2OF7A

Structural genomics, the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor a3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
191
structure length
191
Chain Sequence
b'GLRERKKTRTREAIRAATYGLIRQQGYEATTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLRKALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEVRIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 64
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2007-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2of7A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2of7A02
3W6VA 4QTRA 1TWGJ 3EGQA 4X6AJ 3ZOBA 1B72A 3JRAA 3NXCA 3S2HJ 3QKXA 5F0FA 5F04A 2JN6A 3HEFA 5EYRA 2DA5A 1I3QJ 5IYCJ 2ME6A 1JT0A 5K7ZA 5E3NA 2LVSA 1NTCA 3ZQFA 3O60A 2OERA 3RZDJ 4C2MJ 5DS9A 3HTHA 3D1NI 1CQTA 3BR1A 1JJ6C 2ZCMA 2XGDA 2IEKA 2R93J 3Q0UA 3HOVJ 3C2BA 3CRJA 2N8GA 2FJ1A 2M34A 3JRBA 1TWHJ 3BJBA 4FE4A 4DYQA 4CYCB 5HSZA 2E2HJ 1MSFC 5M5WJ 3VIBA 4FISA 3NI7A 2GLOA 5EGOB 1GT0C 1SGMA 1F36A 2F07A 2L9RA 5E3OA 1XG1A 3O8GA 1VI0A 3GBGA 2IBDA 1BW6A 2DN0A 3VVZA 1QVTA 1ZR2A 2R5ZA 2REKA 4IHXA 1VNDA 4DZJA 1ZGWA 4EEFG 4UUSA 3SFIA 4A3BJ 2DMPA 4A3CJ 4MFDA 1HF0A 1ZQ3P 5M5YJ 2DTZA 3H0GJ 2GM4A 1K61A 2FX0A 2DG8A 3HOXJ 1JUPA 3CDLA 5HBUA 1U8BA 5BNGA 2LP0A 1JKQC 4B3AA 5D19A 4FTHA 5FJ8J 2V57A 2YVEA 3PO3J 2RHAA 2QOPA 2ELKA 3H3VK 1ENHA 2LKXA 5GPAA 3F1BA 1I6HJ 4B1RA 2OF7A 2I10A 3DPJA 2MW8A 1B72B 3SDGA 1U78A 2M0CA 2WAQN 1ETYA 3G1OA 2YS9A 1F43A 3S1NJ 2XDNA 2XPUA 4BY1J 1U9OA 1HCRA 3JRGA 1P7JA 4C3JJ 2NVYJ 2NVQJ 5JLWA 1JUSA 5C4JJ 1DU0A 3HM5A 2VPRA 3NPIA 2VI6A 2ECBA 5K58A 3HB9A 3HGYA 1XC5A 1TWCJ 4MXMA 1E3OC 2EH3A 2CU7A 2G7SA 1VF9A 1IDZA 4GCTA 3IH2A 1MSEC 3A02A 4CGRA 3ANPA 5K7HA 3MKLA 4AUXA 2H8RA 1BW5A 1BA5A 2X48A 2ME0A 3G1MA 5H9TA 3UKGA 1BL0A 4UUSB 2W53A 1UI6A 2KT0A 1QPIA 1OJLA 2X9DA 3TP0A 5IYBJ 2QWTA 3S1MJ 1FIAA 3KKCA 3GTJJ 3S16J 2G3BA 1RKTA 4JX6A 2JWTA 3BR5A 3A01A 1O4XA 4L5EA 5IYDJ 2LFBA 4D5CA 4GFBA 1P7IA 4J19A 5FKMA 3BRUA 4RBOA 2LY9A 1RKWA 2O7TA 1ETKA 2YVHA 1IRZA 2LLKA 4D7NA 4DW6A 2XGEA 1GDTA 1MBHA 2K9SA 3S17J 4X1EA 1IGNA 4MIMA 3VVYA 2M9HA 4JX4A 1ETWA 1A6IA 4LOCA 4M3EA 4XRSA 4D5FA 1JT6A 1H8AC 2HOTA 2Y2ZA 1MBEA 4JX5A 2HXIA 4Y7NJ 2Y9YA 2XRLA 5C3EJ 3QQAA 1PUFA 2NS7A 2XPVA 2PBXA 5F0CA 3NRGA 4FCYA 4DZPA 4BKXA 3JRFA 1R9TJ 4YZEA 2E19A 3RQIA 4MLOA 1W0TA 3GTPJ 1WH7A 1ORKA 1OFCX 3QPLA 1NK3P 3RZOJ 1IJWC 3HOUJ 3NNRA 1APLC 4L62A 1QVUA 1YRNA 4G12A 3ON2A 2OPTA 1AHDP 3HOYJ 1FEXA 2CQXA 3GTOJ 9ANTA 4M3GA 1ZKGA 5IOZA 2XB5A 1Z0XA 3JRHA 2Y9ZA 5DTDA 1MNMC 3CMYA 2TRTA 2H1KA 4XICA 2HDDA 3EUPA 2DA4A 2HKUA 4A3EJ 3T6NA 3MN2A 1HDDC 2QKOA 3PO2J 1UI5A 4ME9A 3WHBA 2QF7A 4Y52J 1WCMJ 1Z77A 3B81A 3A01B 2DA6A 3KZ9A 4MO7A 4JNNA 1MH3A 2ID3A 3G1LA 4A3FJ 2JA8J 2W48A 2E2IJ 4AF5A 2O8KA 3ANGA 3OSGA 2WUIA 3BG3A 2IU5A 2LR8A 2IAIA 2L0KA 3BTIA 4A69C 4MFEA 3GTLJ 2L7ZA 2WV1A 4NELA 3G56A 3VW2A 1H89C 1GUUA 2B63J 1ETXA 5JLXA 2QIBA 3VW1A 5K7FA 2AO9A 3BR0A 3JREA 3B6AA 2G7GA 3ON4A 2EZLA 1AKHA 4AYBN 3BTJA 5FKNA 5D18A 3ZQLA 3HGGA 2P81A 3ZQIA 3I4NJ 1PUFB 1NK2P 3NAUA 1JTXA 2HXOA 2Q24A 2ZCNA 5HAWA 3AQSA 4A3DJ 2DMNA 3ZQGA 1ZTRA 1VFCA 2COBA 5F1JA 5IOYA 2ID6A 1HOMA 2UXIA 2ZB9A 1LE8A 3VOKA 3ZQCA 5D1RA 3P9TA 3JRDA 3BG9A 1YRNB 2HOAA 3Q0WA 2X6OA 3GZIA 3GEUA 3HIMA 2R92J 2K9NA 1MBFA 1TWFJ 3CQZJ 1FTTA 4M6VA 1GV5A 1IV6A 3LJLA 1WGXA 2R5ZB 1UG2A 4B4CA 1JKPC 2VKEA 5J1UA 3CWRA 4C3IJ 5IP7J 4V2GA 5EG0A 3RKQA 2FD5A 2XPWA 5M5XJ 3LHQA 2DG7A 2WGBA 4GFKA 3E7QA 2TCTA 3CCYA 2UXUA 1T33A 5C4YA 1XS9A 3HTJA 3GTKJ 2DA7A 2EQRA 2KDZA 2K9QA 4M3FA 5J1YA 3HOZJ 3S15J 2G0EA 4UUTA 3LOCA 1H88C 2JMWA 5IP6A 1X58A 2LK2A 2UXHA 2ZOZA 3HE0A 1Y1VJ 1MBKA 2CRGA 3LSGA 2GENA 3FK7A 2LTPA 1K83J 3QBMA 4JL3A 3HTAA 3JSJA 4A3KJ 3LWJA 5AQCA 3O8HA 4DYRA 4M3BA 3HBLA 4QSHA 5GPCA 1S7EA 1TWAJ 3BTCA 5F27A 4NN1A 4BXXJ 3PM1A 1SFOJ 1AU7A 1AKHB 4A3IJ 3COLA 1UMQA 4XIDA 1EF4A 5EFYA 1WI3A 5FLMJ 2CJJA 3HTIA 5FGLA 3SJMA 1RESA 3NARA 5IP9J 1IC8A 1UHSA 1X2MA 2O7OA 4RDUA 1JGGA 3A03A 1SANA 5M3MJ 2Y31A 2RASA 4FE7A 1Q1VA 2LD5A 2EZHA 1ETQA 1FIPA 4C3HJ 2CUFA 3IUVA 2R0QC 2EBIA 3Q3SA 5E3MA 5CXIA 3RH2A 3TW7A 1LE8B 3S5RA 1B8IA 3HOWJ 4IHVA 4AC6A 2HYTA 3BCGA 3M4OJ 3TP3A 2PZ9A 4QIWN 3RD3A 5F08A 3S2DJ 4ACIA 2NP5A 1MBGA 3Q0VA 2R7ZJ 1W0UA 1X2NA 1ETOA 3F0CA 2XGCA 1I50J 5EF6A 3FK6A 3G7RA 2JA5J 3M3YJ 2ZOYA 4HKUA 1U9NA 1BJZA 3BG5A 1ZK8A 2UXPA 1MBJA 5C44J 3PPBA 4D7MA 1RR7A 3DEWA 1TC3C 3DCFA 5EG0B 3LNQA 5FKLA 1JKRC 4A3GJ 2EZKA 2Y0SN 5FKOA 3HDDA 2NVTJ 1POGA 5CXGA 4JKZA 2E2JJ 4A3LJ 3KNWA 2MSYA 1G2HA 2GUHA 4I76A 3JR9A 2DJNA 4BY7J 2ECCA 1WH5A 1Y1WJ 3I4MJ 4BBSJ 4MK6A 3VP5A 5FHPA 3IH4A 1A5JA 1OCTC 2DA2A 3VOXA 3VPRA 4GCLA 2CUEA 1IG7A 5E3LA 3L1PA 1RETA 3BQZA 3FIWA 5EDNA 3B6CA 2G7LA 2Y30A 1OCPA 4JP0A 2QCOA 3S1RJ 3CJDA 3BHQA 2JJ7A 5CW8A 1QRYA 2K40A 5FKKA 2XB0X 3BNIA 2JA6J 1T56A 4W97A 3LSPA 1RPWA 2R5YA 4A3JJ 2NVXJ 2VUMJ 1FTZA 3C07A 2NS8A 2WB1N 2OI8A 2HOSA 4ICHA 3S14J 3BQYA 3TW6A 4HNVA 4M3DA 4XK4A 1HDPA 2AHQA 4V2FA 2HQ5A 4BBRJ 3BR6A 1B8IB 3IH3A 5M3FJ 3BTLA 3GTQJ 2ZCXA 2DMTA 1LFBA 3LSJA 4ABZA 3OIOA 3S1QJ 5C4XJ 1ETVA 4I6ZA 4NDLA 2D5VA 2DA3A 4JYKA 3JRCA 3E7LA 1FJLA 1ITYA 4W1UA 2O9LA 2FQ4A 5EZHA 2RAEA 3BT9A 3OOUA 3LSRA 3VUQA 3MVPA 2XSDC 5HODA 2FBQA 4A93J 5EEAA 5GP9A 4IHWA 2QTQA 2DA1A 3V78A 2L7MP 4UDSA 4IHYA 3JRIA 2HI3A 3KKDA 5J1RA 4A3MJ 4DYCA 3ZQHA 2PMZN 3FRQA 1GV2A 3VW0A 4GCKA 2L7FP 2MGQA 1JTYA 1JJ8C 2DMQA 4AC0A 4CYCA 3K7AJ 3GTGJ 1IDYA 2M8GX 5IPAA 2JA7J 2MG4A 2VKVA 3QPSA 3HKZN 2GBYA 5EZGA 5EGOA 3OSFA 1JUMA 2NX4A 2EZIA 2DMUA 3MNLA 3FISA 4XRSG 3WHCA 1ZR4A 5DAJA 2E1OA 3GTMJ 3VVXA 1MH4A 1LFUP 3TEDA 2HYJA 1DU6A 2NOGA 1JKOC 3K2AA 2NP3A 4GFLA 5J3LA 2GFNA 2CQQA 2D6YA 4KWAA 3BR3A 3V6GA 1GVDA 4S0HB 1HLVA 2JK3A 3PASA 2R5YB 4XRMA 2UXOA 5F0HA 5FMPA 2M2EA 4IEJA 5FLVA 3AQTA 3IV5A 3FKIJ 1IUFA 1D5YA 4PXIA 3BR2A 1WPKA 2YU9J 2YUSA
chains in the Genus database with same CATH superfamily
3W6VA 4XKVA 4CUGA 3WTYC 5AONA 3F6VA 3KYDB 4JK1X 1D0ZA 2XAFA 3ZOBA 1QHHD 2ZNYA 4G9YA 4DIQA 3OYJA 3OYLA 4PGGA 3CC2I 2JN6A 3RTRA 4HNTA 1I3QJ 2ME6A 2DFHA 3K0LA 4XLPF 5E3NA 1NTCA 3RZDJ 4A0YA 3HTHA 1CQTA 3KLNA 1F1ZA 3P9KA 3HOVJ 3C2BA 2ISYA 3CRJA 4ETSA 2M34A 1SFXA 4IJAA 5LHIA 3MKZA 3K70C 4I0AA 1ZYRF 1ZARA 2P6SA 5GAEJ 2H27A 3KYLA 3OYCA 1FOKA 2IS4A 5CQGA 1YTYA 3WTVC 2FBHA 2PN6A 1X1BA 2GAUA 1SGMA 1IRXA 5JVTA 2L9RA 1MKMA 3O8GA 3SHFA 3P5JA 1W36C 1BW6A 3DKYA 1RIOH 2VE9A 2REKA 2X6YA 4EEFG 1D8KA 4RM2A 1FP1D 1FY7A 4PJNA 1I6XA 1Z3YA 1LEBA 3H0GJ 3ZMZA 2I8DA 3QU3A 4IX7A 3IRQA 1LDJA 2GM4A 2PQ8A 4ZYGA 3I64A 2FQ3A 2VT2A 4I99C 4DOZA 3K4BA 3HOXJ 3OS0A 2EFOA 5HBUA 4BJ5C 3OYIA 3GEZA 1JKQC 1JXSA 1O7FA 2V57A 4EJUA 3LQQA 1B9NA 3K1PA 1OR7A 3KP5A 1MDMB 2HYFA 2DW4A 3EUKL 2LKXA 1VQOI 1I6HJ 4B1RA 4CCJA 3DPJA 2MW8A 1YQAA 4BHPA 3RKWA 1HW5A 1ZREA 4OIOF 1W4MA 3A2KA 1ETYA 2YS9A 2RQQA 1BIAA 4BEHB 2XDNA 3J80K 2XPUA 5JHFA 2ZKZA 1FT9A 2NVQJ 1JUSA 2X1CA 3I59A 5C4JJ 1ZG5A 1DU0A 2ECBA 1IN5A 1X1AA 5J8FA 3K4KA 3CCQI 3OR1C 3DKXA 2DDAA 2K5CA 4PDKA 3C2GA 1V5GA 4OU0A 3CMAI 1PVEA 3R4KA 3CCSI 4KT6A 1XC5A 2BY0A 4LMYA 3VYTB 5LEJA 2VQLA 3V7RA 2LY2A 3ONQA 4BQNA 1IDZA 3KP4A 1GXPA 4GCTA 1SEUA 3FM5A 2CWEA 3ANPA 1BR2A 1SMYF 1XMAA 4AUXA 2BY3A 1YIOA 3FXUA 1MZBA 4ZDPA 4UUSB 1G4DA 1WRJA 3BG6A 2D1VA 4AIKA 2QWTA 2VASA 3DU6A 3KKCA 3GTJJ 3OYMA 2JWTA 3ZMUA 1A36A 2ZJRF 1LDKB 4XR6A 3KYCB 3LL7A 2WB1A 1U0JA 4J19A 2L9SA 3BRUA 5TGTA 3GWZA 3KFWX 2RREA 2P4WA 1YS7A 1ETKA 3HOTA 1Z6RA 1GDTA 4BU2A 1T0FC 3C18A 2VOPA 4HOBA 3VVYA 3CDHA 5B1AH 1U3EM 1ETWA 1A6IA 1OKRA 4LOCA 1HSJA 2W25A 3K9TA 3BDDA 4M72A 4D5FA 4S05A 1JT6A 4N9HA 3VYUB 3E6CC 1OCCH 2CYYA 2HNHA 1RZ4A 2HXIA 4YIRX 2O8XA 4A6EA 3CD6I 1DPUA 3G71I 3ZMTA 2VONA 3QQAA 1PUFA 3DEUA 4AD9A 4WF2A 3CJTB 4MQ9F 4DZPA 2ZJQF 2M30A 2A6TA 1R71A 3MAJA 2D1HA 2GIZA 3ZMVA 3SYTA 3N4MA 4YZEA 4JOMA 3LA2A 4P5OA 4L9JA 3GTPJ 3GZNB 3RQ4A 1OFCX 3RZOJ 1NK3P 3NQOA 1KQ0A 2ZC2A 3PQKA 4G12A 3MKWB 2OPTA 2FMYA 2MABA 3OYAA 2DK5A 1MD0A 1VQLI 3GZ5A 4LG0B 1ZKGA 1EV7A 3LA7A 2OQRA 5HS7A 4CSWA 2AQFA 4DVYP 3F22A 1Y0NA 5DTDA 3EUPA 3SZTA 1N77A 4ESFA 3T6NA 2KJBA 2FE3A 4KIGA 1OCRH 3RPUD 5A2QK 2K7LA 2FUG2 4IRIA 2DA6A 4A2UA 3KZ9A 1GXQA 2IPQX 4FX0A 3TL4X 5KHDA 3OS2A 4II2A 1VQKI 1LQ1A 1FSHA 1XGOA 2E5NA 3CMEI 4PZJA 2WUIA 4U88A 2E36A 4RGRA 3NWTA 2L0KA 3BTIA 4A69C 4MFEA 3G2BA 1A04A 2UUZA 3G56A 3D5LA 2B63J 4U7DA 1TNSA 4UVCA 3I3LA 3DTKA 5JLXA 5K7FA 2AO9A 3B73A 3JREA 3B6AA 5D5UB 3ON4A 2V9KA 4AYBN 2GOMA 3BTJA 2Q1ZB 2CFXA 1YLFA 2RNGA 1IXSB 4UVAA 5DV5A 3ZQIA 3V8KA 3WE3A 3MWMA 3L09A 4KYWA 1ON1A 2HXOA 2EK5A 3KCCA 3NAUA 2Q24A 5HAWA 4HLYA 3AQSA 5ED4A 1U5TA 1Z67A 1ZTRA 1XSXA 2COBA 1KU3A 1USTA 3M1CA 3V42A 5IT3A 2R7UA 4KICA 3FKJA 2VOOA 1HOMA 2UXIA 2VLAA 2BY2A 4XL9A 2K27A 4GYIA 4AVZA 3PSIA 2PMUA 1YRNB 2HOAA 3Q0WA 2OZ6A 2KP6A 3GEUA 3HIMA 5J4YA 3MZHA 4ON0A 2H8WA 4YG2F 4Y17A 5HDNA 1V5FA 1OYIA 4XMYA 2ZMEC 1FTTA 2A5YB 3HYIA 1BM9A 2WADA 2KISA 2JPBA 5IP7J 4RS8A 4V2GA 1S9HA 3LHQA 2FD5A 5M5XJ 2WGBA 5C4YA 3E7QA 4G6QA 4BDYA 3RI4A 2UXUA 2MD5A 2GOXB 1IN4A 2E71A 1L3LA 2DA7A 1IRFA 2G7UA 5LGTA 1AOYA 1Z1DA 1BI2A 3HOZJ 4P9FA 4XM3A 3E0JB 3LOCA 3CUOA 4OIQF 2IS1A 1WJEA 3HE0A 3AFHA 1O57A 1QO0D 5D4RA 3HTAA 3WODF 3K4NA 2AS5F 2E7WA 1UJ8A 1TWAJ 5F27A 4NN1A 1YW7A 2JQ7A 4L9VA 4IF4A 4DQ2A 1V54H 3FXJA 1W7PA 5EFYA 1WI3A 2YR2A 3HTIA 1RESA 1Y56A 2GZWA 4UVBA 4RDUA 4M6YA 1QZZA 4OINF 3A03A 1HXDA 2Y31A 4OD4A 2RASA 1KZHA 1P6RA 2ESNA 3QPTA 3VTIA 3IUVA 2CUFA 3QAHA 1MDMA 2BE5F 3TW7A 3QU6A 2R7RA 1U2WA 4HF0A 4IHVA 3FMQA 2FNPA 4L18B 3TP3A 4QIWN 3RD3A 2W57A 4XSZF 3TO9A 2EV0A 3KP2A 4ANJA 1VQ4I 2R7ZJ 1IUYA 1C0WA 3KX2A 2HEOA 2AXTC 5EF6A 2F4MB 4RLFA 3CCLI 3OYBA 3T8RA 2DPDA 3AL0C 1U9NA 1BJZA 2CQ7A 4D9JA 4HKUA 4G7ZF 2LBFA 5GADJ 1TQPA 3U9GA 2UXPA 1MBJA 3A0BC 2YX4A 5CVUA 5ICCA 5EG0B 4I0BA 2XHKA 5FKLA 1JKRC 1ZHFA 2EZKA 