A;  1YI2 I;  3JSP A;  3FMS A;  3BJO A;  1BJA A;  4JX4 A;  1W0T A;  4L62 A;  4R79 A;  1IN5 A;  5FJ8 J;  2LY9 A;  3FWE A;  4E6K G;  5DUI A;  4U0Y A;  1TWG J;  1P92 A;  3K2Z A;  3OOP A;  1O3R A;  1QU3 A;  2ZC2 A;  2RGV A;  4Y3O A;  2XF5 A;  2W53 A;  4RLQ A;  1YFH A;  3EDP A;  4S04 A;  2WAF A;  2X4H A;  3OIP A;  3LWJ A;  3LHQ A;  2VJI A;  1ULY A;  3LSJ A;  3UR3 C;  4AIJ A;  3DPU A;  4MTD A;  3HOS A;  2XAH A;  2VQC A;  4ME9 A;  1HC8 A;  3PQJ A;  3E6M A;  2BE5 F;  4B48 A;  2WA0 A;  5IT9 Z;  1V3F A;  1TWH J;  3KZZ A;  4PXI A;  3PM1 A;  2O3F A;  4EJT A;  5F1J A;  1WJC A;  5B66 C;  2FU4 A;  3QAH A;  4HNU A;  4X6A J;  2K3P A;  4D9J A;  1NHA A;  1Z7U A;  4ESB A;  3AG2 H;  3Q0U A;  4ICH A;  4CCO A;  3K8P C;  4ZH4 F;  3RYR A;  2NOJ B;  1IW7 F;  3DBL B;  2GXA A;  4LG0 B;  3G73 A;  1O3T A;  3I4N J;  4Q47 A;  1V5F A;  1Z05 A;  5IYB J;  4AYB A;  3HKZ N;  5HDK A;  1SFU A;  2R7V A;  3AG4 H;  2L7F P;  4F3Q A;  3RH2 A;  4QSH A;  4ENK A;  4M9S A;  1VND A;  1KGS A;  3G1M A;  3NNR A;  4ENM A;  3LSM A;  2ZB9 A;  4A5N A;  4NC8 A;  2QWT A;  1LUJ B;  5D6E A;  2FXA A;  1U6G A;  2DMQ A;  4NDL A;  1MBE A;  3I64 A;  2MLK A;  1WH7 A;  3HOZ J;  1LFU P;  1SAU A;  3ZOB A;  2JA8 J;  4RGR A;  4OMZ A;  2A68 F;  3SFZ A;  2Z9O A;  2KRH A;  3MEX A;  2QYO A;  1FP1 D;  1QQI A;  2YR2 A;  4IPA A;  3OIQ A;  1WH5 A;  2LRD A;  2O0Y A;  1SMT A;  5E20 A;  2L3D A;  3P9C A;  2CV1 A;  3WTW C;  1A36 A;  3VW1 A;  1OIS A;  4HLY A;  5E3O A;  4ZTJ A;  1ACI A;  5IYD J;  4NB5 A;  4EEF G;  3ANG A;  3CWR A;  2HKO A;  1UHM A;  2G3B A;  1X19 A;  1KU2 A;  1TL8 A;  4U87 A;  1S5L C;  3KP4 A;  3DEE A;  3I9V 2;  4HF1 A;  4BY1 J;  2DFI A;  2RNG A;  3E1S A;  4M71 A;  2RQP A;  1SFE A;  1T08 B;  2JRM A;  2XDN A;  1QGP A;  2X0L A;  2ZJR F;  3OWT A;  1WRJ A;  5EGO B;  2Q0O A;  4M3E A;  3RTR A;  2HZD A;  1X3U A;  1MBH A;  3LSP A;  1TQI A;  2L9R A;  4MQV A;  4PDK A;  2ZME A;  3NQO A;  3NWS A;  2BY1 A;  1FX7 A;  2R7U A;  3CME I;  5EEA A;  2DI3 A;  3ZMZ A;  5LGN A;  1ZGA A;  2NXN B;  5LD2 C;  4FAS D;  4U0W A;  4FT8 A;  4BQO A;  1XB4 A;  4P96 A;  2R5Y B;  1MSF C;  1VQ5 I;  3BC8 A;  1A04 A;  2YVE A;  2V1D A;  4I02 A;  3DLL F;  3ZQL A;  3CUQ A;  3E5U A;  1JHH A;  3V7C A;  4ESF A;  3OSG A;  3KLO A;  2GWR A;  3CMA I;  1WJF A;  3QOE A;  5CVU A;  3RCO A;  4IHW A;  2X6Y A;  2NP5 A;  5ERI A;  4NQW A;  5B1B H;  4CYC B;  1OR7 A;  2F5E A;  5DCM B;  2DU9 A;  1DPU A;  2VUM J;  2F4M B;  2IT0 A;  3LA7 A;  3PUB A;  3IAS 2;  5EJC A;  4A3B J;  4KNY A;  1FZP B;  1ETO A;  4D7N A;  1UHS A;  3I59 B;  4BDZ A;  2PJR B;  3H3U A;  3A01 A;  3HOU J;  3BCG A;  3JTH A;  3K4L A;  3CMY A;  1RR7 A;  2BW3 A;  2DTZ A;  1H89 C;  5HSZ A;  4S0H B;  2EBI A;  2NS7 A;  1SVM A;  2LLK A;  4BUP A;  4WXH A;  5FKM A;  4ENN A;  3MKZ A;  2QBY A;  3ZQI A;  2CV2 A;  1PVE A;  3DKW A;  2JPB A;  2Y75 A;  2A07 F;  5LLQ A;  1TT0 A;  3NAU A;  5GAD J;  1DP3 A;  2QA4 I;  1ZRF A;  4XL9 A;  4C2T A;  2GXB A;  1E0E A;  1DU0 A;  2DA5 A;  2GA1 A;  1H0M A;  4E7L A;  4XSZ F;  3OYL A;  3FK6 A;  1FYM A;  2E71 A;  2XVC A;  5LBQ A;  3SEZ A;  3ZQG A;  3HGG A;  1OR7 C;  2L54 A;  4B09 A;  2E60 A;  1R1V A;  2ZFU A;  2PI0 A;  1T38 A;  2PX9 A;  2PZ9 A;  2UXI A;  4LIV A;  4ENJ A;  2ETH A;  2ZXH A;  2IAI A;  1PUE E;  3HRU A;  3RZO J;  1K83 J;  5EG0 B;  1F36 A;  1WJE A;  4A3I J;  1HDD C;  5FLV A;  2OZ6 A;  1Z0X A;  4KMU X;  3CP2 A;  3VWB A;  4CCL A;  1ZYR F;  1TQM A;  4CCK A;  3EGQ A;  1W1W E;  4Q5S F;  2XRN A;  2OUM A;  4L5I A;  2L7K A;  4NHJ A;  4HX8 A;  4ZDP A;  3FDY A;  1YIJ I;  3CJQ B;  3CCY A;  2R7R A;  1D0X A;  2QKO A;  2CW8 A;  2REK A;  1Z7L A;  2HOA A;  1MH3 A;  4B43 A;  1IDZ A;  2O8K A;  3M8E A;  2MW8 A;  3CJD A;  1Z1D A;  3WU2 C;  1MGT A;  5CXI A;  3E6C C;  4GDF A;  3FHZ A;  5HDG A;  5K5R A;  3HIF A;  3HHG A;  2VIX A;  2I8D A;  2F48 A;  5ICF A;  2L7M P;  2QWW A;  2QSH X;  3VP5 A;  2OZU A;  2V6C A;  2IGO A;  3LSK A;  2XAG A;  3CRJ A;  1X1C A;  1Z21 A;  3PO2 J;  5F0H A;  3RPQ A;  1MNE A;  3VW2 A;  3MQ0 A;  1PP8 F;  3TOA A;  3S32 A;  1V55 H;  2ZNY A;  5ILU A;  2W84 A;  5E8G A;  4EVI A;  2YUS A;  1I1S A;  4G9Y A;  1ZG1 A;  4XRS G;  4K2E A;  4MK6 A;  4PJL A;  1BJZ A;  1HBX G;  2O61 A;  4UV8 A;  5EZG A;  3LWF A;  1W5S A;  4GCK A;  4I2O A;  3CP8 A;  3OYD A;  2JZY A;  4CA0 A;  2QSF X;  2AQE A;  3DV8 A;  4CGZ A;  5BNG A;  5EEG A;  4UXN A;  2XGE A;  1O7F A;  2UWM A;  3MKW B;  4A12 A;  3K2A A;  5CVV A;  3LA3 A;  1IF1 A;  2PMU A;  3T8R A;  5K7Z A;  5HDN A;  2GAU A;  3CCL I;  3ML6 A;  3D5S C;  3HRT A;  2FQ3 A;  1MND A;  3K4M A;  3PFY A;  3DBR B;  3TKY A;  1S72 I;  3F0C A;  2KKO A;  2D6Y A;  5HNH A;  2LMD A;  2ZME B;  3E3V A;  2M0C A;  2JRT A;  1U8R A;  1YO5 C;  1RR8 