2OF7A

Structural genomics, the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor a3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
191
structure length
191
Chain Sequence
GLRERKKTRTREAIRAATYGLIRQQGYEATTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLRKALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEVRIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative tetR-family transcriptional regulator
total genus 64
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2007-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2of7A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2of7A02
2G7LA 2P81A 2JJ7A 4ACIA 1ITYA 4D5CA 3UKGA 1RESA 2VKEA 3HB9A 2G7SA 3E7QA 3BHQA 3NI7A 3TEDA 3GTMJ 2VPRA 3GTQJ 2COBA 1UI6A 4XIDA 1BJZA 2EQRA 3BR6A 3G1LA 5C4YA 2O9LA 4YZEA 4QIWN 5E3LA 3G56A 2R7ZJ 3BR0A 4EEFG 2LY9A 2PZ9A 2E2HJ 1QVUA 1MBHA 2LVSA 2ME0A 4XRSG 3Q0WA 2ZCMA 9ANTA 3QPLA 4XRSA 3S5RA 2LTPA 2GENA 5K58A 4RBOA 2K9SA 3HTAA 4L62A 3LOCA 3LJLA 2UXUA 1QPIA 2QTQA 3VVZA 4MXMA 1RETA 1ZR2A 3HDDA 5EF6A 1B72A 1UI5A 2CRGA 4JKZA 3RD3A 1Z77A 4UUSB 4FCYA 1IUFA 4A3JJ 1HCRA 5F0FA 4A3GJ 3GTOJ 3VW0A 2HXIA 2HI3A 1K61A 1FIAA 2E2JJ 4B3AA 1NTCA 5CXIA 4DW6A 2HDDA 3IH2A 3WHCA 4GFKA 2K9NA 4IHWA 4BKXA 2O7TA 3BTCA 2X48A 4V2FA 1JJ8C 5IYCJ 2WB1N 3QPSA 4L5EA 4CYCB 3G7RA 4M3BA 2LD5A 2WUIA 1NK2P 1X58A 2I10A 2M34A 4Y7NJ 1MSEC 1JKRC 3QQAA 3S17J 5F27A 4JP0A 1QVTA 4QTRA 3ZQLA 3TP3A 3HOVJ 4FE4A 4FE7A 3ANGA 5D18A 1ZKGA 3I4MJ 4M3GA 5FMPA 1Y1VJ 2JN6A 1H88C 1XG1A 1FEXA 3KZ9A 4NELA 5IP7J 2GFNA 1TWCJ 3M3YJ 1E3OC 1T56A 3T6NA 4D7NA 1JTXA 1OFCX 5FKNA 3MVPA 3PO2J 3HTJA 3RZOJ 4GCKA 1NK3P 5JLWA 2PBXA 3LWJA 4C2MJ 2DTZA 1MBFA 2Y31A 4A3EJ 1U9NA 1VNDA 1WCMJ 1ETXA 4PXIA 2D6YA 5FGLA 3V78A 4GCLA 2EH3A 2DJNA 3BQYA 2ZCNA 2ECBA 3GBGA 3IH3A 2LLKA 3CWRA 1F36A 4RDUA 1IG7A 5IPAA 2G3BA 3B6AA 3CJDA 3ZQFA 4JL3A 3FISA 3G1MA 5J1RA 3Q3SA 4W1UA 1YRNA 1MBKA 1JKPC 1B8IB 3PPBA 3NAUA 4X6AJ 3BG5A 3O8GA 2QCOA 3AQSA 3I4NJ 5D19A 3HEFA 3RH2A 2GLOA 2NVXJ 5FLVA 1EF4A 5F0CA 2LP0A 1PUFB 2KT0A 2EZKA 5EGOB 3KNWA 2YVHA 3FK6A 3VOKA 2UXHA 2QF7A 3TW7A 1ETVA 1OCPA 1LE8B 2W53A 2LR8A 1POGA 2WGBA 3GEUA 4ABZA 2DMPA 1GUUA 5IOZA 3F0CA 5EZHA 3CCYA 5DAJA 1ETYA 1IC8A 3VIBA 2IAIA 1AKHA 3B81A 1HDPA 4C3HJ 4B1RA 2L7FP 5J3LA 3PASA 2VUMJ 2JA7J 3HOUJ 4DZPA 3BNIA 1X2NA 1GVDA 2ME6A 3JRHA 3E7LA 5GPAA 5IYDJ 4NN1A 4S0HB 2JWTA 1BL0A 2H8RA 2XDNA 3HBLA 5IYBJ 5FKMA 2PMZN 1IV6A 3KKCA 2M2EA 4AC0A 1BA5A 1R9TJ 2DA3A 2G0EA 1HLVA 3GTKJ 3JSJA 2IU5A 1QRYA 2MG4A 1AU7A 1AHDP 1IDYA 2XPWA 5EDNA 3LNQA 4JX6A 4B4CA 2DN0A 3HOWJ 2OI8A 2R5YA 1MSFC 2CQXA 4M6VA 1MBGA 2FQ4A 1TWAJ 1HF0A 3ZQGA 3BQZA 3M4OJ 5M5XJ 3HGYA 3SDGA 1RKWA 1B8IA 2DG8A 4LOCA 1U9OA 5C44J 1Z0XA 1DU0A 3EUPA 4A3FJ 4A69C 4X1EA 1XC5A 2XPVA 2ZOYA 2JA8J 2NS7A 3S1QJ 4DYQA 1LE8A 2UXOA 1OCTC 5FKKA 3H0GJ 1T33A 3JRAA 2NVQJ 3PM1A 3IUVA 2X9DA 4JNNA 2TCTA 2HXOA 2QWTA 3KKDA 2E2IJ 3B6CA 2IEKA 1CQTA 3EGQA 5FKOA 4MLOA 4AF5A 2AO9A 1Y1WJ 1ZGWA 4A93J 3MN2A 5EEAA 2NP3A 2GM4A 1WI3A 3S16J 4C3JJ 3NRGA 1Q1VA 3JR9A 3GTGJ 1P7IA 4UDSA 1I3QJ 2RHAA 1LFUP 1GT0C 3TW6A 4I76A 3V6GA 2DG7A 5DS9A 3VP5A 3GTJJ 2LFBA 3OIOA 3IV5A 2QKOA 2MGQA 4AYBN 5J1YA 3VUQA 2L7ZA 3S1NJ 4D7MA 2HOSA 2L0KA 2JK3A 2K9QA 2M9HA 3CDLA 4KWAA 2XGEA 4FISA 3S1RJ 1VF9A 3JRBA 2RASA 2ZOZA 2YUSA 3FRQA 2DA1A 4A3IJ 2HKUA 5IP6A 1JT6A 1VFCA 1A6IA 2DMNA 2CUFA 4DYRA 1HDDC 2NOGA 3RZDJ 2CQQA 2HQ5A 1GV5A 3RQIA 2XPUA 3K2AA 4A3MJ 1MNMC 2JMWA 4CGRA 5C3EJ 2HOAA 2AHQA 2EZLA 1W0UA 1HOMA 3LSRA 5HODA 1VI0A 1B72B 5K7FA 3L1PA 3RKQA 2L9RA 5M5YJ 4J19A 2R5ZA 5M3MJ 3FKIJ 1ETKA 5F0HA 1SANA 2R5YB 1O4XA 5EFYA 2NVYJ 2VKVA 2DA6A 5EGOA 1S7EA 4A3CJ 1JUMA 2EZIA 4BXXJ 5CXGA 4CYCA 1H89C 3A01B 5E3MA 3MKLA 4A3DJ 3HIMA 5M3FJ 1JKOC 5FHPA 4BBSJ 1OJLA 2W48A 3F1BA 3CRJA 1K83J 3HOZJ 3MNLA 1ZR4A 1APLC 1WGXA 1MBEA 2CJJA 4V2GA 5M5WJ 1YRNB 3W6VA 2QOPA 2UXPA 1UG2A 1LFBA 2E19A 3NXCA 3DCFA 2G7GA 3BR1A 5K7HA 4IHXA 4UUTA 3PO3J 3GZIA 5CW8A 4MK6A 4HNVA 1W0TA 1IRZA 3BR5A 2IBDA 5JLXA 3HTHA 2XGDA 3ZQHA 5EG0A 3ANPA 1JT0A 4M3EA 5J1UA 2KDZA 4UUSA 4BY1J 3LHQA 3O60A 2R0QC 4A3LJ 1I50J 4GFBA 3VVXA 3G1OA 2CU7A 3COLA 4C3IJ 3SFIA 3BCGA 5H9TA 4JYKA 3JREA 5HBUA 2LK2A 2DMQA 3BT9A 1JUPA 2ECCA 5EYRA 3NPIA 1GV2A 2O8KA 3DPJA 1RPWA 3ON2A 1SGMA 3HE0A 3D1NI 3LSJA 2XB5A 3QBMA 1FTTA 2K40A 2YVEA 2NS8A 1MH4A 2LKXA 1D5YA 3BR3A 3FK7A 3CQZJ 4XRMA 3SJMA 2HOTA 1ZQ3P 5E3NA 4Y52J 4MFEA 2XB0X 5K7ZA 2N8GA 2M0CA 3BTIA 3S1MJ 2ID6A 2CUEA 4MFDA 1BW5A 1ETOA 2FX0A 3ZOBA 2RAEA 3FIWA 3VW1A 3JRCA 1P7JA 2NX4A 1ETWA 5IP9J 2GUHA 2OERA 1WPKA 2E1OA 1TWGJ 1WH7A 4A3BJ 3BTLA 2MSYA 4MIMA 5F1JA 4BY7J 2REKA 4D5FA 5HAWA 2JA5J 2WV1A 5EZGA 4M3FA 2FD5A 4IEJA 3CMYA 5FLMJ 2YS9A 1UMQA 1AKHB 4I6ZA 2OF7A 1ENHA 1BW6A 2DA7A 2Y30A 3BTJA 5GP9A 1ZTRA 2FJ1A 3GTPJ 4GFLA 3BJBA 4GCTA 2OPTA 3ZQIA 1H8AC 2JA6J 5GPCA 5IOYA 2ZCXA 1A5JA 1FJLA 3VPRA 4JX4A 3GTLJ 2Y0SN 3S2DJ 2ZB9A 1TWFJ 2WAQN 3QKXA 1MH3A 2B63J 3LSPA 5C4JJ 4ICHA 4A3KJ 3JRFA 3C2BA 1F43A 2NP5A 3S14J 3JRGA 2XSDC 2L7MP 2DA5A 1SFOJ 1JGGA 1X2MA 1WH5A 2M8GX 4AUXA 1JJ6C 3HTIA 4MO7A 2R92J 5E3OA 1JUSA 1MBJA 3JRIA 4ME9A 3NNRA 1TWHJ 1U78A 1FIPA 3Q0VA 3C07A 1G2HA 2Q24A 1IJWC 3NARA 2ID3A 3Q0UA 3VW2A 3OOUA 3H3VK 3OSGA 4NDLA 2D5VA 2EZHA 3IH4A 1JKQC 2DMUA 2Y9YA 3HKZN 5D1RA 1ETQA 3S15J 2F07A 2ELKA 2QIBA 4HKUA 2X6OA 3VVYA 2HYTA 2V57A 3JRDA 1JTYA 5F04A 4JX5A 5FJ8J 1UHSA 5HSZA 2XGCA 4DZJA 2EBIA 5DTDA 3BG3A 3VOXA 3HOXJ 1RR7A 3ZQCA 1TC3C 2O7OA 4BBRJ 2R5ZB 3BG9A 2DA2A 2GBYA 3BR2A 2UXIA 3HM5A 4IHYA 4G12A 2HYJA 4W97A 1IGNA 5BNGA 2YU9J 1IDZA 1ORKA 3S2HJ 3K7AJ 2VI6A 3WHBA 4FTHA 2DMTA 1ZK8A 2H1KA 2R93J 2DA4A 5AQCA 1U8BA 4IHVA 4M3DA 3DEWA 4XICA 5FKLA 3P9TA 4XK4A 3OSFA 2Y2ZA 3A03A 1FTZA 1I6HJ 3A02A 3A01A 3O8HA 2FBQA 4QSHA 2MW8A 1PUFA 5C4XJ 2TRTA 1RKTA 4DYCA 3LSGA 4AC6A 1GDTA 3BRUA 3AQTA 3ON4A 2XRLA 2NVTJ 3HOYJ 2Y9ZA 3HGGA 1XS9A 5F08A 1DU6A 5EG0B 3TP0A
chains in the Genus database with same CATH superfamily
2V9PA 5DCFA 5DD8A 4ESJA 3E7QA 3HB9A 4H0EA 2RGVA 4RMNA 3NI7A 3CCRI 4GXOA 2EIJH 2DK8A 2COBA 4BAYA 1YHQI 4LLLA 1UI6A 5ERIA 3BR6A 4ASNA 1FSHA 1E17A 1K78A 1VQ5I 2LY9A 3MZHA 2WY7Q 2ME0A 4XRSG 3Q0WA 4I98B 1T38A 3P9IA 1WKMA 4EM2A 4G9YA 1ERDA 2GENA 4N0BA 3V42A 1T6SA 3DPLC 4AVPA 3E0JB 1BIBA 3LMMA 1B9NA 2QTQA 3VVZA 5LEJA 4I01A 1ZR2A 2E5NA 2XAUA 2VE8A 2DOFA 4JKZA 1E3HA 4FCYA 3P7NA 1SEUA 4RA2A 5D6FA 1HCRA 4A3JJ 4HLXA 3AAFA 2GXAA 4M72A 3WGIA 4B09A 1FOXA 1KU3A 2ETHA 2PG4A 2QQ8A 1K61A 4IQ4A 1FIAA 2E2JJ 4DW6A 2A2FX 3SXYA 2OTLI 5LGTA 2XC7A 4PSWA 2K9NA 2JSCA 4ZTFA 4QPQA 1LQ1A 4IHWA 5EEGA 2X48A 1G8XA 1FLIA 2BE5F 3DU5A 2WB1N 1BBYA 4BEHA 4L5EA 3FKJA 1D0ZA 2QSHX 2BY2A 1X58A 2I10A 2M34A 2B7EA 1JKRC 2BW3A 2F5VA 3ZQ7A 4PK4A 1R4MB 1OKRA 3IUOA 4TV7A 1VQ8I 3HOVJ 3MQ0A 1TQPA 2KRHA 1N78A 3BCAA 5D18A 3GVAA 1KGSA 5FMPA 2R7RA 5HNHA 1XG1A 2LOOA 4GO1A 2FEZA 2GXBA 1OLTA 3J7AY 1TWCJ 1T56A 1Z91A 3R60A 1PDNC 4YIRX 3PNYA 4D7NA 1WZ2A 1XSDA 1JTXA 3IRRA 2ZMEB 2XAQA 5AIQA 3HOTA 1W1WE 3CF5F 3HTJA 2PBXA 3LWJA 3KP4A 4RLFA 5HLGA 2DLLA 1GXPA 2DTZA 3ESWB 3K1MA 4RB1A 1ZH5A 4PXIA 1U9NA 2CW0F 4HF0A 3RPUD 2D6YA 4F91B 1P2FA 1YE9A 3H92A 3DKYA 4HRIA 2OZ6A 4ZYGA 1SVLA 2AXLA 4NC7A 3VB2A 1LDDA 1IG7A 2DDBA 2IGKA 2LKSA 4E7KA 1YIOA 3ZQFA 4PJJA 1J7KA 3FISA 3G1MA 1MBKA 1B8IB 3PPBA 1FYMA 2E1NA 4N9IA 1IN7A 1KYZA 3AQSA 4XNFA 1FX7A 3OY9A 3HEFA 5LEKA 1SAXA 2NVXJ 2EWNA 2V26A 2YSRA 4BACA 3D5RC 2LP0A 3M9AA 5F0CA 2KT0A 2VASA 4BE2A 4KYWA 2EZKA 1VQ4I 3ECHA 5EGOB 2HS5A 2YVHA 1R5GA 4NBQA 3DBLB 2R7WA 1SD7A 2CYYA 3KE2A 3GEUA 1KONA 2DMPA 4RB3C 1GLNA 2FU4A 5IOZA 3R4KA 3CCYA 3AG4H 4IVNA 1AKHA 3GUDA 2ZCWA 2M7AA 1ZG1A 4R1HA 4B1RA 2L7FP 5J3LA 1HSJA 1ZLKA 1BN5A 4DZPA 1X2NA 4LK1F 1IN8A 1T98A 2ME6A 2HVSA 4EJUA 4NN1A 3IAS2 4IF4A 3V8JA 1TNSA 1KYWA 1NG6A 3OS0A 1KQ8A 4NB5A 4GCVA 5L3EA 5FD5A 4ZYHA 5JVGF 3HBLA 4XR6A 3ZMSA 4R8HA 5FKMA 2PMZN 2F48A 1BA5A 4M9XA 4XRFA 4L0ZB 2G0EA 1HLVA 3VTIA 3JSJA 2QBYB 2KRFA 4XLEA 4C2UA 2JUCA 4E7IA 4JX6A 3HHGA 3ZMTA 2ACJA 3OOPA 2R5YA 2DU9A 4U88A 1IRFA 2VBYA 4GGGA 2FQ4A 4QPOA 2ELJA 5E20A 4G6DA 4OU0A 2XHKA 3ZQGA 1XN7A 3I56I 2PFVA 1OQYA 2DG8A 2XAFA 4XM3A 1DU0A 3EUPA 3AFHA 3ZPLA 2I8DA 2XPVA 3N05A 4BUPA 2A3SA 2KZGA 2R7UA 4DYQA 2UXOA 1FSEA 3H0GJ 3ONQA 2NVQJ 1TQMA 2DPDA 4D1QA 4IOAF 3NWTA 2TCTA 1QA6A 4LJZF 2NVUB 3IP4B 3HXLA 2E2IJ 3T8TA 2Z33A 2EK5A 3EGQA 5FKOA 3FZVA 1Y1WJ 5F1RA 1U2WA 2VJJA 3K4LA 3GMEA 4ON0A 1ACIA 2L9NA 1D8KA 1I3QJ 1D5VA 1UCRA 2BY1A 1LFUP 1FC3A 3ZGKA 4BJ6C 5FD6A 3A0HC 3HPGA 3GTJJ 4JQFA 2K9MA 4P5OA 2LFBA 3S32A 4AYBN 5J1YA 4RAGA 3VUQA 4O5VA 4CH7A 4EM1A 2XGXA 3V7SA 4D7MA 4LFUA 5J8FA 2P0WA 5HLHA 1FOWA 2K9QA 2JT1A 3CDLA 3FXMA 2XGEA 3QOEA 3H36A 2R7DA 3S1RJ 3CZ6A 3L2VA 3WTVC 2W7NA 2XIGA 2FA5A 1MNDA 2ZOZA 4GDFA 2MD0A 3HPHA 1O3SA 2CH0A 4IRHA 4KITB 3TO7A 1A6IA 2LF8A 3SEQA 3H9GA 1GV5A 2CWEA 3K2AA 2KRCA 4HYEA 4LIUA 5LRSA 4IOCF 2BVMA 3C2GA 