1HQCA 5CXGA 2NVTJ 1POGA 3KEQA 3LQRA 3RYPA 2E2JJ 2BEOA 4C30A 4A3LJ 1LVAA 2LKPA 3KNWA 2MSYA 3DBLB 3WTSC 5DYMA 2JVHA 4BACA 2QLZA 1WH5A 1Y1WJ 3VP5A 2VB6A 2DA2A 3VPRA 4GCLA 2BW3B 1BJAA 3R0AA 2ZMEB 4XKCA 5ILVA 2VQCA 1Z21A 3NS4A 2OD5A 3B6CA 1BI3A 4PJ0C 4XLAA 1K78B 4LB5A 4JP0A 3CJDA 2ZXHA 4ZYHA 3QOEA 4P1WA 4KIBA 5FKKA 2NRAC 3BNIA 1T56A 3R60A 2DOEA 1I27A 4A3JJ 2BBYA 1DUXC 2NYXA 4LFUA 2V6EA 2OI8A 1OYWA 3WTWC 3BQYA 4IO9F 1FX7A 3BR6A 1B8IB 3MKYB 5BMZA 2VE8A 3BPVA 1LFBA 2DXIA 3OMYA 2A05A 2CUZA 4KN4X 1Z05A 4LJZF 4NDLA 4ZTFA 2ACJA 4JYKA 3E7LA 5J40A 2Z1DA 4UUVA 3DTIA 5DM7F 2RAEA 3OOUA 2F5EA 3ZN0A 5HOOA 3WGHA 1XB4A 1DPRA 3FXMA 1ZLJA 2QQBA 3WGGA 2FBQA 5EEAA 1J75A 2DA1A 3V78A 3FHNA 3V4GA 3DP7A 5FD5A 2Y0SA 5J1RA 3A1YA 4A3MJ 3S93A 1TW2A 2PMZN 3GUDA 3UR3C 3FRQA 1GV2A 2HKOA 3O6BB 3VW0A 2L7FP 2GQQA 4MNUA 1JTYA 2VKDA 5HLIA 3W6JB 2L4MA 3BP8A 4U87A 2OC6A 5IPAA 3LSHA 5KCMA 2JA7J 2B9SA 1BN5A 1FMWA 2EIJH 3WTXC 3AG1H 4LG0A 1XMKA 3IUOA 3FXKA 1VQ5I 2LOOA 4QLCU 1Z7LA 3VFZA 2DMUA 3MNLA 1ZR4A 3WHCA 2OQGA 2VIXA 5GTHC 3AL0B 2RN7A 4NQWB 3TEDA 4OMZA 3F8CA 2ZY9A 4GDFA 3GF2A 2OCEA 2XUBA 5J3LA 4Q47A 2FU4A 3CJRB 2GFNA 1XPXA 4A5NA 2H09A 1XDUA 4CDGA 1JE8A 3DPTA 4S0HB 1RC9A 4N9IA 3DLLF 2UXOA 1FSEA 3K10A 5F0HA 4IRVA 3K69A 2M2EA 4IEJA 3AQTA 4XN0A 2VT3A 1R5HA 3BZCA 3H36A 1AHDP 4LLGF 2LYCA 2YU9J 1SFKA 3DU5A 1VQ6I 4IPAA 2A68F 1ZN2A 3IKTA 4Q4ZF 4AU7A 4HYEA 4ITVA 5JHUA 3EGQA 4X6AJ 3C1DA 3HRTA 4RMNA 3U1KA 4CZZA 1N25A 1B72A 3I9V2 3QKXA 3V8LA 5CPRB 5F0FA 2A6EF 4LIVA 1LJ9A 5F04A 5TISC 3S2WA 4F3QA 3C2HA 3L2RA 4Q48A 2YX7A 2DA5A 5IYCJ 1JT0A 5IT9Z 5K7ZA 3AG4H 3O60A 2OERA 2K9MA 2PG4A 5DS9A 3D1NI 2ZCMA 2HPMA 2XGDA 2QA4I 2IEKA 2GA2A 3Q0UA 3S32A 3L2UA 2RQPA 4KFCA 2FJ1A 3JRBA 3DBRB 4FETA 1SAXA 3H9QA 3BJBA 4DYQA 3I71A 1Z3XA 1OPCA 1WHUA 1SC7A 4IOCF 1MSFC 5M5WJ 2STTA 4G8XA 4FISA 2BGCA 3VIBA 5EGOB 4ZYDA 1PP8F 2CH0A 2CGPA 1XG1A 3JTGA 5E1ZB 2XDVA 1X1DA 1J5YA 2DN0A 1O3QA 2W84A 1FLIA 4U0WA 2ZXJA 3IWZA 4A3CJ 4MFDA 1HF0A 1ZQ3P 2E34A 3ABUA 5M5YJ 2XIGA 1SAUA 4PSXA 2MD0A 2KFDA 2VBWA 1VQNI 2R7QA 5GAGJ 3I0TA 2BV6A 2E1CA 3CDLA 3WU1B 2HTSA 1B4AA 1U8BA 3E5UA 2LP0A 5D19A 4FTHA 3OYDA 1JHHA 1FMVA 1WFXA 3VODA 2QOPA 2ELKA 3J7ZI 2KZVA 1ENHA 1QA6A 5GPAA 1IN7A 2QZ8A 2OF7A 1Y6IA 3VDXA 3PL8A 1I39A 5KVRA 3KE2A 1MW7A 2F4IA 2WAQN 3EUAA 1S5LC 3S1NJ 4BHCA 1OYYA 4EM2A 4BY1J 2DAOA 4WXCA 1P7JA 3JRGA 1K4SA 2NVYJ 5JLWA 2VPRA 1CGPA 4WK8F 3HOSA 3LFKA 2LRDA 2I5UA 3DLAA 4AIJA 4KN7X 1MJAA 1ZRCA 3HGYA 2BYVE 2V4JC 4MXMA 5ILSA 2IP2A 3BCAA 3VEPA 3SXYA 1H9TA 4DGWB 1J2XA 1A35A 4MEYF 1MSEC 2YPRA 4UNOA 2A2FX 4BUPA 4LG3A 3H35A 3OIPA 1YO5C 1ON2A 2F5FA 1BA5A 2X48A 4LLLA 1UELB 3L00A 3QPHA 3L7WA 1YFHA 1YJ9I 1BL0A 2LSOA 5AIQA 4IHSA 3RPUA 1T8IA 1QU3A 1DGWY 2Q2EB 5BS6A 2V9VA 1SD4A 4N0BA 3ZQ7A 5GAHJ 5LRSA 2G3BA 2LY1A 1RKTA 4JX6A 2DFEA 3FHZA 2VBXA 3BR5A 3A01A 4I7HA 2R7FA 4L5EA 1BR4A 5IYDJ 4DNCA 2RV8A 1BI1A 1JGSA 2KJCA 2LY9A 4BQQA 3CO6C 2COMA 1RKWA 2R7XA 4BE2A 3SFZA 1ZGJA 3K70D 2YVHA 2X85A 2LLKA 4D7NA 2WA0A 1FBSA 4LB6B 1YW9A 3DBHB 2QGUA 3ISPA 4KMUX 2K9SA 4F92B 2M9HA 4M3EA 3TDZC 3RSNA 1W36D 3CUQA 1I1SA 1EH7A 3EUHA 2Y2ZA 1MBEA 1K78A 3IL2A 2W24A 4BDZA 1XD7A 4DJAA 5DCMB 3CLQA 3V7SA 2Y9YA 3R6SA 5C3EJ 2V1UA 5D6EA 2W82A 2XPVA 2PBXA 5F0CA 4D0PA 4FCYA 4BKXA 2CG4A 2K02A 1GVJA 2DYRH 3BCBA 4MLOA 1W0TA 4U7BA 4EM0B 1ORKA 3HOUJ 4OIPF 1QVUA 3FBIB 4P96A 1TL8A 2NOJB 1FP2A 3HUGB 2CQXA 4KT5C 1FEXA 9ANTA 3WU0A 4YELA 3JCUC 3ZMSA 3NRVA 1KU2A 2XB5A 3CC4I 1K79A 3FM3A 3JRHA 2Y9ZA 1D1AA 2DCEA 3CMYA 2HDDA 2DA4A 1T95A 3K4MA 3SZPA 2GXAA 4HSRA 3ZN1A 1HDDC 2QKOA 2W7NA 5CVVA 3BG7A 2WBMA 1WCMJ 2LF8A 4MO7A 1XGMA 1TZLA 2JA8J 1IXRC 1LUJB 2W48A 3GFMA 1KYZA 3I55I 3OSGA 1G59A 3KEOA 4OAYA 2F2EA 1I3AA 2D2WA 2LR8A 2IAIA 3T1BA 4B3XA 5JVGF 2WV1A 2L7ZA 4EJOA 2CW8A 1U6GA 1YOVB 1H89C 1H0MA 4ASNA 3VW1A 3K8PC 2IA0A 3BR0A 2FXAA 4HSTA 3WTUC 2EZLA 1IW7F 4YIIA 1YI2I 4BHBA 4ZH4F 4UV9A 3VWBA 3HGGA 2P81A 5ICFA 4E70A 4RB1A 1M1EB 3I4NJ 2ZCNA 3OL4A 3CCJI 1DP3A 2VJ5A 1G3WA 1MNDA 2DMNA 3FBNB 1VFCA 3QYEA 5KAIC 5IOYA 5ICGA 4MEXF 2IJLA 1D3YA 3TGNA 3GYHX 2ZB9A 3VOKA 3OL3A 1J09A 5D1RA 2PBIA 4UB6C 4H4KC 3PNTA 1YHQI 3WE2A 4YFKF 2X6OA 1K7AA 1IN6A 3D0SA 4HPQA 3RYRA 1VQMI 2K9NA 1IXCA 1RI7A 4B47A 5DUKA 4E6KG 1MBFA 1ZRDA 3K6GA 1P92A 1TWFJ 3CQZJ 3RDIA 3J81Z 4M6VA 1R1VA 1RUNA 3LJLA 1JKPC 3LWFA 5ILUA 2HWVA 1XSDA 2LKSA 3R0JA 1D8JA 3NWSA 2FRHA 2DG7A 1Y8QB 2TCTA 1UFMA 1WJDA 4XLHA 1XS9A 1YS6A 3KETA 3RJPA 3PIOF 2G7HA 4XNFA 4OMYA 2PJPA 2KQRA 3CCEI 4EGYA 3BWGA 3FMRA 4M3FA 2ETHA 5J1YA 2G0EA 1SVMA 2PLYA 3M9AA 2STWA 4O6JA 1H88C 1X58A 4HAMA 2UXHA 4RAFA 3GVAA 1Y1VJ 4HV5A 3GZ6A 4I98B 5H2FC 3CO7C 2Y69H 3O8HA 3BC8A 4M3BA 1R5GA 4AYBA 2F5CA 3HBLA 4M9ZA 4XN3A 4QSHA 5FO5A 5E20A 1S7EA 2EB7A 5HS9A 2DJIA 2K85A 3TBIA 5JR3A 1TP4A 1PJRA 4RAZA 4NHJA 1QNTA 3PM1A 1AU7A 2GIVA 1AKHB 1VQ8I 2VXZA 3CLOA 3HHGA 3COLA 2NNYA 2KKOA 3SJMA 1MJ9A 3NARA 4BAYA 1IC8A 2CV1A 1UHSA 1X2MA 2HVSA 3S8PA 2RDPA 2L5QA 4FE7A 4BYYA 2LD5A 2EZHA 4R8HA 4XLFA 2CV0A 3RCOA 5CXIA 3ZXSA 3RH2A 2OTJI 1WSUA 1LE8B 4CXFA 1SVLA 3HOWJ 3S5RA 2DT6A 3QYFA 4AC6A 2GA1A 3R61A 2XAQA 2XC7A 5FD6A 5L3FA 2PZ9A 1X1CA 1FOYA 3S2DJ 4M9SA 3HG9A 2XROA 2NP5A 1TLHB 4CCLA 4E7JA 3KZZA 3DEEA 3MZ8A 1I50J 3FK6A 2HS5A 2VL8A 3G7RA 2JA5J 2O0YA 3BG5A 2KLOA 1ZK8A 3HPGA 4BL0B 2PX9A 3REOA 3QRFF 2M5WA 1RR7A 3DEWA 5IT9K 2HZDA 1OCZH 3LNQA 1NG6A 2DTRA 4A3GJ 3LFUA 5H20A 2VJJA 3HDDA 1FPQA 4M73A 4OAZA 1JI8A 3HHHA 4JKZA 2L3DA 4EVIA 2WY7Q 4I2OA 2JRTA 4I76A 3JR9A 3V7CA 2DJNA 3B02A 2ECCA 4MTDA 2VXDA 3I4MJ 4MK6A 3F3XA 3IH4A 1A5JA 2K3FA 3I53A 3HSEA 1XSVA 4KDPA 4M71A 2Q2EA 5DUIA 2E5ZA 1R7JA 3FIWA 1J9IA 3KP3A 2DPUA 2L02A 1S29A 4WXHA 1Y0UA 5HNFA 3BHQA 1QRYA 5F1RA 2K40A 4QPQA 2QSFX 1O7LA 5LFAA 1RPWA 1CF7B 2NVXJ 2QSHX 2NS8A 3PIPF 1Y39A 2QWWA 1STZA 2FF4A 2WB1N 3CCVI 3OYGA 1R23A 2O6GE 2WY8Q 1W5CC 3H5RA 4HNVA 4M3DA 1HDPA 2HQ5A 3D5RC 5KAFC 1SD6A 5AIPA 3BTLA 1N78A 2ZCXA 4ENKA 3VB2A 4ABZA 2KRCA 3OIOA 5C4XJ 4I6ZA 2MYSA 1P4AA 1UHWA 1HW1A 2UWMA 2O9LA 1R36A 2FQ4A 3BT9A 3EQLF 2KIMA 3L2CA 5HODA 2ELHA 4IXAA 4A93J 5L3GA 4IHWA 2QTQA 5CKTA 2ZXWH 1QBJA 2HI3A 3KKDA 3E5QA 2F5VA 4CHUA 5E18F 5LD2C 1ZG3A 2UXXA 2Z3YA 3HZJA 5K5RA 1W5SA 2DFIA 3SQNA 4AC0A 3E3VA 2BHYA 2M8GX 1G3TA 4RB3C 3NEUA 3W2VA 3HKZN 3IKVA 2CW0F 2GBYA 4F55A 3TDUC 2E7XA 2GWRA 4XRSG 2R7SA 5DAJA 2E1OA 2X1DA 2KRHA 2L9NA 4J01A 3GMEA 4HZFA 4N4NB 3GTMJ 3VVXA 2EJRA 2LH9A 2LF7A 3GW2A 4YFXF 3OYFA 2HYJA 3ESWB 3JSOA 2NOGA 3KPHA 4PJLA 4QPOA 3BJAA 3HSRA 4B43A 3K2AA 1LPQA 1FC3A 1X3ZB 2CQQA 2JUGA 4AVPA 4CZCA 3I56I 4KWAA 2IS2A 2LC2A 3BR3A 2Y75A 1HLVA 2H6CA 4PFPA 2MC4A 3PASA 2R5YB 4XRMA 5FMPA 3TKYA 2V26A 2ZFWA 2GXGA 1D5YA 4PXIA 3BR2A 5DD8A 4ENNA 1WPKA 2R92J 1X3UA 1HKTA 2VODA 3MD2A 2VJ4A 3BLYA 4II3A 1PUEE 2W85A 5H6QA 4BJTA 3KEYA 3JRAA 3NXCA 2IS6A 4LD5A 5EJCA 5D5XB 4GXOA 4BEHA 2D45A 1ZLKA 3HEFA 1P2FA 5EYRA 1MNEA 1R58A 3QP5A 2M4KA 3F6OA 1O3RA 4NB5A 4A0XA 2LVSA 1K6OA 3ZQFA 2C6YA 1IZ1A 3GFIA 5J6XA 4CICA 2JUCA 2XF7A 3BR1A 2Z2SB 1HW2A 4KISA 3TOBA 3FDYA 2R93J 1DQUA 2P5LC 3PFYA 1G8XA 4Y33A 2EINH 4RAGA 3W6KB 2DI3A 1MMGA 1OISA 4OIRF 1D5VA 4XLEA 1TWHJ 2QBYB 1TQMA 4FE4A 4CYCB 4GGGA 5HSZA 1V5EA 1FZPB 5DCFA 3NI7A 2V79A 1GT0C 2DQRA 3IAM2 3DWLE 1REPC 2JTVA 4BH9A 1OR7C 3JSPA 2HVRA 4ZDOA 2DDBA 1VI0A 2IBDA 1YYVA 3GLXA 5FROA 1QVTA 3FXOA 1ZR2A 3VVZA 4M74A 1V4RA 1XGNA 4IHXA 1VNDA 4BS9A 3I58A 5CQEA 2QVOA 2O03A 4UUSA 1R6RA 3SFIA 2XRNA 4A3BJ 2KDOA 4FT8A 2EFQA 2DTZA 4FQGA 2CQNA 2HQRA 1XN7A 3CJQB 1K61A 1VTNC 3G3ZA 2R7DA 2V6CA 3E5XA 1X1PA 4HLXA 4NC8A 4B09A 1O3SA 2VBYA 3ERED 1G3SA 1WJ5A 5FJ8J 2YVEA 3H3VK 2GXBA 2KL4A 3F1BA 1X4PA 5FGMA 2HOEA 2OA4A 3PSFA 4YEJA 1YW8A 3DV8A 3SDGA 2M0CA 1U78A 3E6BA 3G1OA 1HSTA 1F43A 1A31A 3HSFA 1OMIA 1FYKA 2K4JA 1I5ZA 1Y8RB 3NPIA 4WIBA 2EILH 4L9TA 2R7TA 3PUBA 1UCRA 2VJIA 2W1OA 5HVQC 5K58A 2XV4S 3HB9A 4IKFA 4E7SA 2EH3A 3J7YJ 1JHFA 2CU7A 5J47A 2G7SA 1YIJI 1Z6TA 1R49A 1K6YA 1F9NA 3DPUA 3SDBA 1KU7A 4CGRA 2DO7A 5K7HA 4RAYA 3MKLA 2CW7A 2P7VB 5H9TA 1P4WA 3G1MA 3AAFA 2P0WA 4UXNA 2DOAA 1BC8C 3CC7I 4EJWA 2MFZA 3LSKA 3DTEA 1UI6A 1DGRM 1QPIA 2X9DA 5IYBJ 1B59A 1USSA 3J81K 1B1BA 3S1MJ 4HNUA 3G73A 1YJWI 2HGCA 3S16J 4KIFA 5FLXZ 1T98A 2L9VA 4GRIA 1O4XA 2IW5A 5H6RA 3HRSA 4D5CA 1P7IA 4GFBA 5FKMA 3C3WA 5LHGA 2F5DA 4XORA 2EPFA 2O7TA 3BROA 2LG4A 4EATA 4ENMA 4DW6A 2XGEA 3FXQA 3FZVA 4G7HF 3JAMZ 2Q8KA 2CSOA 3S17J 4X1EA 1IGNA 4MIMA 1BOBA 2QKMB 3F8FA 2DU9A 4JX4A 4XRSA 3SZGA 2DYSH 4HV6A 4JBAA 4IVNA 4JX5A 1WJAA 3H0DA 2ZJPF 2X4HA 1TW3A 2ZSHB 3K4LA 1YG2A 3BJ6A 4CCKA 2XKPA 2XRLA 4AIHA 4I09A 1MMDA 5DDGA 2M0MA 4LK0F 1R9TJ 1G3YA 2Z16A 3F9KA 1WH7A 2HQNA 3JW4A 1T0FA 1APLC 1RRJA 3OWTA 1YRNA 1WVRA 1HC8A 4DBQA 3H9JA 1V55H 3GX4X 3HOYJ 5D8KB 1TT5B 3AG2H 3GTOJ 3M7GA 3OV8A 4FX4A 2DFFA 1Z0XA 4CYDA 1E3HA 4CCNA 1XTAA 5HS8A 1QQIA 2X0LA 2TRTA 1S3JA 4KUMA 4MGRA 1MNMC 4XICA 2HKUA 4A3EJ 3GCMA 1ULYA 5B5EC 1SFEA 3PNVA 4UY8I 3PO2J 4PCQA 4M9XA 1FYMA 3SEQA 3B81A 2DOFA 2KIUA 3F8MA 1MH3A 1U5TC 2ID3A 3LSIA 5K5QA 3G1LA 4A3FJ 1YITI 4AF5A 1SD5A 2E2IJ 2X6WA 1TT0A 3D5SC 2PI0A 3BG3A 2IU5A 3KIOA 5FRMA 3OYNA 4XLNF 1G6NA 3KZIC 4F91B 2CFOA 4HDVA 1BI0A 4PFOA 1GUUA 3FWEA 3ZRGA 2CV2A 3PNYA 3AG3H 3C7JA 3M07A 4UV8A 2OTLI 4HEA2 1D0YA 2G7GA 4CA0A 4DBRA 2A69F 2ZFUA 5FFZA 3FF5A 4NUBA 3OIQA 3L2WA 4V19K 2VQHA 3DF8A 1LEAA 3DFGA 2R7OA 5B1BH 4XRFA 1PUFB 1K4TA 1XDSA 1WWXA 3HIFA 4NBQA 2MH2A 5ERIA 3ZQGA 5HLTA 4HX7A 3MFKA 3F8NA 2ID6A 1QZYA 2KZGA 1WKMA 3ZQCA 1IN8A 2L4AA 3JRDA 2WC2A 3BG9A 3CCRI 1GLNA 3CESA 3ULQB 1FBUA 4KMFA 3OR2C 2VKHA 4C2MA 1S7OA 4PK4A 2LNBA 1X19A 2ZJ2A 3IC7A 4ZZLA 3KZYA 1UZCA 1XCBA 2OZUA 3T8TA 2Z33A 1GV5A 4L0YB 1WGXA 5E8GA 2R5ZB 1UG2A 2OUMA 3ABKH 3CWRA 1YX5A 4RM3A 4C3IJ 5EG0A 4LITA 3U2RA 4GFKA 2EFPA 2FEZA 2MA3A 2PJRB 3HTJA 1KQ9A 3RKYA 3GTKJ 2EQRA 2KDZA 