C;  1IXS B;  3Q3S A;  4BJT A;  4LFU A;  3KP7 A;  3IL2 A;  2EV6 A;  2IP2 A;  1RZ4 A;  3U1K A;  1K4T A;  3G3Z A;  1YLF A;  1S9H A;  2K27 A;  5DYM A;  5FFX A;  2D45 A;  2YVX A;  3E97 A;  2P7C B;  3FX3 A;  2R7S A;  4BS9 A;  3BR2 A;  3ELK A;  4E7Z A;  3CUQ B;  1R23 A;  1MBG A;  2CUZ A;  3H5N A;  2EK5 A;  2EWN A;  4JX5 A;  3WTY C;  2K9Q A;  1J9I A;  2GZW A;  1TQP A;  2HQ5 A;  1OYI A;  2M30 A;  5LHG A;  1JJ8 C;  2STW A;  1X4P A;  2M7A A;  2VQG A;  3AG1 H;  3KZ9 A;  3W6K B;  2LNB A;  1G3T A;  4WK8 F;  4YIR X;  3ERE D;  1MMG A;  2X9D A;  1JJ6 C;  3A1Y A;  2L4M A;  1R49 A;  1MDM A;  5CJ9 A;  4N4N B;  2B7E A;  3V42 A;  4BH9 A;  5BQT A;  6PAX A;  2ESN A;  3Q9S A;  3OYI A;  2QEX I;  2DYR H;  1SD6 A;  2EIK H;  2L2O A;  1JKQ C;  3FXQ A;  4J01 A;  2CG4 A;  2BW3 B;  1BA5 A;  3OV8 A;  2H8W A;  1ETQ A;  1HDP A;  1RKW A;  2IJL A;  2MBF A;  2O5R A;  4M6Y A;  4AVZ A;  1IXR C;  5JVT A;  5E3N A;  3IWZ A;  3HTA A;  1BR2 A;  2R4G A;  2QBY B;  5DUK A;  1TW2 A;  4GCV A;  3ZMD A;  2F5C A;  1NG6 A;  2RKH A;  3KX2 A;  4E7K A;  1BR4 A;  5JR3 A;  3WGI A;  3QPT A;  2DMN A;  2ZFW A;  3KP5 A;  4XRF A;  3DQV C;  3N05 A;  2PQ8 A;  2WY8 Q;  1IV6 A;  4GGG A;  2L02 A;  2VI6 A;  1A6Q A;  1ZK8 A;  2K4B A;  2L9S A;  2WTE A;  1O4X A;  4BXX J;  4ACI A;  2EV0 A;  4F55 A;  5F0C A;  3CDH A;  2XPW A;  2RN7 A;  1U2W A;  3ZCO A;  2K9N A;  1VQK I;  2M5W A;  2W7N A;  3V7S A;  4M9Z A;  3AL0 B;  4ZTF A;  2EZK A;  4DBQ A;  2EA2 A;  1B9N A;  3L9F A;  1J59 A;  1AA7 A;  1X1A A;  4CSW A;  3GX4 X;  2C6Y A;  4KT5 C;  3BG6 A;  5K1Y A;  5BMZ A;  3PNY A;  1IDY A;  1XSX A;  3FHN A;  1QA6 A;  2F07 A;  4CO8 A;  1FWZ A;  2FE3 A;  3MN2 A;  1RET A;  4XLH A;  3SDG A;  3F3X A;  2IGN A;  3GTG J;  1UI5 A;  3S14 J;  1CGP A;  3IV5 A;  4ESJ A;  1B72 A;  1LVA A;  3TO7 A;  5HS7 A;  1RC9 A;  3BG5 A;  1LKX A;  2OI8 A;  3VTI A;  2UXU A;  2H94 A;  3W6V A;  3QPH A;  3PFI A;  4CYD A;  3BZ6 A;  4WIB A;  3TW6 A;  4M6V A;  4MFD A;  1GV2 A;  2DN0 A;  4JP0 A;  2DT5 A;  1MMN A;  5TJJ A;  2DA2 A;  2R7D A;  1A35 A;  3FMR A;  2ZCX A;  1T0F A;  1I3Q J;  3QU3 A;  4G94 A;  4I01 A;  3HB9 A;  1AKH A;  2VJJ A;  3NAR A;  3LQR A;  3K4C A;  5FKK A;  3OIO A;  1KON A;  2QQ9 A;  4RAF A;  2V1N A;  1YJW I;  2CW0 F;  2Q24 A;  1SAX A;  4G12 A;  1IRF A;  2WAD A;  3ULQ B;  1FJL A;  2K9S A;  1LVK A;  2F5D A;  1KZH A;  1HLV A;  5IP9 J;  3ZXS A;  5KAI C;  2J5P A;  4BNC A;  1YS6 A;  4HKU A;  3NI7 A;  4XLA A;  2KZV A;  4CZZ A;  4MTE A;  5H20 A;  4BEH B;  3I0T A;  4G7H F;  1SFO J;  4A3C J;  2B3W A;  3HBL A;  5J3L A;  4HRI A;  4RGX A;  3KPH A;  3T1B A;  5GAG J;  2B63 J;  2G7L A;  1T95 A;  2ISY A;  3GZN B;  1YRN A;  2R7W A;  2BOL A;  3FK7 A;  1FP2 A;  3ABT A;  1BN5 A;  1OCR H;  2FD5 A;  2QQA A;  2RAS A;  2E2J J;  2XPU A;  3OL4 A;  1W7P D;  2IPQ X;  4IEJ A;  1R4N B;  3ZMV A;  1BI3 A;  3LOC A;  2LK2 A;  4KIF A;  4OOI A;  2HDC A;  2OER A;  1JE8 A;  1QVU A;  2DA6 A;  1U5T B;  4LD5 A;  1KU9 A;  2COB A;  2VBX A;  2LY1 A;  1MD0 A;  2K5C A;  2NVQ J;  4L0Y B;  3QOP A;  2HDW A;  2ZKZ A;  4AID A;  1MKM A;  3KEQ A;  1TP4 A;  5TGT A;  1UZC A;  3O60 A;  2HOT A;  3H5R A;  4NEL A;  1Z3Y A;  1BR1 A;  1SVL A;  5D19 A;  4CHU A;  2UZK A;  4A3E J;  1UMQ A;  2DJI A;  4UV9 A;  4CXF A;  4PUS A;  4A3M J;  5FD6 A;  4D0P A;  4AWX B;  1MIJ A;  1W5T A;  1W36 C;  2ZOZ A;  1J0R A;  1ORK A;  2Z99 A;  1VQN I;  3L09 A;  5B1A H;  3TBI A;  4XBF A;  3HGY A;  2FNP A;  1IC8 A;  3KYD B;  3U9G A;  3WHB A;  3LSI A;  4Y15 A;  4HDV A;  1OYY A;  2V1U A;  4KIS A;  1U9O A;  1A5J A;  5ED4 A;  4XR6 A;  5HLG A;  5DDG A;  1FOW A;  5E1X A;  1DU6 A;  2L9V A;  1JUM A;  1I6X A;  1TNT A;  4IO9 F;  3J7Z I;  1MDM B;  4DBR A;  1UFM A;  1R6R A;  3VYU B;  2HU9 A;  4XOP A;  2XV4 S;  2DA1 A;  3KP3 A;  4C3I J;  2ZXW H;  3BWG A;  1FOK A;  3ASO H;  4C3J J;  1K61 A;  1H88 C;  4EMS A;  3CCM I;  2HPI A;  3DEU A;  2FQ4 A;  4XN3 A;  2OPT A;  3QP6 A;  2E7W A;  4ITV A;  3S1R J;  1WI3 A;  2KIM A;  4IHT A;  3S2W A;  3IH2 A;  4A0Y A;  1BI0 A;  3WE3 A;  2HQA A;  3BR0 A;  3BDD A;  5CPR B;  2F4I A;  2R5Z A;  2GUH A;  3SYT A;  1K4S A;  4HOB A;  5E1Z B;  2AS5 F;  1E2X A;  4A2U A;  4BHC A;  3RPU A;  2HTJ A;  4HA8 A;  5K7F A;  4JL3 A;  3V8K A;  3L2R A;  2O9L A;  1JI8 A;  2KZG A;  3SWH A;  1VQ9 I;  2PBI A;  3ZN0 A;  5D5W B;  2AXT C;  3RZD J;  1SAN A;  5LGU A;  2P4W A;  3OL3 A;  3NS4 A;  3CJR B;  1LJ9 A;  2BHY A;  1Z67 A;  3VVX A;  2AQF A;  1ON2 A;  2FUG 2;  1Z77 A;  2JUG A;  2XGC A;  3A03 A;  1FTZ A;  1TLH B;  1F9N A;  2AXL A;  3JRH A;  2E1O A;  1HW2 A;  3GF2 A;  4KJZ A;  1ZR4 A;  3F6O A;  4L9T A;  3TP3 A;  3NXC A;  1E3H A;  4HNV A;  2ELH A;  2H1K A;  1TWF J;  1MH4 A;  3K1N A;  1QNT A;  5CQE A;  3VDX A;  