4YELA 4A3MJ 3ZCOA 1TL8A 5KCMA 2JMWA 2GWRA 2VJ4A 4B47A 2AHQA 2KIQA 3MMYB 1BOBA 3KX2A 1LVKA 1FYKA 2R7SA 4BHPA 4OAYA 4HDUA 3LSRA 1K7AA 5HODA 4DBRA 4EM0B 3L1PA 3LSKA 3LA2A 3ZR8X 2R5ZA 2JPCA 3FKIJ 3KZZA 4CO8A 2VKVA 1DGWY 5EGOA 3F22A 2EZIA 5CXGA 1H89C 3HIMA 3TMOA 3CCVI 2F5FA 5FHPA 3EETA 4OD4A 1I3AA 2RVCA 5FRNA 1XSVA 3OYAA 1YIJI 2XSJC 3K1NA 1ZR4A 1IRGA 4WXDA 4LD5A 2E34A 2UXPA 5ILVA 3CUQA 1GXQA 3DCFA 1YITI 3BR1A 3HIFA 5K7HA 4UUTA 5BPDA 5CW8A 3L00A 1T95A 3SZPA 5JLXA 2A68F 3ZQHA 3QPTA 1JT0A 4YIIA 1MMNA 3ZMDA 1DQUA 3BC8A 2KDZA 4BY1J 3O60A 3COLA 3F8BA 3SFIA 2ZY9A 5H9TA 5L3GA 3CLQA 4CYDA 1VZ0A 2LK2A 1LDKB 2L7KA 5TISC 3WTUC 3U21A 5J8CA 5CLSA 4MHGA 1P4WA 3NPIA 3KP7A 3Q5FA 1GV2A 4HZFA 4EJVA 1RPWA 5FRMA 3ZMVA 3D1NI 1F5TA 1WVRA 4E6KG 2XB5A 3HE0A 3EDPA 4KIFA 1C0WA 3F6VA 2K40A 4L9JA 5LRRA 2LKXA 5HDGA 3CQZJ 4XRMA 3SJMA 5E3NA 4XLHA 2FRHA 2XB0X 5K7ZA 2VC0A 2M0CA 5DCMB 1TBXA 3S1MJ 5D8LB 4MFDA 3WG7H 3DLAA 1ETOA 1OYIA 1O7FA 2M8EA 3RKWA 4RLQA 2A5YB 1ETWA 3KP6A 2EJRA 3ZXSA 1D8JA 5ICFA 2MC4A 2WTEA 1H9GA 2E1OA 4U9LA 4A3BJ 3VYSB 2ZBKA 4MIMA 4II2A 1MJ9A 2X85A 2UV1A 2JA5J 5EEHA 3R6SA 5FLMJ 3CD6I 3COAC 5D8KB 4I6ZA 1X3WB 2IT0A 1D1CA 4P55A 1J5YA 2Y30A 3H5AA 5FLXK 4L18B 3BG7A 3KPHA 2O61A 3PJRA 4RAFA 1ZTRA 4FHTA 2DYSH 3P5JA 3VODA 1VQPI 2DI3A 2JA6J 2ESHA 2MFZA 1A5JA 2E71A 1LNWA 3S2DJ 3NQOA 2WAQN 3SZTA 2E7WA 2DODA 3HC7A 2FXAA 4OMZA 3L7WA 2CQ7A 5DV5A 4IXAA 3GX4X 3C2BA 4L0YB 1YJNI 3C18A 1F43A 2NP5A 4ICHA 5KHDA 2X1EA 3JRGA 3PIOF 1X2MA 1WH5A 2F5DA 2EIKH 4AUXA 1JJ6C 3EUHA 3O6BB 3FHNA 4MO7A 5E3OA 2P7VB 4LB6B 2FNPA 1TWHJ 3WU0A 3P9KA 1WJ5A 3C07A 2Q24A 3SYTA 2VJIA 3NARA 3E1SA 2LREA 3TDUC 3OOUA 2OA4A 3H3VK 2PJRB 1Z6TA 4NDLA 4D0PA 2PQ8A 5DM7F 1I27A 2D5VA 2Y9YA 3BLYA 3N97A 1ETQA 4HKUA 4HSRA 2HYTA 2V57A 3EYYA 3KYCB 1HKQA 1UFMA 2XGCA 1G6NA 2NNYA 4KISA 1T0FC 3FXQA 1OR7A 1WSUA 1TC3C 2GA2A 3CTAA 3TGNA 3M7GA 3KCCA 2DA2A 4ZYDA 2UXIA 3CJRB 3E5UA 3HM5A 4IHYA 2HYJA 3V8LA 5DUKA 4NQWA 4BHBA 2VI6A 5HLIA 2YX7A 2DMTA 5KAIC 1JGSA 1VQNI 4I09A 2PLYA 2DA4A 5J4YA 5AQCA 2M4KA 4CCNA 4EQQA 4M3DA 3DEWA 2EA4A 2VQGA 3FXJA 2Y2ZA 3H3ZA 4HSTA 1ZAOA 1P6RA 3A02A 3A01A 3O8HA 5CVJA 4QSHA 1FPQA 2MW8A 3I64A 2LDUA 5C4XJ 4BJ5C 1LJ9A 3LSGA 4MQ9F 4AC6A 2AS5F 2XRLA 1YS7A 2Y9ZA 5JHFA 2MA3A 1WJEA 5DD4A 4CHUA 1SD6A 2E1MC 4ESFA 2BHZA 5GADJ 4FX0A 4KDPA 3QODA 3OR1C 4P1WA 2P81A 1ODDA 2WAFA 1XPXA 1WFXA 3GF2A 4D5CA 2BGCA 2VKEA 2G7SA 2P5KA 3BHQA 4ZYAA 3PFIA 1YOVB 2VT3A 1G4DA 2F6CA 1B72A 3GTMJ 4HAMA 2GQQA 3QP6A 4KN4X 1EA3A 3G1LA 1FP1D 4JK1X 3HKZA 3OYDA 3REOA 2E2HJ 1QVUA 2LVSA 4ZJZA 5BPIA 3CCLI 4XRSA 1YI2I 4IRIA 3RKXA 5BMZA 3RQ4A 1MMSA 1QPMA 4RBOA 2FBIA 3I59A 2MD5A 4YFKF 1F9NA 5LD2C 2UXUA 3H35A 3OYCA 2JRMA 2HPMA 1QPIA 2PJPA 1FT9A 1G3TA 4RAYA 2OCEA 1UI5A 1OPCA 2Z99A 2D1HA 3BOQA 2KKOA 2KFDA 2CRGA 1SFXA 1P4AA 3BJOA 4UV8A 1OCRH 2W00A 3FX3A 3VSKA 5FFZA 1QZZA 3E3VA 3HZJA 1IUFA 1BR4A 4IPAA 4RS8A 3CDIA 3ABLH 2ICWG 2K9LA 3NRVA 2EA2A 5HDNA 2K27A 2ZKZA 4YRVA 1RR8C 4HF1A 3WHCA 4EV0A 5KK1A 3BTCA 2BV6A 1JJ8C 5IYCJ 4KUMA 3I53A 3PNVA 2FE3A 3QPSA 4GYGA 4CYCB 3G7RA 2WUIA 2HTJA 2KIUA 2VB6A 4UVAA 1NK2P 4Y7NJ 4ENJA 3S17J 5F27A 1BI1A 4QTRA 1KZHA 1WWXA 3TDZC 1B9MA 3ELKA 3S93A 3TL4X 4BDYA 5BS6A 1K6YA 3BJAA 4RB0A 1SC7A 4M3GA 5HS7A 1H88C 3K1PA 4FQGA 4NELA 1YX3A 2GFNA 3M3YJ 3FM5A 2I5UA 3T6NA 2CV1A 5HOOA 5LGUA 4A6EA 2H6BA 3RZOJ 4GCKA 1NK3P 4AIKA 1QBJA 3QOPA 3M1CA 2QVOA 3CP8A 4UV9A 2CUJA 2Y31A 1WCMJ 2B0LA 2HOEA 2G7UA 2NOJB 2RQPA 3U9GA 5FGLA 4LG3A 1RZ4A 2A05A 2F4IA 3W3CA 3GBGA 2ELHA 1FNNA 4M73A 2LLKA 3CWRA 1F36A 3TKYA 3B6AA 2L4AA 3FM3A 2VOOA 4JL3A 5TGTA 2P6SA 3E6CC 4W1UA 4HW0A 3PIPF 1MMAA 1OCCH 2VIXA 4E7HA 1MJBA 2CQKA 2DJIA 3VDXA 3RH2A 1JE8A 2GLOA 5ILUA 5FLVA 2HFHA 2QA4I 4DGWB 3CESA 1K4SA 3JSOA 2QLZA 3KNWA 3FK6A 4RM2A 5D5VB 2Z5UA 1V5EA 2K02A 2UXHA 2HNHA 1ETVA 3LQRA 2LR8A 4XLFA 4B48A 2WGBA 1L3LA 3MAJA 4ABZA 1QZEA 1GUUA 3F0CA 2B1EA 1XMXA 5EZHA 4U0WA 1TT0A 1IC8A 5DAJA 4XKBA 3JAMK 1Q1HA 1HDPA 1MNEA 1Z9CA 4PGHA 2HYFA 2OBPA 3IHUA 2RNJA 2VUMJ 3CLOA 3WE3A 3BNIA 4OMYA 1GVDA 1KU7A 3DBHB 5GPAA 1MD0A 3OWTA 3QYBA 1USSA 3ZMZA 3J7YJ 1RUOA 4HNUA 2Q0OA 3B02A 3RPUA 2ZFWA 1OMIA 5IYBJ 3OYJA 2X6XA 3CJQB 2R7TA 3ABMH 4PDKA 1R9TJ 1Z21A 3BWGA 4XSXF 2DA3A 4LLGF 1ZREA 3WGGA 3GTKJ 1MZBA 2WY8Q 2X6YA 3KP3A 2DBBA 2XPWA 5CKTA 3HTSB 2R7VA 5EDNA 3F72A 2IA2A 4B4CA 5B3SH 1ZGAA 2DN0A 2E7XA 1T8IA 1K4TA 1MSFC 2EV6A 1SFEA 4M6VA 2G7HA 2PEXA 2XF7A 1MBGA 2F5EA 2HDWA 1TWAJ 4E7ZA 2RC4A 2FJI1 3HGYA 1R58A 1JHFA 3SDGA 5LFAA 2M30A 1I39A 1Z0XA 4ETSA 4XL9A 5J6XA 3WTWC 2JA8J 4ZDPA 3S1QJ 3CMAI 1LE8A 3JRAA 4HOBA 2Y0SA 1IUYA 3PM1A 3FMRA 2VQLA 4IX7A 1TTYA 5E18F 1TZLA 4IRGA 5K5RA 3DKXA 2D2WA 3VWBA 3N4MA 4PSXA 3T1BA 5CYVA 1ZGWA 4A93J 1O3RA 2EFOA 3RKYA 2GM4A 4C3JJ 3JR9A 2PJRA 1P7IA 1CF7B 1GT0C 2DFIA 5H6RA 2G9WA 3V6GA 2JTVA 2Y75A 3A0BC 1H9TA 4HNTA 3IV5A 4DQ2A 2KQRA 2UWMA 2MGQA 4PJLA 1HKTA 1HKSA 4BXFA 3EPZA 2HOSA 2O5RA 3CO7C 4DOZA 4CCKA 2RASA 2YUSA 3LSTA 5IP6A 1V54H 1VFCA 5CVIA 1YJ9I 2CUFA 5JVTA 4BL0B 1U6GA 4MEYF 1LKXA 4I99C 2GZWA 4G6QA 4CGRA 2LY2A 4U9NA 1WJDA 5CVRA 4DJAA 2QWWA 1HOMA 4UHTA 2QBYA 4NQWB 2KIFA 5CPRB 4PJNA 2DK5A 3BZKA 4KJZA 3RKQA 5M5YJ 4EVIA 4J19A 1X1PA 2GXGA 2L4MA 5M3MJ 4G7HF 4HA8A 1SANA 1A6QA 3SHFA 2AXTC 3RSNA 2DA6A 3A01B 3MKLA 2L3DA 4GYIA 2HVRA 4S05A 2DYRH 3S3OA 3CUOA 1JKOC 4BBSJ 1OJLA 4UVCA 1W5SA 1VTNC 4XLPF 3MFKA 2J5PA 2W48A 3F1BA 1K83J 4Q5SF 3F21A 5B66C 3MNLA 4N9HA 1T08B 3C2HA 1YRNB 2QOPA 2M7BA 1S7AA 3V8KA 2WBMA 3GEZA 1UG2A 1J59A 4XLNF 2V1DA 3QRFF 2A61A 2G7GA 5L3CA 1Z3YA 3GZIA 3IWZA 2E36A 4I0BA 4MK6A 4HNVA 2VONA 3BR5A 2DTRA 2IBDA 4QLCU 2XGDA 3KLNA 2EILH 4ITVA 2KIMA 3T8RA 2QZ8A 2OTJI 5E1WA 3VVXA 5K5OA 1IN4A 2R0QC 4GFBA 4A3LJ 5L3BA 2RREA 1S5LC 2KJCA 4C3IJ 2A6EF 1VQOI 3SFZA 1DGRM 3G3ZA 4Y4RA 4XKVA 4KFCA 3L2CA 2IPQX 2H27A 3HRTA 3I59B 3HL2A 2W85A 4XMYA 2PBIA 5EYRA 3OL3A 1Y8RB 4D9JA 4IHTA 3DPJA 1SGMA 3LSJA 1NH3A 3PUBA 2YVEA 2Z2SB 1MH4A 2K5CA 5HVQC 4AVZA 1KQ0A 2DT5A 4MFEA 1Y8QB 3A4CA 4EATA 1HC8A 3BTIA 3VOEA 1R71A 2FOWA 2RQQA 4U0VA 2IS6A 1BW5A 2GIZA 3CC2I 2FX0A 4Q4ZF 2RAEA 2XVCA 1DPRA 3FIWA 3VW1A 1HW5A 3DU6A 1HXDA 1P7JA 3CJNA 2NX4A 5IP9J 3CDHA 2EFWA 4KIBA 3PFYA 3DV8A 2MSYA 5F1JA 2WADA 3K70C 2IXSA 3EUKL 3MZYA 4M3FA 2FD5A 2C6YA 4KT5C 1R7JA 3F6OA 2R7OA 3FXUA 4S04A 1CF7A 1QHHD 2PN6A 3QYFA 3ULQB 2IW5A 2EV0A 2OF7A 1BW6A 1ENHA 3DQVC 2V79A 4A0YA 2CSOA 1YG2A 4II3A 4DVYP 4GCTA 3GW2A 1D0YA 2OD5A 3RTRA 3ZQIA 4RGUA 5GPCA 2GOXB 3M1EA 4EGYA 5TRDA 4B43A 2EFPA 1FJLA 2V6EA 3TBIA 4JX4A 3BPXA 1B59A 2ZB9A 1TWFJ 2EV5A 1X1DA 1X19A 3LA7A 5C4JJ 3LSPA 3GYHX 1D0XA 4OIQF 3S14J 2W24A 3TOBA 4KT6A 1U5TB 1XSXA 2QEXI 1JGGA 4PCQA 1T0FA 3AL0C 2M8GX 3MD2A 4ENMA 2M0MA 3M8FA 1N77A 2CW7A 1YJWI 1IXCA 3CUQB 1W7PD 1ZG5A 3D5SC 3VYTB 5KVRA 3JSPA 2ID3A 2CFXA 3H3UA 3Q0UA 3VW2A 1REPC 3QYEA 5IY5H 1V4RA 4BGDA 5BQTA 2DMUA 1JKQC 3HKZN 2ELKA 2QIBA 1W5CC 3MZ8A 2HGCA 3JRDA 1JTYA 2LSOA 4JX5A 5HSZA 2QENA 4DZJA 2DQLA 1XGSA 2COMA 5DTDA 3BG3A 3IAM2 3NS4A 3VOXA 3ABUA 3ZQCA 1RIOH 1K78B 3WU1B 3AG3H 4BE1A 1MIJA 4ESBA 2CV2A 3Q9SA 1FYLA 4W97A 3KP5A 1IGNA 1DUXC 4LG0B 1IDZA 1ORKA 4I7HA 3K7AJ 3LSMA 4RGRA 4FTHA 3TOAA 1YYVA 2HKXA 5E8IA 3HG9A 1TNTA 2ZO4A 3KZIC 1YX5A 3A03A 1R1UA 4LG0A 1Y39A 1I6HJ 2H6CA 1PUFA 4PGGA 1AA7A 5D5XB 3GZ5A 3C3WA 3AQTA 3ON4A 3E97A 4YFXF 4IKFA 4CXFA 2VJ5A 5LHIA 3LAJA 1FBUA 3BG6A 2LNBA 2ZJ2A 3W6KB 2YVXA 1TP4A 1KU9A 5EG0B 1QQIA 3CCJI 2R4GA 5A2QZ 3J7ZI 3K4NA 2UZKA 1FOKA 2JJ7A 4ACIA 1JHHA 1S3JA 1RESA 2EFQA 4Y17A 3UKGA 4AD9A 1PP8F 1G59A 2YX4A 2V6CA 3DP7A 4E70A 3WTTC 3QU6A 1E2XA 1MGTA 2EQRA 3FXLA 3Q9VA 3ECOA 3KLOA 4YZEA 4QIWN 1B1BA 3G56A 2O0YA 2ZCMA 1BI0A 4MQVA 3QPLA 4KA4A 3F8MA 2M5WA 1TQIA 4LMYA 5K58A 3K2ZA 4XBFA 3BZCA 2K9SA 3HTAA 3KZYA 3LOCA 2VL8A 3WTZA 3LJLA 1BR1A 1RETA 5BOXA 4UXNA 1LEBA 2K4JA 2UXNA 1USTA 3ERMA 3PL8A 3RD3A 1Z77A 4UUSB 4F52A 2GIVA 4P9FA 3GFMA 3OMYA 1U0JA 4A3GJ 3FXRA 4C2TA 3G73A 3VW0A 1XB4A 2V7FA 3SQNA 2F4OB 1U5TC 2DDAA 4XLCA 1NTCA 3AL0B 4FT8A 5CXIA 2OQGA 2HDDA 2KPMA 1QZYA 4BNCA 2O7TA 4V2FA 3WTXC 1R1VA 2CUZA 1W5TA 4K2EA 4PZJA 5ED4A 4M3BA 2LD5A 4BQOA 2ZNZA 2IS1A 1JXSA 4CCJA 2VOPA 2XROA 4RAZA 2J5OA 4JP0A 4E7LA 1QVTA 1SFUA 4E7SA 3ZQLA 3TP3A 2STWA 4FE4A 2XAJA 4FE7A 1RC9A 2KL4A 2WWYA 4IRVA 1LUJB 3OR2C 1FMWA 4KN7X 3QPHA 1FEXA 4HV6A 5H2FC 4KMUX 4C2MA 3GFLA 2L02A 3GXOA 1VQLI 2UUZA 3PO2J 3MVPA 4MTEA 1R5HA 2MH9A 2P8TA 4B44A 1RNLA 3JTHA 2FMYA 5JLWA 4WX9A 1J75A 2IA0A 4C2MJ 2DFHA 1MBFA 4A3EJ 2P4WA 5JR3A 1ETXA 4AM3A 1IAWA 2CV0A 2ADUA 1I5ZA 3V78A 3QWLA 2BVLA 2EH3A 2ZCNA 4ZYEA 3DF8A 4GCLA 2VXZA 2KP6A 4LITA 3I58A 3IH3A 2V1NA 4RDUA 4QWQA 1Y56A 1MMDA 2Q2EB 4CCLA 3Q3SA 1YRNA 4CGZA 3VYUB 3NAUA 4X6AJ 3O8GA 2HZDA 4BXUA 3I4NJ 3J80Z 5D19A 3DPUA 2ZJRF 4M71A 3ROUA 3GO5A 2TDXA 2CMPA 2JVHA 4AIHA 1PUFB 2Y69H 3GFJA 2H09A 2IS4A 3VOKA 2BEOA 3ISPA 4XONA 3OYBA 2LG4A 3HTUA 2CFOA 4F3QA 1UB9A 