2DODA 3UNGC 2CQKA 2O61A 3LA3A 1UHMA 3U21A 3S15J 5L3DA 3ZR8X 4ZZDA 2JMWA 4Y13A 5IP6A 5K1YA 3VYRB 1D1BA 2CRGA 3LSGA 2GENA 3FK7A 1K83J 4JL3A 3JSJA 4A3KJ 3KP6A 1YX3A 2BW3A 4DYRA 2EA2A 2ZMEA 2QEXI 4G6DA 3CP2A 5GPCA 2XASA 2XKOA 2MLGA 4BXXJ 1N75A 1SFOJ 5J4VA 2HQAA 5K5OA 1UMQA 5CVRA 4XOTA 4PJJA 1W1WE 2CJJA 4RB2C 2PMHA 2HR3A 3TOAA 5HDKA 5IP9J 2A61A 3EDPA 4K2EA 1FYLA 1KA8A 4IQJA 1QGPA 1U5TB 3JTHA 2VQGA 4EV0A 4U0VA 2QSGX 3MQ0A 5LHHA 4G7OF 1FIPA 2E35A 3Q3SA 5E3MA 3HJEA 4B44A 4Q5SF 4MTEA 1B8IA 3BCGA 3LAJA 3QOPA 4LLNA 5F08A 4ACIA 4ZYAA 1E2XA 2L7KA 1X2NA 1BIBA 1ETOA 5KNLA 4HQMA 2XGCA 4OWRB 5BOXA 4H0EA 2YVXA 1VQ7I 4I01A 3ROUA 2KRFA 2EV6A 1EH8A 4IL6C 4D1QA 4NNJA 1HBXG 1P9QC 3HRUA 2IRFG 4D7MA 4YFNF 4KNYA 2ZNZA 2K3PA 2TDXA 5FFXA 4GYGA 4OOIA 5FKOA 4O5VA 2M87A 3X2QH 3M1EA 2VC1A 4WXDA 3O3KA 3ZGKA 1IRGA 3L2VA 1S6LA 3ECOA 5J8CA 4FHTA 2HKXA 4L5IA 2FBIA 1G2HA 2QM3A 2GUHA 1ZGAA 3CF2A 4BY7J 5FRNA 2NXNB 4E7HA 4BBSJ 5GTIC 5FHPA 2XAJA 1OCTC 2RKHA 1S8NA 3PFIA 1OCOH 2FOKA 1E0EA 2CUEA 4NQWA 3WGIA 2MC3A 4EJVA 3CZ6A 3CDIA 5LEKA 2P7CB 2XAGA 2BZTA 4HW0A 1W7PB 3S1RJ 2QCOA 4R1HA 3CP8A 4ESBA 4HF1A 2X51A 3M8EA 3GFJA 3HTUA 3T5XA 4F7ZA 2JA6J 1F4KA 2Y48A 4W97A 1RNLA 2Z5UA 1R1UA 3OY9A 3LSPA 2RC4A 2VUMJ 5KK1A 2Y0MA 1EA3A 2AHQA 4V2FA 4BBRJ 5M3FJ 3GTQJ 4LGWA 3S1QJ 1ETVA 4XSXF 2DA3A 3TQNA 3JRCA 1FJLA 1ITYA 1BBYA 1J0RA 4W1UA 2BXYA 5EZHA 4HDUA 2EIKH 3VUQA 2W4SA 3LMMA 4IHTA 5GP9A 1B9MA 2J5PA 2LBFB 3WG9A 4AM3A 2L7MP 5ICEA 1ACIA 4UDSA 4HRIA 3TMOA 3ZQHA 2XVCA 2FA5A 3H9GA 2NNNA 4A12A 5D5WB 1X4OA 4GCKA 4HX8A 4F93B 1JJ8C 2DMQA 2JRMA 4BGDA 1Z91A 2MG4A 2VKVA 5E1WA 2A3SA 2M4GA 3H92A 4PJMA 5EGOA 1JUMA 4E7LA 3ERMA 1Z9CA 3HRMA 2BVMA 5CVJA 2IVMA 2PEXA 3OYKA 4E7ZA 1LKXA 1Q1HA 4JQFA 1MMNA 1DDNA 2H1LA 4O3MA 3HPHA 2LDUA 1NG7A 1WI9A 3RIRA 2MLKA 2RNJA 1JKOC 3IP4B 2OBPA 1FOWA 4GFLA 1RUOA 3RKXA 2D6YA 4AIDA 3VOEA 3V6GA 1Z7UA 2JK3A 5FLXK 1IV8A 3FMSA 5L3EA 3L9FA 4GCVA 3EPZA 3IV5A 2V1DA 3IRRA 3EYIA 1AWCA 2IT0A 1OLTA 4QTRA 1TWGJ 3F8BA 4Z6YA 4P55A 3QWLA 3ELKA 3S2HJ 3CTAA 3JAMK 4WCGA 1WJCA 2R4GA 2L54A 5LGNA 5E1XA 2DK8A 2IXSA 5L3CA 5BPIA 2A6HF 3BY6A 5DD4A 4C2MJ 4QWQA 1JJ6C 2AQEA 3TO6A 2UXNA 4HQEA 2N8GA 5EEGA 3HKZA 4E7KA 3MEXA 2E2HJ 1S72I 2M7AA 3OOPA 1KONA 2P5KA 2GLOA 1SD7A 1T38A 2HFHA 2XGXA 1F36A 2EV5A 1EKEA 5E3OA 5LGUA 2F07A 5LBQA 3E97A 3GBGA 1ZH5A 2OAZA 2R5ZA 2JA2A 4BJ6C 4DZJA 1P4XA 1ZGWA 5EEHA 3H3ZA 2DMPA 1TTYA 1WJFA 3Q9SA 3OYHA 3ABLH 4J00A 2PJRA 3ZQQA 3IHUA 2CS3A 3BPXA 4F52A 1MJBA 2V7FA 2JT1A 3VSKA 5JI6A 2M3AA 2FX0A 1PYVA 3F72A 1JUPA 2DG8A 4HF2A 3ZP5A 2VPLA 5BNGA 4OD5A 3V8JA 4B3AA 4I02A 2E60A 2Z99A 5E8IA 4HG2A 3PO3J 1WQ2A 2RHAA 4RGXA 4XBFA 4XONA 3WTZA 3OYEA 3Q5FA 2QQ8A 3P9CA 2I10A 1AA7A 1B72B 2FSWA 4HX4A 3OS1A 3N05A 2CMPA 3W3CA 5L3BA 6PAXA 4A5MA 2B3WA 1HKQA 5DCMA 1U9OA 1HCRA 4C3JJ 3ZPLA 4RA2A 2P5VA 3HM5A 3MMYB 2VI6A 3BZ6A 1IAWA 2V9PA 2B1EA 2M8EA 4C9YA 3U1DA 1ZELA 1MMAA 1SMTA 1TWCJ 2K4BA 1HKSA 1E3OC 3W2WA 3PQJA 1VF9A 3H3UA 5HNHA 5HLHA 5FB2A 1FBQA 3IH2A 3QODA 4MHGA 3HUGA 4XKBA 5D5VB 3A02A 4LIUA 4RLQA 2JSCA 2OCCH 2BVLA 2H8RA 1MMSA 3PJRA 1BW5A 2ME0A 4CO8A 2H6BA 2ZBKA 3UKGA 4E7IA 2QENA 3WG7H 1DP7P 4G94A 1I1GA 2DT7B 2FMLA 5F6FA 4YIFA 3HL2A 1D0XA 2W53A 3CUQC 2KT0A 3EUHC 1OJLA 3TP0A 3FX3A 3EETA 2PFBA 1FIAA 1R1TA 2XAHA 4ZC3A 2PFVA 2AXLA 4Y15A 2MBFA 4LK1F 4A6DA 3ABTA 1MGTA 2NVUB 3WU2C 3CCMI 2FJI1 2LFBA 5JFRA 2XF6A 3RPQA 4RBOA 2IGKA 1T08B 2EFNA 2HDCA 3GFLA 4ZYEA 1IRZA 4L9NA 2ZSIB 3GO5A 1VQ9I 1LDDA 1MBHA 1BC7C 3KLOA 2CUJA 3BJOA 5D4SA 3P7NA 1H8AC 1QZEA 4GO1A 2HOTA 4NC7A 4RGSA 3H5AA 3CF5F 4Y7NJ 4PSWA 3K4CA 4CGZA 2HVQA 1GHCA 1YE9A 3CMMA 2NS7A 2X1EA 1S7AA 3NRGA 4M6XA 3K1MA 2PMZA 3I5UA 4Z2YA 3JRFA 2JPCA 1XCVA 2E19A 3RQIA 4EQQA 4IRGA 3QPLA 4KITB 1IJWC 3NNRA 4EGZA 2K86A 2KMUA 2FBKA 4L62A 1FWZA 4A0ZA 1XGSA 3ON2A 3AKZA 4G6TB 1R4NB 5BQTA 4M3GA 2ZO4A 3K4JA 5IOZA 3M8JA 1J7KA 1ERDA 2E1MC 3S3OA 4EJTA 2H1KA 2RVCA 2O3FA 2M1BA 2X6XA 3MN2A 2K9LA 2QUFA 3F21A 2Z9OA 1UI5A 5DM6F 1WZ2A 3WHBA 4ME9A 2OU2A 2QF7A 2ADUA 3E1SA 4Y52J 4RGUA 4X0GA 3CJNA 1Z77A 3A01B 2W00A 3ASNH 2UV1A 4JNNA 3EYYA 2JVGA 2O8KA 2L2OA 2H94A 2NAZA 2O5RA 3ANGA 3TO7A 1D1CA 1R4MB 3SWHA 4IQ4A 3GTLJ 3ECHA 2P6TA 2F6CA 4NELA 3VW2A 1LVKA 1KU9A 2J5OA 2QQAA 2KHMA 1ETXA 4IZZA 2QIBA 1PP7U 3J80Z 3N97A 3BOQA 3CUQB 4CCOA 1AKHA 4ZJZA 2JZYA 4R79A 2R3SA 3E6MA 4L5JA 5CLSA 5FKNA 5D18A 2M45A 3ZQLA 1TNTA 2KIQA 3QP6A 3K1NA 4BE1A 1JTXA 5CYVA 1NK2P 4A3DJ 3ZMDA 2E1NA 5F1JA 3DQVC 1XX5A 3O2PE 3CCUI 5CVIA 1LE8A 4EMSA 3DKWA 1T39A 3P9TA 1LFPA 2LMDA 2R7WA 3G4SI 3GZIA 2KIFA 2XAUA 2XF5A 3S3MA 1LNWA 3GXOA 3MCZA 2WV0A 4BQOA 1IV6A 4B4CA 2VKEA 5J1UA 3RKQA 2XPWA 2BXZA 4RB0A 3CCYA 1T33A 1J59A 2IGNA 2VC0A 1O3TA 2K9QA 4CCMA 2NS0A 4Y4RA 4UUTA 4ZDLA 2MH9A 3LSTA 2LK2A 5TJJA 2ZOZA 1E3PA 1MBKA 2LTPA 2OJED 1IO2A 3PUFA 2EFWA 3QBMA 3S3NA 1X3WB 3H5NA 1NHAA 3FXRA 5D6FA 3LWJA 2IA2A 5AQCA 2E1MB 1W5TA 3K2ZA 2WAQA 3BTCA 2CO5A 2L01A 2ESHA 1KYWA 3LSMA 4ZTJA 2Q0OA 3G6EI 5HDGA 4B48A 2ISZA 4A3IJ 4N4OB 4XIDA 2UZKA 4BNCA 1EF4A 5FLMJ 5FGLA 3F23A 1V3FA 3LAPA 2KPMA 2O7OA 4BXUA 5D8LB 2HZTA 3I59B 1JGGA 1CF7A 1SANA 5M3MJ 1ZAOA 4ENJA 1Q1VA 2VN2A 1ETQA 4C3HJ 3QYBA 2R0QC 2EBIA 3HTSB 3ML6A 1U8RA 1RR8C 2BOLA 1EJ9A 2OV7A 2JSPA 2YSRA 2HYTA 3M4OJ 2IGMA 1KGSA 2ELJA 2DBBA 4P9UA 3WTTC 3FXLA 1MBGA 2DLLA 3Q0VA 4IRHA 1W0UA 2EWNA 3W2AA 3F0CA 3M3YJ 1ZRFA 2ZOYA 3M8FA 1FOXA 4MQVA 1E17A 5C44J 5A2QZ 3PPBA 3Q9VA 4AWXB 1TC3C 1L0OC 3DCFA 3P9IA 2B7EA 1SFUA 3I4PA 2Y0SN 3VYSB 2P8TA 4XKWA 2RGVA 1FNNA 1UG0A 2IGOA 1VZ0A 4KA4A 1EH6A 4NC6A 2G9WA 1NH3A 3BZKA 1BOAA 4PUSA 3IAS2 1ZG1A 4FASD 1B6AA 4U0YA 3VOXA 2BY1A 3KP7A 3I54A 4XQFA 1ONVA 4HBLA 2A5WA 3ZCOA 1IG7A 2A07F 2QYOA 5LRRA 5E3LA 2QQ9A 1UAAA 3SEZA 3L1PA 1RETA 3BQZA 5EDNA 2G7LA 2FNAA 3IWFA 4Y3OA 4C2UA 2Y30A 1OCPA 3ASOH 2WAFA 2V1XA 2JJ7A 4L0ZB 5CW8A 1H9GA 1F5TA 1IF1A 2EA4A 1HA8A 1W7PD 2XB0X 2XSJC 2ZCWA 2HPIA 3HXLA 2ZXIA 3T0YA 1R00A 3GLLA 3L2QA 4IOAF 2R5YA 1FTZA 3C07A 1R5ID 3A0HC 4BE0A 1YJNI 2ICWG 1OQYA 2WTEA 2HOSA 4C2TA 3J7AO 3S14J 2QKLB 4ICHA 3TW6A 4XK4A 3IH3A 2DQLA 1BR1A 2DMTA 1QHGA 3LSJA 3DPLC 2D5VA 3E6DA 2IA1A 2BHZA 2M7BA 4XLCA 3LSRA 3MVPA 2HDWA 1R22A 2HTJA 4U9LA 2XSDC 4U9NA 1A6QA 4IHYA 3JRIA 4YRVA 4UB8C 5CJ9A 4DYCA 4XOPA 4WWCA 5B66C 4E4HA 5E17F 2LREA 5IY5H 3ABMH 2MGQA 4S04A 2HYGD 1T6SA 1UB9A 2QBYA 5DEQA 3K7AJ 4KJZA 5B3SH 1IDYA 4CYCA 4HA8A 3GTGJ 2F4OB 2VBZA 1VQPI 2HU9A 3QPSA 5BPDA 1QPMA 1LB2A 5EZGA 3OSFA 2NX4A 5HLGA 2EZIA 3H1CA 3J7AY 5LLQA 1WJBA 1PDNC 3FISA 2R7VA 1XMXA 4ESJA 3COAC 4EM1A 1MH4A 1ODDA 2F48A 1LFUP 4PGHA 1DU6A 2EIMH 1T2KA 2NP3A 5F64A 4BQAA 2V1NA 4CH7A 2WAEA 4BXFA 5E79C 4B8XA 2YU3A 3VSLA 1GVDA 2FOWA 3HC7A 4TV7A 5TRDA 2WWYA 3MZYA 3A4CA 2B0LA 1KQ8A 4WX9A 3DXJF 1TQIA 2DT5A 5FLVA 1TBXA 3FKIJ 1IUFA 1SVOA 1MIJA 4UHTA 2YUSA
chains in the Genus database with same CATH topology
3W6VA 4QTRA 1TWGJ 3EGQA 4X6AJ 3ZOBA 1B72A 3JRAA 3NXCA 3S2HJ 3QKXA 5F0FA 5F04A 2JN6A 3HEFA 5EYRA 2DA5A 1I3QJ 5IYCJ 2ME6A 1JT0A 5K7ZA 5E3NA 2LVSA 1NTCA 3ZQFA 3O60A 2OERA 3RZDJ 4C2MJ 5DS9A 3HTHA 3D1NI 1CQTA 3BR1A 1JJ6C 2ZCMA 2XGDA 2IEKA 2R93J 3Q0UA 3HOVJ 3C2BA 3CRJA 2N8GA 2FJ1A 2M34A 3JRBA 1TWHJ 3BJBA 4FE4A 4DYQA 4CYCB 5HSZA 2E2HJ 1MSFC 5M5WJ 3VIBA 4FISA 3NI7A 2GLOA 5EGOB 1GT0C 1SGMA 1F36A 2F07A 2L9RA 5E3OA 1XG1A 3O8GA 1VI0A 3GBGA 2IBDA 1BW6A 2DN0A 3VVZA 1QVTA 1ZR2A 2R5ZA 2REKA 4IHXA 1VNDA 4DZJA 1ZGWA 4EEFG 4UUSA 3SFIA 4A3BJ 2DMPA 4A3CJ 4MFDA 1HF0A 1ZQ3P 5M5YJ 2DTZA 3H0GJ 2GM4A 1K61A 2FX0A 2DG8A 3HOXJ 1JUPA 3CDLA 5HBUA 1U8BA 5BNGA 2LP0A 1JKQC 4B3AA 5D19A 4FTHA 5FJ8J 2V57A 2YVEA 3PO3J 2RHAA 2QOPA 2ELKA 3H3VK 1ENHA 2LKXA 5GPAA 3F1BA 1I6HJ 4B1RA 2OF7A 2I10A 3DPJA 2MW8A 1B72B 3SDGA 1U78A 2M0CA 2WAQN 1ETYA 3G1OA 2YS9A 1F43A 3S1NJ 2XDNA 2XPUA 4BY1J 1U9OA 1HCRA 3JRGA 1P7JA 4C3JJ 2NVYJ 2NVQJ 5JLWA 1JUSA 5C4JJ 1DU0A 3HM5A 2VPRA 3NPIA 2VI6A 2ECBA 5K58A 3HB9A 3HGYA 1XC5A 1TWCJ 4MXMA 1E3OC 2EH3A 2CU7A 2G7SA 1VF9A 1IDZA 4GCTA 3IH2A 1MSEC 3A02A 4CGRA 3ANPA 5K7HA 3MKLA 4AUXA 2H8RA 1BW5A 1BA5A 2X48A 2ME0A 3G1MA 5H9TA 3UKGA 1BL0A 4UUSB 2W53A 1UI6A 2KT0A 1QPIA 1OJLA 2X9DA 3TP0A 5IYBJ 2QWTA 3S1MJ 1FIAA 3KKCA 3GTJJ 3S16J 2G3BA 1RKTA 4JX6A 2JWTA 3BR5A 3A01A 1O4XA 4L5EA 5IYDJ 2LFBA 4D5CA 4GFBA 1P7IA 4J19A 5FKMA 3BRUA 4RBOA 2LY9A 1RKWA 2O7TA 1ETKA 2YVHA 1IRZA 2LLKA 4D7NA 4DW6A 2XGEA 1GDTA 1MBHA 2K9SA 3S17J 4X1EA 1IGNA 4MIMA 3VVYA 2M9HA 4JX4A 1ETWA 1A6IA 4LOCA 4M3EA 4XRSA 4D5FA 1JT6A 1H8AC 2HOTA 2Y2ZA 1MBEA 4JX5A 2HXIA 4Y7NJ 2Y9YA 2XRLA 5C3EJ 3QQAA 1PUFA 2NS7A 2XPVA 2PBXA 5F0CA 3NRGA 4FCYA 4DZPA 4BKXA 3JRFA 1R9TJ 4YZEA 2E19A 3RQIA 4MLOA 1W0TA 3GTPJ 1WH7A 1ORKA 1OFCX 3QPLA 1NK3P 3RZOJ 1IJWC 3HOUJ 3NNRA 1APLC 4L62A 1QVUA 1YRNA 4G12A 3ON2A 2OPTA 1AHDP 3HOYJ 1FEXA 2CQXA 3GTOJ 9ANTA 4M3GA 1ZKGA 5IOZA 2XB5A 1Z0XA 3JRHA 2Y9ZA 5DTDA 1MNMC 3CMYA 2TRTA 2H1KA 4XICA 2HDDA 3EUPA 2DA4A 2HKUA 4A3EJ 3T6NA 3MN2A 1HDDC 2QKOA 3PO2J 1UI5A 4ME9A 3WHBA 2QF7A 4Y52J 1WCMJ 1Z77A 3B81A 3A01B 2DA6A 3KZ9A 4MO7A 4JNNA 1MH3A 2ID3A 3G1LA 4A3FJ 2JA8J 2W48A 2E2IJ 4AF5A 2O8KA 3ANGA 3OSGA 2WUIA 3BG3A 2IU5A 2LR8A 2IAIA 2L0KA 3BTIA 4A69C 4MFEA 3GTLJ 2L7ZA 2WV1A 4NELA 3G56A 3VW2A 1H89C 1GUUA 2B63J 1ETXA 5JLXA 2QIBA 3VW1A 5K7FA 2AO9A 3BR0A 3JREA 3B6AA 2G7GA 3ON4A 2EZLA 1AKHA 4AYBN 3BTJA 5FKNA 5D18A 3ZQLA 3HGGA 2P81A 3ZQIA 3I4NJ 1PUFB 1NK2P 3NAUA 1JTXA 2HXOA 2Q24A 2ZCNA 5HAWA 3AQSA 4A3DJ 2DMNA 3ZQGA 1ZTRA 1VFCA 2COBA 5F1JA 5IOYA 2ID6A 1HOMA 2UXIA 2ZB9A 1LE8A 3VOKA 3ZQCA 5D1RA 3P9TA 3JRDA 3BG9A 1YRNB 2HOAA 3Q0WA 2X6OA 3GZIA 3GEUA 3HIMA 2R92J 2K9NA 1MBFA 1TWFJ 3CQZJ 1FTTA 4M6VA 1GV5A 1IV6A 3LJLA 1WGXA 2R5ZB 1UG2A 4B4CA 1JKPC 2VKEA 5J1UA 3CWRA 4C3IJ 5IP7J 4V2GA 5EG0A 3RKQA 2FD5A 2XPWA 5M5XJ 3LHQA 2DG7A 2WGBA 4GFKA 3E7QA 2TCTA 3CCYA 2UXUA 1T33A 5C4YA 1XS9A 3HTJA 3GTKJ 2DA7A 