4AD9 A;  2B0L A;  5D8K B;  3QYF A;  4XLP F;  4YFX F;  1UST A;  2FX0 A;  4Q4Z F;  2GIZ A;  3GFL A;  1J09 A;  2YS9 A;  3AFH A;  4OWR B;  3L2Q A;  1B72 B;  3BJB A;  2DXI A;  1HOM A;  3IAM 2;  4OIR F;  2VPL A;  1ETK A;  2WGB A;  2ZBK A;  3K4J A;  4CIC A;  4XOR A;  5DM6 F;  2DPD A;  2CQX A;  3S3M A;  1IO2 A;  5B5E C;  4OU0 A;  4DYC A;  3A0B C;  1DUX C;  1J2X A;  2QZ8 A;  2RRE A;  1Y0N A;  3D0S A;  3CCS I;  3HOV J;  1EA3 A;  1HQC A;  4L9V A;  5BPI A;  4ETS A;  2HEO A;  1LDD A;  3QRF F;  4JYK A;  1KQ9 A;  1AKH B;  3F21 A;  5HNF A;  1AU7 A;  1QO0 D;  2ECC A;  3CJT B;  3JRB A;  4A3G J;  3FKI J;  2IXS A;  1TZL A;  3MKL A;  2GFN A;  2VOP A;  5KAF C;  1RES A;  2X1C A;  2NVU B;  2FNA A;  1W36 D;  3E6B A;  3COL A;  2BVL A;  2RC4 A;  3WHC A;  4D1Q A;  3G71 I;  1AWC A;  1D8K A;  4C2U A;  3MZH A;  3CC2 I;  2DBB A;  1JT0 A;  3F23 A;  5J6X A;  3OYB A;  3I56 I;  2EZL A;  2Z5U A;  2ZOY A;  1QBJ A;  2E34 A;  1OCC H;  1HXD A;  4PSX A;  4CUG A;  3KEO A;  4NC6 A;  4DOZ A;  5K7H A;  2WV1 A;  4D5C A;  4N4O B;  4MGR A;  5J4V A;  3JAM K;  4DQ2 A;  1BC7 C;  4IJA A;  1YW8 A;  3RI4 A;  4R8H A;  4IXA A;  3I4M J;  2A6H F;  2KPM A;  3P7N A;  4YII A;  1EH8 A;  2BXY A;  3F6V A;  3I71 A;  3CF5 F;  5EZH A;  1J5Y A;  2XAQ A;  4BU2 A;  5HOO A;  4HF2 A;  2VC1 A;  2KQR A;  2QEN A;  1UB9 A;  3OYM A;  3DFG A;  3H35 A;  4BYY A;  2G0E A;  1T6S A;  3MD2 A;  1BIB A;  3T5X A;  3RKQ A;  2QIB A;  1SVO A;  1V4R A;  4DW6 A;  3HC7 A;  1A31 A;  1B9M A;  3GBG A;  2MAB A;  2DG8 A;  2EIN H;  3I4P A;  2A05 A;  1O7L A;  2X51 A;  4XON A;  1OCO H;  2LRE A;  3OR1 C;  1JTX A;  2KP6 A;  2L7Z A;  4KN4 X;  5JLW A;  4CCN A;  1BI2 A;  4M3F A;  3Q9V A;  1RIO H;  1QHG A;  4HBL A;  3W2V A;  3G6E I;  1TC3 C;  2QKL B;  4KYW A;  3CTA A;  3DTE A;  1LPQ A;  1YE9 A;  1VI0 A;  2L01 A;  5M3M J;  4E7I A;  3ZRG A;  3ZP5 A;  1Q1H A;  2FMY A;  4BXF A;  4GXO A;  2ID3 A;  5CVR A;  2ZCM A;  5EEH A;  4OIN F;  3RDI A;  3HIM A;  4LLL A;  2P81 A;  4I7H A;  5LFA A;  1KQ0 A;  1FSH A;  3CCE I;  1WVR A;  4E7S A;  2CUE A;  3WTU C;  2EFP A;  3DTK A;  2IA1 A;  2A69 F;  3H1C A;  3KYL A;  2CUF A;  1SD4 A;  4HPQ A;  2X1D A;  2BVM A;  3CO6 C;  5CYV A;  2K02 A;  2LR8 A;  2GEN A;  3O8G A;  4EV0 A;  2EB7 A;  1P7J A;  1JKP C;  1I27 A;  3RQ4 A;  1TBX A;  2V9K A;  4Q48 A;  3IWF A;  2DPU A;  3RD3 A;  1FSE A;  3LST A;  4UHT A;  4JX6 A;  1LE8 A;  2P5K A;  3EUK L;  1KA8 A;  3ZN1 A;  1CQT A;  4EJO A;  1I3A A;  2V79 A;  1G59 A;  4KIC A;  4HQE A;  3C1D A;  2JTV A;  1RRJ A;  2WB1 A;  5K5O A;  1ZGW A;  4F52 A;  4UNO A;  2XF7 A;  4QPQ A;  1R71 A;  2DA3 A;  2NAZ A;  3BTI A;  4A3L J;  2LVS A;  1VQO I;  3ROU A;  2LDU A;  4LLG F;  5CVJ A;  2DMT A;  4CDG A;  4KDP A;  4GFL A;  1KU3 A;  4OIQ F;  1PJR A;  2A6E F;  1ZRC A;  1K6Y A;  5LRS A;  4H4K C;  1OKR A;  3BNI A;  4HF0 A;  1VTN C;  4B3A A;  2K85 A;  4C2M J;  4GCL A;  2JVG A;  1TT5 B;  2EPF A;  2LKP A;  2ZCW A;  4KA4 A;  4BHB A;  3RQI A;  2QTQ A;  1YX5 A;  4YFK F;  1MMS A;  1WKM A;  1XCB A;  3H5A A;  1NK2 P;  4BHP A;  5EFY A;  1I39 A;  2CQQ A;  2P5L C;  3GFM A;  4WXC A;  4Y4R A;  4UB8 C;  5DV5 A;  3DBH B;  3BG9 A;  4V19 K;  4D5F A;  1YW7 A;  3CUO A;  3HUG A;  4O6J A;  2JA5 J;  4I76 A;  4B8X A;  2DLL A;  2Y31 A;  5J40 A;  3BG7 A;  1D3Y A;  1QPM A;  3DLA A;  2GOM A;  1SEU A;  1R36 A;  3CJN A;  2K7L A;  2K4J A;  3S17 J;  3KNW A;  1ZH5 A;  3GEU A;  2LFB A;  2K86 A;  3M4O J;  5CLS A;  4BAC A;  1MW7 A;  3G1O A;  4EM0 B;  4BBS J;  4RB2 C;  3LJL A;  3T6N A;  1T98 A;  2PMZ A;  3WTZ A;  1OCZ H;  4JQF A;  1IRZ A;  2FF4 A;  4I09 A;  4M6X A;  4C2M A;  5E18 F;  3LAJ A;  2W1O A;  5EDN A;  1SFX A;  2FEZ A;  2YX7 A;  4DVY P;  5LGT A;  2Y30 A;  4WWC A;  1MSE C;  3V8L A;  1UCR A;  3JTG A;  1ERD A;  3CDL A;  3VSL A;  1R22 A;  1SMY F;  2E1N A;  1S7A A;  2DT6 A;  3BR1 A;  3RKW A;  4IHX A;  1XS9 A;  2R3S A;  1OJL A;  1ZLK A;  1R1T A;  2JUC A;  1IZ1 A;  4FX4 A;  2HDD A;  4IQJ A;  3L2V A;  3LFK A;  1TNS A;  1V5E A;  2E36 A;  1IAW A;  3WG7 H;  2VE9 A;  1Y56 A;  4D7M A;  3CCQ I;  4ZDL A;  2QM3 A;  4DJA A;  5IT9 K;  4BBR J;  4XKB A;  3HXL A;  1WZ2 A;  2X6X A;  2PJP A;  1G8X A;  1VFC A;  1VQ4 I;  2KHM A;  4L9N A;  4MO7 A;  2QF7 A;  4XLF A;  3BT9 A;  2OBP A;  2VJ5 A;  2ZJP F;  3ZQC A;  2MFZ A;  4R1H A;  2FSW A;  1PDN C;  3VB2 A;  2F5F A;  2XKP A;  1X1P A;  3V4G A;  2E7X A;  1S7E A;  2DT7 B;  4IKF A;  2JWT A;  1JKR C;  4AM3 A;  4LOC A;  4BQQ A;  1DDN A;  3DPL C;  1LEB A;  3ZQ7 A;  5GAH J;  3T8T A;  3MNL A;  2A2F X;  3RIR A;  3WTX C;  1XX5 A;  4UUV A;  3J81 K;  2F6C A;  2BYV E;  1MMD A;  1XDU A;  2WBM A;  3AKZ A;  1YHQ I;  2LSO A;  3GZ5 A;  5DAJ A;  2GXG A;  1H9G A;  3BCB A;  4OAZ A;  4FCY A;  1ETY A;  2QGU A;  