3GZNB 2LC2A 1W4MA 1XD7A 2BOLA 4Y13A 2M87A 2ZMEA 1ETYA 1VQ9I 3VIBA 2IAIA 2V9KA 3HRMA 2D1VA 1A36A 1HQCA 3PASA 2XF5A 1D1BA 2JA7J 4A2UA 3NWSA 1A35A 3ABTA 3BZ6A 3JRHA 3E7LA 3JCUC 2HVQA 4RB2C 5LLQA 1HW2A 2XDNA 2QGUA 3S8PA 2QSGX 1I1SA 4E4HA 4AC0A 2FBKA 1IXSB 1PUEE 3CC7I 3ASNH 1IO2A 2IU5A 1QRYA 2LY1A 3U1DA 2MG4A 2VBWA 1AU7A 1AHDP 1BI3A 1P9QC 1Z3XA 2IJLA 3KP2A 3LNQA 3SZGA 1VQMI 2OI8A 3OYFA 1Z6RA 3PSIA 3PQJA 1S6LA 1F4KA 3HHHA 2IP2A 2Z16A 3M4OJ 2L2OA 1B8IA 1RKWA 1XCVA 1WJCA 4LOCA 2P6TA 3UNGC 4LK0F 4Q47A 3M07A 4A69C 3OYLA 1ZGJA 2ZC2A 1XC5A 2V1UA 2ZOYA 1DP7P 2NS7A 4L9TA 4YFNF 1WQ2A 1OCTC 3PUFA 1BR2A 1FWZA 2X9DA 1XDSA 3CCUI 1L0OC 2QWTA 3KKDA 1LFPA 2IEKA 2V9VA 4AF5A 2PMUA 4MLOA 2KJBA 3C1DA 3MN2A 5EEAA 2E1CA 4I2OA 4ZZLA 2NP3A 2LH9A 3T0YA 3S16J 2ZXHA 4I02A 3GTGJ 2XUBA 5ICGA 1ZRFA 4L9NA 4UDSA 2R7QA 2BZTA 4N4NB 2RHAA 3TW6A 4I76A 1X4OA 2Y48A 1P4XA 3H9QA 3GLXA 5DS9A 4UUVA 1T2KA 3V4GA 2QKOA 3KETA 4FX4A 1IW7F 3S1NJ 1YW7A 4EJWA 1S8NA 2FUG2 1RRJA 1U5TA 1UELB 2JK3A 2L0KA 1K6OA 2M9HA 4UNOA 4CDGA 2LMDA 4BQQA 1B6AA 1VF9A 3JRBA 3HJEA 1DP3A 1TW3A 3FRQA 2DA1A 2QKMB 3HRUA 1Z7LA 1IF1A 1ZARA 2WB1A 4A5NA 1MDMB 1JT6A 2EFNA 2V4JC 2DMNA 1Y6IA 1HDDC 3PQKA 1WJAA 1HA8A 2NOGA 5HNFA 2JZYA 2CQQA 2HQ5A 2L54A 3F9KA 3RQIA 2XPUA 3OS1A 3RZDJ 3ZQQA 2XF6A 1QGPA 3K10A 1MNMC 2XKOA 2BHYA 2F2EA 5IT9K 2XRNA 5C3EJ 1XMAA 2HOAA 2WA0A 1W0UA 4M6YA 3I0TA 5FB2A 4G6TB 4P9UA 1GHCA 3WU2C 1BI2A 2XAHA 2X1DA 3CJTB 2A6TA 5DUIA 2L9RA 5FO5A 1YTYA 4CUGA 5F0HA 5DM6F 2LYCA 3MCZA 2R5YB 5EFYA 2NVYJ 4A12A 2HU9A 1ZELA 3MKYB 4BDZA 1MW7A 1YO5C 4A3CJ 1JUMA 4BEHB 4BJTA 4BXXJ 5LGNA 1BIAA 3UR3C 5E3MA 1UAAA 4A3DJ 3K4JA 1R6RA 3FDYA 4H4KC 5CVVA 2EINH 2BW3B 2VKHA 2K3PA 4WK8F 1O7LA 3A2KA 2VQHA 5CJ9A 2IGMA 4G8XA 2HQRA 2LBFB 5B5EC 3HOZJ 1WJFA 3K4MA 3IKTA 1APLC 1FY7A 1LFBA 4ZZDA 1PJRA 4XKWA 3O2PE 4M9ZA 1IRXA 4IHXA 2O8XA 1AWCA 3MEXA 2CGPA 4OIPF 2HPIA 4X0GA 4LIVA 3K6GA 3DBRB 3HTHA 4NNJA 2RNGA 2BYVE 3FBIB 5EG0A 1EH8A 2ZNYA 3H5RA 2ZXJA 1J9IA 2FOKA 4UUSA 3LHQA 3RIRA 3CCMI 1E0EA 3ABKH 3K4KA 4WIBA 3G1OA 2CU7A 3I5UA 5H20A 1J2XA 4JYKA 3LWFA 3JREA 2O6GE 2STTA 4XN0A 5HBUA 3D0SA 2W25A 2DMQA 5CQEA 3BT9A 1JUPA 2GA1A 3CCEI 1SFKA 3E5QA 2P7CB 2Q8KA 3GLLA 1LEAA 3E6MA 2O8KA 1FBQA 3OYKA 2ZSHB 2V1XA 1FTTA 4UVBA 5IT3A 1QHGA 2ISZA 2A5WA 3AG1H 1XCBA 2O3FA 1V3FA 1W36C 2F4MB 2N8GA 1YLFA 2ID6A 2QQ9A 2VODA 4IL6C 3CO6C 4O3MA 3ZOBA 1DDNA 4G94A 5DEQA 5H6QA 3JRCA 2GUHA 1FP2A 3MKZA 2D45A 2OERA 1WPKA 1WRJA 2FNAA 3FXOA 2OZUA 3KEOA 2JA2A 2BY0A 2EB7A 2DQRA 1SMYF 4XSZF 3BTLA 3J7AO 2REKA 4ENKA 2DOEA 3ZN0A 5HAWA 1A04A 2WV1A 2ESNA 5EZGA 4IEJA 1NG7A 3CMYA 2DAOA 3LFUA 2YS9A 5TJJA 2Z9OA 2WAQA 1UMQA 1STZA 3WODF 5DDGA 1AKHB 1Z05A 4YIFA 5L3DA 4ZTJA 2CG4A 3RYPA 4AIDA 1EJ9A 4WWCA 5GP9A 2BY3A 2W4SA 5LBQA 2FJ1A 3GTPJ 4GFLA 5GAGJ 3BJBA 3LSIA 3ML6A 4PJ0C 2ZCXA 2W1OA 1RI7A 4WXHA 2HWVA 2PI0A 5D4SA 3VPRA 4F93B 2CO5A 3IWFA 2X1CA 3GTLJ 2Y0SN 3C7JA 2XASA 1G3YA 2NRAC 4NC8A 3QKXA 1BOAA 1XDUA 5GAHJ 5KAFC 3CMMA 2WAEA 2E5ZA 5D6EA 4A3KJ 3OYGA 1X3UA 3FWEA 2L7MP 3FMSA 4G7OF 4J00A 1T39A 2M45A 2LKPA 3E5XA 3I4PA 1JUSA 5AIPA 2JRTA 3JAMZ 1MBJA 2IGNA 1EV7A 4A5MA 4A6DA 1BC7C 2Z3YA 2MLGA 1IXRC 3KYDB 1OYWA 1A31A 2KHMA 4XORA 1RUNA 4HBLA 1IJWC 3DTIA 2NXNB 3EYIA 3K69A 3W6JB 2XDVA 3OSGA 2RN7A 5DYMA 2L5QA 3S15J 2DOAA 4HQEA 3VVYA 4Z6YA 3LA3A 3BJ6A 4FETA 5B1BH 1S72I 5FJ8J 1UHSA 3OYHA 4ENNA 2DXIA 1Y0UA 1ZRDA 3HOXJ 1RR7A 1S29A 2O7OA 5E17F 5DCMA 4LB5A 3BG9A 1J0RA 5B1AH 1VQKI 3HOSA 4XOTA 2YU9J 2ISYA 3LAPA 3K70D 3DFGA 3S3MA 2B9SA 1SD5A 3ZN1A 1Z1DA 3K0LA 2JUGA 4L9VA 1BC8C 5HDKA 2R93J 2NS0A 3BROA 3TO6A 4EMSA 2VBZA 5FKLA 4XICA 3ZRGA 3P9TA 4XK4A 1FTZA 4I0AA 2X6WA 2FBQA 5ILSA 1O57A 2MABA 4DIQA 5HS8A 2TRTA 1RKTA 2DW4A 4DYCA 1GDTA 3I55I 2NVTJ 3HOYJ 2ZMEC 3HGGA 3GFIA 1X1CA 3V7CA 5F08A 4IHSA 2QYOA 4F92B 2MYSA 3WGHA 3TP0A 1E3PA 1R4NB 2VLAA 1F1ZA 1SD4A 2L9VA 3HRSA 1R36A 2G7LA 2Q1ZB 1ITYA 6PAXA 2BXZA 3TEDA 3P9CA 1YFHA 1SVOA 2VPRA 3K4CA 3GTQJ 2M4GA 4CZCA 4XIDA 4Y3OA 3EUAA 1BJZA 1LDJA 5C4YA 3WTSC 3ZMUA 2O9LA 5E3LA 2VQCA 4NC6A 3BR0A 2R7ZJ 2H8WA 2JPBA 4EEFG 2PZ9A 1MBHA 9ANTA 5HLTA 1V5FA 3S5RA 2LTPA 1PP7U 1FBSA 2E35A 2EPFA 4L62A 3I71A 3G4SI 4MXMA 2HQAA 4LGWA 4YG2F 1O3TA 3HDDA 2ZXIA 5EF6A 1OCZH 1Z7UA 3BY6A 5K5QA 3HSEA 3PNTA 4E7JA 5F0FA 5HS9A 1SVMA 3GTOJ 2HXIA 2HI3A 2ZXWH 4B3AA 2ZJPF 3KYLA 2M3AA 3H1CA 3IH2A 4XN3A 4GFKA 3FHZA 4WF2A 4BKXA 5D5UB 3DWLE 4GRIA 4BH9A 5JHUA 3CUQC 5FGMA 2DO7A 2HEOA 5KNLA 1ZYRF 4MNUA 4EJTA 1MSEC 2FBHA 3QQAA 3DTEA 1PVEA 2DFFA 1KQ9A 3DEEA 1N25A 2FQ3A 1HBXG 4R79A 4V19K 3ANGA 2A6HF 3CCQI 1ZKGA 3I4MJ 1U3EM 1YS6A 1JI8A 3KFWX 1Y1VJ 2JN6A 4C9YA 3WTYC 3DLLF 2PX9A 3KZ9A 2R3SA 5IP7J 1E3OC 2HR3A 2CQNA 3JTGA 3PSFA 1OFCX 2OUMA 5FKNA 1HSTA 2NYXA 4BYYA 1TW2A 1EKEA 4O6JA 3QU3A 1UHMA 2FF4A 1IV8A 4PJMA 3G2BA 1VNDA 2WV0A 1BM9A 2RKHA 3MKWB 4C30A 4WCGA 3BQYA 2DJNA 4HLYA 3FMQA 1ON2A 3CF2A 2ECBA 4XQFA 3AKZA 3OYEA 2X51A 3TQNA 3LSHA 4NHJA 3JW4A 2FSWA 3OYNA 1LB2A 5FFXA 3L2QA 4FASD 2HDCA 1OCOH 3SDBA 5IPAA 1O3QA 1SMTA 2G3BA 3CJDA 1SAUA 4HF2A 1N75A 5J1RA 3ASOH 1JKPC 2OV7A 3R0JA 2PMHA 2LF7A 3BG5A 4YEJA 2QCOA 2PFBA 3R61A 2VN2A 1WHUA 3IKVA 3IL2A 1EF4A 5CVUA 4OWRB 2KMUA 1R22A 1I1GA 1OYYA 4KIGA 4RGXA 2VBXA 2K7LA 3EUHC 2QF7A 3TW7A 1FMVA 2VC1A 1OCPA 2XV4S 1LE8B 2W53A 1POGA 3R0AA 3FXKA 2CS3A 4A0XA 4BQAA 2NNNA 4M9SA 1I6XA 2HQNA 3B81A 4C3HJ 2KZVA 2AQFA 5D5WB 1OISA 3GCMA 2OQRA 2GOMA 3ERED 3HOUJ 2ZFUA 5IYDJ 4S0HB 2JWTA 2NAZA 5D4RA 1BL0A 2H8RA 4KNYA 5GTHC 4OAZA 1YW8A 2MLKA 3I3LA 3J81Z 3L2WA 2MH2A 1KA8A 1IV6A 3KKCA 2M2EA 1FOYA 4Y33A 1R23A 3OIPA 4CCMA 3VFZA 1D3YA 1IDYA 4WXCA 2HTSA 2DPUA 1MJAA 4M74A 3HOWJ 3RDIA 2W57A 1MKMA 2CQXA 3WG9A 1LVAA 1XX5A 2BXYA 5CQGA 2KISA 1HF0A 5FROA 2JQ7A 5IT9Z 3BQZA 4AU7A 2IRFG 2H1LA 1B4AA 5M5XJ 3K4BA 3J81K 1U9OA 1UZCA 5C44J 4A3FJ 3VYRB 1M1EB 2QSFX 4X1EA 2XAGA 3X2QH 3A1YA 5FKKA 5E79C 1T33A 4Y15A 5J4VA 4MGRA 1NHAA 3IUVA 4JNNA 2L9SA 2EIMH 2HXOA 3D5LA 1UG0A 4DBQA 3B6CA 1CQTA 4HX8A 2IVMA 2DT7B 3AG2H 1W36D 2AO9A 5ICCA 4Z2YA 2QQBA 3L9FA 1WI3A 3H9JA 3NRGA 1Q1VA 1R1TA 1TT5B 3LFKA 3CP2A 4P96A 1ON1A 3OV8A 3RJPA 2DG7A 5E1ZB 4CA0A 3VP5A 2Q2EA 1ONVA 3OIOA 4OIRF 4F55A 4XOPA 4XLAA 4IO9F 4BE0A 2K86A 2L7ZA 4HPQA 4ZH4F 1R00A 2E60A 5LHGA 2Y0MA 1IZ1A 4KWAA 3HYIA 4FISA 4JOMA 2B3WA 4OIOF 3TO9A 4HX7A 4A3IJ 2F5CA 3BDDA 2KLOA 4IZZA 4HDVA 2HKUA 2QM3A 4CZZA 4A0ZA 4ANJA 2IA1A 4AIJA 2VE9A 4DYRA 2YU3A 4JBAA 3U2RA 4PUSA 4KICA 2A07F 3E6BA 4U7BA 1LPQA 4B8XA 5JI6A 3W2AA 2HYGD 1U8RA 4IJAA 2W84A 2EZLA 3DEUA 4CICA 3L09A 4PFPA 2M1BA 4XKCA 1P92A 1QO0D 5L3FA 1VI0A 2WC2A 2P5LC 5J47A 3E6DA 5K7FA 1B72B 3BP8A 3K9TA 2P5VA 1KU2A 3IC7A 1ETKA 2DCEA 3OL4A 1X1BA 4HQMA 1O4XA 1GVJA 2OAZA 1R5ID 2OCCH 1S7EA 1YQAA 1DPUA 4CYCA 5ICEA 2W82A 4AWXB 4G7ZF 5M3FJ 4ZC3A 4LLNA 4M6XA 4OINF 3L2UA 5A2QK 2Z1DA 3BPVA 2OJED 3CRJA 1G3SA 2A69F 1PYVA 1WGXA 1MBEA 2CJJA 4V2GA 5M5WJ 3W6VA 4HX4A 1S7OA 2VT2A 2E19A 5EJCA 4MEXF 1FZPB 3NXCA 2FMLA 3I54A 1ZHFA 1BJAA 5FLXZ 3PO3J 1W0TA 1IRZA 2R7FA 2H94A 1Z67A 2GAUA 1IN5A 1X4PA 3DXJF 3ANPA 1W7PB 4HG2A 4M3EA 5J1UA 5LHHA 1Y0NA 2UXXA 2HZTA 1I50J 3CCSI 2O03A 2R7XA 2X4HA 3V7RA 3GWZA 3MWMA 3BCGA 1ZN2A 3U1KA 4CSWA 1ULYA 3ZP5A 4UY8I 2QKLB 4HEA2 1R49A 4U87A 1YW9A 3W2VA 4B3XA 4UB6C 3OYIA 2VPLA 3OS2A 3K8PC 2ECCA 1W7PA 1HW1A 5K1YA 4PFOA 1V55H 4L5IA 3ON2A 1QU3A 3RI4A 3QBMA 2K85A 3BCBA 3L2RA 5AONA 2NS8A 4IQJA 1D5YA 3BR3A 3FK7A 4J01A 3KEQA 2HOTA 1ZQ3P 1X1AA 4Y52J 4BS9A 1XGNA 2JSPA 3H5NA 3DTKA 2BBYA 2CUEA 1J09A 3SWHA 4OOIA 5E8GA 2JVGA 2L01A 2XKPA 2OC6A 3QP5A 4DNCA 3G6EI 1MDMA 1XGMA 1TWGJ 1WH7A 3I9V2 1X3ZB 2DFEA 1V5GA 4BY7J 4D5FA 3G71I 1G3WA 2IS2A 3SEZA 3T5XA 3F8FA 4AYBA 2DA7A 2DT6A 3BTJA 4N4OB 2CW8A 3WE2A 1ZLJA 2OPTA 4ZDLA 3RPQA 1H8AC 3DPTA 3M8JA 3J80K 4NUBA 2PMZA 5IOYA 2MC3A 3FBNB 2YR2A 1XGOA 3H0DA 1UJ8A 3FF5A 1MH3A 2B63J 4BHCA 2AQEA 3VSLA 3CC4I 5GAEJ 3JRFA 5E1XA 3RCOA 1S9HA 3M8EA 4MTDA 2XSDC 2DA5A 1OR7C 2VXDA 1QNTA 1SFOJ 3OYMA 1CGPA 2LBFA 3HUGA 4U0YA 3HTIA 5J40A 2R92J 4KMFA 3OIQA 3HUGB 3JRIA 4EJOA 4ME9A 2QUFA 4BQNA 3NNRA 3F3XA 2ZJQF 1U78A 1FIPA 3Q0VA 5GTIC 4HV5A 3S3NA 1G2HA 2IGOA 1XMKA 3LL7A 3HSRA 4RM3A 1ZRCA 4BU2A 3F8NA 4U7DA 2EZHA 3IH4A 3NEUA 4ZDOA 5D1RA 5JFRA 1H0MA 2F07A 2VKDA 2X6OA 5F64A 1XTAA 5F04A 3RYRA 2EBIA 2HKOA 1IN6A 1D1AA 2OU2A 3B73A 1VQ6I 1UHWA 4BBRJ 1MMGA 2YPRA 2R5ZB 4L5JA 1EH7A 4EGZA 2GBYA 3BR2A 2X0LA 2K3FA 2K4BA 1EH6A 2ZSIB 4G12A 5BNGA 3O3KA 1VQ7I 1K79A 3S2HJ 3WHBA 3DKWA 3CMEI 2KDOA 3IRQA 1AOYA 2E1MB 1ZK8A 4UB8C 2H1KA 3KEYA 1ZG3A 1U8BA 4IHVA 3W2WA 3S2WA 3OSFA 4OD5A 4F7ZA 3VEPA 5F6FA 4RGSA 3GZ6A 3QAHA 3EQLF 3F23A 3LQQA 2RDPA 4CCOA 3BRUA 1TLHB 2MBFA 3KIOA 1WI9A 1XS9A 2LRDA 3F8CA 1DU6A 2RV8A 2QQAA 1WJBA 3HSFA 4Q48A
chains in the Genus database with same CATH topology