2EQRA 2KDZA 2K9QA 4M3FA 5J1YA 3HOZJ 3S15J 2G0EA 4UUTA 3LOCA 1H88C 2JMWA 5IP6A 1X58A 2LK2A 2UXHA 2ZOZA 3HE0A 1Y1VJ 1MBKA 2CRGA 3LSGA 2GENA 3FK7A 2LTPA 1K83J 3QBMA 4JL3A 3HTAA 3JSJA 4A3KJ 3LWJA 5AQCA 3O8HA 4DYRA 4M3BA 3HBLA 4QSHA 5GPCA 1S7EA 1TWAJ 3BTCA 5F27A 4NN1A 4BXXJ 3PM1A 1SFOJ 1AU7A 1AKHB 4A3IJ 3COLA 1UMQA 4XIDA 1EF4A 5EFYA 1WI3A 5FLMJ 2CJJA 3HTIA 5FGLA 3SJMA 1RESA 3NARA 5IP9J 1IC8A 1UHSA 1X2MA 2O7OA 4RDUA 1JGGA 3A03A 1SANA 5M3MJ 2Y31A 2RASA 4FE7A 1Q1VA 2LD5A 2EZHA 1ETQA 1FIPA 4C3HJ 2CUFA 3IUVA 2R0QC 2EBIA 3Q3SA 5E3MA 5CXIA 3RH2A 3TW7A 1LE8B 3S5RA 1B8IA 3HOWJ 4IHVA 4AC6A 2HYTA 3BCGA 3M4OJ 3TP3A 2PZ9A 4QIWN 3RD3A 5F08A 3S2DJ 4ACIA 2NP5A 1MBGA 3Q0VA 2R7ZJ 1W0UA 1X2NA 1ETOA 3F0CA 2XGCA 1I50J 5EF6A 3FK6A 3G7RA 2JA5J 3M3YJ 2ZOYA 4HKUA 1U9NA 1BJZA 3BG5A 1ZK8A 2UXPA 1MBJA 5C44J 3PPBA 4D7MA 1RR7A 3DEWA 1TC3C 3DCFA 5EG0B 3LNQA 5FKLA 1JKRC 4A3GJ 2EZKA 2Y0SN 5FKOA 3HDDA 2NVTJ 1POGA 5CXGA 4JKZA 2E2JJ 4A3LJ 3KNWA 2MSYA 1G2HA 2GUHA 4I76A 3JR9A 2DJNA 4BY7J 2ECCA 1WH5A 1Y1WJ 3I4MJ 4BBSJ 4MK6A 3VP5A 5FHPA 3IH4A 1A5JA 1OCTC 2DA2A 3VOXA 3VPRA 4GCLA 2CUEA 1IG7A 5E3LA 3L1PA 1RETA 3BQZA 3FIWA 5EDNA 3B6CA 2G7LA 2Y30A 1OCPA 4JP0A 2QCOA 3S1RJ 3CJDA 3BHQA 2JJ7A 5CW8A 1QRYA 2K40A 5FKKA 2XB0X 3BNIA 2JA6J 1T56A 4W97A 3LSPA 1RPWA 2R5YA 4A3JJ 2NVXJ 2VUMJ 1FTZA 3C07A 2NS8A 2WB1N 2OI8A 2HOSA 4ICHA 3S14J 3BQYA 3TW6A 4HNVA 4M3DA 4XK4A 1HDPA 2AHQA 4V2FA 2HQ5A 4BBRJ 3BR6A 1B8IB 3IH3A 5M3FJ 3BTLA 3GTQJ 2ZCXA 2DMTA 1LFBA 3LSJA 4ABZA 3OIOA 3S1QJ 5C4XJ 1ETVA 4I6ZA 4NDLA 2D5VA 2DA3A 4JYKA 3JRCA 3E7LA 1FJLA 1ITYA 4W1UA 2O9LA 2FQ4A 5EZHA 2RAEA 3BT9A 3OOUA 3LSRA 3VUQA 3MVPA 2XSDC 5HODA 2FBQA 4A93J 5EEAA 5GP9A 4IHWA 2QTQA 2DA1A 3V78A 2L7MP 4UDSA 4IHYA 3JRIA 2HI3A 3KKDA 5J1RA 4A3MJ 4DYCA 3ZQHA 2PMZN 3FRQA 1GV2A 3VW0A 4GCKA 2L7FP 2MGQA 1JTYA 1JJ8C 2DMQA 4AC0A 4CYCA 3K7AJ 3GTGJ 1IDYA 2M8GX 5IPAA 2JA7J 2MG4A 2VKVA 3QPSA 3HKZN 2GBYA 5EZGA 5EGOA 3OSFA 1JUMA 2NX4A 2EZIA 2DMUA 3MNLA 3FISA 4XRSG 3WHCA 1ZR4A 5DAJA 2E1OA 3GTMJ 3VVXA 1MH4A 1LFUP 3TEDA 2HYJA 1DU6A 2NOGA 1JKOC 3K2AA 2NP3A 4GFLA 5J3LA 2GFNA 2CQQA 2D6YA 4KWAA 3BR3A 3V6GA 1GVDA 4S0HB 1HLVA 2JK3A 3PASA 2R5YB 4XRMA 2UXOA 5F0HA 5FMPA 2M2EA 4IEJA 5FLVA 3AQTA 3IV5A 3FKIJ 1IUFA 1D5YA 4PXIA 3BR2A 1WPKA 2YU9J 2YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6V A;  4QTR A;  1TWG J;  3EGQ A;  4X6A J;  3ZOB A;  1B72 A;  3JRA A;  3NXC A;  3S2H J;  3QKX A;  5F0F A;  5F04 A;  2JN6 A;  3HEF A;  5EYR A;  2DA5 A;  1I3Q J;  5IYC J;  2ME6 A;  1JT0 A;  5K7Z A;  5E3N A;  2LVS A;  1NTC A;  3ZQF A;  3O60 A;  2OER A;  3RZD J;  4C2M J;  5DS9 A;  3HTH A;  3D1N I;  1CQT A;  3BR1 A;  1JJ6 C;  2ZCM A;  2XGD A;  2IEK A;  2R93 J;  3Q0U A;  3HOV J;  3C2B A;  3CRJ A;  2N8G A;  2FJ1 A;  2M34 A;  3JRB A;  1TWH J;  3BJB A;  4FE4 A;  4DYQ A;  4CYC B;  5HSZ A;  2E2H J;  1MSF C;  5M5W J;  3VIB A;  4FIS A;  3NI7 A;  2GLO A;  5EGO B;  1GT0 C;  1SGM A;  1F36 A;  2F07 A;  2L9R A;  5E3O A;  1XG1 A;  3O8G A;  1VI0 A;  3GBG A;  2IBD A;  1BW6 A;  2DN0 A;  3VVZ A;  1QVT A;  1ZR2 A;  2R5Z A;  2REK A;  4IHX A;  1VND A;  4DZJ A;  1ZGW A;  4EEF G;  4UUS A;  3SFI A;  4A3B J;  2DMP A;  4A3C J;  4MFD A;  1HF0 A;  1ZQ3 P;  5M5Y J;  2DTZ A;  3H0G J;  2GM4 A;  1K61 A;  2FX0 A;  2DG8 A;  3HOX J;  1JUP A;  3CDL A;  5HBU A;  1U8B A;  5BNG A;  2LP0 A;  1JKQ C;  4B3A A;  5D19 A;  4FTH A;  5FJ8 J;  2V57 A;  2YVE A;  3PO3 J;  2RHA A;  2QOP A;  2ELK A;  3H3V K;  1ENH A;  2LKX A;  5GPA A;  3F1B A;  1I6H J;  4B1R A;  2OF7 A;  2I10 A;  3DPJ A;  2MW8 A;  1B72 B;  3SDG A;  1U78 A;  2M0C A;  2WAQ N;  1ETY A;  3G1O A;  2YS9 A;  1F43 A;  3S1N J;  2XDN A;  2XPU A;  4BY1 J;  1U9O A;  1HCR A;  3JRG A;  1P7J A;  4C3J J;  2NVY J;  2NVQ J;  5JLW A;  1JUS A;  5C4J J;  1DU0 A;  3HM5 A;  2VPR A;  3NPI A;  2VI6 A;  2ECB A;  5K58 A;  3HB9 A;  3HGY A;  1XC5 A;  1TWC J;  4MXM A;  1E3O C;  2EH3 A;  2CU7 A;  2G7S A;  1VF9 A;  1IDZ A;  4GCT A;  3IH2 A;  1MSE C;  3A02 A;  4CGR A;  3ANP A;  5K7H A;  3MKL A;  4AUX A;  2H8R A;  1BW5 A;  1BA5 A;  2X48 A;  2ME0 A;  3G1M A;  5H9T A;  3UKG A;  1BL0 A;  4UUS B;  2W53 A;  1UI6 A;  2KT0 A;  1QPI A;  1OJL A;  2X9D A;  3TP0 A;  5IYB J;  2QWT A;  3S1M J;  1FIA A;  3KKC A;  3GTJ J;  3S16 J;  2G3B A;  1RKT A;  4JX6 A;  2JWT A;  3BR5 A;  3A01 A;  1O4X A;  4L5E A;  5IYD J;  2LFB A;  4D5C A;  4GFB A;  1P7I A;  4J19 A;  5FKM A;  3BRU A;  4RBO A;  2LY9 A;  1RKW A;  2O7T A;  1ETK A;  2YVH A;  1IRZ A;  2LLK A;  4D7N A;  4DW6 A;  2XGE A;  1GDT A;  1MBH A;  2K9S A;  3S17 J;  4X1E A;  1IGN A;  4MIM A;  3VVY A;  2M9H A;  4JX4 A;  1ETW A;  1A6I A;  4LOC A;  4M3E A;  4XRS A;  4D5F A;  1JT6 A;  1H8A C;  2HOT A;  2Y2Z A;  1MBE A;  4JX5 A;  2HXI A;  4Y7N J;  2Y9Y A;  2XRL A;  5C3E J;  3QQA A;  1PUF A;  2NS7 A;  2XPV A;  2PBX A;  5F0C A;  3NRG A;  4FCY A;  4DZP A;  4BKX A;  3JRF A;  1R9T J;  4YZE A;  2E19 A;  3RQI A;  4MLO A;  1W0T A;  3GTP J;  1WH7 A;  1ORK A;  1OFC X;  3QPL A;  1NK3 P;  3RZO J;  1IJW C;  3HOU J;  3NNR A;  1APL C;  4L62 A;  1QVU A;  1YRN A;  4G12 A;  3ON2 A;  2OPT A;  1AHD P;  3HOY J;  1FEX A;  2CQX A;  3GTO J;  9ANT A;  4M3G A;  1ZKG A;  5IOZ A;  2XB5 A;  1Z0X A;  3JRH A;  2Y9Z A;  5DTD A;  1MNM C;  3CMY A;  2TRT A;  2H1K A;  4XIC A;  2HDD A;  3EUP A;  2DA4 A;  2HKU A;  4A3E J;  3T6N A;  3MN2 A;  1HDD C;  2QKO A;  3PO2 J;  1UI5 A;  4ME9 A;  3WHB A;  2QF7 A;  4Y52 J;  1WCM J;  1Z77 A;  3B81 A;  3A01 B;  2DA6 A;  3KZ9 A;  4MO7 A;  4JNN A;  1MH3 A;  2ID3 A;  3G1L A;  4A3F J;  2JA8 J;  2W48 A;  2E2I J;  4AF5 A;  2O8K A;  3ANG A;  3OSG A;  2WUI A;  3BG3 A;  2IU5 A;  2LR8 A;  2IAI A;  2L0K A;  3BTI A;  4A69 C;  4MFE A;  3GTL J;  2L7Z A;  2WV1 A;  4NEL A;  3G56 A;  3VW2 A;  1H89 C;  1GUU A;  2B63 J;  1ETX A;  5JLX A;  2QIB A;  3VW1 A;  5K7F A;  2AO9 A;  3BR0 A;  3JRE A;  3B6A A;  2G7G A;  3ON4 A;  2EZL A;  1AKH A;  4AYB N;  3BTJ A;  5FKN A;  5D18 A;  3ZQL A;  3HGG A;  2P81 A;  3ZQI A;  3I4N J;  1PUF B;  1NK2 P;  3NAU A;  1JTX A;  2HXO A;  2Q24 A;  2ZCN A;  5HAW A;  3AQS A;  4A3D J;  2DMN A;  3ZQG A;  1ZTR A;  1VFC A;  2COB A;  5F1J A;  5IOY A;  2ID6 A;  1HOM A;  2UXI A;  2ZB9 A;  1LE8 A;  3VOK A;  3ZQC A;  5D1R A;  3P9T A;  3JRD A;  3BG9 A;  1YRN B;  2HOA A;  3Q0W A;  2X6O A;  3GZI A;  3GEU A;  3HIM A;  2R92 J;  2K9N A;  1MBF A;  1TWF J;  3CQZ J;  1FTT A;  4M6V A;  1GV5 A;  1IV6 A;  3LJL A;  1WGX A;  2R5Z B;  1UG2 A;  4B4C A;  1JKP C;  2VKE A;  5J1U A;  3CWR A;  4C3I J;  5IP7 J;  4V2G A;  5EG0 A;  3RKQ A;  2FD5 A;  2XPW A;  5M5X J;  3LHQ A;  2DG7 A;  2WGB A;  4GFK A;  3E7Q A;  2TCT A;  3CCY A;  2UXU A;  1T33 A;  5C4Y A;  1XS9 A;  3HTJ A;  3GTK J;  2DA7 A;  2EQR A;  2KDZ A;  2K9Q A;  4M3F A;  5J1Y A;  3HOZ J;  3S15 J;  2G0E A;  4UUT A;  3LOC A;  1H88 C;  2JMW A;  5IP6 A;  1X58 A;  2LK2 A;  2UXH A;  2ZOZ A;  3HE0 A;  1Y1V J;  1MBK A;  2CRG A;  3LSG A;  2GEN A;  3FK7 A;  2LTP A;  1K83 J;  3QBM A;  4JL3 A;  3HTA A;  3JSJ A;  4A3K J;  3LWJ A;  5AQC A;  3O8H A;  4DYR A;  4M3B A;  3HBL A;  4QSH A;  5GPC A;  1S7E A;  1TWA J;  3BTC A;  5F27 A;  4NN1 A;  4BXX J;  3PM1 A;  1SFO J;  1AU7 A;  1AKH B;  4A3I J;  3COL A;  1UMQ A;  4XID A;  1EF4 A;  5EFY A;  1WI3 A;  5FLM J;  2CJJ A;  3HTI A;  5FGL A;  3SJM A;  1RES A;  3NAR A;  5IP9 J;  1IC8 A;  1UHS A;  1X2M A;  2O7O A;  4RDU A;  1JGG A;  3A03 A;  1SAN A;  5M3M J;  2Y31 A;  2RAS A;  4FE7 A;  1Q1V A;  2LD5 A;  2EZH A;  1ETQ A;  1FIP A;  4C3H J;  2CUF A;  3IUV A;  2R0Q C;  2EBI A;  3Q3S A;  5E3M A;  5CXI A;  3RH2 A;  3TW7 A;  1LE8 B;  3S5R A;  1B8I A;  3HOW J;  4IHV A;  4AC6 A;  2HYT A;  3BCG A;  3M4O J;  3TP3 A;  2PZ9 A;  4QIW N;  3RD3 A;  5F08 A;  3S2D J;  4ACI A;  2NP5 A;  1MBG A;  3Q0V A;  2R7Z J;  1W0U A;  1X2N A;  1ETO A;  3F0C A;  2XGC A;  1I50 J;  5EF6 A;  3FK6 A;  3G7R A;  2JA5 J;  3M3Y J;  2ZOY A;  4HKU A;  1U9N A;  1BJZ A;  3BG5 A;  1ZK8 A;  2UXP A;  1MBJ A;  5C44 J;  3PPB A;  4D7M A;  1RR7 A;  3DEW A;  1TC3 C;  3DCF A;  5EG0 B;  3LNQ A;  5FKL A;  1JKR C;  4A3G J;  2EZK A;  2Y0S N;  5FKO A;  3HDD A;  2NVT J;  1POG A;  5CXG A;  4JKZ A;  2E2J J;  4A3L J;  3KNW A;  2MSY A;  1G2H A;  2GUH A;  4I76 A;  3JR9 A;  2DJN A;  4BY7 J;  2ECC A;  1WH5 A;  1Y1W J;  3I4M J;  4BBS J;  4MK6 A;  3VP5 A;  5FHP A;  3IH4 A;  1A5J A;  1OCT C;  2DA2 A;  3VOX A;  3VPR A;  4GCL A;  2CUE A;  1IG7 A;  5E3L A;  3L1P A;  1RET A;  3BQZ A;  3FIW A;  5EDN A;  3B6C A;  2G7L A;  2Y30 A;  1OCP A;  4JP0 A;  2QCO A;  3S1R J;  3CJD A;  3BHQ A;  2JJ7 A;  5CW8 A;  1QRY A;  2K40 A;  5FKK A;  2XB0 X;  3BNI A;  2JA6 J;  1T56 A;  4W97 A;  3LSP A;  1RPW A;  2R5Y A;  4A3J J;  2NVX J;  2VUM J;  1FTZ A;  3C07 A;  2NS8 A;  2WB1 N;  2OI8 A;  2HOS A;  4ICH A;  3S14 J;  3BQY A;  3TW6 A;  4HNV A;  4M3D A;  4XK4 A;  1HDP A;  2AHQ A;  4V2F A;  2HQ5 A;  4BBR J;  3BR6 A;  1B8I B;  3IH3 A;  5M3F J;  3BTL A;  3GTQ J;  2ZCX A;  2DMT A;  1LFB A;  3LSJ A;  4ABZ A;  3OIO A;  3S1Q J;  5C4X J;  1ETV A;  4I6Z A;  4NDL A;  2D5V A;  2DA3 A;  4JYK A;  3JRC A;  3E7L A;  1FJL A;  1ITY A;  4W1U A;  2O9L A;  2FQ4 A;  5EZH A;  2RAE A;  3BT9 A;  3OOU A;  3LSR A;  3VUQ A;  3MVP A;  2XSD C;  5HOD A;  2FBQ A;  4A93 J;  5EEA A;  5GP9 A;  4IHW A;  2QTQ A;  2DA1 A;  3V78 A;  2L7M P;  4UDS A;  4IHY A;  3JRI A;  2HI3 A;  3KKD A;  5J1R A;  4A3M J;  4DYC A;  3ZQH A;  2PMZ N;  3FRQ A;  1GV2 A;  3VW0 A;  4GCK A;  2L7F P;  2MGQ A;  1JTY A;  1JJ8 C;  2DMQ A;  4AC0 A;  4CYC A;  3K7A J;  3GTG J;  1IDY A;  2M8G X;  5IPA A;  2JA7 J;  2MG4 A;  2VKV A;  3QPS A;  3HKZ N;  2GBY A;  5EZG A;  5EGO A;  3OSF A;  1JUM A;  2NX4 A;  2EZI A;  2DMU A;  3MNL A;  3FIS A;  4XRS G;  3WHC A;  1ZR4 A;  5DAJ A;  2E1O A;  3GTM J;  3VVX A;  1MH4 A;  1LFU P;  3TED A;  2HYJ A;  1DU6 A;  2NOG A;  1JKO C;  3K2A A;  2NP3 A;  4GFL A;  5J3L A;  2GFN A;  2CQQ A;  2D6Y A;  4KWA A;  3BR3 A;  3V6G A;  1GVD A;  4S0H B;  1HLV A;  2JK3 A;  3PAS A;  2R5Y B;  4XRM A;  2UXO A;  5F0H A;  5FMP A;  2M2E A;  4IEJ A;  5FLV A;  3AQT A;  3IV5 A;  3FKI J;  1IUF A;  1D5Y A;  4PXI A;  3BR2 A;  1WPK A;  2YU9 J;  2YUS A; 