2XC7 A;  2MSY A;  1GV5 A;  5KVR A;  2ZJQ F;  2DG7 A;  2B9S A;  3EUP A;  5L3D A;  2ELJ A;  2FJI 1;  2DK5 A;  4RAZ A;  2CH0 A;  3HSF A;  4ABZ A;  2ACJ A;  3BCA A;  1YOV B;  4RM2 A;  1K79 A;  3HOW J;  3AQS A;  1Z6T A;  2BHZ A;  5CVI A;  1WI9 A;  3OOU A;  4RB0 A;  1L0O C;  1MBK A;  2LTP A;  2X6O A;  3BQY A;  5F08 A;  3GTJ J;  3E5Q A;  2MYS A;  3H36 A;  1Y1V J;  1QZY A;  1GT0 C;  1BC8 C;  1X3W B;  4LIT A;  1DGR M;  2EQR A;  3F22 A;  2YVH A;  2VKV A;  2HVS A;  2COM A;  2JJ7 A;  3GZ6 A;  2PMH A;  1PUF A;  1LE8 B;  1ZKG A;  1IN6 A;  2YU3 A;  5F04 A;  1W7P A;  3F8N A;  3CO7 C;  3EUH C;  1E3P A;  5HAW A;  1XCV A;  4QPO A;  4HNT A;  4U88 A;  1W5C C;  1WWX A;  4TV7 A;  3BPX A;  3RSN A;  3SEQ A;  5FD5 A;  2EJR A;  3SFI A;  3OY9 A;  3GEZ A;  1KQ8 A;  3E0J B;  4EQQ A;  3S5R A;  2W25 A;  4RA2 A;  2DA4 A;  5D8L B;  2NOG A;  5D5U B;  3WU0 A;  2VKH A;  1JUS A;  1T56 A;  5A2Q Z;  1H9T A;  5LHI A;  4A0X A;  2V57 A;  3HM5 A;  4LJZ F;  1BIA A;  2MLG A;  2DJN A;  4EM2 A;  5IOY A;  3B02 A;  4C9Y A;  1VQ8 I;  2OCC H;  3CCJ I;  3S1Q J;  3IP4 B;  2JSP A;  3BRO A;  1K78 A;  3EUA A;  2OJE D;  1N75 A;  3S93 A;  5D18 A;  5KNL A;  4L5J A;  2W48 A;  2HQR A;  2HXI A;  2E2H J;  1MZB A;  1AOY A;  3GFJ A;  2ISZ A;  4NQW B;  4IX7 A;  2Y9Y A;  2AHQ A;  3ABK H;  4M73 A;  2HR3 A;  2MC4 A;  1IN8 A;  2BV6 A;  4RAG A;  2G7S A;  2F2E A;  4CH7 A;  4A0Z A;  2FOW A;  4U7B A;  1G3W A;  3B6A A;  2R92 J;  5CW8 A;  4ZYH A;  2KL4 A;  1ETV A;  4U7D A;  3A01 B;  2ME6 A;  3ZQF A;  3K70 C;  3W6J B;  1FTT A;  1JTY A;  1R7J A;  2MD0 A;  3JSJ A;  2KRC A;  1TW3 A;  4NUB A;  3Q0W A;  2JK3 A;  3TOB A;  4F91 B;  2VC0 A;  4PFP A;  4RGU A;  4P1W A;  4C3H J;  3ON4 A;  3PUF A;  1RUO A;  1EF4 A;  2EZH A;  2R7X A;  4BY7 J;  5FLM J;  4IHY A;  2EIL H;  4IOA F;  1SFK A;  3V7R A;  3PSI A;  4UUS A;  1MNM C;  4XLE A;  3SZP A;  3U1D A;  2PBX A;  3T0Y A;  3L7W A;  2ID6 A;  3QWL A;  1D0Y A;  3R61 A;  3O6B B;  1N25 A;  5IYC J;  3F1B A;  2DFF A;  4HSR A;  5HS8 A;  1G3Y A;  4IRG A;  2Y0S A;  3ESW B;  4YEL A;  1WGX A;  2XAF A;  4ASN A;  3MZY A;  3WU1 B;  3AAF A;  5FFZ A;  3FXU A;  4CGR A;  5KCM A;  1ZAO A;  3DKY A;  4E7H A;  4II2 A;  5C4Y A;  1UHW A;  4P9F A;  2RDP A;  2MA3 A;  4MEX F;  3BQZ A;  4XRS A;  1X58 A;  1HKT A;  2MC3 A;  3BR6 A;  4GYG A;  4LK0 F;  3DP7 A;  4FET A;  5F6F A;  4XQF A;  4HQM A;  3CMM A;  2UV1 A;  3A2K A;  3SZT A;  3IH3 A;  1GLN A;  4HW0 A;  1H8A C;  1ETX A;  3BTL A;  2OAZ A;  3KP2 A;  2HS5 A;  5C4X J;  2KLO A;  3VPR A;  2A61 A;  2V9V A;  1LQ1 A;  1JKO C;  1DGW Y;  3TO6 A;  5E3M A;  1P2F A;  3C3W A;  5GPC A;  5ILS A;  4RM3 A;  4Z6Y A;  2RQQ A;  3S3O A;  3BR3 A;  2L0K A;  2VBZ A;  3HRM A;  4O3M A;  1IN7 A;  3VOX A;  5LEK A;  4B44 A;  2BY3 A;  2FOK A;  3S2D J;  1DPR A;  3LA2 A;  5E8I A;  3W2W A;  1IRG A;  3H3Z A;  3PNV A;  2RNJ A;  1D1A A;  4AUX A;  3FBI B;  3UKG A;  2HQN A;  4G6T B;  1FPQ A;  5BOX A;  2ZNZ A;  2EV5 A;  2CYY A;  2VOD A;  3HYI A;  4PJ0 C;  2KIU A;  1JXS A;  1G2H A;  2VKE A;  3E7Q A;  1KYZ A;  1JT6 A;  1FYL A;  2WAQ N;  2XPV A;  2M3A A;  4FQG A;  2OF7 A;  3ZMU A;  1W7P B;  5L3B A;  3ABL H;  4ZDO A;  2YSR A;  3GZI A;  2DOA A;  3S8P A;  3JRI A;  3GTK J;  5F1R A;  3RKX A;  4IHS A;  3GXO A;  4HX7 A;  3G2B A;  3I5U A;  2HPM A;  3IH4 A;  2CSO A;  1LEA A;  2HI3 A;  5J4Y A;  3K6G A;  3R0J A;  1YW9 A;  2FML A;  2NS8 A;  3KLN A;  5GAE J;  4I0A A;  3PIP F;  1BI1 A;  3FZV A;  2OTL I;  4XKW A;  2J5O A;  2R0Q C;  5FLX K;  3K70 D;  2HOE A;  2RAE A;  1I6H J;  1XMX A;  3M7G A;  4RMN A;  3LSH A;  2OV7 A;  4LG3 A;  1X1B A;  5DM7 F;  3HOT A;  1KU7 A;  4ON0 A;  3HDD A;  5LEJ A;  1TWC J;  1MMA A;  2XAS A;  3L2C A;  2VQH A;  3BHQ A;  4YZE A;  1X2M A;  4KIT B;  2XSD C;  5HBU A;  1TTY A;  3SJM A;  1JGS A;  2D2W A;  3TMO A;  2P6T A;  1S29 A;  1R5H A;  4E4H A;  5L3E A;  1I1G A;  3CLQ A;  3L1P A;  1YJ9 I;  2M87 A;  2VXD A;  2E1M C;  4ZYG A;  3PPB A;  3C2H A;  2Y69 H;  1BBY A;  1BOA A;  4MQ9 F;  3DU5 A;  4F92 B;  3A02 A;  2NVY J;  3V8J A;  4HDU A;  2M4G A;  4UUT A;  1HKQ A;  4I6Z A;  1VZ0 A;  3A0H C;  2TDX A;  4A5M A;  3F8F A;  2LKS A;  4B3X A;  4BGD A;  2MG4 A;  3ECH A;  4DYR A;  5JHU A;  1VF9 A;  2QOP A;  1Y1W J;  1WCM J;  2XB5 A;  3FMQ A;  1EV7 A;  1Y0U A;  1T39 A;  4BQA A;  3DU6 A;  2VN2 A;  3NWT A;  1Z3X A;  2D1H A;  1B1B A;  5BS6 A;  3MWM A;  5FB2 A;  1B59 A;  5GPA A;  1OCT C;  1POG A;  1USS A;  3F8B A;  3KZY A;  2EA4 A;  2Y48 A;  4A6D A;  4XN0 A;  4GCT A;  4Y13 A;  5ICC A;  2CU7 A;  1FT9 A;  3CDI A;  1PP7 U;  3SZG A;  1T33 A;  4YIF A;  3TDU C;  2WAE A;  1T8I A;  3F9K A;  1ZG5 A;  5FRN A;  5K58 A;  2FJ1 A;  4HYE A;  1ZHF A;  3LSG A;  2O03 A;  3S16 J;  3VOD A;  2V26 A;  4P5O