2G7LA 2P81A 2JJ7A 4ACIA 1ITYA 4D5CA 3UKGA 1RESA 2VKEA 3HB9A 2G7SA 3E7QA 3BHQA 3NI7A 3TEDA 3GTMJ 2VPRA 3GTQJ 2COBA 1UI6A 4XIDA 1BJZA 2EQRA 3BR6A 3G1LA 5C4YA 2O9LA 4YZEA 4QIWN 5E3LA 3G56A 2R7ZJ 3BR0A 4EEFG 2LY9A 2PZ9A 2E2HJ 1QVUA 1MBHA 2LVSA 2ME0A 4XRSG 3Q0WA 2ZCMA 9ANTA 3QPLA 4XRSA 3S5RA 2LTPA 2GENA 5K58A 4RBOA 2K9SA 3HTAA 4L62A 3LOCA 3LJLA 2UXUA 1QPIA 2QTQA 3VVZA 4MXMA 1RETA 1ZR2A 3HDDA 5EF6A 1B72A 1UI5A 2CRGA 4JKZA 3RD3A 1Z77A 4UUSB 4FCYA 1IUFA 4A3JJ 1HCRA 5F0FA 4A3GJ 3GTOJ 3VW0A 2HXIA 2HI3A 1K61A 1FIAA 2E2JJ 4B3AA 1NTCA 5CXIA 4DW6A 2HDDA 3IH2A 3WHCA 4GFKA 2K9NA 4IHWA 4BKXA 2O7TA 3BTCA 2X48A 4V2FA 1JJ8C 5IYCJ 2WB1N 3QPSA 4L5EA 4CYCB 3G7RA 4M3BA 2LD5A 2WUIA 1NK2P 1X58A 2I10A 2M34A 4Y7NJ 1MSEC 1JKRC 3QQAA 3S17J 5F27A 4JP0A 1QVTA 4QTRA 3ZQLA 3TP3A 3HOVJ 4FE4A 4FE7A 3ANGA 5D18A 1ZKGA 3I4MJ 4M3GA 5FMPA 1Y1VJ 2JN6A 1H88C 1XG1A 1FEXA 3KZ9A 4NELA 5IP7J 2GFNA 1TWCJ 3M3YJ 1E3OC 1T56A 3T6NA 4D7NA 1JTXA 1OFCX 5FKNA 3MVPA 3PO2J 3HTJA 3RZOJ 4GCKA 1NK3P 5JLWA 2PBXA 3LWJA 4C2MJ 2DTZA 1MBFA 2Y31A 4A3EJ 1U9NA 1VNDA 1WCMJ 1ETXA 4PXIA 2D6YA 5FGLA 3V78A 4GCLA 2EH3A 2DJNA 3BQYA 2ZCNA 2ECBA 3GBGA 3IH3A 2LLKA 3CWRA 1F36A 4RDUA 1IG7A 5IPAA 2G3BA 3B6AA 3CJDA 3ZQFA 4JL3A 3FISA 3G1MA 5J1RA 3Q3SA 4W1UA 1YRNA 1MBKA 1JKPC 1B8IB 3PPBA 3NAUA 4X6AJ 3BG5A 3O8GA 2QCOA 3AQSA 3I4NJ 5D19A 3HEFA 3RH2A 2GLOA 2NVXJ 5FLVA 1EF4A 5F0CA 2LP0A 1PUFB 2KT0A 2EZKA 5EGOB 3KNWA 2YVHA 3FK6A 3VOKA 2UXHA 2QF7A 3TW7A 1ETVA 1OCPA 1LE8B 2W53A 2LR8A 1POGA 2WGBA 3GEUA 4ABZA 2DMPA 1GUUA 5IOZA 3F0CA 5EZHA 3CCYA 5DAJA 1ETYA 1IC8A 3VIBA 2IAIA 1AKHA 3B81A 1HDPA 4C3HJ 4B1RA 2L7FP 5J3LA 3PASA 2VUMJ 2JA7J 3HOUJ 4DZPA 3BNIA 1X2NA 1GVDA 2ME6A 3JRHA 3E7LA 5GPAA 5IYDJ 4NN1A 4S0HB 2JWTA 1BL0A 2H8RA 2XDNA 3HBLA 5IYBJ 5FKMA 2PMZN 1IV6A 3KKCA 2M2EA 4AC0A 1BA5A 1R9TJ 2DA3A 2G0EA 1HLVA 3GTKJ 3JSJA 2IU5A 1QRYA 2MG4A 1AU7A 1AHDP 1IDYA 2XPWA 5EDNA 3LNQA 4JX6A 4B4CA 2DN0A 3HOWJ 2OI8A 2R5YA 1MSFC 2CQXA 4M6VA 1MBGA 2FQ4A 1TWAJ 1HF0A 3ZQGA 3BQZA 3M4OJ 5M5XJ 3HGYA 3SDGA 1RKWA 1B8IA 2DG8A 4LOCA 1U9OA 5C44J 1Z0XA 1DU0A 3EUPA 4A3FJ 4A69C 4X1EA 1XC5A 2XPVA 2ZOYA 2JA8J 2NS7A 3S1QJ 4DYQA 1LE8A 2UXOA 1OCTC 5FKKA 3H0GJ 1T33A 3JRAA 2NVQJ 3PM1A 3IUVA 2X9DA 4JNNA 2TCTA 2HXOA 2QWTA 3KKDA 2E2IJ 3B6CA 2IEKA 1CQTA 3EGQA 5FKOA 4MLOA 4AF5A 2AO9A 1Y1WJ 1ZGWA 4A93J 3MN2A 5EEAA 2NP3A 2GM4A 1WI3A 3S16J 4C3JJ 3NRGA 1Q1VA 3JR9A 3GTGJ 1P7IA 4UDSA 1I3QJ 2RHAA 1LFUP 1GT0C 3TW6A 4I76A 3V6GA 2DG7A 5DS9A 3VP5A 3GTJJ 2LFBA 3OIOA 3IV5A 2QKOA 2MGQA 4AYBN 5J1YA 3VUQA 2L7ZA 3S1NJ 4D7MA 2HOSA 2L0KA 2JK3A 2K9QA 2M9HA 3CDLA 4KWAA 2XGEA 4FISA 3S1RJ 1VF9A 3JRBA 2RASA 2ZOZA 2YUSA 3FRQA 2DA1A 4A3IJ 2HKUA 5IP6A 1JT6A 1VFCA 1A6IA 2DMNA 2CUFA 4DYRA 1HDDC 2NOGA 3RZDJ 2CQQA 2HQ5A 1GV5A 3RQIA 2XPUA 3K2AA 4A3MJ 1MNMC 2JMWA 4CGRA 5C3EJ 2HOAA 2AHQA 2EZLA 1W0UA 1HOMA 3LSRA 5HODA 1VI0A 1B72B 5K7FA 3L1PA 3RKQA 2L9RA 5M5YJ 4J19A 2R5ZA 5M3MJ 3FKIJ 1ETKA 5F0HA 1SANA 2R5YB 1O4XA 5EFYA 2NVYJ 2VKVA 2DA6A 5EGOA 1S7EA 4A3CJ 1JUMA 2EZIA 4BXXJ 5CXGA 4CYCA 1H89C 3A01B 5E3MA 3MKLA 4A3DJ 3HIMA 5M3FJ 1JKOC 5FHPA 4BBSJ 1OJLA 2W48A 3F1BA 3CRJA 1K83J 3HOZJ 3MNLA 1ZR4A 1APLC 1WGXA 1MBEA 2CJJA 4V2GA 5M5WJ 1YRNB 3W6VA 2QOPA 2UXPA 1UG2A 1LFBA 2E19A 3NXCA 3DCFA 2G7GA 3BR1A 5K7HA 4IHXA 4UUTA 3PO3J 3GZIA 5CW8A 4MK6A 4HNVA 1W0TA 1IRZA 3BR5A 2IBDA 5JLXA 3HTHA 2XGDA 3ZQHA 5EG0A 3ANPA 1JT0A 4M3EA 5J1UA 2KDZA 4UUSA 4BY1J 3LHQA 3O60A 2R0QC 4A3LJ 1I50J 4GFBA 3VVXA 3G1OA 2CU7A 3COLA 4C3IJ 3SFIA 3BCGA 5H9TA 4JYKA 3JREA 5HBUA 2LK2A 2DMQA 3BT9A 1JUPA 2ECCA 5EYRA 3NPIA 1GV2A 2O8KA 3DPJA 1RPWA 3ON2A 1SGMA 3HE0A 3D1NI 3LSJA 2XB5A 3QBMA 1FTTA 2K40A 2YVEA 2NS8A 1MH4A 2LKXA 1D5YA 3BR3A 3FK7A 3CQZJ 4XRMA 3SJMA 2HOTA 1ZQ3P 5E3NA 4Y52J 4MFEA 2XB0X 5K7ZA 2N8GA 2M0CA 3BTIA 3S1MJ 2ID6A 2CUEA 4MFDA 1BW5A 1ETOA 2FX0A 3ZOBA 2RAEA 3FIWA 3VW1A 3JRCA 1P7JA 2NX4A 1ETWA 5IP9J 2GUHA 2OERA 1WPKA 2E1OA 1TWGJ 1WH7A 4A3BJ 3BTLA 2MSYA 4MIMA 5F1JA 4BY7J 2REKA 4D5FA 5HAWA 2JA5J 2WV1A 5EZGA 4M3FA 2FD5A 4IEJA 3CMYA 5FLMJ 2YS9A 1UMQA 1AKHB 4I6ZA 2OF7A 1ENHA 1BW6A 2DA7A 2Y30A 3BTJA 5GP9A 1ZTRA 2FJ1A 3GTPJ 4GFLA 3BJBA 4GCTA 2OPTA 3ZQIA 1H8AC 2JA6J 5GPCA 5IOYA 2ZCXA 1A5JA 1FJLA 3VPRA 4JX4A 3GTLJ 2Y0SN 3S2DJ 2ZB9A 1TWFJ 2WAQN 3QKXA 1MH3A 2B63J 3LSPA 5C4JJ 4ICHA 4A3KJ 3JRFA 3C2BA 1F43A 2NP5A 3S14J 3JRGA 2XSDC 2L7MP 2DA5A 1SFOJ 1JGGA 1X2MA 1WH5A 2M8GX 4AUXA 1JJ6C 3HTIA 4MO7A 2R92J 5E3OA 1JUSA 1MBJA 3JRIA 4ME9A 3NNRA 1TWHJ 1U78A 1FIPA 3Q0VA 3C07A 1G2HA 2Q24A 1IJWC 3NARA 2ID3A 3Q0UA 3VW2A 3OOUA 3H3VK 3OSGA 4NDLA 2D5VA 2EZHA 3IH4A 1JKQC 2DMUA 2Y9YA 3HKZN 5D1RA 1ETQA 3S15J 2F07A 2ELKA 2QIBA 4HKUA 2X6OA 3VVYA 2HYTA 2V57A 3JRDA 1JTYA 5F04A 4JX5A 5FJ8J 1UHSA 5HSZA 2XGCA 4DZJA 2EBIA 5DTDA 3BG3A 3VOXA 3HOXJ 1RR7A 3ZQCA 1TC3C 2O7OA 4BBRJ 2R5ZB 3BG9A 2DA2A 2GBYA 3BR2A 2UXIA 3HM5A 4IHYA 4G12A 2HYJA 4W97A 1IGNA 5BNGA 2YU9J 1IDZA 1ORKA 3S2HJ 3K7AJ 2VI6A 3WHBA 4FTHA 2DMTA 1ZK8A 2H1KA 2R93J 2DA4A 5AQCA 1U8BA 4IHVA 4M3DA 3DEWA 4XICA 5FKLA 3P9TA 4XK4A 3OSFA 2Y2ZA 3A03A 1FTZA 1I6HJ 3A02A 3A01A 3O8HA 2FBQA 4QSHA 2MW8A 1PUFA 5C4XJ 2TRTA 1RKTA 4DYCA 3LSGA 4AC6A 1GDTA 3BRUA 3AQTA 3ON4A 2XRLA 2NVTJ 3HOYJ 2Y9ZA 3HGGA 1XS9A 5F08A 1DU6A 5EG0B 3TP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7L A;  2P81 A;  2JJ7 A;  4ACI A;  1ITY A;  4D5C A;  3UKG A;  1RES A;  2VKE A;  3HB9 A;  2G7S A;  3E7Q A;  3BHQ A;  3NI7 A;  3TED A;  3GTM J;  2VPR A;  3GTQ J;  2COB A;  1UI6 A;  4XID A;  1BJZ A;  2EQR A;  3BR6 A;  3G1L A;  5C4Y A;  2O9L A;  4YZE A;  4QIW N;  5E3L A;  3G56 A;  2R7Z J;  3BR0 A;  4EEF G;  2LY9 A;  2PZ9 A;  2E2H J;  1QVU A;  1MBH A;  2LVS A;  2ME0 A;  4XRS G;  3Q0W A;  2ZCM A;  9ANT A;  3QPL A;  4XRS A;  3S5R A;  2LTP A;  2GEN A;  5K58 A;  4RBO A;  2K9S A;  3HTA A;  4L62 A;  3LOC A;  3LJL A;  2UXU A;  1QPI A;  2QTQ A;  3VVZ A;  4MXM A;  1RET A;  1ZR2 A;  3HDD A;  5EF6 A;  1B72 A;  1UI5 A;  2CRG A;  4JKZ A;  3RD3 A;  1Z77 A;  4UUS B;  4FCY A;  1IUF A;  4A3J J;  1HCR A;  5F0F A;  4A3G J;  3GTO J;  3VW0 A;  2HXI A;  2HI3 A;  1K61 A;  1FIA A;  2E2J J;  4B3A A;  1NTC A;  5CXI A;  4DW6 A;  2HDD A;  3IH2 A;  3WHC A;  4GFK A;  2K9N A;  4IHW A;  4BKX A;  2O7T A;  3BTC A;  2X48 A;  4V2F A;  1JJ8 C;  5IYC J;  2WB1 N;  3QPS A;  4L5E A;  4CYC B;  3G7R A;  4M3B A;  2LD5 A;  2WUI A;  1NK2 P;  1X58 A;  2I10 A;  2M34 A;  4Y7N J;  1MSE C;  1JKR C;  3QQA A;  3S17 J;  5F27 A;  4JP0 A;  1QVT A;  4QTR A;  3ZQL A;  3TP3 A;  3HOV J;  4FE4 A;  4FE7 A;  3ANG A;  5D18 A;  1ZKG A;  3I4M J;  4M3G A;  5FMP A;  1Y1V J;  2JN6 A;  1H88 C;  1XG1 A;  1FEX A;  3KZ9 A;  4NEL A;  5IP7 J;  2GFN A;  1TWC J;  3M3Y J;  1E3O C;  1T56 A;  3T6N A;  4D7N A;  1JTX A;  1OFC X;  5FKN A;  3MVP A;  3PO2 J;  3HTJ A;  3RZO J;  4GCK A;  1NK3 P;  5JLW A;  2PBX A;  3LWJ A;  4C2M J;  2DTZ A;  1MBF A;  2Y31 A;  4A3E J;  1U9N A;  1VND A;  1WCM J;  1ETX A;  4PXI A;  2D6Y A;  5FGL A;  3V78 A;  4GCL A;  2EH3 A;  2DJN A;  3BQY A;  2ZCN A;  2ECB A;  3GBG A;  3IH3 A;  2LLK A;  3CWR A;  1F36 A;  4RDU A;  1IG7 A;  5IPA A;  2G3B A;  3B6A A;  3CJD A;  3ZQF A;  4JL3 A;  3FIS A;  3G1M A;  5J1R A;  3Q3S A;  4W1U A;  1YRN A;  1MBK A;  1JKP C;  1B8I B;  3PPB A;  3NAU A;  4X6A J;  3BG5 A;  3O8G A;  2QCO A;  3AQS A;  3I4N J;  5D19 A;  3HEF A;  3RH2 A;  2GLO A;  2NVX J;  5FLV A;  1EF4 A;  5F0C A;  2LP0 A;  1PUF B;  2KT0 A;  2EZK A;  5EGO B;  3KNW A;  2YVH A;  3FK6 A;  3VOK A;  2UXH A;  2QF7 A;  3TW7 A;  1ETV A;  1OCP A;  1LE8 B;  2W53 A;  2LR8 A;  1POG A;  2WGB A;  3GEU A;  4ABZ A;  2DMP A;  1GUU A;  5IOZ A;  3F0C A;  5EZH A;  3CCY A;  5DAJ A;  1ETY A;  1IC8 A;  3VIB A;  2IAI A;  1AKH A;  3B81 A;  1HDP A;  4C3H J;  4B1R A;  2L7F P;  5J3L A;  3PAS A;  2VUM J;  2JA7 J;  3HOU J;  4DZP A;  3BNI A;  1X2N A;  1GVD A;  2ME6 A;  3JRH A;  3E7L A;  5GPA A;  5IYD J;  4NN1 A;  4S0H B;  2JWT A;  1BL0 A;  2H8R A;  2XDN A;  3HBL A;  5IYB J;  5FKM A;  2PMZ N;  1IV6 A;  3KKC A;  2M2E A;  4AC0 A;  1BA5 A;  1R9T J;  2DA3 A;  2G0E A;  1HLV A;  3GTK J;  3JSJ A;  2IU5 A;  1QRY A;  2MG4 A;  1AU7 A;  1AHD P;  1IDY A;  2XPW A;  5EDN A;  3LNQ A;  4JX6 A;  4B4C A;  2DN0 A;  3HOW J;  2OI8 A;  2R5Y A;  1MSF C;  2CQX A;  4M6V A;  1MBG A;  2FQ4 A;  1TWA J;  1HF0 A;  3ZQG A;  3BQZ A;  3M4O J;  5M5X J;  3HGY A;  3SDG A;  1RKW A;  1B8I A;  2DG8 A;  4LOC A;  1U9O A;  5C44 J;  1Z0X A;  1DU0 A;  3EUP A;  4A3F J;  4A69 C;  4X1E A;  1XC5 A;  2XPV A;  2ZOY A;  2JA8 J;  2NS7 A;  3S1Q J;  4DYQ A;  1LE8 A;  2UXO A;  1OCT C;  5FKK A;  3H0G J;  1T33 A;  3JRA A;  2NVQ J;  3PM1 A;  3IUV A;  2X9D A;  4JNN A;  2TCT A;  2HXO A;  2QWT A;  3KKD A;  2E2I J;  3B6C A;  2IEK A;  1CQT A;  3EGQ A;  5FKO A;  4MLO A;  4AF5 A;  2AO9 A;  1Y1W J;  1ZGW A;  4A93 J;  3MN2 A;  5EEA A;  2NP3 A;  2GM4 A;  1WI3 A;  3S16 J;  4C3J J;  3NRG A;  1Q1V A;  3JR9 A;  3GTG J;  1P7I A;  4UDS A;  1I3Q J;  2RHA A;  1LFU P;  1GT0 C;  3TW6 A;  4I76 A;  3V6G A;  2DG7 A;  5DS9 A;  3VP5 A;  3GTJ J;  2LFB A;  3OIO A;  3IV5 A;  2QKO A;  2MGQ A;  4AYB N;  5J1Y A;  3VUQ A;  2L7Z A;  3S1N J;  4D7M A;  2HOS A;  2L0K A;  2JK3 A;  2K9Q A;  2M9H A;  3CDL A;  4KWA A;  2XGE A;  4FIS A;  3S1R J;  1VF9 A;  3JRB A;  2RAS A;  2ZOZ A;  2YUS A;  3FRQ A;  2DA1 A;  4A3I J;  2HKU A;  5IP6 A;  1JT6 A;  1VFC A;  1A6I A;  2DMN A;  2CUF A;  4DYR A;  1HDD C;  2NOG A;  3RZD J;  2CQQ A;  2HQ5 A;  1GV5 A;  3RQI A;  2XPU A;  3K2A A;  4A3M J;  1MNM C;  2JMW A;  4CGR A;  5C3E J;  2HOA A;  2AHQ A;  2EZL A;  1W0U A;  1HOM A;  3LSR A;  5HOD A;  1VI0 A;  1B72 B;  5K7F A;  3L1P A;  3RKQ A;  2L9R A;  5M5Y J;  4J19 A;  2R5Z A;  5M3M J;  3FKI J;  1ETK A;  5F0H A;  1SAN A;  2R5Y B;  1O4X A;  5EFY A;  2NVY J;  2VKV A;  2DA6 A;  5EGO A;  1S7E A;  4A3C J;  1JUM A;  2EZI A;  4BXX J;  5CXG A;  4CYC A;  1H89 C;  3A01 B;  5E3M A;  3MKL A;  4A3D J;  3HIM A;  5M3F J;  1JKO C;  5FHP A;  4BBS J;  1OJL A;  2W48 A;  3F1B A;  3CRJ A;  1K83 J;  3HOZ J;  3MNL A;  1ZR4 A;  1APL C;  1WGX A;  1MBE A;  2CJJ A;  4V2G A;  5M5W J;  1YRN B;  3W6V A;  2QOP A;  2UXP A;  1UG2 A;  1LFB A;  2E19 A;  3NXC A;  3DCF A;  2G7G A;  3BR1 A;  5K7H A;  4IHX A;  4UUT A;  3PO3 J;  3GZI A;  5CW8 A;  4MK6 A;  4HNV A;  1W0T A;  1IRZ A;  3BR5 A;  2IBD A;  5JLX A;  3HTH A;  2XGD A;  3ZQH A;  5EG0 A;  3ANP A;  1JT0 A;  4M3E A;  5J1U A;  2KDZ A;  4UUS A;  4BY1 J;  3LHQ A;  3O60 A;  2R0Q C;  4A3L J;  1I50 J;  4GFB A;  3VVX A;  3G1O A;  2CU7 A;  3COL A;  4C3I J;  3SFI A;  3BCG A;  5H9T A;  4JYK A;  3JRE A;  5HBU A;  2LK2 A;  2DMQ A;  3BT9 A;  1JUP A;  2ECC A;  5EYR A;  3NPI A;  1GV2 A;  2O8K A;  3DPJ A;  1RPW A;  3ON2 A;  1SGM A;  3HE0 A;  3D1N I;  3LSJ A;  2XB5 A;  3QBM A;  1FTT A;  2K40 A;  2YVE A;  2NS8 A;  1MH4 A;  2LKX A;  1D5Y A;  3BR3 A;  3FK7 A;  3CQZ J;  4XRM A;  3SJM A;  2HOT A;  1ZQ3 P;  5E3N A;  4Y52 J;  4MFE A;  2XB0 X;  5K7Z A;  2N8G A;  2M0C A;  3BTI A;  3S1M J;  2ID6 A;  2CUE A;  4MFD A;  1BW5 A;  1ETO A;  2FX0 A;  3ZOB A;  2RAE A;  3FIW A;  3VW1 A;  3JRC A;  1P7J A;  2NX4 A;  1ETW A;  5IP9 J;  2GUH A;  2OER A;  1WPK A;  2E1O A;  1TWG J;  1WH7 A;  4A3B J;  3BTL A;  2MSY A;  4MIM A;  5F1J A;  4BY7 J;  2REK A;  4D5F A;  5HAW A;  2JA5 J;  2WV1 A;  5EZG A;  4M3F A;  2FD5 A;  4IEJ A;  3CMY A;  5FLM J;  2YS9 A;  1UMQ A;  1AKH B;  4I6Z A;  2OF7 A;  1ENH A;  1BW6 A;  2DA7 A;  2Y30 A;  3BTJ A;  5GP9 A;  1ZTR A;  2FJ1 A;  3GTP J;  4GFL A;  3BJB A;  4GCT A;  2OPT A;  3ZQI A;  1H8A C;  2JA6 J;  5GPC A;  5IOY A;  2ZCX A;  1A5J A;  1FJL A;  3VPR A;  4JX4 A;  3GTL J;  2Y0S N;  3S2D J;  2ZB9 A;  1TWF J;  2WAQ N;  3QKX A;  1MH3 A;  2B63 J;  3LSP A;  5C4J J;  4ICH A;  4A3K J;  3JRF A;  3C2B A;  1F43 A;  2NP5 A;  3S14 J;  3JRG A;  2XSD C;  2L7M P;  2DA5 A;  1SFO J;  1JGG A;  1X2M A;  1WH5 A;  2M8G X;  4AUX A;  1JJ6 C;  3HTI A;  4MO7 A;  2R92 J;  5E3O A;  1JUS A;  1MBJ A;  3JRI A;  4ME9 A;  3NNR A;  1TWH J;  1U78 A;  1FIP A;  3Q0V A;  3C07 A;  1G2H A;  2Q24 A;  1IJW C;  3NAR A;  2ID3 A;  3Q0U A;  3VW2 A;  3OOU A;  3H3V K;  3OSG A;  4NDL A;  2D5V A;  2EZH A;  3IH4 A;  1JKQ C;  2DMU A;  2Y9Y A;  3HKZ N;  5D1R A;  1ETQ A;  3S15 J;  2F07 A;  2ELK A;  2QIB A;  4HKU A;  2X6O A;  3VVY A;  2HYT A;  2V57 A;  3JRD A;  1JTY A;  5F04 A;  4JX5 A;  5FJ8 J;  1UHS A;  5HSZ A;  2XGC A;  4DZJ A;  2EBI A;  5DTD A;  3BG3 A;  3VOX A;  3HOX J;  1RR7 A;  3ZQC A;  1TC3 C;  2O7O A;  4BBR J;  2R5Z B;  3BG9 A;  2DA2 A;  2GBY A;  3BR2 A;  2UXI A;  3HM5 A;  4IHY A;  4G12 A;  2HYJ A;  4W97 A;  1IGN A;  5BNG A;  2YU9 J;  1IDZ A;  1ORK A;  3S2H J;  3K7A J;  2VI6 A;  3WHB A;  4FTH A;  2DMT A;  1ZK8 A;  2H1K A;  2R93 J;  2DA4 A;  5AQC A;  1U8B A;  4IHV A;  4M3D A;  3DEW A;  4XIC A;  5FKL A;  3P9T A;  4XK4 A;  3OSF A;  2Y2Z A;  3A03 A;  1FTZ A;  1I6H J;  3A02 A;  3A01 A;  3O8H A;  2FBQ A;  4QSH A;  2MW8 A;  1PUF A;  5C4X J;  2TRT A;  1RKT A;  4DYC A;  3LSG A;  4AC6 A;  1GDT A;  3BRU A;  3AQT A;  3ON4 A;  2XRL A;  2NVT J;  3HOY J;  2Y9Z A;  3HGG A;  1XS9 A;  5F08 A;  1DU6 A;  5EG0 B;  3TP0 A; 
#chains in the Genus database with same CATH topology
 2V9P A;  5DCF A;  5DD8 A;  4ESJ A;  3E7Q A;  3HB9 A;  4H0E A;  2RGV A;  4RMN A;  3NI7 A;  3CCR I;  4GXO A;  2EIJ H;  2DK8 A;  2COB A;  4BAY A;  1YHQ I;  4LLL A;  1UI6 A;  5ERI A;  3BR6 A;  4ASN A;  1FSH A;  1E17 A;  1K78 A;  1VQ5 I;  2LY9 A;  3MZH A;  2WY7 Q;  2ME0 A;  4XRS G;  3Q0W A;  4I98 B;  1T38 A;  3P9I A;  1WKM A;  4EM2 A;  4G9Y A;  1ERD A;  2GEN A;  4N0B A;  3V42 A;  1T6S A;  3DPL C;  4AVP A;  3E0J B;  1BIB A;  3LMM A;  1B9N A;  2QTQ A;  3VVZ A;  5LEJ A;  4I01 A;  1ZR2 A;  2E5N A;  2XAU A;  2VE8 A;  2DOF A;  4JKZ A;  1E3H A;  4FCY A;  3P7N A;  1SEU A;  4RA2 A;  5D6F A;  1HCR A;  4A3J J;  4HLX A;  3AAF A;  2GXA A;  4M72 A;  3WGI A;  4B09 A;  1FOX A;  1KU3 A;  2ETH A;  2PG4 A;  2QQ8 A;  1K61 A;  4IQ4 A;  1FIA A;  2E2J J;  4DW6 A;  2A2F X;  3SXY A;  2OTL I;  5LGT A;  2XC7 A;  4PSW A;  2K9N A;  2JSC A;  4ZTF A;  4QPQ A;  1LQ1 A;  4IHW A;  5EEG A;  2X48 A;  1G8X A;  1FLI A;  2BE5 F;  3DU5 A;  2WB1 N;  1BBY A;  4BEH A;  4L5E A;  3FKJ A;  1D0Z A;  2QSH X;  2BY2 A;  1X58 A;  2I10 A;  2M34 A;  2B7E A;  1JKR C;  2BW3 A;  2F5V A;  3ZQ7 A;  4PK4 A;  1R4M B;  1OKR A;  3IUO A;  4TV7 A;  1VQ8 I;  3HOV J;  3MQ0 A;  1TQP A;  2KRH A;  1N78 A;  3BCA A;  5D18 A;  3GVA A;  1KGS A;  5FMP A;  2R7R A;  5HNH A;  1XG1 A;  2LOO A;  4GO1 A;  2FEZ A;  2GXB A;  1OLT A;  3J7A Y;  1TWC J;  1T56 A;  1Z91 A;  3R60 A;  1PDN C;  4YIR X;  3PNY A;  4D7N A;  1WZ2 A;  1XSD A;  1JTX A;  3IRR A;  2ZME B;  2XAQ A;  5AIQ A;  3HOT A;  1W1W E;  3CF5 F;  3HTJ A;  2PBX A;  3LWJ A;  3KP4 A;  4RLF A;  5HLG A;  2DLL A;  1GXP A;  2DTZ A;  3ESW B;  3K1M A;  4RB1 A;  1ZH5 A;  4PXI A;  1U9N A;  2CW0 F;  4HF0 A;  3RPU D;  2D6Y A;  4F91 B;  1P2F A;  1YE9 A;  3H92 A;  3DKY A;  4HRI A;  2OZ6 A;  4ZYG A;  1SVL A;  2AXL A;  4NC7 A;  3VB2 A;  1LDD A;  1IG7 A;  2DDB A;  2IGK A;  2LKS A;  4E7K A;  1YIO A;  3ZQF A;  4PJJ A;  1J7K A;  3FIS A;  3G1M A;  1MBK A;  1B8I B;  3PPB A;  1FYM A;  2E1N A;  4N9I A;  1IN7 A;  1KYZ A;  3AQS A;  4XNF A;  1FX7 A;  3OY9 A;  3HEF A;  5LEK A;  1SAX A;  2NVX J;  2EWN A;  2V26 A;  2YSR A;  4BAC A;  3D5R C;  2LP0 A;  3M9A A;  5F0C A;  2KT0 A;  2VAS A;  4BE2 A;  4KYW A;  2EZK A;  1VQ4 I;  3ECH A;  5EGO B;  2HS5 A;  2YVH A;  1R5G A;  4NBQ A;  3DBL B;  2R7W A;  1SD7 A;  2CYY A;  3KE2 A;  3GEU A;  1KON A;  2DMP A;  4RB3 C;  1GLN A;  2FU4 A;  5IOZ A;  3R4K A;  3CCY A;  3AG4 H;  4IVN A;  1AKH A;  3GUD A;  2ZCW A;  2M7A A;  1ZG1 A;  4R1H A;  4B1R A;  2L7F P;  5J3L A;  1HSJ A;  1ZLK A;  1BN5 A;  4DZP A;  1X2N A;  4LK1 F;  1IN8 A;  1T98 A;  2ME6 A;  2HVS A;  4EJU A;  4NN1 A;  3IAS 2;  4IF4 A;  3V8J A;  1TNS A;  1KYW A;  1NG6 A;  3OS0 A;  1KQ8 A;  4NB5 A;  4GCV A;  5L3E A;  5FD5 A;  4ZYH A;  5JVG F;  3HBL A;  4XR6 A;  3ZMS A;  4R8H A;  5FKM A;  2PMZ N;  2F48 A;  1BA5 A;  4M9X A;  4XRF A;  4L0Z B;  2G0E A;  1HLV A;  3VTI A;  3JSJ A;  2QBY B;  2KRF A;  4XLE A;  4C2U A;  2JUC A;  4E7I A;  4JX6 A;  3HHG A;  3ZMT A;  2ACJ A;  3OOP A;  2R5Y A;  2DU9 A;  4U88 A;  1IRF A;  2VBY A;  4GGG A;  2FQ4 A;  4QPO A;  2ELJ A;  5E20 A;  4G6D A;  4OU0 A;  2XHK A;  3ZQG A;  1XN7 A;  3I56 I;  2PFV A;  1OQY A;  2DG8 A;  2XAF A;  4XM3 A;  1DU0 A;  3EUP A;  3AFH A;  3ZPL A;  2I8D A;  2XPV A;  3N05 A;  4BUP A;  2A3S A;  2KZG A;  2R7U A;  4DYQ A;  2UXO A;  1FSE A;  3H0G J;  3ONQ A;  2NVQ J;  1TQM A;  2DPD A;  4D1Q A;  4IOA F;  3NWT A;  2TCT A;  1QA6 A;  4LJZ F;  2NVU B;  3IP4 B;  3HXL A;  2E2I J;  3T8T A;  2Z33 A;  2EK5 A;  3EGQ A;  5FKO A;  3FZV A;  1Y1W J;  5F1R A;  1U2W A;  2VJJ A;  3K4L A;  3GME A;  4ON0 A;  1ACI A;  2L9N A;  1D8K A;  1I3Q J;  1D5V A;  1UCR A;  2BY1 A;  1LFU P;  1FC3 A;  3ZGK A;  4BJ6 C;  5FD6 A;  3A0H C;  3HPG A;  3GTJ J;  4JQF A;  2K9M A;  4P5O A;  2LFB A;  3S32 A;  4AYB N;  5J1Y A;  4RAG A;  3VUQ A;  4O5V A;  4CH7 A;  4EM1 A;  2XGX A;  3V7S A;  4D7M A;  4LFU A;  5J8F A;  2P0W A;  5HLH A;  1FOW A;  2K9Q A;  2JT1 A;  3CDL A;  3FXM A;  2XGE A;  3QOE A;  3H36 A;  2R7D A;  3S1R J;  3CZ6 A;  3L2V A;  3WTV C;  2W7N A;  2XIG A;  2FA5 A;  1MND A;  2ZOZ A;  4GDF A;  2MD0 A;  3HPH A;  1O3S A;  2CH0 A;  4IRH A;  4KIT B;  3TO7 A;  1A6I A;  2LF8 A;  3SEQ A;  3H9G A;  1GV5 A;  2CWE A;  3K2A A;  2KRC A;  4HYE A;  4LIU A;  5LRS A;  4IOC F;  2BVM A;  3C2G A;  4YEL A;  4A3M J;  3ZCO A;  1TL8 A;  5KCM A;  2JMW A;  2GWR A;  2VJ4 A;  4B47 A;  2AHQ A;  2KIQ A;  3MMY B;  1BOB A;  3KX2 A;  1LVK A;  1FYK A;  2R7S A;  4BHP A;  4OAY A;  4HDU A;  3LSR A;  1K7A A;  5HOD A;  4DBR A;  4EM0 B;  3L1P A;  3LSK A;  3LA2 A;  