#chains in the Genus database with same CATH topology
 3W6V A;  4XKV A;  4CUG A;  3WTY C;  5AON A;  3F6V A;  3KYD B;  4JK1 X;  1D0Z A;  2XAF A;  3ZOB A;  1QHH D;  2ZNY A;  4G9Y A;  4DIQ A;  3OYJ A;  3OYL A;  4PGG A;  3CC2 I;  2JN6 A;  3RTR A;  4HNT A;  1I3Q J;  2ME6 A;  2DFH A;  3K0L A;  4XLP F;  5E3N A;  1NTC A;  3RZD J;  4A0Y A;  3HTH A;  1CQT A;  3KLN A;  1F1Z A;  3P9K A;  3HOV J;  3C2B A;  2ISY A;  3CRJ A;  4ETS A;  2M34 A;  1SFX A;  4IJA A;  5LHI A;  3MKZ A;  3K70 C;  4I0A A;  1ZYR F;  1ZAR A;  2P6S A;  5GAE J;  2H27 A;  3KYL A;  3OYC A;  1FOK A;  2IS4 A;  5CQG A;  1YTY A;  3WTV C;  2FBH A;  2PN6 A;  1X1B A;  2GAU A;  1SGM A;  1IRX A;  5JVT A;  2L9R A;  1MKM A;  3O8G A;  3SHF A;  3P5J A;  1W36 C;  1BW6 A;  3DKY A;  1RIO H;  2VE9 A;  2REK A;  2X6Y A;  4EEF G;  1D8K A;  4RM2 A;  1FP1 D;  1FY7 A;  4PJN A;  1I6X A;  1Z3Y A;  1LEB A;  3H0G J;  3ZMZ A;  2I8D A;  3QU3 A;  4IX7 A;  3IRQ A;  1LDJ A;  2GM4 A;  2PQ8 A;  4ZYG A;  3I64 A;  2FQ3 A;  2VT2 A;  4I99 C;  4DOZ A;  3K4B A;  3HOX J;  3OS0 A;  2EFO A;  5HBU A;  4BJ5 C;  3OYI A;  3GEZ A;  1JKQ C;  1JXS A;  1O7F A;  2V57 A;  4EJU A;  3LQQ A;  1B9N A;  3K1P A;  1OR7 A;  3KP5 A;  1MDM B;  2HYF A;  2DW4 A;  3EUK L;  2LKX A;  1VQO I;  1I6H J;  4B1R A;  4CCJ A;  3DPJ A;  2MW8 A;  1YQA A;  4BHP A;  3RKW A;  1HW5 A;  1ZRE A;  4OIO F;  1W4M A;  3A2K A;  1ETY A;  2YS9 A;  2RQQ A;  1BIA A;  4BEH B;  2XDN A;  3J80 K;  2XPU A;  5JHF A;  2ZKZ A;  1FT9 A;  2NVQ J;  1JUS A;  2X1C A;  3I59 A;  5C4J J;  1ZG5 A;  1DU0 A;  2ECB A;  1IN5 A;  1X1A A;  5J8F A;  3K4K A;  3CCQ I;  3OR1 C;  3DKX A;  2DDA A;  2K5C A;  4PDK A;  3C2G A;  1V5G A;  4OU0 A;  3CMA I;  1PVE A;  3R4K A;  3CCS I;  4KT6 A;  1XC5 A;  2BY0 A;  4LMY A;  3VYT B;  5LEJ A;  2VQL A;  3V7R A;  2LY2 A;  3ONQ A;  4BQN A;  1IDZ A;  3KP4 A;  1GXP A;  4GCT A;  1SEU A;  3FM5 A;  2CWE A;  3ANP A;  1BR2 A;  1SMY F;  1XMA A;  4AUX A;  2BY3 A;  1YIO A;  3FXU A;  1MZB A;  4ZDP A;  4UUS B;  1G4D A;  1WRJ A;  3BG6 A;  2D1V A;  4AIK A;  2QWT A;  2VAS A;  3DU6 A;  3KKC A;  3GTJ J;  3OYM A;  2JWT A;  3ZMU A;  1A36 A;  2ZJR F;  1LDK B;  4XR6 A;  3KYC B;  3LL7 A;  2WB1 A;  1U0J A;  4J19 A;  2L9S A;  3BRU A;  5TGT A;  3GWZ A;  3KFW X;  2RRE A;  2P4W A;  1YS7 A;  1ETK A;  3HOT A;  1Z6R A;  1GDT A;  4BU2 A;  1T0F C;  3C18 A;  2VOP A;  4HOB A;  3VVY A;  3CDH A;  5B1A H;  1U3E M;  1ETW A;  1A6I A;  1OKR A;  4LOC A;  1HSJ A;  2W25 A;  3K9T A;  3BDD A;  4M72 A;  4D5F A;  4S05 A;  1JT6 A;  4N9H A;  3VYU B;  3E6C C;  1OCC H;  2CYY A;  2HNH A;  1RZ4 A;  2HXI A;  4YIR X;  2O8X A;  4A6E A;  3CD6 I;  1DPU A;  3G71 I;  3ZMT A;  2VON A;  3QQA A;  1PUF A;  3DEU A;  4AD9 A;  4WF2 A;  3CJT B;  4MQ9 F;  4DZP A;  2ZJQ F;  2M30 A;  2A6T A;  1R71 A;  3MAJ A;  2D1H A;  2GIZ A;  3ZMV A;  3SYT A;  3N4M A;  4YZE A;  4JOM A;  3LA2 A;  4P5O A;  4L9J A;  3GTP J;  3GZN B;  3RQ4 A;  1OFC X;  3RZO J;  1NK3 P;  3NQO A;  1KQ0 A;  2ZC2 A;  3PQK A;  4G12 A;  3MKW B;  2OPT A;  2FMY A;  2MAB A;  3OYA A;  2DK5 A;  1MD0 A;  1VQL I;  3GZ5 A;  4LG0 B;  1ZKG A;  1EV7 A;  3LA7 A;  2OQR A;  5HS7 A;  4CSW A;  2AQF A;  4DVY P;  3F22 A;  1Y0N A;  5DTD A;  3EUP A;  3SZT A;  1N77 A;  4ESF A;  3T6N A;  2KJB A;  2FE3 A;  4KIG A;  1OCR H;  3RPU D;  5A2Q K;  2K7L A;  2FUG 2;  4IRI A;  2DA6 A;  4A2U A;  3KZ9 A;  1GXQ A;  2IPQ X;  4FX0 A;  3TL4 X;  5KHD A;  3OS2 A;  4II2 A;  1VQK I;  1LQ1 A;  1FSH A;  1XGO A;  2E5N A;  3CME I;  4PZJ A;  2WUI A;  4U88 A;  2E36 A;  4RGR A;  3NWT A;  2L0K A;  3BTI A;  4A69 C;  4MFE A;  3G2B A;  1A04 A;  2UUZ A;  3G56 A;  3D5L A;  2B63 J;  4U7D A;  1TNS A;  4UVC A;  3I3L A;  3DTK A;  5JLX A;  5K7F A;  2AO9 A;  3B73 A;  3JRE A;  3B6A A;  5D5U B;  3ON4 A;  2V9K A;  4AYB N;  2GOM A;  3BTJ A;  2Q1Z B;  2CFX A;  1YLF A;  2RNG A;  1IXS B;  4UVA A;  5DV5 A;  3ZQI A;  3V8K A;  3WE3 A;  3MWM A;  3L09 A;  4KYW A;  1ON1 A;  2HXO A;  2EK5 A;  3KCC A;  3NAU A;  2Q24 A;  5HAW A;  4HLY A;  3AQS A;  5ED4 A;  1U5T A;  1Z67 A;  1ZTR A;  1XSX A;  2COB A;  1KU3 A;  1UST A;  3M1C A;  3V42 A;  5IT3 A;  2R7U A;  4KIC A;  3FKJ A;  2VOO A;  1HOM A;  2UXI A;  2VLA A;  2BY2 A;  4XL9 A;  2K27 A;  4GYI A;  4AVZ A;  3PSI A;  2PMU A;  1YRN B;  2HOA A;  3Q0W A;  2OZ6 A;  2KP6 A;  3GEU A;  3HIM A;  5J4Y A;  3MZH A;  4ON0 A;  2H8W A;  4YG2 F;  4Y17 A;  5HDN A;  1V5F A;  1OYI A;  4XMY A;  2ZME C;  1FTT A;  2A5Y B;  3HYI A;  1BM9 A;  2WAD A;  2KIS A;  2JPB A;  5IP7 J;  4RS8 A;  4V2G A;  1S9H A;  3LHQ A;  2FD5 A;  5M5X J;  2WGB A;  5C4Y A;  3E7Q A;  4G6Q A;  4BDY A;  3RI4 A;  2UXU A;  2MD5 A;  2GOX B;  1IN4 A;  2E71 A;  1L3L A;  2DA7 A;  1IRF A;  2G7U A;  5LGT A;  1AOY A;  1Z1D A;  1BI2 A;  3HOZ J;  4P9F A;  4XM3 A;  3E0J B;  3LOC A;  3CUO A;  4OIQ F;  2IS1 A;  1WJE A;  3HE0 A;  3AFH A;  1O57 A;  1QO0 D;  5D4R A;  3HTA A;  3WOD F;  3K4N A;  2AS5 F;  2E7W A;  1UJ8 A;  1TWA J;  5F27 A;  4NN1 A;  1YW7 A;  2JQ7 A;  4L9V A;  4IF4 A;  4DQ2 A;  1V54 H;  3FXJ A;  1W7P A;  5EFY A;  1WI3 A;  2YR2 A;  3HTI A;  1RES A;  1Y56 A;  2GZW A;  4UVB A;  4RDU A;  4M6Y A;  1QZZ A;  4OIN F;  3A03 A;  1HXD A;  2Y31 A;  4OD4 A;  2RAS A;  1KZH A;  1P6R A;  2ESN A;  3QPT A;  3VTI A;  3IUV A;  2CUF A;  3QAH A;  1MDM A;  2BE5 F;  3TW7 A;  3QU6 A;  2R7R A;  1U2W A;  4HF0 A;  4IHV A;  3FMQ A;  2FNP A;  4L18 B;  3TP3 A;  4QIW N;  3RD3 A;  2W57 A;  4XSZ F;  3TO9 A;  2EV0 A;  3KP2 A;  4ANJ A;  1VQ4 I;  2R7Z J;  1IUY A;  1C0W A;  3KX2 A;  2HEO A;  2AXT C;  5EF6 A;  2F4M B;  4RLF A;  3CCL I;  3OYB A;  3T8R A;  2DPD A;  3AL0 C;  1U9N A;  1BJZ A;  2CQ7 A;  4D9J A;  4HKU A;  4G7Z F;  2LBF A;  5GAD J;  1TQP A;  3U9G A;  2UXP A;  1MBJ A;  3A0B C;  2YX4 A;  5CVU A;  5ICC A;  5EG0 B;  4I0B A;  2XHK A;  5FKL A;  1JKR C;  1ZHF A;  2EZK A;  1HQC A;  5CXG A;  2NVT J;  1POG A;  3KEQ A;  3LQR A;  3RYP A;  2E2J J;  2BEO A;  4C30 A;  4A3L J;  1LVA A;  2LKP A;  3KNW A;  2MSY A;  3DBL B;  3WTS C;  5DYM A;  2JVH A;  4BAC A;  2QLZ A;  1WH5 A;  1Y1W J;  3VP5 A;  2VB6 A;  2DA2 A;  3VPR A;  4GCL A;  2BW3 B;  1BJA A;  3R0A A;  2ZME B;  4XKC A;  5ILV A;  2VQC A;  1Z21 A;  3NS4 A;  2OD5 A;  3B6C A;  1BI3 A;  4PJ0 C;  4XLA A;  1K78 B;  4LB5 A;  4JP0 A;  3CJD A;  2ZXH A;  4ZYH A;  3QOE A;  4P1W A;  4KIB A;  5FKK A;  2NRA C;  3BNI A;  1T56 A;  3R60 A;  2DOE A;  1I27 A;  4A3J J;  2BBY A;  1DUX C;  2NYX A;  4LFU A;  2V6E A;  2OI8 A;  1OYW A;  3WTW C;  3BQY A;  4IO9 F;  1FX7 A;  3BR6 A;  1B8I B;  3MKY B;  5BMZ A;  2VE8 A;  3BPV A;  1LFB A;  2DXI A;  3OMY A;  2A05 A;  2CUZ A;  4KN4 X;  1Z05 A;  4LJZ F;  4NDL A;  4ZTF A;  2ACJ A;  4JYK A;  3E7L A;  5J40 A;  2Z1D A;  4UUV A;  3DTI A;  5DM7 F;  2RAE A;  3OOU A;  2F5E A;  3ZN0 A;  5HOO A;  3WGH A;  1XB4 A;  1DPR A;  3FXM A;  1ZLJ A;  2QQB A;  3WGG A;  2FBQ A;  5EEA A;  1J75 A;  2DA1 A;  3V78 A;  3FHN A;  3V4G A;  3DP7 A;  5FD5 A;  2Y0S A;  5J1R A;  3A1Y A;  4A3M J;  3S93 A;  1TW2 A;  2PMZ N;  3GUD A;  3UR3 C;  3FRQ A;  1GV2 A;  2HKO A;  3O6B B;  3VW0 A;  2L7F P;  2GQQ A;  4MNU A;  1JTY A;  2VKD A;  5HLI A;  3W6J B;  2L4M A;  3BP8 A;  4U87 A;  2OC6 A;  5IPA A;  3LSH A;  5KCM A;  2JA7 J;  2B9S A;  1BN5 A;  1FMW A;  2EIJ H;  3WTX C;  3AG1 H;  4LG0 A;  1XMK A;  3IUO A;  3FXK A;  1VQ5 I;  2LOO A;  4QLC U;  1Z7L A;  3VFZ A;  2DMU A;  3MNL A;  1ZR4 A;  3WHC A;  2OQG A;  2VIX A;  5GTH C;  3AL0 B;  2RN7 A;  4NQW B;  3TED A;  4OMZ A;  3F8C A;  2ZY9 A;  4GDF A;  3GF2 A;  2OCE A;  2XUB A;  5J3L A;  4Q47 A;  2FU4 A;  3CJR B;  2GFN A;  1XPX A;  4A5N A;  2H09 A;  1XDU A;  4CDG A;  1JE8 A;  3DPT A;  4S0H B;  1RC9 A;  4N9I A;  3DLL F;  2UXO A;  1FSE A;  3K10 A;  5F0H A;  4IRV A;  3K69 A;  2M2E A;  4IEJ A;  3AQT A;  4XN0 A;  2VT3 A;  1R5H A;  3BZC A;  3H36 A;  1AHD P;  4LLG F;  2LYC A;  2YU9 J;  1SFK A;  3DU5 A;  1VQ6 I;  4IPA A;  2A68 F;  1ZN2 A;  3IKT A;  4Q4Z F;  4AU7 A;  4HYE A;  4ITV A;  5JHU A;  3EGQ A;  4X6A J;  3C1D A;  3HRT A;  4RMN A;  3U1K A;  4CZZ A;  1N25 A;  1B72 A;  3I9V 2;  3QKX A;  3V8L A;  5CPR B;  5F0F A;  2A6E F;  4LIV A;  1LJ9 A;  5F04 A;  5TIS C;  3S2W A;  4F3Q A;  3C2H A;  3L2R A;  4Q48 A;  2YX7 A;  2DA5 A;  5IYC J;  1JT0 A;  5IT9 Z;  5K7Z A;  3AG4 H;  3O60 A;  2OER A;  2K9M A;  2PG4 A;  5DS9 A;  3D1N I;  2ZCM A;  2HPM A;  2XGD A;  2QA4 I;  2IEK A;  2GA2 A;  3Q0U A;  3S32 A;  3L2U A;  2RQP A;  4KFC A;  2FJ1 A;  3JRB A;  3DBR B;  4FET A;  1SAX A;  3H9Q A;  3BJB A;  4DYQ A;  3I71 A;  1Z3X A;  1OPC A;  1WHU A;  1SC7 A;  4IOC F;  1MSF C;  5M5W J;  2STT A;  4G8X A;  4FIS A;  2BGC A;  3VIB A;  5EGO B;  4ZYD A;  1PP8 F;  2CH0 A;  2CGP A;  1XG1 A;  3JTG A;  5E1Z B;  2XDV A;  1X1D A;  1J5Y A;  2DN0 A;  1O3Q A;  2W84 A;  1FLI A;  4U0W A;  2ZXJ A;  3IWZ A;  4A3C J;  4MFD A;  1HF0 A;  1ZQ3 P;  2E34 A;  3ABU A;  5M5Y J;  2XIG A;  1SAU A;  4PSX A;  2MD0 A;  2KFD A;  2VBW A;  1VQN I;  2R7Q A;  5GAG J;  3I0T A;  2BV6 A;  2E1C A;  3CDL A;  3WU1 B;  2HTS A;  1B4A A;  1U8B A;  3E5U A;  2LP0 A;  5D19 A;  4FTH A;  3OYD A;  1JHH A;  1FMV A;  1WFX A;  3VOD A;  2QOP A;  2ELK A;  3J7Z I;  2KZV A;  1ENH A;  1QA6 A;  5GPA A;  1IN7 A;  2QZ8 A;  2OF7 A;  1Y6I A;  3VDX A;  3PL8 A;  1I39 A;  5KVR A;  3KE2 A;  1MW7 A;  2F4I A;  2WAQ N;  3EUA A;  1S5L C;  3S1N J;  4BHC A;  1OYY A;  4EM2 A;  4BY1 J;  2DAO A;  4WXC A;  1P7J A;  3JRG A;  1K4S A;  2NVY J;  5JLW A;  2VPR A;  1CGP A;  4WK8 F;  3HOS A;  3LFK A;  2LRD A;  2I5U A;  3DLA A;  4AIJ A;  4KN7 X;  1MJA A;  1ZRC A;  3HGY A;  2BYV E;  2V4J C;  4MXM A;  5ILS A;  2IP2 A;  3BCA A;  3VEP A;  3SXY A;  1H9T A;  4DGW B;  1J2X A;  1A35 A;  4MEY F;  1MSE C;  2YPR A;  4UNO A;  2A2F X;  4BUP A;  4LG3 A;  3H35 A;  3OIP A;  1YO5 C;  1ON2 A;  2F5F A;  1BA5 A;  2X48 A;  4LLL A;  1UEL B;  3L00 A;  3QPH A;  3L7W A;  1YFH A;  1YJ9 I;  1BL0 A;  2LSO A;  5AIQ A;  4IHS A;  3RPU A;  1T8I A;  1QU3 A;  1DGW Y;  2Q2E B;  5BS6 A;  2V9V A;  1SD4 A;  4N0B A;  3ZQ7 A;  5GAH J;  5LRS A;  2G3B A;  2LY1 A;  1RKT A;  4JX6 A;  2DFE A;  3FHZ A;  2VBX A;  3BR5 A;  3A01 A;  4I7H A;  2R7F A;  4L5E A;  1BR4 A;  5IYD J;  4DNC A;  2RV8 A;  1BI1 A;  1JGS A;  2KJC A;  2LY9 A;  4BQQ A;  3CO6 C;  2COM A;  1RKW A;  2R7X A;  4BE2 A;  3SFZ A;  1ZGJ A;  3K70 D;  2YVH A;  2X85 A;  2LLK A;  4D7N A;  2WA0 A;  1FBS A;  4LB6 B;  1YW9 A;  3DBH B;  2QGU A;  3ISP A;  4KMU X;  2K9S A;  4F92 B;  2M9H A;  4M3E A;  3TDZ C;  3RSN A;  1W36 D;  3CUQ A;  1I1S A;  1EH7 A;  3EUH A;  2Y2Z A;  1MBE A;  1K78 A;  3IL2 A;  2W24 A;  4BDZ A;  1XD7 A;  4DJA A;  5DCM B;  3CLQ A;  3V7S A;  2Y9Y A;  3R6S A;  5C3E J;  2V1U A;  5D6E A;  2W82 A;  2XPV A;  2PBX A;  5F0C A;  4D0P A;  4FCY A;  4BKX A;  2CG4 A;  2K02 A;  1GVJ A;  2DYR H;  3BCB A;  4MLO A;  1W0T A;  4U7B A;  4EM0 B;  1ORK A;  3HOU J;  4OIP F;  1QVU A;  3FBI B;  4P96 A;  1TL8 A;  2NOJ B;  1FP2 A;  3HUG B;  2CQX A;  4KT5 C;  1FEX A;  9ANT A;  3WU0 A;  4YEL A;  3JCU C;  3ZMS A;  3NRV A;  1KU2 A;  2XB5 A;  3CC4 I;  1K79 A;  3FM3 A;  3JRH A;  2Y9Z A;  1D1A A;  2DCE A;  3CMY A;  2HDD A;  2DA4 A;  1T95 A;  3K4M A;  3SZP A;  2GXA A;  4HSR A;  3ZN1 A;  1HDD C;  2QKO A;  2W7N A;  5CVV A;  3BG7 A;  2WBM A;  1WCM J;  2LF8 A;  4MO7 A;  1XGM A;  1TZL A;  2JA8 J;  1IXR C;  1LUJ B;  2W48 A;  3GFM A;  1KYZ A;  3I55 I;  3OSG A;  1G59 A;  3KEO A;  4OAY A;  2F2E A;  1I3A A;  2D2W A;  2LR8 A;  2IAI A;  3T1B A;  4B3X A;  5JVG F;  2WV1 A;  2L7Z A;  4EJO A;  2CW8 A;  1U6G A;  1YOV B;  1H89 C;  1H0M A;  4ASN A;  3VW1 A;  3K8P C;  2IA0 A;  3BR0 A;  2FXA A;  4HST A;  3WTU C;  2EZL A;  1IW7 F;  4YII A;  1YI2 I;  4BHB A;  4ZH4 F;  4UV9 A;  3VWB A;  3HGG A;  2P81 A;  5ICF A;  4E70 A;  4RB1 A;  1M1E B;  3I4N J;  2ZCN A;  3OL4 A;  3CCJ I;  1DP3 A;  2VJ5 A;  1G3W A;  1MND A;  2DMN A;  3FBN B;  1VFC A;  3QYE A;  5KAI C;  5IOY A;  5ICG A;  4MEX F;  2IJL A;  1D3Y A;  3TGN A;  3GYH X;  2ZB9 A;  3VOK A;  3OL3 A;  1J09 A;  5D1R A;  2PBI A;  4UB6 C;  4H4K C;  3PNT A;  1YHQ I;  3WE2 A;  4YFK F;  2X6O A;  1K7A A;  1IN6 A;  3D0S A;  4HPQ A;  3RYR A;  1VQM I;  2K9N A;  1IXC A;  1RI7 A;  4B47 A;  5DUK A;  4E6K G;  1MBF A;  1ZRD A;  3K6G A;  1P92 A;  1TWF J;  3CQZ J;  3RDI A;  3J81 Z;  4M6V A;  1R1V A;  1RUN A;  3LJL A;  1JKP C;  3LWF A;  5ILU A;  2HWV A;  1XSD A;  2LKS A;  3R0J A;  1D8J A;  3NWS A;  2FRH A;  2DG7 A;  1Y8Q B;  2TCT A;  1UFM A;  1WJD A;  4XLH A;  1XS9 A;  1YS6 A;  3KET A;  3RJP A;  3PIO F;  2G7H A;  4XNF A;  4OMY A;  2PJP A;  2KQR A;  3CCE I;  4EGY A;  3BWG A;  3FMR A;  4M3F A;  2ETH A;  5J1Y A;  2G0E A;  1SVM A;  2PLY A;  3M9A A;  2STW A;  4O6J A;  1H88 C;  1X58 A;  4HAM A;  2UXH A;  4RAF A;  3GVA A;  1Y1V J;  4HV5 A;  3GZ6 A;  4I98 B;  5H2F C;  3CO7 C;  2Y69 H;  3O8H A;  3BC8 A;  4M3B A;  1R5G A;  4AYB A;  2F5C A;  3HBL A;  4M9Z A;  4XN3 A;  4QSH A;  5FO5 A;  5E20 A;  1S7E A;  2EB7 A;  5HS9 A;  2DJI A;  2K85 A;  3TBI A;  5JR3 A;  1TP4 A;  1PJR A;  4RAZ A;  4NHJ A;  1QNT A;  3PM1 A;  1AU7 A;  2GIV A;  1AKH B;  1VQ8 I;  2VXZ A;  3CLO A;  3HHG A;  3COL A;  2NNY A;  2KKO A;  3SJM A;  1MJ9 A;  3NAR A;  4BAY A;  1IC8 A;  2CV1 A;  1UHS A;  1X2M A;  2HVS A;  3S8P A;  2RDP A;  2L5Q A;  4FE7 A;  4BYY A;  2LD5 A;  2EZH A;  4R8H A;  4XLF A;  2CV0 A;  3RCO A;  5CXI A;  3ZXS A;  3RH2 A;  2OTJ I;  1WSU A;  1LE8 B;  4CXF A;  1SVL A;  3HOW J;  3S5R A;  2DT6 A;  3QYF A;  4AC6 A;  2GA1 A;  3R61 A;  2XAQ A;  2XC7 A;  5FD6 A;  5L3F A;  2PZ9 A;  1X1C A;  1FOY A;  3S2D J;  4M9S A;  3HG9 A;  2XRO A;  2NP5 A;  1TLH B;  4CCL A;  4E7J A;  3KZZ A;  3DEE A;  3MZ8 A;  1I50 J;  3FK6 A;  2HS5 A;  2VL8 A;  3G7R A;  2JA5 J;  2O0Y A;  3BG5 A;  2KLO A;  1ZK8 A;  3HPG A;  4BL0 B;  2PX9 A;  3REO A;  3QRF F;  2M5W A;  1RR7 A;  3DEW A;  5IT9 K;  2HZD A;  1OCZ H;  3LNQ A;  1NG6 A;  2DTR A;  4A3G J;  3LFU A;  5H20 A;  2VJJ A;  3HDD A;  1FPQ A;  4M73 A;  4OAZ A;  1JI8 A;  3HHH A;  4JKZ A;  2L3D A;  4EVI A;  2WY7 Q;  4I2O A;  2JRT A;  4I76 A;  3JR9 A;  3V7C A;  2DJN A;  3B02 A;  2ECC A;  4MTD A;  2VXD A;  3I4M J;  4MK6 A;  3F3X A;  3IH4 A;  1A5J A;  2K3F A;  3I53 A;  3HSE A;  1XSV A;  4KDP A;  4M71 A;  2Q2E A;  5DUI A;  2E5Z A;  1R7J A;  3FIW A;  1J9I A;  3KP3 A;  2DPU A;  2L02 A;  1S29 A;  4WXH A;  1Y0U A;  5HNF A;  3BHQ A;  1QRY A;  5F1R A;  2K40 A;  4QPQ A;  2QSF X;  1O7L A;  5LFA A;  1RPW A;  1CF7 B;  2NVX J;  2QSH X;  2NS8 A;  3PIP F;  1Y39 A;  2QWW A;  1STZ A;  2FF4 A;  2WB1 N;  3CCV I;  3OYG A;  1R23 A;  2O6G E;  2WY8 Q;  1W5C C;  3H5R A;  4HNV A;  4M3D A;  1HDP A;  2HQ5 A;  3D5R C;  5KAF C;  1SD6 A;  5AIP A;  3BTL A;  1N78 A;  2ZCX A;  4ENK A;  3VB2 A;  4ABZ A;  2KRC A;  3OIO A;  5C4X J;  4I6Z A;  2MYS A;  1P4A A;  1UHW A;  1HW1 A;  2UWM A;  2O9L A;  1R36 A;  2FQ4 A;  3BT9 A;  3EQL F;  2KIM A;  3L2C A;  5HOD A;  2ELH A;  4IXA A;  4A93 J;  5L3G A;  4IHW A;  2QTQ A;  5CKT A;  2ZXW H;  1QBJ A;  2HI3 A;  3KKD A;  3E5Q A;  2F5V A;  4CHU A;  5E18 F;  5LD2 C;  1ZG3 A;  2UXX A;  2Z3Y A;  3HZJ A;  5K5R A;  1W5S A;  2DFI A;  3SQN A;  4AC0 A;  3E3V A;  2BHY A;  2M8G X;  1G3T A;  4RB3 C;  3NEU A;  3W2V A;  3HKZ N;  3IKV A;  2CW0 F;  2GBY A;  4F55 A;  3TDU C;  2E7X A;  2GWR A;  4XRS G;  2R7S A;  5DAJ A;  2E1O A;  2X1D A;  2KRH A;  2L9N A;  4J01 A;  3GME A;  4HZF A;  4N4N B;  3GTM J;  3VVX A;  2EJR A;  2LH9 A;  2LF7 A;  3GW2 A;  4YFX F;  3OYF A;  2HYJ A;  3ESW B;  3JSO A;  2NOG A;  3KPH A;  4PJL A;  4QPO A;  3BJA A;  3HSR A;  4B43 A;  3K2A A;  1LPQ A;  1FC3 A;  1X3Z B;  2CQQ A;  2JUG A;  4AVP A;  4CZC A;  3I56 I;  4KWA A;  2IS2 A;  2LC2 A;  3BR3 A;  2Y75 A;  1HLV A;  2H6C A;  4PFP A;  2MC4 A;  3PAS A;  2R5Y B;  4XRM A;  5FMP A;  3TKY A;  2V26 A;  2ZFW A;  2GXG A;  1D5Y A;  4PXI A;  3BR2 A;  5DD8 A;  4ENN A;  1WPK A;  2R92 J;  1X3U A;  1HKT A;  2VOD A;  3MD2 A;  2VJ4 A;  3BLY A;  4II3 A;  1PUE E;  2W85 A;  5H6Q A;  4BJT A;  3KEY A;  3JRA A;  3NXC A;  2IS6 A;  4LD5 A;  5EJC A;  5D5X B;  4GXO A;  4BEH A;  2D45 A;  1ZLK A;  3HEF A;  1P2F A;  5EYR A;  1MNE A;  1R58 A;  3QP5 A;  2M4K A;  3F6O A;  1O3R A;  4NB5 A;  4A0X A;  2LVS A;  1K6O A;  3ZQF A;  2C6Y A;  1IZ1 A;  3GFI A;  5J6X A;  4CIC A;  2JUC A;  2XF7 A;  3BR1 A;  2Z2S B;  1HW2 A;  4KIS A;  3TOB A;  3FDY A;  2R93 J;  1DQU A;  2P5L C;  3PFY A;  1G8X A;  4Y33 A;  2EIN H;  4RAG A;  3W6K B;  2DI3 A;  1MMG A;  1OIS A;  4OIR F;  1D5V A;  4XLE A;  1TWH J;  2QBY B;  1TQM A;  4FE4 A;  4CYC B;  4GGG A;  5HSZ A;  1V5E A;  1FZP B;  5DCF A;  3NI7 A;  2V79 A;  1GT0 C;  2DQR A;  3IAM 2;  3DWL E;  1REP C;  2JTV A;  4BH9 A;  1OR7 C;  3JSP A;  2HVR A;  4ZDO A;  2DDB A;  1VI0 A;  2IBD A;  1YYV A;  3GLX A;  5FRO A;  1QVT A;  3FXO A;  1ZR2 A;  3VVZ A;  4M74 A;  1V4R A;  1XGN A;  4IHX A;  1VND A;  4BS9 A;  3I58 A;  5CQE A;  2QVO A;  2O03 A;  4UUS A;  1R6R A;  3SFI A;  2XRN A;  4A3B J;  2KDO A;  4FT8 A;  2EFQ A;  2DTZ A;  4FQG A;  2CQN A;  2HQR A;  1XN7 A;  3CJQ B;  1K61 A;  1VTN C;  3G3Z A;  2R7D A;  2V6C A;  3E5X A;  1X1P A;  4HLX A;  4NC8 A;  4B09 A;  1O3S A;  2VBY A;  3ERE D;  1G3S A;  1WJ5 A;  5FJ8 J;  2YVE A;  3H3V K;  2GXB A;  2KL4 A;  3F1B A;  1X4P A;  5FGM A;  2HOE A;  2OA4 A;  3PSF A;  4YEJ A;  1YW8 A;  3DV8 A;  3SDG A;  2M0C A;  1U78 A;  3E6B A;  3G1O A;  1HST A;  1F43 A;  1A31 A;  3HSF A;  1OMI A;  1FYK A;  2K4J A;  1I5Z A;  1Y8R B;  3NPI A;  4WIB A;  2EIL H;  4L9T A;  2R7T A;  3PUB A;  1UCR A;  2VJI A;  2W1O A;  5HVQ C;  5K58 A;  2XV4 S;  3HB9 A;  4IKF A;  4E7S A;  2EH3 A;  3J7Y J;  1JHF A;  2CU7 A;  5J47 A;  2G7S A;  1YIJ I;  1Z6T A;  1R49 A;  1K6Y A;  1F9N A;  3DPU A;  3SDB A;  1KU7 A;  4CGR A;  2DO7 A;  5K7H A;  4RAY A;  3MKL A;  2CW7 A;  2P7V B;  5H9T A;  1P4W A;  3G1M A;  3AAF A;  2P0W A;  4UXN A;  2DOA A;  1BC8 C;  3CC7 I;  4EJW A;  2MFZ A;  3LSK A;  3DTE A;  1UI6 A;  1DGR M;  1QPI A;  2X9D A;  5IYB J;  1B59 A;  1USS A;  3J81 K;  1B1B A;  3S1M J;  4HNU A;  3G73 A;  1YJW I;  2HGC A;  3S16 J;  4KIF A;  5FLX Z;  1T98 A;  2L9V A;  4GRI A;  1O4X A;  2IW5 A;  5H6R A;  3HRS A;  4D5C A;  1P7I A;  4GFB A;  5FKM A;  3C3W A;  5LHG A;  2F5D A;  4XOR A;  2EPF A;  2O7T A;  3BRO A;  2LG4 A;  4EAT A;  4ENM A;  4DW6 A;  2XGE A;  3FXQ A;  3FZV A;  4G7H F;  3JAM Z;  2Q8K A;  2CSO A;  3S17 J;  4X1E A;  1IGN A;  4MIM A;  1BOB A;  2QKM B;  3F8F A;  2DU9 A;  4JX4 A;  4XRS A;  3SZG A;  2DYS H;  4HV6 A;  4JBA A;  4IVN A;  4JX5 A;  1WJA A;  3H0D A;  2ZJP F;  2X4H A;  1TW3 A;  2ZSH B;  3K4L A;  1YG2 A;  3BJ6 A;  4CCK A;  2XKP A;  2XRL A;  4AIH A;  4I09 A;  1MMD A;  5DDG A;  2M0M A;  4LK0 F;  1R9T J;  1G3Y A;  2Z16 A;  3F9K A;  1WH7 A;  2HQN A;  3JW4 A;  1T0F A;  1APL C;  1RRJ A;  3OWT A;  1YRN A;  1WVR A;  1HC8 A;  4DBQ A;  3H9J A;  1V55 H;  3GX4 X;  3HOY J;  5D8K B;  1TT5 B;  3AG2 H;  3GTO J;  3M7G A;  3OV8 A;  4FX4 A;  2DFF A;  1Z0X A;  4CYD A;  1E3H A;  4CCN A;  1XTA A;  5HS8 A;  1QQI A;  2X0L A;  2TRT A;  1S3J A;  4KUM A;  4MGR A;  1MNM C;  