A;  1U78 A;  4A93 J;  2O7T A;  4BDY A;  3WG9 A;  1F43 A;  2DAO A;  4ZZL A;  4II3 A;  2O7O A;  5HVQ C;  3DCF A;  1XMA A;  2P8T A;  4KIG A;  5EF6 A;  4QTR A;  1UJ8 A;  4DIQ A;  1X1D A;  3GW2 A;  4AYB N;  3JRG A;  3HTH A;  5C44 J;  1HA8 A;  2R7O A;  4MLO A;  5M5Y J;  2IS2 A;  2HFH A;  3R0A A;  2HYG D;  3FM3 A;  4OD4 A;  3TP0 A;  3WTT C;  2KRF A;  4RB3 C;  1TWA J;  2TRT A;  3KP6 A;  5JVG F;  1HW5 A;  1RI7 A;  5D1R A;  4G6D A;  5DTD A;  1R9T J;  2BXZ A;  4PCQ A;  1OCP A;  3HSE A;  1FOX A;  2QQ8 A;  3EQL F;  1LFB A;  3C18 A;  4I98 B;  2IBD A;  2DFE A;  3DKX A;  2G7H A;  3IUO A;  1EJ9 A;  4CCJ A;  1OMI A;  3HPG A;  3MMY B;  2A3S A;  4YRV A;  2HYT A;  3KZI C;  2DYS H;  2KJB A;  3GME A;  2DQL A;  2H6B A;  3B73 A;  2DOD A;  4GYI A;  4KIB A;  1D1B A;  3PAS A;  3BZC A;  1E3O C;  2CGP A;  3J80 K;  2MH9 A;  1F4K A;  3TO9 A;  2E35 A;  1NG7 A;  4BJ5 C;  1IG7 A;  3B81 A;  1XGN A;  3ABU A;  1QVT A;  3HTU A;  4HG2 A;  2HYF A;  1ONV A;  2LF7 A;  5J8C A;  1XPX A;  1YRN B;  2M4K A;  3QPL A;  3QYE A;  3BJA A;  2FBQ A;  3GLL A;  1GXQ A;  3FXR A;  1WQ2 A;  4MIM A;  2H6C A;  2O6G E;  3GWZ A;  1WJA A;  4S05 A;  5M3F J;  3OR2 C;  3ERM A;  2QKM B;  1G4D A;  3BY6 A;  4QIW N;  2ZCN A;  1EH7 A;  2GBY A;  1U0J A;  4ZZD A;  4RB1 A;  3X2Q H;  2PJR A;  4BQN A;  3BZK A;  4YG2 F;  5J1U A;  3DXJ F;  2OTJ I;  1SD5 A;  2UXN A;  3ON2 A;  3OMY A;  2O8X A;  3VOK A;  1WJ5 A;  5IT3 A;  3IRQ A;  3CCV I;  1R5I D;  2DQR A;  5FGM A;  3GFI A;  1FMV A;  3ISP A;  1IUY A;  4PGH A;  2CMP A;  2F4O B;  2DOE A;  2XSJ C;  2XGD A;  2NRA C;  3G56 A;  4UDS A;  3OYG A;  1YQA A;  2W82 A;  3NPI A;  1QZZ A;  4QLC U;  3IKT A;  1G6N A;  3NEU A;  2PN6 A;  5H6Q A;  3TQN A;  4LLN A;  2D1V A;  4LGW A;  2OQG A;  3H0D A;  1GUU A;  3OYC A;  2V1X A;  4A3J J;  5EG0 A;  2L4A A;  2DDA A;  1RPW A;  3K4K A;  4PJM A;  2A5W A;  4AU7 A;  1I5Z A;  2JT1 A;  4A3D J;  2PMZ N;  4L5E A;  3G7R A;  2RV8 A;  2ICW G;  2CW7 A;  4RAY A;  3K1P A;  3OYE A;  1U8B A;  3ZQH A;  5D6F A;  3HTJ A;  2VAS A;  3AG3 H;  3FIS A;  3P9T A;  2LKX A;  3LMM A;  5TRD A;  3PIO F;  3J81 Z;  4P9U A;  3S3N A;  2R5Z B;  2VON A;  1IV8 A;  1OFC X;  2XGX A;  4UB6 C;  1HF0 A;  2GLO A;  4L0Z B;  4NC7 A;  3BR5 A;  3F8M A;  4ANJ A;  1QPI A;  1FEX A;  2D5V A;  4Z2Y A;  5FRM A;  2XF6 A;  1NH3 A;  2QUF A;  2VE8 A;  1J75 A;  5H9T A;  3L00 A;  5GP9 A;  3GTM J;  3C7J A;  3FKJ A;  1U3E M;  4AIK A;  4XKV A;  2W4S A;  4BJ6 C;  2X6W A;  2CJJ A;  1MBJ A;  2EZI A;  2OD5 A;  1IRX A;  3KE2 A;  2WC2 A;  3BPV A;  1R58 A;  3PL8 A;  3O3K A;  3BOQ A;  2DO7 A;  2Z3Y A;  4LB6 B;  1ZR2 A;  1ITY A;  4F7Z A;  3LSR A;  1KYW A;  4E70 A;  3ONQ A;  1VQ6 I;  4XKC A;  3VYR B;  3RPU D;  4PK4 A;  3K10 A;  5CKT A;  5HLI A;  1N78 A;  3GTP J;  2W85 A;  4G6Q A;  3VIB A;  4EGZ A;  2VPR A;  1ENH A;  2DCE A;  5K5Q A;  3OS0 A;  3MVP A;  3CZ6 A;  2P0W A;  3OYA A;  2M34 A;  4WCG A;  1APL C;  1UAA A;  3VFZ A;  1VQM I;  3V78 A;  3H9J A;  4Y33 A;  1QRY A;  2DMP A;  2DW4 A;  5H2F C;  2ZXJ A;  5ILV A;  3Q0V A;  3LNQ A;  4FHT A;  3C2G A;  3ZPL A;  3E7L A;  4JNN A;  3VSK A;  4J00 A;  3FBN B;  2CWE A;  3I55 I;  5M5X J;  3J7Y J;  2XDV A;  4M3G A;  3D5R C;  3N4M A;  4G7O F;  3A4C A;  2GM4 A;  2A5Y B;  4KUM A;  5L3C A;  4Y7N J;  2HXO A;  2IVM A;  3JRE A;  4AC6 A;  4IZZ A;  3DPT A;  2VL8 A;  2HTS A;  2N8G A;  2E2I J;  3SQN A;  1Z91 A;  5EYR A;  3JCU C;  2FBK A;  1XN7 A;  3UNG C;  2XUB A;  2MD5 A;  2Z33 A;  4OIP F;  5M5W J;  1F5T A;  2XIG A;  3ECO A;  2V9P A;  2M8E A;  2IGK A;  4P55 A;  3OS2 A;  1Y8Q B;  2CQN A;  3COA C;  4KT6 A;  1RKT A;  4HV5 A;  1LB2 A;  2ZSH B;  3G4S I;  2IGM A;  4ZYE A;  2FBI A;  2H27 A;  4BXU A;  2VT2 A;  1YIT I;  3BP8 A;  3K1M A;  3RJP A;  1YIO A;  3HKZ A;  2HZT A;  1MJB A;  1MBF A;  2ELK A;  2QVO A;  3WGG A;  3E6D A;  4XLC A;  5DEQ A;  4JBA A;  1SD7 A;  3H9Q A;  5HLT A;  2ZME C;  3VVZ A;  3JR9 A;  4ZYD A;  2JSC A;  4M74 A;  3OSF A;  3F72 A;  2BZT A;  4GO1 A;  2KDZ A;  5IP6 A;  5JI6 A;  4NNJ A;  2IW5 A;  2G7G A;  3WGH A;  3QP5 A;  3H0G J;  3JW4 A;  1GXP A;  3JRC A;  1C0W A;  5DS9 A;  2IS6 A;  3WOD F;  2P7V B;  3R60 A;  2IS1 A;  1V54 H;  1ZTR A;  2ZSI B;  3CUQ C;  5HS9 A;  3JRA A;  2E1C A;  3CC7 I;  2M0M A;  2XKO A;  5AIP A;  5FMP A;  3M9A A;  3SDB A;  5DD4 A;  1LDJ A;  3K4N A;  2RHA A;  3CCU I;  2DFH A;  2YPR A;  5B3S H;  2UXO A;  2DK8 A;  2DOF A;  1UG2 A;  1P4W A;  4IHV A;  1UG0 A;  1WSU A;  5KHD A;  1D5Y A;  1J7K A;  4FE7 A;  4LIU A;  2E19 A;  4Y17 A;  3EUH A;  3I58 A;  3FIW A;  3LL7 A;  5DCF A;  4BAY A;  1HW1 A;  2KFD A;  1ZAR A;  3AQT A;  4CZC A;  4BE2 A;  1CF7 A;  1V5G A;  1ZEL A;  3DF8 A;  2GQQ A;  4RBO A;  2NVT J;  1QZE A;  4L9J A;  1RUN A;  2M2E A;  5AIQ A;  5IY5 H;  1SGM A;  1GVD A;  2WWY A;  4Y52 J;  4J19 A;  4AF5 A;  1YG2 A;  2MGQ A;  4QWQ A;  1O3S A;  1E17 A;  1PYV A;  2JMW A;  3R4K A;  4XM3 A;  4UVA A;  1FNN A;  2OC6 A;  1HST A;  3TW7 A;  4JKZ A;  2Y9Z A;  3R6S A;  4WXD A;  5FGL A;  3I53 A;  2I5U A;  3OYK A;  5JLX A;  3F8C A;  4A3F J;  4OIO F;  3BRU A;  2Y0S N;  1BW5 A;  2ADU A;  1XG1 A;  2K9M A;  3AL0 C;  2XRL A;  3EPZ A;  1VQP I;  2CFO A;  5D5X B;  5E17 F;  2IA0 A;  3C2B A;  3LFU A;  3CD6 I;  1XDS A;  2Z1D A;  3K0L A;  1O57 A;  4A6E A;  3HHH A;  2HKU A;  1XSD A;  3PO3 J;  1WHU A;  2GOX B;  2Q1Z B;  3PSF A;  4PJN A;  1OQY A;  2K3F A;  2NNN A;  1S6L A;  3HTS B;  4BEH A;  1X3Z B;  1BL0 A;  2BEO A;  1OLT A;  3HSR A;  1FIP A;  3KYC B;  3VW0 A;  4RGS A;  2KIQ A;  1F1Z A;  1LNW A;  2R7Q A;  3OYN A;  2KIS A;  1XGS A;  4XNF A;  1ZRD A;  5J1Y A;  2W57 A;  2VJ4 A;  2TCT A;  2X48 A;  4FIS A;  1U9N A;  2JVH A;  3KKC A;  3BTJ A;  2M7B A;  2LBF A;  4HEA 2;  4DGW B;  2KIF A;  5F0F A;  5GTI C;  3VUQ A;  3M1C A;  2VXZ A;  1IXC A;  3MAJ A;  2P5V A;  4HX4 A;  2V4J C;  3CCR I;  3IRR A;  1U5T A;  3RYP A;  4BL0 B;  2NP3 A;  1D5V A;  3DWL E;  3G1L A;  3FF5 A;  5FLX Z;  5J47 A;  2XRO A;  4L18 B;  3LAP A;  3C07 A;  4V2F A;  5J1R A;  3HUG B;  1S7O A;  4LK1 F;  4IL6 C;  4N9H A;  4BE0 A;  4NBQ A;  3FXM A;  3VOE A;  5CQG A;  3FM5 A;  5FHP A;  2KDO A;  2XAJ A;  3FXO A;  3GYH X;  3HZJ A;  1B6A A;  5D5V B;  1GDT A;  2JPC A;  1I50 J;  5F64 A;  2PFB A;  2HNH A;  5FO5 A;  1QHH D;  2LH9 A;  2X1E A;  4W97 A;  4E7J A;  2KT0 A;  3U21 A;  2QSG X;  3EYY A;  4M9X A;  1R00 A;  2L9N A;  5BPD A;  2DTR A;  4KMF A;  3JRF A;  1N77 A;  4RLF A;  3D5L A;  2IEK A;  3B6C A;  4DZP A;  3ANP A;  2ZJ2 A;  4G7Z F;  1WJD A;  1YS7 A;  4LMY A;  4KFC A;  2CO5 A;  3ZQQ A;  3GO5 A;  1BW6 A;  1R4M B;  3H92 A;  2VLA A;  4IQ4 A;  2NX4 A;  1FIA A;  3RKY A;  1GVJ A;  3ASN H;  1YJN I;  4XMY A;  1U5T C;  5E1W A;  1LFP A;  3TDZ C;  1M1E B;  2Y0M A;  4IRV A;  2BY2 A;  1P4X A;  1EH6 A;  4PJJ A;  1W0U A;  3M07 A;  5AON A;  5KK1 A;  2L5Q A;  2EIM H;  2MH2 A;  2LOO A;  4HZF A;  2X85 A;  4A3K J;  2NVX J;  2LC2 A;  4FX0 A;  3HPH A;  4JK1 X;  3ZGK A;  4B47 A;  5FKL A;  1ZLJ A;  2HVR A;  1GHC A;  1P7I A;  3DEW A;  1X2N A;  2WV0 A;  1FYK A;  3QQA A;  1D0Z A;  2E5N A;  4W1U A;  5IPA A;  5E79 C;  3O8H A;  3DTI A;  2Q8K A;  2LP0 A;  1K7A A;  2WUI A;  1P4A A;  3KCC A;  3GCM A;  1B8I A;  2NNY A;  2CV0 A;  4X0G A;  4EJV A;  2UXH A;  1NTC A;  1ODD A;  4PGG A;  2IU5 A;  4KWA A;  4PFO A;  1ON1 A;  4XLN F;  4U0V A;  5FKN A;  5IOZ A;  1Y8R B;  2R7T A;  4GRI A;  2ZO4 A;  3QPS A;  3ZMT A;  1UI6 A;  3DPJ A;  4H0E A;  2HYJ A;  2Q2E A;  3CES A;  5GTH C;  1IN4 A;  2JN6 A;  1FBQ A;  1CF7 B;  2BGC A;  4XIC A;  1R5G A;  3BLY A;  4MNU A;  2BY0 A;  4IF4 A;  1HCR A;  1O3Q A;  2BBY A;  2FRH A;  3VYS B;  2K9L A;  3QOD A;  4MXM A;  3S15 J;  1ZN2 A;  1BOB A;  3GLX A;  3IC7 A;  3M8F A;  3P9K A;  4B1R A;  2UXP A;  2Z16 A;  3E5X A;  4CCM A;  1Y39 A;  4UVB A;  3QKX A;  4WX9 A;  5ICG A;  9ANT A;  3MFK A;  4OAY A;  4N9I A;  4EJU A;  3S1M J;  3S1N J;  4NN1 A;  1EKE A;  3I3L A;  3HE0 A;  1IGN A;  3P9I A;  1PUF B;  2JA7 J;  1FOY A;  4M72 A;  2WY7 Q;  4U9L A;  2DA7 A;  3GVA A;  4XOT A;  3H3V K;  2HOS A;  5HLH A;  5C3E J;  4DZJ A;  2UXX A;  2VOO A;  3EET A;  3HOY J;  3J80 Z;  2R7Z J;  2F5V A;  5L3F A;  1WFX A;  4EM1 A;  5DD8 A;  4I99 C;  2IS4 A;  5L3G A;  1FC3 A;  4LB5 A;  2CRG A;  1K6O A;  2OU2 A;  3MCZ A;  1MJA A;  3HRS A;  5E3L A;  3TED A;  2Y2Z A;  3ZR8 X;  3GTL J;  1L3L A;  5ICE A;  4BKX A;  4DNC A;  3TGN A;  1G3S A;  4XSX F;  4FTH A;  2PLY A;  4XK4 A;  3J7A Y;  5FKO A;  2K40 A;  2QLZ A;  3JAM Z;  1X4O A;  5A2Q K;  2A6T A;  2QCO A;  4IRH A;  1B4A A;  2H1L A;  2LBF B;  2ZXI A;  5D4S A;  1XD7 A;  3K7A J;  5C4J J;  1ETW A;  1ZGJ A;  3Q5F A;  1K78 B;  1IJW C;  3HOX J;  3PQK A;  3GTQ J;  4A69 C;  3NRG A;  5HOD A;  3P5J A;  5D4R A;  3VYT B;  4HST A;  5H6R A;  3ZMS A;  1FY7 A;  2M9H A;  1R1U A;  3PJR A;  3CC4 I;  1FBS A;  1T0F C;  4HAM A;  3HG9 A;  4O5V A;  3CF2 A;  3GUD A;  3OYF A;  3FXK A;  4MHG A;  1P9Q C;  5LRR A;  1FBU A;  1AHD P;  3OYJ A;  2LG4 A;  2OQR A;  4EAT A;  2G9W A;  4RDU A;  4EGY A;  5F27 A;  3LQQ A;  1VQ7 I;  1JGG A;  2PFV A;  4AC0 A;  3L2U A;  3O2P E;  3L2W A;  4DYQ A;  3WTV C;  2JA2 A;  4MFE A;  1FLI A;  3IUV A;  2VB6 A;  2JQ7 A;  2HWV A;  3KEY A;  4U9N A;  1P6R A;  2FA5 A;  1LDK B;  3H9G A;  4ZC3 A;  2CFX A;  2LD5 A;  3KFW X;  4M3B A;  3I54 A;  4LG0 A;  4IVN A;  4KN7 X;  5J8F A;  1JUP A;  2EFW A;  2M45 A;  1YX3 A;  3OS1 A;  5AQC A;  3MZ8 A;  3V6G A;  3U2R A;  4XID A;  3VEP A;  1W4M A;  3BG3 A;  1BM9 A;  1IUF A;  2W24 A;  1XGO A;  5TIS C;  3M3Y J;  