3ZR8 X;  2R5Z A;  2JPC A;  3FKI J;  3KZZ A;  4CO8 A;  2VKV A;  1DGW Y;  5EGO A;  3F22 A;  2EZI A;  5CXG A;  1H89 C;  3HIM A;  3TMO A;  3CCV I;  2F5F A;  5FHP A;  3EET A;  4OD4 A;  1I3A A;  2RVC A;  5FRN A;  1XSV A;  3OYA A;  1YIJ I;  2XSJ C;  3K1N A;  1ZR4 A;  1IRG A;  4WXD A;  4LD5 A;  2E34 A;  2UXP A;  5ILV A;  3CUQ A;  1GXQ A;  3DCF A;  1YIT I;  3BR1 A;  3HIF A;  5K7H A;  4UUT A;  5BPD A;  5CW8 A;  3L00 A;  1T95 A;  3SZP A;  5JLX A;  2A68 F;  3ZQH A;  3QPT A;  1JT0 A;  4YII A;  1MMN A;  3ZMD A;  1DQU A;  3BC8 A;  2KDZ A;  4BY1 J;  3O60 A;  3COL A;  3F8B A;  3SFI A;  2ZY9 A;  5H9T A;  5L3G A;  3CLQ A;  4CYD A;  1VZ0 A;  2LK2 A;  1LDK B;  2L7K A;  5TIS C;  3WTU C;  3U21 A;  5J8C A;  5CLS A;  4MHG A;  1P4W A;  3NPI A;  3KP7 A;  3Q5F A;  1GV2 A;  4HZF A;  4EJV A;  1RPW A;  5FRM A;  3ZMV A;  3D1N I;  1F5T A;  1WVR A;  4E6K G;  2XB5 A;  3HE0 A;  3EDP A;  4KIF A;  1C0W A;  3F6V A;  2K40 A;  4L9J A;  5LRR A;  2LKX A;  5HDG A;  3CQZ J;  4XRM A;  3SJM A;  5E3N A;  4XLH A;  2FRH A;  2XB0 X;  5K7Z A;  2VC0 A;  2M0C A;  5DCM B;  1TBX A;  3S1M J;  5D8L B;  4MFD A;  3WG7 H;  3DLA A;  1ETO A;  1OYI A;  1O7F A;  2M8E A;  3RKW A;  4RLQ A;  2A5Y B;  1ETW A;  3KP6 A;  2EJR A;  3ZXS A;  1D8J A;  5ICF A;  2MC4 A;  2WTE A;  1H9G A;  2E1O A;  4U9L A;  4A3B J;  3VYS B;  2ZBK A;  4MIM A;  4II2 A;  1MJ9 A;  2X85 A;  2UV1 A;  2JA5 J;  5EEH A;  3R6S A;  5FLM J;  3CD6 I;  3COA C;  5D8K B;  4I6Z A;  1X3W B;  2IT0 A;  1D1C A;  4P55 A;  1J5Y A;  2Y30 A;  3H5A A;  5FLX K;  4L18 B;  3BG7 A;  3KPH A;  2O61 A;  3PJR A;  4RAF A;  1ZTR A;  4FHT A;  2DYS H;  3P5J A;  3VOD A;  1VQP I;  2DI3 A;  2JA6 J;  2ESH A;  2MFZ A;  1A5J A;  2E71 A;  1LNW A;  3S2D J;  3NQO A;  2WAQ N;  3SZT A;  2E7W A;  2DOD A;  3HC7 A;  2FXA A;  4OMZ A;  3L7W A;  2CQ7 A;  5DV5 A;  4IXA A;  3GX4 X;  3C2B A;  4L0Y B;  1YJN I;  3C18 A;  1F43 A;  2NP5 A;  4ICH A;  5KHD A;  2X1E A;  3JRG A;  3PIO F;  1X2M A;  1WH5 A;  2F5D A;  2EIK H;  4AUX A;  1JJ6 C;  3EUH A;  3O6B B;  3FHN A;  4MO7 A;  5E3O A;  2P7V B;  4LB6 B;  2FNP A;  1TWH J;  3WU0 A;  3P9K A;  1WJ5 A;  3C07 A;  2Q24 A;  3SYT A;  2VJI A;  3NAR A;  3E1S A;  2LRE A;  3TDU C;  3OOU A;  2OA4 A;  3H3V K;  2PJR B;  1Z6T A;  4NDL A;  4D0P A;  2PQ8 A;  5DM7 F;  1I27 A;  2D5V A;  2Y9Y A;  3BLY A;  3N97 A;  1ETQ A;  4HKU A;  4HSR A;  2HYT A;  2V57 A;  3EYY A;  3KYC B;  1HKQ A;  1UFM A;  2XGC A;  1G6N A;  2NNY A;  4KIS A;  1T0F C;  3FXQ A;  1OR7 A;  1WSU A;  1TC3 C;  2GA2 A;  3CTA A;  3TGN A;  3M7G A;  3KCC A;  2DA2 A;  4ZYD A;  2UXI A;  3CJR B;  3E5U A;  3HM5 A;  4IHY A;  2HYJ A;  3V8L A;  5DUK A;  4NQW A;  4BHB A;  2VI6 A;  5HLI A;  2YX7 A;  2DMT A;  5KAI C;  1JGS A;  1VQN I;  4I09 A;  2PLY A;  2DA4 A;  5J4Y A;  5AQC A;  2M4K A;  4CCN A;  4EQQ A;  4M3D A;  3DEW A;  2EA4 A;  2VQG A;  3FXJ A;  2Y2Z A;  3H3Z A;  4HST A;  1ZAO A;  1P6R A;  3A02 A;  3A01 A;  3O8H A;  5CVJ A;  4QSH A;  1FPQ A;  2MW8 A;  3I64 A;  2LDU A;  5C4X J;  4BJ5 C;  1LJ9 A;  3LSG A;  4MQ9 F;  4AC6 A;  2AS5 F;  2XRL A;  1YS7 A;  2Y9Z A;  5JHF A;  2MA3 A;  1WJE A;  5DD4 A;  4CHU A;  1SD6 A;  2E1M C;  4ESF A;  2BHZ A;  5GAD J;  4FX0 A;  4KDP A;  3QOD A;  3OR1 C;  4P1W A;  2P81 A;  1ODD A;  2WAF A;  1XPX A;  1WFX A;  3GF2 A;  4D5C A;  2BGC A;  2VKE A;  2G7S A;  2P5K A;  3BHQ A;  4ZYA A;  3PFI A;  1YOV B;  2VT3 A;  1G4D A;  2F6C A;  1B72 A;  3GTM J;  4HAM A;  2GQQ A;  3QP6 A;  4KN4 X;  1EA3 A;  3G1L A;  1FP1 D;  4JK1 X;  3HKZ A;  3OYD A;  3REO A;  2E2H J;  1QVU A;  2LVS A;  4ZJZ A;  5BPI A;  3CCL I;  4XRS A;  1YI2 I;  4IRI A;  3RKX A;  5BMZ A;  3RQ4 A;  1MMS A;  1QPM A;  4RBO A;  2FBI A;  3I59 A;  2MD5 A;  4YFK F;  1F9N A;  5LD2 C;  2UXU A;  3H35 A;  3OYC A;  2JRM A;  2HPM A;  1QPI A;  2PJP A;  1FT9 A;  1G3T A;  4RAY A;  2OCE A;  1UI5 A;  1OPC A;  2Z99 A;  2D1H A;  3BOQ A;  2KKO A;  2KFD A;  2CRG A;  1SFX A;  1P4A A;  3BJO A;  4UV8 A;  1OCR H;  2W00 A;  3FX3 A;  3VSK A;  5FFZ A;  1QZZ A;  3E3V A;  3HZJ A;  1IUF A;  1BR4 A;  4IPA A;  4RS8 A;  3CDI A;  3ABL H;  2ICW G;  2K9L A;  3NRV A;  2EA2 A;  5HDN A;  2K27 A;  2ZKZ A;  4YRV A;  1RR8 C;  4HF1 A;  3WHC A;  4EV0 A;  5KK1 A;  3BTC A;  2BV6 A;  1JJ8 C;  5IYC J;  4KUM A;  3I53 A;  3PNV A;  2FE3 A;  3QPS A;  4GYG A;  4CYC B;  3G7R A;  2WUI A;  2HTJ A;  2KIU A;  2VB6 A;  4UVA A;  1NK2 P;  4Y7N J;  4ENJ A;  3S17 J;  5F27 A;  1BI1 A;  4QTR A;  1KZH A;  1WWX A;  3TDZ C;  1B9M A;  3ELK A;  3S93 A;  3TL4 X;  4BDY A;  5BS6 A;  1K6Y A;  3BJA A;  4RB0 A;  1SC7 A;  4M3G A;  5HS7 A;  1H88 C;  3K1P A;  4FQG A;  4NEL A;  1YX3 A;  2GFN A;  3M3Y J;  3FM5 A;  2I5U A;  3T6N A;  2CV1 A;  5HOO A;  5LGU A;  4A6E A;  2H6B A;  3RZO J;  4GCK A;  1NK3 P;  4AIK A;  1QBJ A;  3QOP A;  3M1C A;  2QVO A;  3CP8 A;  4UV9 A;  2CUJ A;  2Y31 A;  1WCM J;  2B0L A;  2HOE A;  2G7U A;  2NOJ B;  2RQP A;  3U9G A;  5FGL A;  4LG3 A;  1RZ4 A;  2A05 A;  2F4I A;  3W3C A;  3GBG A;  2ELH A;  1FNN A;  4M73 A;  2LLK A;  3CWR A;  1F36 A;  3TKY A;  3B6A A;  2L4A A;  3FM3 A;  2VOO A;  4JL3 A;  5TGT A;  2P6S A;  3E6C C;  4W1U A;  4HW0 A;  3PIP F;  1MMA A;  1OCC H;  2VIX A;  4E7H A;  1MJB A;  2CQK A;  2DJI A;  3VDX A;  3RH2 A;  1JE8 A;  2GLO A;  5ILU A;  5FLV A;  2HFH A;  2QA4 I;  4DGW B;  3CES A;  1K4S A;  3JSO A;  2QLZ A;  3KNW A;  3FK6 A;  4RM2 A;  5D5V B;  2Z5U A;  1V5E A;  2K02 A;  2UXH A;  2HNH A;  1ETV A;  3LQR A;  2LR8 A;  4XLF A;  4B48 A;  2WGB A;  1L3L A;  3MAJ A;  4ABZ A;  1QZE A;  1GUU A;  3F0C A;  2B1E A;  1XMX A;  5EZH A;  4U0W A;  1TT0 A;  1IC8 A;  5DAJ A;  4XKB A;  3JAM K;  1Q1H A;  1HDP A;  1MNE A;  1Z9C A;  4PGH A;  2HYF A;  2OBP A;  3IHU A;  2RNJ A;  2VUM J;  3CLO A;  3WE3 A;  3BNI A;  4OMY A;  1GVD A;  1KU7 A;  3DBH B;  5GPA A;  1MD0 A;  3OWT A;  3QYB A;  1USS A;  3ZMZ A;  3J7Y J;  1RUO A;  4HNU A;  2Q0O A;  3B02 A;  3RPU A;  2ZFW A;  1OMI A;  5IYB J;  3OYJ A;  2X6X A;  3CJQ B;  2R7T A;  3ABM H;  4PDK A;  1R9T J;  1Z21 A;  3BWG A;  4XSX F;  2DA3 A;  4LLG F;  1ZRE A;  3WGG A;  3GTK J;  1MZB A;  2WY8 Q;  2X6Y A;  3KP3 A;  2DBB A;  2XPW A;  5CKT A;  3HTS B;  2R7V A;  5EDN A;  3F72 A;  2IA2 A;  4B4C A;  5B3S H;  1ZGA A;  2DN0 A;  2E7X A;  1T8I A;  1K4T A;  1MSF C;  2EV6 A;  1SFE A;  4M6V A;  2G7H A;  2PEX A;  2XF7 A;  1MBG A;  2F5E A;  2HDW A;  1TWA J;  4E7Z A;  2RC4 A;  2FJI 1;  3HGY A;  1R58 A;  1JHF A;  3SDG A;  5LFA A;  2M30 A;  1I39 A;  1Z0X A;  4ETS A;  4XL9 A;  5J6X A;  3WTW C;  2JA8 J;  4ZDP A;  3S1Q J;  3CMA I;  1LE8 A;  3JRA A;  4HOB A;  2Y0S A;  1IUY A;  3PM1 A;  3FMR A;  2VQL A;  4IX7 A;  1TTY A;  5E18 F;  1TZL A;  4IRG A;  5K5R A;  3DKX A;  2D2W A;  3VWB A;  3N4M A;  4PSX A;  3T1B A;  5CYV A;  1ZGW A;  4A93 J;  1O3R A;  2EFO A;  3RKY A;  2GM4 A;  4C3J J;  3JR9 A;  2PJR A;  1P7I A;  1CF7 B;  1GT0 C;  2DFI A;  5H6R A;  2G9W A;  3V6G A;  2JTV A;  2Y75 A;  3A0B C;  1H9T A;  4HNT A;  3IV5 A;  4DQ2 A;  2KQR A;  2UWM A;  2MGQ A;  4PJL A;  1HKT A;  1HKS A;  4BXF A;  3EPZ A;  2HOS A;  2O5R A;  3CO7 C;  4DOZ A;  4CCK A;  2RAS A;  2YUS A;  3LST A;  5IP6 A;  1V54 H;  1VFC A;  5CVI A;  1YJ9 I;  2CUF A;  5JVT A;  4BL0 B;  1U6G A;  4MEY F;  1LKX A;  4I99 C;  2GZW A;  4G6Q A;  4CGR A;  2LY2 A;  4U9N A;  1WJD A;  5CVR A;  4DJA A;  2QWW A;  1HOM A;  4UHT A;  2QBY A;  4NQW B;  2KIF A;  5CPR B;  4PJN A;  2DK5 A;  3BZK A;  4KJZ A;  3RKQ A;  5M5Y J;  4EVI A;  4J19 A;  1X1P A;  2GXG A;  2L4M A;  5M3M J;  4G7H F;  4HA8 A;  1SAN A;  1A6Q A;  3SHF A;  2AXT C;  3RSN A;  2DA6 A;  3A01 B;  3MKL A;  2L3D A;  4GYI A;  2HVR A;  4S05 A;  2DYR H;  3S3O A;  3CUO A;  1JKO C;  4BBS J;  1OJL A;  4UVC A;  1W5S A;  1VTN C;  4XLP F;  3MFK A;  2J5P A;  2W48 A;  3F1B A;  1K83 J;  4Q5S F;  3F21 A;  5B66 C;  3MNL A;  4N9H A;  1T08 B;  3C2H A;  1YRN B;  2QOP A;  2M7B A;  1S7A A;  3V8K A;  2WBM A;  3GEZ A;  1UG2 A;  1J59 A;  4XLN F;  2V1D A;  3QRF F;  2A61 A;  2G7G A;  5L3C A;  1Z3Y A;  3GZI A;  3IWZ A;  2E36 A;  4I0B A;  4MK6 A;  4HNV A;  2VON A;  3BR5 A;  2DTR A;  2IBD A;  4QLC U;  2XGD A;  3KLN A;  2EIL H;  4ITV A;  2KIM A;  3T8R A;  2QZ8 A;  2OTJ I;  5E1W A;  3VVX A;  5K5O A;  1IN4 A;  2R0Q C;  4GFB A;  4A3L J;  5L3B A;  2RRE A;  1S5L C;  2KJC A;  4C3I J;  2A6E F;  1VQO I;  3SFZ A;  1DGR M;  3G3Z A;  4Y4R A;  4XKV A;  4KFC A;  3L2C A;  2IPQ X;  2H27 A;  3HRT A;  3I59 B;  3HL2 A;  2W85 A;  4XMY A;  2PBI A;  5EYR A;  3OL3 A;  1Y8R B;  4D9J A;  4IHT A;  3DPJ A;  1SGM A;  3LSJ A;  1NH3 A;  3PUB A;  2YVE A;  2Z2S B;  1MH4 A;  2K5C A;  5HVQ C;  4AVZ A;  1KQ0 A;  2DT5 A;  4MFE A;  1Y8Q B;  3A4C A;  4EAT A;  1HC8 A;  3BTI A;  3VOE A;  1R71 A;  2FOW A;  2RQQ A;  4U0V A;  2IS6 A;  1BW5 A;  2GIZ A;  3CC2 I;  2FX0 A;  4Q4Z F;  2RAE A;  