4XIC A;  2HKU A;  4A3E J;  3GCM A;  1ULY A;  5B5E C;  1SFE A;  3PNV A;  4UY8 I;  3PO2 J;  4PCQ A;  4M9X A;  1FYM A;  3SEQ A;  3B81 A;  2DOF A;  2KIU A;  3F8M A;  1MH3 A;  1U5T C;  2ID3 A;  3LSI A;  5K5Q A;  3G1L A;  4A3F J;  1YIT I;  4AF5 A;  1SD5 A;  2E2I J;  2X6W A;  1TT0 A;  3D5S C;  2PI0 A;  3BG3 A;  2IU5 A;  3KIO A;  5FRM A;  3OYN A;  4XLN F;  1G6N A;  3KZI C;  4F91 B;  2CFO A;  4HDV A;  1BI0 A;  4PFO A;  1GUU A;  3FWE A;  3ZRG A;  2CV2 A;  3PNY A;  3AG3 H;  3C7J A;  3M07 A;  4UV8 A;  2OTL I;  4HEA 2;  1D0Y A;  2G7G A;  4CA0 A;  4DBR A;  2A69 F;  2ZFU A;  5FFZ A;  3FF5 A;  4NUB A;  3OIQ A;  3L2W A;  4V19 K;  2VQH A;  3DF8 A;  1LEA A;  3DFG A;  2R7O A;  5B1B H;  4XRF A;  1PUF B;  1K4T A;  1XDS A;  1WWX A;  3HIF A;  4NBQ A;  2MH2 A;  5ERI A;  3ZQG A;  5HLT A;  4HX7 A;  3MFK A;  3F8N A;  2ID6 A;  1QZY A;  2KZG A;  1WKM A;  3ZQC A;  1IN8 A;  2L4A A;  3JRD A;  2WC2 A;  3BG9 A;  3CCR I;  1GLN A;  3CES A;  3ULQ B;  1FBU A;  4KMF A;  3OR2 C;  2VKH A;  4C2M A;  1S7O A;  4PK4 A;  2LNB A;  1X19 A;  2ZJ2 A;  3IC7 A;  4ZZL A;  3KZY A;  1UZC A;  1XCB A;  2OZU A;  3T8T A;  2Z33 A;  1GV5 A;  4L0Y B;  1WGX A;  5E8G A;  2R5Z B;  1UG2 A;  2OUM A;  3ABK H;  3CWR A;  1YX5 A;  4RM3 A;  4C3I J;  5EG0 A;  4LIT A;  3U2R A;  4GFK A;  2EFP A;  2FEZ A;  2MA3 A;  2PJR B;  3HTJ A;  1KQ9 A;  3RKY A;  3GTK J;  2EQR A;  2KDZ A;  2DOD A;  3UNG C;  2CQK A;  2O61 A;  3LA3 A;  1UHM A;  3U21 A;  3S15 J;  5L3D A;  3ZR8 X;  4ZZD A;  2JMW A;  4Y13 A;  5IP6 A;  5K1Y A;  3VYR B;  1D1B A;  2CRG A;  3LSG A;  2GEN A;  3FK7 A;  1K83 J;  4JL3 A;  3JSJ A;  4A3K J;  3KP6 A;  1YX3 A;  2BW3 A;  4DYR A;  2EA2 A;  2ZME A;  2QEX I;  4G6D A;  3CP2 A;  5GPC A;  2XAS A;  2XKO A;  2MLG A;  4BXX J;  1N75 A;  1SFO J;  5J4V A;  2HQA A;  5K5O A;  1UMQ A;  5CVR A;  4XOT A;  4PJJ A;  1W1W E;  2CJJ A;  4RB2 C;  2PMH A;  2HR3 A;  3TOA A;  5HDK A;  5IP9 J;  2A61 A;  3EDP A;  4K2E A;  1FYL A;  1KA8 A;  4IQJ A;  1QGP A;  1U5T B;  3JTH A;  2VQG A;  4EV0 A;  4U0V A;  2QSG X;  3MQ0 A;  5LHH A;  4G7O F;  1FIP A;  2E35 A;  3Q3S A;  5E3M A;  3HJE A;  4B44 A;  4Q5S F;  4MTE A;  1B8I A;  3BCG A;  3LAJ A;  3QOP A;  4LLN A;  5F08 A;  4ACI A;  4ZYA A;  1E2X A;  2L7K A;  1X2N A;  1BIB A;  1ETO A;  5KNL A;  4HQM A;  2XGC A;  4OWR B;  5BOX A;  4H0E A;  2YVX A;  1VQ7 I;  4I01 A;  3ROU A;  2KRF A;  2EV6 A;  1EH8 A;  4IL6 C;  4D1Q A;  4NNJ A;  1HBX G;  1P9Q C;  3HRU A;  2IRF G;  4D7M A;  4YFN F;  4KNY A;  2ZNZ A;  2K3P A;  2TDX A;  5FFX A;  4GYG A;  4OOI A;  5FKO A;  4O5V A;  2M87 A;  3X2Q H;  3M1E A;  2VC1 A;  4WXD A;  3O3K A;  3ZGK A;  1IRG A;  3L2V A;  1S6L A;  3ECO A;  5J8C A;  4FHT A;  2HKX A;  4L5I A;  2FBI A;  1G2H A;  2QM3 A;  2GUH A;  1ZGA A;  3CF2 A;  4BY7 J;  5FRN A;  2NXN B;  4E7H A;  4BBS J;  5GTI C;  5FHP A;  2XAJ A;  1OCT C;  2RKH A;  1S8N A;  3PFI A;  1OCO H;  2FOK A;  1E0E A;  2CUE A;  4NQW A;  3WGI A;  2MC3 A;  4EJV A;  3CZ6 A;  3CDI A;  5LEK A;  2P7C B;  2XAG A;  2BZT A;  4HW0 A;  1W7P B;  3S1R J;  2QCO A;  4R1H A;  3CP8 A;  4ESB A;  4HF1 A;  2X51 A;  3M8E A;  3GFJ A;  3HTU A;  3T5X A;  4F7Z A;  2JA6 J;  1F4K A;  2Y48 A;  4W97 A;  1RNL A;  2Z5U A;  1R1U A;  3OY9 A;  3LSP A;  2RC4 A;  2VUM J;  5KK1 A;  2Y0M A;  1EA3 A;  2AHQ A;  4V2F A;  4BBR J;  5M3F J;  3GTQ J;  4LGW A;  3S1Q J;  1ETV A;  4XSX F;  2DA3 A;  3TQN A;  3JRC A;  1FJL A;  1ITY A;  1BBY A;  1J0R A;  4W1U A;  2BXY A;  5EZH A;  4HDU A;  2EIK H;  3VUQ A;  2W4S A;  3LMM A;  4IHT A;  5GP9 A;  1B9M A;  2J5P A;  2LBF B;  3WG9 A;  4AM3 A;  2L7M P;  5ICE A;  1ACI A;  4UDS A;  4HRI A;  3TMO A;  3ZQH A;  2XVC A;  2FA5 A;  3H9G A;  2NNN A;  4A12 A;  5D5W B;  1X4O A;  4GCK A;  4HX8 A;  4F93 B;  1JJ8 C;  2DMQ A;  2JRM A;  4BGD A;  1Z91 A;  2MG4 A;  2VKV A;  5E1W A;  2A3S A;  2M4G A;  3H92 A;  4PJM A;  5EGO A;  1JUM A;  4E7L A;  3ERM A;  1Z9C A;  3HRM A;  2BVM A;  5CVJ A;  2IVM A;  2PEX A;  3OYK A;  4E7Z A;  1LKX A;  1Q1H A;  4JQF A;  1MMN A;  1DDN A;  2H1L A;  4O3M A;  3HPH A;  2LDU A;  1NG7 A;  1WI9 A;  3RIR A;  2MLK A;  2RNJ A;  1JKO C;  3IP4 B;  2OBP A;  1FOW A;  4GFL A;  1RUO A;  3RKX A;  2D6Y A;  4AID A;  3VOE A;  3V6G A;  1Z7U A;  2JK3 A;  5FLX K;  1IV8 A;  3FMS A;  5L3E A;  3L9F A;  4GCV A;  3EPZ A;  3IV5 A;  2V1D A;  3IRR A;  3EYI A;  1AWC A;  2IT0 A;  1OLT A;  4QTR A;  1TWG J;  3F8B A;  4Z6Y A;  4P55 A;  3QWL A;  3ELK A;  3S2H J;  3CTA A;  3JAM K;  4WCG A;  1WJC A;  2R4G A;  2L54 A;  5LGN A;  5E1X A;  2DK8 A;  2IXS A;  5L3C A;  5BPI A;  2A6H F;  3BY6 A;  5DD4 A;  4C2M J;  4QWQ A;  1JJ6 C;  2AQE A;  3TO6 A;  2UXN A;  4HQE A;  2N8G A;  5EEG A;  3HKZ A;  4E7K A;  3MEX A;  2E2H J;  1S72 I;  2M7A A;  3OOP A;  1KON A;  2P5K A;  2GLO A;  1SD7 A;  1T38 A;  2HFH A;  2XGX A;  1F36 A;  2EV5 A;  1EKE A;  5E3O A;  5LGU A;  2F07 A;  5LBQ A;  3E97 A;  3GBG A;  1ZH5 A;  2OAZ A;  2R5Z A;  2JA2 A;  4BJ6 C;  4DZJ A;  1P4X A;  1ZGW A;  5EEH A;  3H3Z A;  2DMP A;  1TTY A;  1WJF A;  3Q9S A;  3OYH A;  3ABL H;  4J00 A;  2PJR A;  3ZQQ A;  3IHU A;  2CS3 A;  3BPX A;  4F52 A;  1MJB A;  2V7F A;  2JT1 A;  3VSK A;  5JI6 A;  2M3A A;  2FX0 A;  1PYV A;  3F72 A;  1JUP A;  2DG8 A;  4HF2 A;  3ZP5 A;  2VPL A;  5BNG A;  4OD5 A;  3V8J A;  4B3A A;  4I02 A;  2E60 A;  2Z99 A;  5E8I A;  4HG2 A;  3PO3 J;  1WQ2 A;  2RHA A;  4RGX A;  4XBF A;  4XON A;  3WTZ A;  3OYE A;  3Q5F A;  2QQ8 A;  3P9C A;  2I10 A;  1AA7 A;  1B72 B;  2FSW A;  4HX4 A;  3OS1 A;  3N05 A;  2CMP A;  3W3C A;  5L3B A;  6PAX A;  4A5M A;  2B3W A;  1HKQ A;  5DCM A;  1U9O A;  1HCR A;  4C3J J;  3ZPL A;  4RA2 A;  2P5V A;  3HM5 A;  3MMY B;  2VI6 A;  3BZ6 A;  1IAW A;  2V9P A;  2B1E A;  2M8E A;  4C9Y A;  3U1D A;  1ZEL A;  1MMA A;  1SMT A;  1TWC J;  2K4B A;  1HKS A;  1E3O C;  3W2W A;  3PQJ A;  1VF9 A;  3H3U A;  5HNH A;  5HLH A;  5FB2 A;  1FBQ A;  3IH2 A;  3QOD A;  4MHG A;  3HUG A;  4XKB A;  5D5V B;  3A02 A;  4LIU A;  4RLQ A;  2JSC A;  2OCC H;  2BVL A;  2H8R A;  1MMS A;  3PJR A;  1BW5 A;  2ME0 A;  4CO8 A;  2H6B A;  2ZBK A;  3UKG A;  4E7I A;  2QEN A;  3WG7 H;  1DP7 P;  4G94 A;  1I1G A;  2DT7 B;  2FML A;  5F6F A;  4YIF A;  3HL2 A;  1D0X A;  2W53 A;  3CUQ C;  2KT0 A;  3EUH C;  1OJL A;  3TP0 A;  3FX3 A;  3EET A;  2PFB A;  1FIA A;  1R1T A;  2XAH A;  4ZC3 A;  2PFV A;  2AXL A;  4Y15 A;  2MBF A;  4LK1 F;  4A6D A;  3ABT A;  1MGT A;  2NVU B;  3WU2 C;  3CCM I;  2FJI 1;  2LFB A;  5JFR A;  2XF6 A;  3RPQ A;  4RBO A;  2IGK A;  1T08 B;  2EFN A;  2HDC A;  3GFL A;  4ZYE A;  1IRZ A;  4L9N A;  2ZSI B;  3GO5 A;  1VQ9 I;  1LDD A;  1MBH A;  1BC7 C;  3KLO A;  2CUJ A;  3BJO A;  5D4S A;  3P7N A;  1H8A C;  1QZE A;  4GO1 A;  2HOT A;  4NC7 A;  4RGS A;  3H5A A;  3CF5 F;  4Y7N J;  4PSW A;  3K4C A;  4CGZ A;  2HVQ A;  1GHC A;  1YE9 A;  3CMM A;  2NS7 A;  2X1E A;  1S7A A;  3NRG A;  4M6X A;  3K1M A;  2PMZ A;  3I5U A;  4Z2Y A;  3JRF A;  2JPC A;  1XCV A;  2E19 A;  3RQI A;  4EQQ A;  4IRG A;  3QPL A;  4KIT B;  1IJW C;  3NNR A;  4EGZ A;  2K86 A;  2KMU A;  2FBK A;  4L62 A;  1FWZ A;  4A0Z A;  1XGS A;  3ON2 A;  3AKZ A;  4G6T B;  1R4N B;  5BQT A;  4M3G A;  2ZO4 A;  3K4J A;  5IOZ A;  3M8J A;  1J7K A;  1ERD A;  2E1M C;  3S3O A;  4EJT A;  2H1K A;  2RVC A;  2O3F A;  2M1B A;  2X6X A;  3MN2 A;  2K9L A;  2QUF A;  3F21 A;  2Z9O A;  1UI5 A;  5DM6 F;  1WZ2 A;  3WHB A;  4ME9 A;  2OU2 A;  2QF7 A;  2ADU A;  3E1S A;  4Y52 J;  4RGU A;  4X0G A;  3CJN A;  1Z77 A;  3A01 B;  2W00 A;  3ASN H;  2UV1 A;  4JNN A;  3EYY A;  2JVG A;  2O8K A;  2L2O A;  2H94 A;  2NAZ A;  2O5R A;  3ANG A;  3TO7 A;  1D1C A;  1R4M B;  3SWH A;  4IQ4 A;  3GTL J;  3ECH A;  2P6T A;  2F6C A;  4NEL A;  3VW2 A;  1LVK A;  1KU9 A;  2J5O A;  2QQA A;  2KHM A;  1ETX A;  4IZZ A;  2QIB A;  1PP7 U;  3J80 Z;  3N97 A;  3BOQ A;  3CUQ B;  4CCO A;  1AKH A;  4ZJZ A;  2JZY A;  4R79 A;  2R3S A;  3E6M A;  4L5J A;  5CLS A;  5FKN A;  5D18 A;  2M45 A;  3ZQL A;  1TNT A;  2KIQ A;  3QP6 A;  3K1N A;  4BE1 A;  1JTX A;  5CYV A;  1NK2 P;  4A3D J;  3ZMD A;  2E1N A;  5F1J A;  3DQV C;  1XX5 A;  3O2P E;  3CCU I;  5CVI A;  1LE8 A;  4EMS A;  3DKW A;  1T39 A;  3P9T A;  1LFP A;  2LMD A;  2R7W A;  3G4S I;  3GZI A;  2KIF A;  2XAU A;  2XF5 A;  3S3M A;  1LNW A;  3GXO A;  3MCZ A;  2WV0 A;  4BQO A;  1IV6 A;  4B4C A;  2VKE A;  5J1U A;  3RKQ A;  2XPW A;  2BXZ A;  4RB0 A;  3CCY A;  1T33 A;  1J59 A;  2IGN A;  2VC0 A;  1O3T A;  2K9Q A;  4CCM A;  2NS0 A;  4Y4R A;  4UUT A;  4ZDL A;  2MH9 A;  3LST A;  2LK2 A;  5TJJ A;  2ZOZ A;  1E3P A;  1MBK A;  2LTP A;  2OJE D;  1IO2 A;  3PUF A;  2EFW A;  3QBM A;  3S3N A;  1X3W B;  3H5N A;  1NHA A;  3FXR A;  5D6F A;  3LWJ A;  2IA2 A;  5AQC A;  2E1M B;  1W5T A;  3K2Z A;  2WAQ A;  3BTC A;  2CO5 A;  2L01 A;  2ESH A;  1KYW A;  3LSM A;  4ZTJ A;  2Q0O A;  3G6E I;  5HDG A;  4B48 A;  2ISZ A;  4A3I J;  4N4O B;  4XID A;  2UZK A;  4BNC A;  1EF4 A;  5FLM J;  5FGL A;  3F23 A;  1V3F A;  3LAP A;  2KPM A;  2O7O A;  4BXU A;  5D8L B;  2HZT A;  3I59 B;  1JGG A;  1CF7 A;  1SAN A;  5M3M J;  1ZAO A;  4ENJ A;  1Q1V A;  2VN2 A;  1ETQ A;  4C3H J;  3QYB A;  2R0Q C;  2EBI A;  3HTS B;  3ML6 A;  1U8R A;  1RR8 C;  2BOL A;  1EJ9 A;  2OV7 A;  2JSP A;  2YSR A;  2HYT A;  3M4O J;  2IGM A;  1KGS A;  2ELJ A;  2DBB A;  4P9U A;  3WTT C;  3FXL A;  1MBG A;  2DLL A;  3Q0V A;  4IRH A;  1W0U A;  2EWN A;  3W2A A;  3F0C A;  3M3Y J;  1ZRF A;  2ZOY A;  3M8F A;  1FOX A;  4MQV A;  1E17 A;  5C44 J;  5A2Q Z;  3PPB A;  3Q9V A;  4AWX B;  1TC3 C;  1L0O C;  3DCF A;  3P9I A;  2B7E A;  1SFU A;  3I4P A;  2Y0S N;  3VYS B;  2P8T A;  4XKW A;  2RGV A;  1FNN A;  1UG0 A;  2IGO A;  1VZ0 A;  4KA4 A;  1EH6 A;  4NC6 A;  2G9W A;  1NH3 A;  3BZK A;  1BOA A;  4PUS A;  3IAS 