4WF2 A;  4IRI A;  2LY2 A;  4UUS B;  3J7A O;  2JA6 J;  3FRQ A;  2RVC A;  5IP7 J;  3K4B A;  2FBH A;  1XTA A;  2B1E A;  2AO9 A;  4M3D A;  2G7U A;  4XRM A;  2IA2 A;  4I0B A;  1WJB A;  2EFN A;  4B4C A;  3GTO J;  2HGC A;  4G8X A;  3N97 A;  2YX4 A;  4JOM A;  3FXJ A;  1XSV A;  2QQB A;  2ECB A;  2Z2S B;  1Z9C A;  1HKS A;  2V6E A;  3CLO A;  4HLX A;  2HKX A;  2XAU A;  2XB0 X;  2GA2 A;  1OYW A;  1Z6R A;  4GFB A;  2GIV A;  1A6I A;  2ME0 A;  4YFN F;  2EFO A;  2YU9 J;  1B8I B;  1D1C A;  2DDB A;  2CQK A;  2HVQ A;  2KJC A;  4YEJ A;  2VQL A;  3OYH A;  2VKD A;  3MKY B;  2M1B A;  1Y6I A;  2EIJ H;  4AIH A;  3FXL A;  1XMK A;  1T2K A;  2DMU A;  1ZRE A;  2PEX A;  2EH3 A;  2WAQ A;  2ZY9 A;  5JFR A;  3QBM A;  1JHF A;  5CXG A;  2OA4 A;  3ABM H;  4GFK A;  4EJW A;  3JRD A;  3SHF A;  3BJ6 A;  3W2A A;  2UUZ A;  1REP C;  2STT A;  3QYB A;  2R93 J;  4IOC F;  4UY8 I;  2Q2E B;  1Q1V A;  3EYI A;  5EGO A;  2W00 A;  1D8J A;  3KKD A;  1FMW A;  5JHF A;  4MEY F;  1SC7 A;  3D1N I;  1STZ A;  2LYC A;  3NRV A;  2CQ7 A;  3PNT A;  1XGM A;  1ZQ3 P;  4X1E A;  3S2H J;  2XHK A;  2NYX A;  5LHH A;  2P6S A;  3IHU A;  1OPC A;  4AVP A;  1HSJ A;  2LF8 A;  3KET A;  4ZJZ A;  3REO A;  5FRO A;  3HJE A;  2R5Y A;  3QU6 A;  2OCE A;  3VVY A;  3HEF A;  4HV6 A;  4V2G A;  3BTC A;  1WPK A;  3M1E A;  2KMU A;  3M8J A;  4FE4 A;  2IRF G;  3WTS C;  4UVC A;  1VQL I;  3JSO A;  4OD5 A;  4CYC A;  1RNL A;  2H09 A;  4ZYA A;  2CUJ A;  2E1M B;  2VBW A;  2V7F A;  2WB1 N;  4PZJ A;  5DCM A;  4OMY A;  1S8N A;  4PSW A;  2NS0 A;  2VT3 A;  3TL4 X;  3IKV A;  1NK3 P;  3HTI A; 
#chains in the Genus database with same CATH homology
 3LOC A;  2LK2 A;  2E2I J;  2OER A;  1QVU A;  1XC5 A;  2DA6 A;  2I10 A;  2COB A;  5EYR A;  2NVQ J;  5D18 A;  5M5W J;  2W48 A;  2HXI A;  2E2H J;  3CQZ J;  3O60 A;  2HOT A;  2Y9Y A;  4NEL A;  2AHQ A;  2M8G X;  5D19 A;  1RKT A;  4A3E J;  1UMQ A;  4A3M J;  2G7S A;  4JX4 A;  1W0T A;  4L62 A;  2ZOZ A;  5FJ8 J;  1ORK A;  2LY9 A;  3B6A A;  1TWG J;  2R92 J;  5CW8 A;  1ETV A;  2W53 A;  1MBF A;  2ELK A;  3HGY A;  3A01 B;  1IC8 A;  2ME6 A;  3LWJ A;  3WHB A;  3LHQ A;  3LSJ A;  3VVZ A;  3ZQF A;  1U9O A;  1FTT A;  1A5J A;  3JR9 A;  1JTY A;  3OSF A;  1DU6 A;  2KDZ A;  5IP6 A;  4ME9 A;  3JSJ A;  1JUM A;  2G7G A;  3Q0W A;  2JK3 A;  3H0G J;  3JRC A;  5DS9 A;  1TWH J;  4C3H J;  3ON4 A;  2DA1 A;  4PXI A;  3PM1 A;  1EF4 A;  1ZTR A;  4C3I J;  2EZH A;  3JRA A;  4BY7 J;  5F1J A;  5FLM J;  5FMP A;  4IHY A;  4C3J J;  1K61 A;  1H88 C;  4X6A J;  2RHA A;  2FQ4 A;  4UUS A;  4ICH A;  3Q0U A;  1MNM C;  2OPT A;  2PBX A;  2UXO A;  1UG2 A;  4IHV A;  3S1R J;  1WI3 A;  2ID6 A;  5IYC J;  3IH2 A;  3F1B A;  1D5Y A;  2H8R A;  3I4N J;  1WGX A;  5IYB J;  4FE7 A;  3BR0 A;  3HKZ N;  2R5Z A;  2GUH A;  2E19 A;  2L7F P;  4CGR A;  3RH2 A;  3FIW A;  4QSH A;  5C4Y A;  5K7F A;  4JL3 A;  2O9L A;  1VND A;  3G1M A;  3AQT A;  3BQZ A;  3NNR A;  4XRS A;  1X58 A;  2ZB9 A;  3BR6 A;  2QWT A;  4RBO A;  3RZD J;  2NVT J;  1SAN A;  2DMQ A;  2M2E A;  4NDL A;  1SGM A;  1GVD A;  1MBE A;  4Y52 J;  1WH7 A;  4J19 A;  1LFU P;  3HOZ J;  4AF5 A;  2MGQ A;  3IH3 A;  3ZOB A;  2JA8 J;  1H8A C;  3VVX A;  1ETX A;  1Z77 A;  2JMW A;  3BTL A;  5C4X J;  2XGC A;  3A03 A;  1FTZ A;  3JRH A;  2E1O A;  3VPR A;  3TW7 A;  1ZR4 A;  1JKO C;  4JKZ A;  2Y9Z A;  5E3M A;  1WH5 A;  5GPC A;  5FGL A;  3TP3 A;  3NXC A;  4HNV A;  2H1K A;  3VW1 A;  1TWF J;  5E3O A;  1MH4 A;  5IYD J;  3BR3 A;  4EEF G;  2L0K A;  5JLX A;  3ANG A;  4A3F J;  3CWR A;  3BRU A;  3VOX A;  2Y0S N;  1BW5 A;  2G3B A;  1XG1 A;  2FX0 A;  2XRL A;  2YS9 A;  1B72 B;  3BJB A;  1HOM A;  3S2D J;  3C2B A;  4BY1 J;  1ETK A;  2WGB A;  4AUX A;  2XDN A;  3UKG A;  2HKU A;  2CQX A;  3PO3 J;  5EGO B;  4DYC A;  4M3E A;  1BL0 A;  1MBH A;  1G2H A;  2VKE A;  3LSP A;  2L9R A;  3HOV J;  3E7Q A;  1FIP A;  1JT6 A;  3VW0 A;  2WAQ N;  2XPV A;  4JYK A;  1AKH B;  5EEA A;  2OF7 A;  1AU7 A;  2ECC A;  5J1Y A;  3JRB A;  4A3G J;  3FKI J;  2TCT A;  2X48 A;  4FIS A;  1U9N A;  3KKC A;  3BTJ A;  3MKL A;  2GFN A;  3GZI A;  2R5Y B;  3JRI A;  5F0F A;  3GTK J;  1MSF C;  1ZR2 A;  3VUQ A;  1RES A;  2YVE A;  3ZQL A;  3COL A;  3IH4 A;  2HI3 A;  3WHC A;  2NP3 A;  3OSG A;  3G1L A;  2NS8 A;  1JT0 A;  4IHW A;  2EZL A;  2ZOY A;  3C07 A;  2NP5 A;  4V2F A;  5J1R A;  4CYC B;  2R0Q C;  2RAE A;  1I6H J;  2VUM J;  5K7H A;  2WV1 A;  5FHP A;  4D5C A;  1GDT A;  4A3B J;  1I50 J;  1ETO A;  4D7N A;  1UHS A;  4W97 A;  2KT0 A;  3HDD A;  3I4M J;  1TWC J;  4YZE A;  3A01 A;  3HOU J;  3BCG A;  3BHQ A;  1X2M A;  2XSD C;  5HBU A;  3CMY A;  1RR7 A;  2DTZ A;  3SJM A;  1H89 C;  5HSZ A;  4S0H B;  2EBI A;  2NS7 A;  3JRF A;  5EZH A;  2LLK A;  2IEK A;  3B6C A;  5FKM A;  4DZP A;  