2XVC A;  1DPR A;  3FIW A;  3VW1 A;  1HW5 A;  3DU6 A;  1HXD A;  1P7J A;  3CJN A;  2NX4 A;  5IP9 J;  3CDH A;  2EFW A;  4KIB A;  3PFY A;  3DV8 A;  2MSY A;  5F1J A;  2WAD A;  3K70 C;  2IXS A;  3EUK L;  3MZY A;  4M3F A;  2FD5 A;  2C6Y A;  4KT5 C;  1R7J A;  3F6O A;  2R7O A;  3FXU A;  4S04 A;  1CF7 A;  1QHH D;  2PN6 A;  3QYF A;  3ULQ B;  2IW5 A;  2EV0 A;  2OF7 A;  1BW6 A;  1ENH A;  3DQV C;  2V79 A;  4A0Y A;  2CSO A;  1YG2 A;  4II3 A;  4DVY P;  4GCT A;  3GW2 A;  1D0Y A;  2OD5 A;  3RTR A;  3ZQI A;  4RGU A;  5GPC A;  2GOX B;  3M1E A;  4EGY A;  5TRD A;  4B43 A;  2EFP A;  1FJL A;  2V6E A;  3TBI A;  4JX4 A;  3BPX A;  1B59 A;  2ZB9 A;  1TWF J;  2EV5 A;  1X1D A;  1X19 A;  3LA7 A;  5C4J J;  3LSP A;  3GYH X;  1D0X A;  4OIQ F;  3S14 J;  2W24 A;  3TOB A;  4KT6 A;  1U5T B;  1XSX A;  2QEX I;  1JGG A;  4PCQ A;  1T0F A;  3AL0 C;  2M8G X;  3MD2 A;  4ENM A;  2M0M A;  3M8F A;  1N77 A;  2CW7 A;  1YJW I;  1IXC A;  3CUQ B;  1W7P D;  1ZG5 A;  3D5S C;  3VYT B;  5KVR A;  3JSP A;  2ID3 A;  2CFX A;  3H3U A;  3Q0U A;  3VW2 A;  1REP C;  3QYE A;  5IY5 H;  1V4R A;  4BGD A;  5BQT A;  2DMU A;  1JKQ C;  3HKZ N;  2ELK A;  2QIB A;  1W5C C;  3MZ8 A;  2HGC A;  3JRD A;  1JTY A;  2LSO A;  4JX5 A;  5HSZ A;  2QEN A;  4DZJ A;  2DQL A;  1XGS A;  2COM A;  5DTD A;  3BG3 A;  3IAM 2;  3NS4 A;  3VOX A;  3ABU A;  3ZQC A;  1RIO H;  1K78 B;  3WU1 B;  3AG3 H;  4BE1 A;  1MIJ A;  4ESB A;  2CV2 A;  3Q9S A;  1FYL A;  4W97 A;  3KP5 A;  1IGN A;  1DUX C;  4LG0 B;  1IDZ A;  1ORK A;  4I7H A;  3K7A J;  3LSM A;  4RGR A;  4FTH A;  3TOA A;  1YYV A;  2HKX A;  5E8I A;  3HG9 A;  1TNT A;  2ZO4 A;  3KZI C;  1YX5 A;  3A03 A;  1R1U A;  4LG0 A;  1Y39 A;  1I6H J;  2H6C A;  1PUF A;  4PGG A;  1AA7 A;  5D5X B;  3GZ5 A;  3C3W A;  3AQT A;  3ON4 A;  3E97 A;  4YFX F;  4IKF A;  4CXF A;  2VJ5 A;  5LHI A;  3LAJ A;  1FBU A;  3BG6 A;  2LNB A;  2ZJ2 A;  3W6K B;  2YVX A;  1TP4 A;  1KU9 A;  5EG0 B;  1QQI A;  3CCJ I;  2R4G A;  5A2Q Z;  3J7Z I;  3K4N A;  2UZK A;  1FOK A;  2JJ7 A;  4ACI A;  1JHH A;  1S3J A;  1RES A;  2EFQ A;  4Y17 A;  3UKG A;  4AD9 A;  1PP8 F;  1G59 A;  2YX4 A;  2V6C A;  3DP7 A;  4E70 A;  3WTT C;  3QU6 A;  1E2X A;  1MGT A;  2EQR A;  3FXL A;  3Q9V A;  3ECO A;  3KLO A;  4YZE A;  4QIW N;  1B1B A;  3G56 A;  2O0Y A;  2ZCM A;  1BI0 A;  4MQV A;  3QPL A;  4KA4 A;  3F8M A;  2M5W A;  1TQI A;  4LMY A;  5K58 A;  3K2Z A;  4XBF A;  3BZC A;  2K9S A;  3HTA A;  3KZY A;  3LOC A;  2VL8 A;  3WTZ A;  3LJL A;  1BR1 A;  1RET A;  5BOX A;  4UXN A;  1LEB A;  2K4J A;  2UXN A;  1UST A;  3ERM A;  3PL8 A;  3RD3 A;  1Z77 A;  4UUS B;  4F52 A;  2GIV A;  4P9F A;  3GFM A;  3OMY A;  1U0J A;  4A3G J;  3FXR A;  4C2T A;  3G73 A;  3VW0 A;  1XB4 A;  2V7F A;  3SQN A;  2F4O B;  1U5T C;  2DDA A;  4XLC A;  1NTC A;  3AL0 B;  4FT8 A;  5CXI A;  2OQG A;  2HDD A;  2KPM A;  1QZY A;  4BNC A;  2O7T A;  4V2F A;  3WTX C;  1R1V A;  2CUZ A;  1W5T A;  4K2E A;  4PZJ A;  5ED4 A;  4M3B A;  2LD5 A;  4BQO A;  2ZNZ A;  2IS1 A;  1JXS A;  4CCJ A;  2VOP A;  2XRO A;  4RAZ A;  2J5O A;  4JP0 A;  4E7L A;  1QVT A;  1SFU A;  4E7S A;  3ZQL A;  3TP3 A;  2STW A;  4FE4 A;  2XAJ A;  4FE7 A;  1RC9 A;  2KL4 A;  2WWY A;  4IRV A;  1LUJ B;  3OR2 C;  1FMW A;  4KN7 X;  3QPH A;  1FEX A;  4HV6 A;  5H2F C;  4KMU X;  4C2M A;  3GFL A;  2L02 A;  3GXO A;  1VQL I;  2UUZ A;  3PO2 J;  3MVP A;  4MTE A;  1R5H A;  2MH9 A;  2P8T A;  4B44 A;  1RNL A;  3JTH A;  2FMY A;  5JLW A;  4WX9 A;  1J75 A;  2IA0 A;  4C2M J;  2DFH A;  1MBF A;  4A3E J;  2P4W A;  5JR3 A;  1ETX A;  4AM3 A;  1IAW A;  2CV0 A;  2ADU A;  1I5Z A;  3V78 A;  3QWL A;  2BVL A;  2EH3 A;  2ZCN A;  4ZYE A;  3DF8 A;  4GCL A;  2VXZ A;  2KP6 A;  4LIT A;  3I58 A;  3IH3 A;  2V1N A;  4RDU A;  4QWQ A;  1Y56 A;  1MMD A;  2Q2E B;  4CCL A;  3Q3S A;  1YRN A;  4CGZ A;  3VYU B;  3NAU A;  4X6A J;  3O8G A;  2HZD A;  4BXU A;  3I4N J;  3J80 Z;  5D19 A;  3DPU A;  2ZJR F;  4M71 A;  3ROU A;  3GO5 A;  2TDX A;  2CMP A;  2JVH A;  4AIH A;  1PUF B;  2Y69 H;  3GFJ A;  2H09 A;  2IS4 A;  3VOK A;  2BEO A;  3ISP A;  4XON A;  3OYB A;  2LG4 A;  3HTU A;  2CFO A;  4F3Q A;  1UB9 A;  3GZN B;  2LC2 A;  1W4M A;  1XD7 A;  2BOL A;  4Y13 A;  2M87 A;  2ZME A;  1ETY A;  1VQ9 I;  3VIB A;  2IAI A;  2V9K A;  3HRM A;  2D1V A;  1A36 A;  1HQC A;  3PAS A;  2XF5 A;  1D1B A;  2JA7 J;  4A2U A;  3NWS A;  1A35 A;  3ABT A;  3BZ6 A;  3JRH A;  3E7L A;  3JCU C;  2HVQ A;  4RB2 C;  5LLQ A;  1HW2 A;  2XDN A;  2QGU A;  3S8P A;  2QSG X;  1I1S A;  4E4H A;  4AC0 A;  2FBK A;  1IXS B;  1PUE E;  3CC7 I;  3ASN H;  1IO2 A;  2IU5 A;  1QRY A;  2LY1 A;  3U1D A;  2MG4 A;  2VBW A;  1AU7 A;  1AHD P;  1BI3 A;  1P9Q C;  1Z3X A;  2IJL A;  3KP2 A;  3LNQ A;  3SZG A;  1VQM I;  2OI8 A;  3OYF A;  1Z6R A;  3PSI A;  3PQJ A;  1S6L A;  1F4K A;  3HHH A;  2IP2 A;  2Z16 A;  3M4O J;  2L2O A;  1B8I A;  1RKW A;  1XCV A;  1WJC A;  4LOC A;  2P6T A;  3UNG C;  4LK0 F;  4Q47 A;  3M07 A;  4A69 C;  3OYL A;  1ZGJ A;  2ZC2 A;  1XC5 A;  2V1U A;  2ZOY A;  1DP7 P;  2NS7 A;  4L9T A;  4YFN F;  1WQ2 A;  1OCT C;  3PUF A;  1BR2 A;  1FWZ A;  2X9D A;  1XDS A;  3CCU I;  1L0O C;  2QWT A;  3KKD A;  1LFP A;  2IEK A;  2V9V A;  4AF5 A;  2PMU A;  4MLO A;  2KJB A;  3C1D A;  3MN2 A;  5EEA A;  2E1C A;  4I2O A;  4ZZL A;  2NP3 A;  2LH9 A;  3T0Y A;  3S16 J;  2ZXH A;  4I02 A;  3GTG J;  2XUB A;  5ICG A;  1ZRF A;  4L9N A;  4UDS A;  2R7Q A;  2BZT A;  4N4N B;  2RHA A;  3TW6 A;  4I76 A;  1X4O A;  2Y48 A;  1P4X A;  3H9Q A;  3GLX A;  5DS9 A;  4UUV A;  1T2K A;  3V4G A;  2QKO A;  3KET A;  4FX4 A;  1IW7 F;  3S1N J;  1YW7 A;  4EJW A;  1S8N A;  2FUG 2;  1RRJ A;  1U5T A;  1UEL B;  2JK3 A;  2L0K A;  1K6O A;  2M9H A;  4UNO A;  4CDG A;  2LMD A;  4BQQ A;  1B6A A;  1VF9 A;  3JRB A;  3HJE A;  1DP3 A;  1TW3 A;  3FRQ A;  2DA1 A;  2QKM B;  3HRU A;  1Z7L A;  1IF1 A;  1ZAR A;  2WB1 A;  4A5N A;  1MDM B;  1JT6 A;  2EFN A;  2V4J C;  2DMN A;  1Y6I A;  1HDD C;  3PQK A;  1WJA A;  1HA8 A;  2NOG A;  5HNF A;  2JZY A;  2CQQ A;  2HQ5 A;  2L54 A;  3F9K A;  3RQI A;  2XPU A;  3OS1 A;  3RZD J;  3ZQQ A;  2XF6 A;  1QGP A;  3K10 A;  1MNM C;  2XKO A;  2BHY A;  2F2E A;  5IT9 K;  2XRN A;  5C3E J;  1XMA A;  2HOA A;  2WA0 A;  1W0U A;  4M6Y A;  3I0T A;  5FB2 A;  4G6T B;  4P9U A;  1GHC A;  3WU2 C;  1BI2 A;  2XAH A;  2X1D A;  3CJT B;  2A6T A;  5DUI A;  2L9R A;  5FO5 A;  1YTY A;  4CUG A;  5F0H A;  5DM6 F;  2LYC A;  3MCZ A;  2R5Y B;  5EFY A;  2NVY J;  4A12 A;  2HU9 A;  1ZEL A;  3MKY B;  4BDZ A;  1MW7 A;  1YO5 C;  4A3C J;  1JUM A;  4BEH B;  4BJT A;  4BXX J;  5LGN A;  1BIA A;  3UR3 C;  5E3M A;  1UAA A;  4A3D J;  3K4J A;  1R6R A;  3FDY A;  4H4K C;  5CVV A;  2EIN H;  2BW3 B;  2VKH A;  2K3P A;  4WK8 F;  1O7L A;  3A2K A;  2VQH A;  5CJ9 A;  2IGM A;  4G8X A;  2HQR A;  2LBF B;  5B5E C;  3HOZ J;  1WJF A;  3K4M A;  3IKT A;  1APL C;  1FY7 A;  1LFB A;  4ZZD A;  1PJR A;  4XKW A;  3O2P E;  4M9Z A;  1IRX A;  4IHX A;  2O8X A;  1AWC A;  3MEX A;  2CGP A;  4OIP F;  2HPI A;  4X0G A;  4LIV A;  3K6G A;  3DBR B;  3HTH A;  4NNJ A;  2RNG A;  2BYV E;  3FBI B;  5EG0 A;  1EH8 A;  2ZNY A;  3H5R A;  2ZXJ A;  1J9I A;  2FOK A;  4UUS A;  3LHQ A;  3RIR A;  3CCM I;  1E0E A;  3ABK H;  3K4K A;  4WIB A;  3G1O A;  2CU7 A;  3I5U A;  5H20 A;  1J2X A;  4JYK A;  3LWF A;  3JRE A;  2O6G E;  2STT A;  4XN0 A;  5HBU A;  3D0S A;  2W25 A;  2DMQ A;  5CQE A;  3BT9 A;  1JUP A;  2GA1 A;  3CCE I;  1SFK A;  3E5Q A;  2P7C B;  2Q8K A;  3GLL A;  1LEA A;  3E6M A;  2O8K A;  1FBQ A;  3OYK A;  2ZSH B;  2V1X A;  1FTT A;  4UVB A;  5IT3 A;  1QHG A;  2ISZ A;  2A5W A;  3AG1 H;  1XCB A;  2O3F A;  1V3F A;  1W36 C;  2F4M B;  2N8G A;  1YLF A;  2ID6 A;  2QQ9 A;  2VOD A;  4IL6 C;  3CO6 C;  4O3M A;  3ZOB A;  1DDN A;  4G94 A;  5DEQ A;  5H6Q A;  3JRC A;  2GUH A;  1FP2 A;  3MKZ A;  2D45 A;  2OER A;  1WPK A;  1WRJ A;  2FNA A;  3FXO A;  2OZU A;  3KEO A;  2JA2 A;  2BY0 A;  2EB7 A;  2DQR A;  1SMY F;  4XSZ F;  3BTL A;  3J7A O;  2REK A;  4ENK A;  2DOE A;  3ZN0 A;  5HAW A;  1A04 A;  2WV1 A;  2ESN A;  5EZG A;  4IEJ A;  1NG7 A;  3CMY A;  2DAO A;  3LFU A;  2YS9 A;  5TJJ A;  2Z9O A;  2WAQ A;  1UMQ A;  1STZ A;  3WOD F;  5DDG A;  1AKH B;  1Z05 A;  4YIF A;  5L3D A;  4ZTJ A;  2CG4 A;  3RYP A;  4AID A;  1EJ9 A;  4WWC A;  5GP9 A;  2BY3 A;  2W4S A;  5LBQ A;  2FJ1 A;  3GTP J;  4GFL A;  5GAG J;  3BJB A;  3LSI A;  3ML6 A;  4PJ0 C;  2ZCX A;  2W1O A;  1RI7 A;  4WXH A;  2HWV A;  2PI0 A;  5D4S A;  3VPR A;  4F93 B;  2CO5 A;  3IWF A;  2X1C A;  3GTL J;  2Y0S N;  3C7J A;  2XAS A;  1G3Y A;  2NRA C;  4NC8 A;  3QKX A;  1BOA A;  1XDU A;  5GAH J;  5KAF C;  3CMM A;  2WAE A;  2E5Z A;  5D6E A;  4A3K J;  3OYG A;  1X3U A;  3FWE A;  2L7M P;  3FMS A;  4G7O F;  4J00 A;  1T39 A;  2M45 A;  2LKP A;  3E5X A;  3I4P A;  1JUS A;  5AIP A;  2JRT A;  3JAM Z;  1MBJ A;  2IGN