2;  1ZG1 A;  4FAS D;  1B6A A;  4U0Y A;  3VOX A;  2BY1 A;  3KP7 A;  3I54 A;  4XQF A;  1ONV A;  4HBL A;  2A5W A;  3ZCO A;  1IG7 A;  2A07 F;  2QYO A;  5LRR A;  5E3L A;  2QQ9 A;  1UAA A;  3SEZ A;  3L1P A;  1RET A;  3BQZ A;  5EDN A;  2G7L A;  2FNA A;  3IWF A;  4Y3O A;  4C2U A;  2Y30 A;  1OCP A;  3ASO H;  2WAF A;  2V1X A;  2JJ7 A;  4L0Z B;  5CW8 A;  1H9G A;  1F5T A;  1IF1 A;  2EA4 A;  1HA8 A;  1W7P D;  2XB0 X;  2XSJ C;  2ZCW A;  2HPI A;  3HXL A;  2ZXI A;  3T0Y A;  1R00 A;  3GLL A;  3L2Q A;  4IOA F;  2R5Y A;  1FTZ A;  3C07 A;  1R5I D;  3A0H C;  4BE0 A;  1YJN I;  2ICW G;  1OQY A;  2WTE A;  2HOS A;  4C2T A;  3J7A O;  3S14 J;  2QKL B;  4ICH A;  3TW6 A;  4XK4 A;  3IH3 A;  2DQL A;  1BR1 A;  2DMT A;  1QHG A;  3LSJ A;  3DPL C;  2D5V A;  3E6D A;  2IA1 A;  2BHZ A;  2M7B A;  4XLC A;  3LSR A;  3MVP A;  2HDW A;  1R22 A;  2HTJ A;  4U9L A;  2XSD C;  4U9N A;  1A6Q A;  4IHY A;  3JRI A;  4YRV A;  4UB8 C;  5CJ9 A;  4DYC A;  4XOP A;  4WWC A;  5B66 C;  4E4H A;  5E17 F;  2LRE A;  5IY5 H;  3ABM H;  2MGQ A;  4S04 A;  2HYG D;  1T6S A;  1UB9 A;  2QBY A;  5DEQ A;  3K7A J;  4KJZ A;  5B3S H;  1IDY A;  4CYC A;  4HA8 A;  3GTG J;  2F4O B;  2VBZ A;  1VQP I;  2HU9 A;  3QPS A;  5BPD A;  1QPM A;  1LB2 A;  5EZG A;  3OSF A;  2NX4 A;  5HLG A;  2EZI A;  3H1C A;  3J7A Y;  5LLQ A;  1WJB A;  1PDN C;  3FIS A;  2R7V A;  1XMX A;  4ESJ A;  3COA C;  4EM1 A;  1MH4 A;  1ODD A;  2F48 A;  1LFU P;  4PGH A;  1DU6 A;  2EIM H;  1T2K A;  2NP3 A;  5F64 A;  4BQA A;  2V1N A;  4CH7 A;  2WAE A;  4BXF A;  5E79 C;  4B8X A;  2YU3 A;  3VSL A;  1GVD A;  2FOW A;  3HC7 A;  4TV7 A;  5TRD A;  2WWY A;  3MZY A;  3A4C A;  2B0L A;  1KQ8 A;  4WX9 A;  3DXJ F;  1TQI A;  2DT5 A;  5FLV A;  1TBX A;  3FKI J;  1IUF A;  1SVO A;  1MIJ A;  4UHT A;  2YUS A; 
#chains in the Genus database with same CATH homology
 3W6V A;  4QTR A;  1TWG J;  3EGQ A;  4X6A J;  3ZOB A;  1B72 A;  3JRA A;  3NXC A;  3S2H J;  3QKX A;  5F0F A;  5F04 A;  2JN6 A;  3HEF A;  5EYR A;  2DA5 A;  1I3Q J;  5IYC J;  2ME6 A;  1JT0 A;  5K7Z A;  5E3N A;  2LVS A;  1NTC A;  3ZQF A;  3O60 A;  2OER A;  3RZD J;  4C2M J;  5DS9 A;  3HTH A;  3D1N I;  1CQT A;  3BR1 A;  1JJ6 C;  2ZCM A;  2XGD A;  2IEK A;  2R93 J;  3Q0U A;  3HOV J;  3C2B A;  3CRJ A;  2N8G A;  2FJ1 A;  2M34 A;  3JRB A;  1TWH J;  3BJB A;  4FE4 A;  4DYQ A;  4CYC B;  5HSZ A;  2E2H J;  1MSF C;  5M5W J;  3VIB A;  4FIS A;  3NI7 A;  2GLO A;  5EGO B;  1GT0 C;  1SGM A;  1F36 A;  2F07 A;  2L9R A;  5E3O A;  1XG1 A;  3O8G A;  1VI0 A;  3GBG A;  2IBD A;  1BW6 A;  2DN0 A;  3VVZ A;  1QVT A;  1ZR2 A;  2R5Z A;  2REK A;  4IHX A;  1VND A;  4DZJ A;  1ZGW A;  4EEF G;  4UUS A;  3SFI A;  4A3B J;  2DMP A;  4A3C J;  4MFD A;  1HF0 A;  1ZQ3 P;  5M5Y J;  2DTZ A;  3H0G J;  2GM4 A;  1K61 A;  2FX0 A;  2DG8 A;  3HOX J;  1JUP A;  3CDL A;  5HBU A;  1U8B A;  5BNG A;  2LP0 A;  1JKQ C;  4B3A A;  5D19 A;  4FTH A;  5FJ8 J;  2V57 A;  2YVE A;  3PO3 J;  2RHA A;  2QOP A;  2ELK A;  3H3V K;  1ENH A;  2LKX A;  5GPA A;  3F1B A;  1I6H J;  4B1R A;  2OF7 A;  2I10 A;  3DPJ A;  2MW8 A;  1B72 B;  3SDG A;  1U78 A;  2M0C A;  2WAQ N;  1ETY A;  3G1O A;  2YS9 A;  1F43 A;  3S1N J;  2XDN A;  2XPU A;  4BY1 J;  1U9O A;  1HCR A;  3JRG A;  1P7J A;  4C3J J;  2NVY J;  2NVQ J;  5JLW A;  1JUS A;  5C4J J;  1DU0 A;  3HM5 A;  2VPR A;  3NPI A;  2VI6 A;  2ECB A;  5K58 A;  3HB9 A;  3HGY A;  1XC5 A;  1TWC J;  4MXM A;  1E3O C;  2EH3 A;  2CU7 A;  2G7S A;  1VF9 A;  1IDZ A;  4GCT A;  3IH2 A;  1MSE C;  3A02 A;  4CGR A;  3ANP A;  5K7H A;  3MKL A;  4AUX A;  2H8R A;  1BW5 A;  1BA5 A;  2X48 A;  2ME0 A;  3G1M A;  5H9T A;  3UKG A;  1BL0 A;  4UUS B;  2W53 A;  1UI6 A;  2KT0 A;  1QPI A;  1OJL A;  2X9D A;  3TP0 A;  5IYB J;  2QWT A;  3S1M J;  1FIA A;  3KKC A;  3GTJ J;  3S16 J;  2G3B A;  1RKT A;  4JX6 A;  2JWT A;  3BR5 A;  3A01 A;  1O4X A;  4L5E A;  5IYD J;  2LFB A;  4D5C A;  4GFB A;  1P7I A;  4J19 A;  5FKM A;  3BRU A;  4RBO A;  2LY9 A;  1RKW A;  2O7T A;  1ETK A;  2YVH A;  1IRZ A;  2LLK A;  4D7N A;  4DW6 A;  2XGE A;  1GDT A;  1MBH A;  2K9S A;  3S17 J;  4X1E A;  1IGN A;  4MIM A;  3VVY A;  2M9H A;  4JX4 A;  1ETW A;  1A6I A;  4LOC A;  4M3E A;  4XRS A;  4D5F A;  1JT6 A;  1H8A C;  2HOT A;  2Y2Z A;  1MBE A;  4JX5 A;  2HXI A;  4Y7N J;  2Y9Y A;  2XRL A;  5C3E J;  3QQA A;  1PUF A;  2NS7 A;  2XPV A;  2PBX A;  5F0C A;  3NRG A;  4FCY A;  4DZP A;  4BKX A;  3JRF A;  1R9T J;  4YZE A;  2E19 A;  3RQI A;  4MLO A;  1W0T A;  3GTP J;  1WH7 A;  1ORK A;  1OFC X;  3QPL A;  1NK3 P;  3RZO J;  1IJW C;  3HOU J;  3NNR A;  1APL C;  4L62 A;  1QVU A;  1YRN A;  4G12 A;  3ON2 A;  2OPT A;  1AHD P;  3HOY J;  1FEX A;  2CQX A;  3GTO J;  9ANT A;  4M3G A;  1ZKG A;  5IOZ A;  2XB5 A;  1Z0X A;  3JRH A;  2Y9Z A;  5DTD A;  1MNM C;  3CMY A;  2TRT A;  2H1K A;  4XIC A;  2HDD A;  3EUP A;  2DA4 A;  2HKU A;  4A3E J;  3T6N A;  3MN2 A;  1HDD C;  2QKO A;  3PO2 J;  1UI5 A;  4ME9 A;  3WHB A;  2QF7 A;  4Y52 J;  1WCM J;  1Z77 A;  3B81 A;  3A01 B;  2DA6 A;  3KZ9 A;  4MO7 A;  4JNN A;  1MH3 A;  2ID3 A;  3G1L A;  4A3F J;  2JA8 J;  2W48 A;  2E2I J;  4AF5 A;  2O8K A;  3ANG A;  3OSG A;  2WUI A;  3BG3 A;  2IU5 A;  2LR8 A;  2IAI A;  2L0K A;  3BTI A;  4A69 C;  4MFE A;  3GTL J;  2L7Z A;  2WV1 A;  4NEL A;  3G56 A;  3VW2 A;  1H89 C;  1GUU A;  2B63 J;  1ETX A;  5JLX A;  2QIB A;  3VW1 A;  5K7F A;  2AO9 A;  3BR0 A;  3JRE A;  3B6A A;  2G7G A;  3ON4 A;  2EZL A;  1AKH A;  4AYB N;  3BTJ A;  5FKN A;  5D18 A;  3ZQL A;  3HGG A;  2P81 A;  3ZQI A;  3I4N J;  1PUF B;  1NK2 P;  3NAU A;  1JTX A;  2HXO A;  2Q24 A;  2ZCN A;  5HAW A;  3AQS A;  4A3D J;  2DMN A;  3ZQG A;  1ZTR A;  1VFC A;  2COB A;  5F1J A;  5IOY A;  2ID6 A;  1HOM A;  2UXI A;  2ZB9 A;  1LE8 A;  3VOK A;  3ZQC A;  5D1R A;  3P9T A;  3JRD A;  3BG9 A;  1YRN B;  2HOA A;  3Q0W A;  2X6O A;  3GZI A;  3GEU A;  3HIM A;  2R92 J;  2K9N A;  1MBF A;  1TWF J;  3CQZ J;  1FTT A;  4M6V A;  1GV5 A;  1IV6 A;  3LJL A;  1WGX A;  2R5Z B;  1UG2 A;  4B4C A;  1JKP C;  2VKE A;  5J1U A;  3CWR A;  4C3I J;  5IP7 J;  4V2G A;  5EG0 A;  3RKQ A;  2FD5 A;  2XPW A;  5M5X J;  3LHQ A;  2DG7 A;  2WGB A;  4GFK A;  3E7Q A;  2TCT A;  3CCY A;  2UXU A;  1T33 A;  5C4Y A;  1XS9 A;  3HTJ A;  3GTK J;  2DA7 A;  2EQR A;  2KDZ A;  2K9Q A;  4M3F A;  5J1Y A;  3HOZ J;  3S15 J;  2G0E A;  4UUT A;  3LOC A;  1H88 C;  2JMW A;  5IP6 A;  1X58 A;  2LK2 A;  2UXH A;  2ZOZ A;  3HE0 A;  1Y1V J;  1MBK A;  2CRG A;  3LSG A;  2GEN A;  3FK7 A;  2LTP A;  1K83 J;  3QBM A;  4JL3 A;  3HTA A;  3JSJ A;  4A3K J;  3LWJ A;  5AQC A;  3O8H A;  4DYR A;  4M3B A;  3HBL A;  4QSH A;  5GPC A;  1S7E A;  1TWA J;  3BTC A;  5F27 A;  4NN1 A;  4BXX J;  3PM1 A;  1SFO J;  1AU7 A;  1AKH B;  4A3I J;  3COL A;  1UMQ A;  4XID A;  1EF4 A;  5EFY A;  1WI3 A;  5FLM J;  2CJJ A;  3HTI A;  5FGL A;  3SJM A;  1RES A;  3NAR A;  5IP9 J;  1IC8 A;  1UHS A;  1X2M A;  2O7O A;  4RDU A;  1JGG A;  3A03 A;  1SAN A;  5M3M J;  2Y31 A;  2RAS A;  4FE7 A;  1Q1V A;  2LD5 A;  2EZH A;  1ETQ A;  1FIP A;  4C3H J;  2CUF A;  3IUV A;  2R0Q C;  2EBI A;  3Q3S A;  5E3M A;  5CXI A;  3RH2 A;  3TW7 A;  1LE8 B;  3S5R A;  1B8I A;  3HOW J;  4IHV A;  4AC6 A;  2HYT A;  3BCG A;  3M4O J;  3TP3 A;  2PZ9 A;  4QIW N;  3RD3 A;  5F08 A;  3S2D J;  4ACI A;  2NP5 A;  1MBG A;  3Q0V A;  2R7Z J;  1W0U A;  1X2N A;  1ETO A;  3F0C A;  2XGC A;  1I50 J;  5EF6 A;  3FK6 A;  3G7R A;  2JA5 J;  3M3Y J;  2ZOY A;  4HKU A;  1U9N A;  1BJZ A;  3BG5 A;  1ZK8 A;  2UXP A;  1MBJ A;  5C44 J;  3PPB A;  4D7M A;  1RR7 A;  3DEW A;  1TC3 C;  3DCF A;  5EG0 B;  3LNQ A;  5FKL A;  1JKR C;  4A3G J;  2EZK A;  2Y0S N;  5FKO A;  3HDD A;  2NVT J;  1POG A;  5CXG A;  4JKZ A;  2E2J J;  4A3L J;  3KNW A;  2MSY A;  1G2H A;  2GUH A;  4I76 A;  3JR9 A;  2DJN A;  4BY7 J;  2ECC A;  1WH5 A;  1Y1W J;  3I4M J;  4BBS J;  4MK6 A;  3VP5 A;  5FHP A;  3IH4 A;  1A5J A;  1OCT C;  2DA2 A;  3VOX A;  3VPR A;  4GCL A;  2CUE A;  1IG7 A;  5E3L A;  3L1P A;  1RET A;  3BQZ A;  3FIW A;  5EDN A;  3B6C A;  2G7L A;  2Y30 A;  1OCP A;  4JP0 A;  2QCO A;  3S1R J;  3CJD A;  3BHQ A;  2JJ7 A;  5CW8 A;  1QRY A;  2K40 A;  5FKK A;  2XB0 X;  3BNI A;  2JA6 J;  1T56 A;  4W97 A;  3LSP A;  1RPW A;  2R5Y A;  4A3J J;  2NVX J;  2VUM J;  1FTZ A;  3C07 A;  2NS8 A;  2WB1 N;  2OI8 A;  2HOS A;  4ICH A;  3S14 J;  3BQY A;  3TW6 A;  4HNV A;  4M3D A;  4XK4 A;  1HDP A;  2AHQ A;  4V2F A;  2HQ5 A;  4BBR J;  3BR6 A;  1B8I B;  3IH3 A;  5M3F J;  3BTL A;  3GTQ J;  2ZCX A;  2DMT A;  1LFB A;  3LSJ A;  4ABZ A;  3OIO A;  3S1Q J;  5C4X J;  1ETV A;  4I6Z A;  4NDL A;  2D5V A;  2DA3 A;  4JYK A;  3JRC A;  3E7L A;  1FJL A;  1ITY A;  4W1U A;  2O9L A;  2FQ4 A;  5EZH A;  2RAE A;  3BT9 A;  3OOU A;  3LSR A;  3VUQ A;  3MVP A;  2XSD C;  5HOD A;  2FBQ A;  4A93 J;  5EEA A;  5GP9 A;  4IHW A;  2QTQ A;  2DA1 A;  3V78 A;  2L7M P;  4UDS A;  4IHY A;  3JRI A;  2HI3 A;  3KKD A;  5J1R A;  4A3M J;  4DYC A;  3ZQH A;  2PMZ N;  3FRQ A;  1GV2 A;  3VW0 A;  4GCK A;  2L7F P;  2MGQ A;  1JTY A;  1JJ8 C;  2DMQ A;  4AC0 A;  4CYC A;  3K7A J;  3GTG J;  1IDY A;  2M8G X;  5IPA A;  2JA7 J;  2MG4 A;  2VKV A;  3QPS A;  3HKZ N;  2GBY A;  5EZG A;  5EGO A;  3OSF A;  1JUM A;  2NX4 A;  2EZI A;  2DMU A;  3MNL A;  3FIS A;  4XRS G;  3WHC A;  1ZR4 A;  5DAJ A;  2E1O A;  3GTM J;  3VVX A;  1MH4 A;  1LFU P;  3TED A;  2HYJ A;  1DU6 A;  2NOG A;  1JKO C;  3K2A A;  2NP3 A;  4GFL A;  5J3L A;  2GFN A;  2CQQ A;  2D6Y A;  4KWA A;  3BR3 A;  3V6G A;  1GVD A;  4S0H B;  1HLV A;  2JK3 A;  3PAS A;  2R5Y B;  4XRM A;  2UXO A;  5F0H A;  5FMP A;  2M2E A;  4IEJ A;  5FLV A;  3AQT A;  3IV5 A;  3FKI J;  1IUF A;  1D5Y A;  4PXI A;  3BR2 A;  1WPK A;  2YU9 J;  2YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...