3L1P A;  3ANP A;  3PPB A;  2G0E A;  3ZQI A;  3RKQ A;  3A02 A;  2QIB A;  2NVY J;  1BW6 A;  3NAU A;  4DW6 A;  2NX4 A;  1FIA A;  4UUT A;  4I6Z A;  3GBG A;  2DG8 A;  1DU0 A;  2DA5 A;  1W0U A;  2MG4 A;  4DYR A;  3FK6 A;  1JTX A;  1VF9 A;  2QOP A;  1Y1W J;  2L7Z A;  3ZQG A;  1WCM J;  3HGG A;  5JLW A;  2XB5 A;  4M3F A;  4A3K J;  2NVX J;  2PZ9 A;  1TC3 C;  2UXI A;  2IAI A;  5FKL A;  1P7I A;  1VI0 A;  3DEW A;  5M3M J;  3RZO J;  1K83 J;  1X2N A;  5EG0 B;  1F36 A;  3QQA A;  5GPA A;  4W1U A;  1POG A;  1OCT C;  4A3I J;  2ID3 A;  1HDD C;  5FLV A;  1Z0X A;  2ZCM A;  5IPA A;  3O8H A;  4GCT A;  2CU7 A;  2LP0 A;  3HIM A;  2WUI A;  2P81 A;  3EGQ A;  1B8I A;  1T33 A;  2UXH A;  1NTC A;  2CUE A;  2IU5 A;  3CCY A;  4KWA A;  5K58 A;  2QKO A;  2REK A;  2FJ1 A;  5FKN A;  3LSG A;  5IOZ A;  2HOA A;  3QPS A;  2CUF A;  3S16 J;  1MH3 A;  1IDZ A;  1U78 A;  2O8K A;  4A93 J;  1UI6 A;  2O7T A;  3DPJ A;  2MW8 A;  2HYJ A;  1F43 A;  3CJD A;  2LR8 A;  2O7O A;  2GEN A;  3DCF A;  2JN6 A;  3O8G A;  5EF6 A;  5CXI A;  4XIC A;  4QTR A;  1P7J A;  1JKP C;  1HCR A;  4AYB N;  3RD3 A;  3JRG A;  3HTH A;  5C44 J;  4JX6 A;  2L7M P;  4MXM A;  1LE8 A;  3S15 J;  4MLO A;  3VP5 A;  5M5Y J;  1CQT A;  3CRJ A;  3TP0 A;  3PO2 J;  5F0H A;  1TWA J;  4B1R A;  2UXP A;  2TRT A;  3VW2 A;  5D1R A;  1ZGW A;  2YUS A;  5DTD A;  1R9T J;  3QKX A;  9ANT A;  2DA3 A;  4XRS G;  1OCP A;  4MK6 A;  3BTI A;  4A3L J;  1BJZ A;  3S1M J;  3S1N J;  1LFB A;  2LVS A;  5EZG A;  4NN1 A;  2IBD A;  2DMT A;  4GFL A;  4GCK A;  3HE0 A;  1IGN A;  1PUF B;  2JA7 J;  2DA7 A;  3BNI A;  5BNG A;  4B3A A;  3H3V K;  2HOS A;  4C2M J;  2XGE A;  2HYT A;  5C3E J;  3K2A A;  4DZJ A;  4GCL A;  3HOY J;  5K7Z A;  2R7Z J;  2QTQ A;  3RQI A;  3PAS A;  1E3O C;  2CRG A;  1NK2 P;  3F0C A;  5EFY A;  2CQQ A;  2D6Y A;  5E3L A;  3TED A;  2Y2Z A;  1IG7 A;  3GTL J;  3B81 A;  1QVT A;  2M0C A;  3BG9 A;  4BKX A;  4FTH A;  3Q3S A;  4XK4 A;  4D5F A;  1YRN B;  2JA5 J;  5FKO A;  2K40 A;  3QPL A;  4I76 A;  2FBQ A;  2Y31 A;  4MIM A;  2QCO A;  5M3F J;  3K7A J;  5C4J J;  1ETW A;  3BR2 A;  1IJW C;  3HOX J;  3GTQ J;  4A69 C;  3NRG A;  1MBG A;  4JX5 A;  2GBY A;  4QIW N;  5HOD A;  2ZCN A;  2K9Q A;  3S17 J;  3KNW A;  2M9H A;  2HQ5 A;  2LFB A;  3GEU A;  3M4O J;  1JJ8 C;  3G1O A;  5J1U A;  4BBS J;  3KZ9 A;  3LJL A;  3T6N A;  3ON2 A;  2X9D A;  1IRZ A;  1JJ6 C;  1AHD P;  3VOK A;  4RDU A;  5F27 A;  5EDN A;  1JGG A;  4AC0 A;  4DYQ A;  3IUV A;  4MFE A;  2XGD A;  3G56 A;  4UDS A;  2Y30 A;  1MSE C;  1JKQ C;  3NPI A;  1BA5 A;  1ETQ A;  1HDP A;  1RKW A;  3CDL A;  5E3N A;  3HTA A;  2LD5 A;  3BR1 A;  4IHX A;  1XS9 A;  4M3B A;  1OJL A;  2HDD A;  1JUP A;  1GUU A;  3V6G A;  5AQC A;  2DMN A;  4XID A;  4D7M A;  3BG3 A;  4A3J J;  5EG0 A;  1RPW A;  1IUF A;  1IV6 A;  4BBR J;  2VI6 A;  1ZK8 A;  1O4X A;  3M3Y J;  4BXX J;  1VFC A;  4A3D J;  4ACI A;  2PMZ N;  5F0C A;  4MO7 A;  4L5E A;  4UUS B;  2QF7 A;  3G7R A;  2XPW A;  2JA6 J;  3BT9 A;  2K9N A;  3FRQ A;  3ZQC A;  5IP7 J;  2AO9 A;  4M3D A;  3ZQH A;  1U8B A;  3HTJ A;  2EZK A;  4XRM A;  3FIS A;  1S7E A;  3P9T A;  2JWT A;  2LKX A;  1JKR C;  4LOC A;  4B4C A;  3GTO J;  2R5Z B;  3MNL A;  1OFC X;  1HF0 A;  2GLO A;  1IDY A;  3BR5 A;  2ECB A;  1QPI A;  1FEX A;  2D5V A;  5DAJ A;  2F07 A;  2XB0 X;  5H9T A;  3MN2 A;  5GP9 A;  3GTM J;  4GFB A;  1RET A;  1A6I A;  2ME0 A;  3SDG A;  4FCY A;  1ETY A;  2YU9 J;  1B8I B;  2MSY A;  1GV5 A;  2DG7 A;  3GTG J;  1UI5 A;  3EUP A;  3S14 J;  3IV5 A;  1B72 A;  3BG5 A;  2CJJ A;  2DMU A;  4ABZ A;  1MBJ A;  3HOW J;  2EZI A;  2EH3 A;  2OI8 A;  3AQS A;  2UXU A;  3QBM A;  3W6V A;  5CXG A;  4GFK A;  3JRD A;  3TW6 A;  4M6V A;  3OOU A;  2R93 J;  2LTP A;  1MBK A;  3BQY A;  2X6O A;  4MFD A;  1GV2 A;  5F08 A;  2DN0 A;  1Q1V A;  3GTJ J;  4JP0 A;  3LSR A;  5EGO A;  1ITY A;  3KKD A;  1Y1V J;  2DA2 A;  1GT0 C;  2EQR A;  2ZCX A;  2YVH A;  3D1N I;  2VKV A;  3GTP J;  3VIB A;  1I3Q J;  2VPR A;  2JJ7 A;  1ENH A;  3HB9 A;  1AKH A;  1ZQ3 P;  4X1E A;  3S2H J;  3NAR A;  1PUF A;  1LE8 B;  1ZKG A;  5FKK A;  3MVP A;  3OIO A;  5F04 A;  2Q24 A;  2M34 A;  1APL C;  4G12 A;  1FJL A;  2K9S A;  3V78 A;  5HAW A;  3LNQ A;  1QRY A;  2DMP A;  2R5Y A;  1HLV A;  3Q0V A;  5IP9 J;  4JNN A;  3E7L A;  4HKU A;  3NI7 A;  3VVY A;  3HEF A;  4V2G A;  1SFO J;  4A3C J;  3BTC A;  3SFI A;  1WPK A;  3HBL A;  5J3L A;  3S5R A;  2DA4 A;  2NOG A;  4FE4 A;  2B63 J;  5M5X J;  1JUS A;  1T56 A;  2G7L A;  4M3G A;  2V57 A;  4CYC A;  3HM5 A;  1YRN A;  2GM4 A;  2DJN A;  2WB1 N;  3FK7 A;  4Y7N J;  2HXO A;  3HTI A;  3JRE A;  5IOY A;  4AC6 A;  2FD5 A;  2RAS A;  2E2J J;  2XPU A;  1NK3 P;  3S1Q J;  4IEJ A;  2N8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...