A;  1EV7 A;  4A5M A;  4A6D A;  1BC7 C;  2Z3Y A;  2MLG A;  1IXR C;  3KYD B;  1OYW A;  1A31 A;  2KHM A;  4XOR A;  1RUN A;  4HBL A;  1IJW C;  3DTI A;  2NXN B;  3EYI A;  3K69 A;  3W6J B;  2XDV A;  3OSG A;  2RN7 A;  5DYM A;  2L5Q A;  3S15 J;  2DOA A;  4HQE A;  3VVY A;  4Z6Y A;  3LA3 A;  3BJ6 A;  4FET A;  5B1B H;  1S72 I;  5FJ8 J;  1UHS A;  3OYH A;  4ENN A;  2DXI A;  1Y0U A;  1ZRD A;  3HOX J;  1RR7 A;  1S29 A;  2O7O A;  5E17 F;  5DCM A;  4LB5 A;  3BG9 A;  1J0R A;  5B1A H;  1VQK I;  3HOS A;  4XOT A;  2YU9 J;  2ISY A;  3LAP A;  3K70 D;  3DFG A;  3S3M A;  2B9S A;  1SD5 A;  3ZN1 A;  1Z1D A;  3K0L A;  2JUG A;  4L9V A;  1BC8 C;  5HDK A;  2R93 J;  2NS0 A;  3BRO A;  3TO6 A;  4EMS A;  2VBZ A;  5FKL A;  4XIC A;  3ZRG A;  3P9T A;  4XK4 A;  1FTZ A;  4I0A A;  2X6W A;  2FBQ A;  5ILS A;  1O57 A;  2MAB A;  4DIQ A;  5HS8 A;  2TRT A;  1RKT A;  2DW4 A;  4DYC A;  1GDT A;  3I55 I;  2NVT J;  3HOY J;  2ZME C;  3HGG A;  3GFI A;  1X1C A;  3V7C A;  5F08 A;  4IHS A;  2QYO A;  4F92 B;  2MYS A;  3WGH A;  3TP0 A;  1E3P A;  1R4N B;  2VLA A;  1F1Z A;  1SD4 A;  2L9V A;  3HRS A;  1R36 A;  2G7L A;  2Q1Z B;  1ITY A;  6PAX A;  2BXZ A;  3TED A;  3P9C A;  1YFH A;  1SVO A;  2VPR A;  3K4C A;  3GTQ J;  2M4G A;  4CZC A;  4XID A;  4Y3O A;  3EUA A;  1BJZ A;  1LDJ A;  5C4Y A;  3WTS C;  3ZMU A;  2O9L A;  5E3L A;  2VQC A;  4NC6 A;  3BR0 A;  2R7Z J;  2H8W A;  2JPB A;  4EEF G;  2PZ9 A;  1MBH A;  9ANT A;  5HLT A;  1V5F A;  3S5R A;  2LTP A;  1PP7 U;  1FBS A;  2E35 A;  2EPF A;  4L62 A;  3I71 A;  3G4S I;  4MXM A;  2HQA A;  4LGW A;  4YG2 F;  1O3T A;  3HDD A;  2ZXI A;  5EF6 A;  1OCZ H;  1Z7U A;  3BY6 A;  5K5Q A;  3HSE A;  3PNT A;  4E7J A;  5F0F A;  5HS9 A;  1SVM A;  3GTO J;  2HXI A;  2HI3 A;  2ZXW H;  4B3A A;  2ZJP F;  3KYL A;  2M3A A;  3H1C A;  3IH2 A;  4XN3 A;  4GFK A;  3FHZ A;  4WF2 A;  4BKX A;  5D5U B;  3DWL E;  4GRI A;  4BH9 A;  5JHU A;  3CUQ C;  5FGM A;  2DO7 A;  2HEO A;  5KNL A;  1ZYR F;  4MNU A;  4EJT A;  1MSE C;  2FBH A;  3QQA A;  3DTE A;  1PVE A;  2DFF A;  1KQ9 A;  3DEE A;  1N25 A;  2FQ3 A;  1HBX G;  4R79 A;  4V19 K;  3ANG A;  2A6H F;  3CCQ I;  1ZKG A;  3I4M J;  1U3E M;  1YS6 A;  1JI8 A;  3KFW X;  1Y1V J;  2JN6 A;  4C9Y A;  3WTY C;  3DLL F;  2PX9 A;  3KZ9 A;  2R3S A;  5IP7 J;  1E3O C;  2HR3 A;  2CQN A;  3JTG A;  3PSF A;  1OFC X;  2OUM A;  5FKN A;  1HST A;  2NYX A;  4BYY A;  1TW2 A;  1EKE A;  4O6J A;  3QU3 A;  1UHM A;  2FF4 A;  1IV8 A;  4PJM A;  3G2B A;  1VND A;  2WV0 A;  1BM9 A;  2RKH A;  3MKW B;  4C30 A;  4WCG A;  3BQY A;  2DJN A;  4HLY A;  3FMQ A;  1ON2 A;  3CF2 A;  2ECB A;  4XQF A;  3AKZ A;  3OYE A;  2X51 A;  3TQN A;  3LSH A;  4NHJ A;  3JW4 A;  2FSW A;  3OYN A;  1LB2 A;  5FFX A;  3L2Q A;  4FAS D;  2HDC A;  1OCO H;  3SDB A;  5IPA A;  1O3Q A;  1SMT A;  2G3B A;  3CJD A;  1SAU A;  4HF2 A;  1N75 A;  5J1R A;  3ASO H;  1JKP C;  2OV7 A;  3R0J A;  2PMH A;  2LF7 A;  3BG5 A;  4YEJ A;  2QCO A;  2PFB A;  3R61 A;  2VN2 A;  1WHU A;  3IKV A;  3IL2 A;  1EF4 A;  5CVU A;  4OWR B;  2KMU A;  1R22 A;  1I1G A;  1OYY A;  4KIG A;  4RGX A;  2VBX A;  2K7L A;  3EUH C;  2QF7 A;  3TW7 A;  1FMV A;  2VC1 A;  1OCP A;  2XV4 S;  1LE8 B;  2W53 A;  1POG A;  3R0A A;  3FXK A;  2CS3 A;  4A0X A;  4BQA A;  2NNN A;  4M9S A;  1I6X A;  2HQN A;  3B81 A;  4C3H J;  2KZV A;  2AQF A;  5D5W B;  1OIS A;  3GCM A;  2OQR A;  2GOM A;  3ERE D;  3HOU J;  2ZFU A;  5IYD J;  4S0H B;  2JWT A;  2NAZ A;  5D4R A;  1BL0 A;  2H8R A;  4KNY A;  5GTH C;  4OAZ A;  1YW8 A;  2MLK A;  3I3L A;  3J81 Z;  3L2W A;  2MH2 A;  1KA8 A;  1IV6 A;  3KKC A;  2M2E A;  1FOY A;  4Y33 A;  1R23 A;  3OIP A;  4CCM A;  3VFZ A;  1D3Y A;  1IDY A;  4WXC A;  2HTS A;  2DPU A;  1MJA A;  4M74 A;  3HOW J;  3RDI A;  2W57 A;  1MKM A;  2CQX A;  3WG9 A;  1LVA A;  1XX5 A;  2BXY A;  5CQG A;  2KIS A;  1HF0 A;  5FRO A;  2JQ7 A;  5IT9 Z;  3BQZ A;  4AU7 A;  2IRF G;  2H1L A;  1B4A A;  5M5X J;  3K4B A;  3J81 K;  1U9O A;  1UZC A;  5C44 J;  4A3F J;  3VYR B;  1M1E B;  2QSF X;  4X1E A;  2XAG A;  3X2Q H;  3A1Y A;  5FKK A;  5E79 C;  1T33 A;  4Y15 A;  5J4V A;  4MGR A;  1NHA A;  3IUV A;  4JNN A;  2L9S A;  2EIM H;  2HXO A;  3D5L A;  1UG0 A;  4DBQ A;  3B6C A;  1CQT A;  4HX8 A;  2IVM A;  2DT7 B;  3AG2 H;  1W36 D;  2AO9 A;  5ICC A;  4Z2Y A;  2QQB A;  3L9F A;  1WI3 A;  3H9J A;  3NRG A;  1Q1V A;  1R1T A;  1TT5 B;  3LFK A;  3CP2 A;  4P96 A;  1ON1 A;  3OV8 A;  3RJP A;  2DG7 A;  5E1Z B;  4CA0 A;  3VP5 A;  2Q2E A;  1ONV A;  3OIO A;  4OIR F;  4F55 A;  4XOP A;  4XLA A;  4IO9 F;  4BE0 A;  2K86 A;  2L7Z A;  4HPQ A;  4ZH4 F;  1R00 A;  2E60 A;  5LHG A;  2Y0M A;  1IZ1 A;  4KWA A;  3HYI A;  4FIS A;  4JOM A;  2B3W A;  4OIO F;  3TO9 A;  4HX7 A;  4A3I J;  2F5C A;  3BDD A;  2KLO A;  4IZZ A;  4HDV A;  2HKU A;  2QM3 A;  4CZZ A;  4A0Z A;  4ANJ A;  2IA1 A;  4AIJ A;  2VE9 A;  4DYR A;  2YU3 A;  4JBA A;  3U2R A;  4PUS A;  4KIC A;  2A07 F;  3E6B A;  4U7B A;  1LPQ A;  4B8X A;  5JI6 A;  3W2A A;  2HYG D;  1U8R A;  4IJA A;  2W84 A;  2EZL A;  3DEU A;  4CIC A;  3L09 A;  4PFP A;  2M1B A;  4XKC A;  1P92 A;  1QO0 D;  5L3F A;  1VI0 A;  2WC2 A;  2P5L C;  5J47 A;  3E6D A;  5K7F A;  1B72 B;  3BP8 A;  3K9T A;  2P5V A;  1KU2 A;  3IC7 A;  1ETK A;  2DCE A;  3OL4 A;  1X1B A;  4HQM A;  1O4X A;  1GVJ A;  2OAZ A;  1R5I D;  2OCC H;  1S7E A;  1YQA A;  1DPU A;  4CYC A;  5ICE A;  2W82 A;  4AWX B;  4G7Z F;  5M3F J;  4ZC3 A;  4LLN A;  4M6X A;  4OIN F;  3L2U A;  5A2Q K;  2Z1D A;  3BPV A;  2OJE D;  3CRJ A;  1G3S A;  2A69 F;  1PYV A;  1WGX A;  1MBE A;  2CJJ A;  4V2G A;  5M5W J;  3W6V A;  4HX4 A;  1S7O A;  2VT2 A;  2E19 A;  5EJC A;  4MEX F;  1FZP B;  3NXC A;  2FML A;  3I54 A;  1ZHF A;  1BJA A;  5FLX Z;  3PO3 J;  1W0T A;  1IRZ A;  2R7F A;  2H94 A;  1Z67 A;  2GAU A;  1IN5 A;  1X4P A;  3DXJ F;  3ANP A;  1W7P B;  4HG2 A;  4M3E A;  5J1U A;  5LHH A;  1Y0N A;  2UXX A;  2HZT A;  1I50 J;  3CCS I;  2O03 A;  2R7X A;  2X4H A;  3V7R A;  3GWZ A;  3MWM A;  3BCG A;  1ZN2 A;  3U1K A;  4CSW A;  1ULY A;  3ZP5 A;  4UY8 I;  2QKL B;  4HEA 2;  1R49 A;  4U87 A;  1YW9 A;  3W2V A;  4B3X A;  4UB6 C;  3OYI A;  2VPL A;  3OS2 A;  3K8P C;  2ECC A;  1W7P A;  1HW1 A;  5K1Y A;  4PFO A;  1V55 H;  4L5I A;  3ON2 A;  1QU3 A;  3RI4 A;  3QBM A;  2K85 A;  3BCB A;  3L2R A;  5AON A;  2NS8 A;  4IQJ A;  1D5Y A;  3BR3 A;  3FK7 A;  4J01 A;  3KEQ A;  2HOT A;  1ZQ3 P;  1X1A A;  4Y52 J;  4BS9 A;  1XGN A;  2JSP A;  3H5N A;  3DTK A;  2BBY A;  2CUE A;  1J09 A;  3SWH A;  4OOI A;  5E8G A;  2JVG A;  2L01 A;  2XKP A;  2OC6 A;  3QP5 A;  4DNC A;  3G6E I;  1MDM A;  1XGM A;  1TWG J;  1WH7 A;  3I9V 2;  1X3Z B;  2DFE A;  1V5G A;  4BY7 J;  4D5F A;  3G71 I;  1G3W A;  2IS2 A;  3SEZ A;  3T5X A;  3F8F A;  4AYB A;  2DA7 A;  2DT6 A;  3BTJ A;  4N4O B;  2CW8 A;  3WE2 A;  1ZLJ A;  2OPT A;  4ZDL A;  3RPQ A;  1H8A C;  3DPT A;  3M8J A;  3J80 K;  4NUB A;  2PMZ A;  5IOY A;  2MC3 A;  3FBN B;  2YR2 A;  1XGO A;  3H0D A;  1UJ8 A;  3FF5 A;  1MH3 A;  2B63 J;  4BHC A;  2AQE A;  3VSL A;  3CC4 I;  5GAE J;  3JRF A;  5E1X A;  3RCO A;  1S9H A;  3M8E A;  4MTD A;  2XSD C;  2DA5 A;  1OR7 C;  2VXD A;  1QNT A;  1SFO J;  3OYM A;  1CGP A;  2LBF A;  3HUG A;  4U0Y A;  3HTI A;  5J40 A;  2R92 J;  4KMF A;  3OIQ A;  3HUG B;  3JRI A;  4EJO A;  4ME9 A;  2QUF A;  4BQN A;  3NNR A;  3F3X A;  2ZJQ F;  1U78 A;  1FIP A;  3Q0V A;  5GTI C;  4HV5 A;  3S3N A;  1G2H A;  2IGO A;  1XMK A;  3LL7 A;  3HSR A;  4RM3 A;  1ZRC A;  4BU2 A;  3F8N A;  4U7D A;  2EZH A;  3IH4 A;  3NEU A;  4ZDO A;  5D1R A;  5JFR A;  1H0M A;  2F07 A;  2VKD A;  2X6O A;  5F64 A;  1XTA A;  5F04 A;  3RYR A;  2EBI A;  2HKO A;  1IN6 A;  1D1A A;  2OU2 A;  3B73 A;  1VQ6 I;  1UHW A;  4BBR J;  1MMG A;  2YPR A;  2R5Z B;  4L5J A;  1EH7 A;  4EGZ A;  2GBY A;  3BR2 A;  2X0L A;  2K3F A;  2K4B A;  1EH6 A;  2ZSI B;  4G12 A;  5BNG A;  3O3K A;  1VQ7 I;  1K79 A;  3S2H J;  3WHB A;  3DKW A;  3CME I;  2KDO A;  3IRQ A;  1AOY A;  2E1M B;  1ZK8 A;  4UB8 C;  2H1K A;  3KEY A;  1ZG3 A;  1U8B A;  4IHV A;  3W2W A;  3S2W A;  3OSF A;  4OD5 A;  4F7Z A;  3VEP A;  5F6F A;  4RGS A;  3GZ6 A;  3QAH A;  3EQL F;  3F23 A;  3LQQ A;  2RDP A;  4CCO A;  3BRU A;  1TLH B;  2MBF A;  3KIO A;  1WI9 A;  1XS9 A;  2LRD A;  3F8C A;  1DU6 A;  2RV8 A;  2QQA A;  1WJB A;  3HSF A;  4Q48 A; 
#chains in the Genus database with same CATH homology
 2G7L A;  2P81 A;  2JJ7 A;  4ACI A;  1ITY A;  4D5C A;  3UKG A;  1RES A;  2VKE A;  3HB9 A;  2G7S A;  3E7Q A;  3BHQ A;  3NI7 A;  3TED A;  3GTM J;  2VPR A;  3GTQ J;  2COB A;  1UI6 A;  4XID A;  1BJZ A;  2EQR A;  3BR6 A;  3G1L A;  5C4Y A;  2O9L A;  4YZE A;  4QIW N;  5E3L A;  3G56 A;  2R7Z J;  3BR0 A;  4EEF G;  2LY9 A;  2PZ9 A;  2E2H J;  1QVU A;  1MBH A;  2LVS A;  2ME0 A;  4XRS G;  3Q0W A;  2ZCM A;  9ANT A;  3QPL A;  4XRS A;  3S5R A;  2LTP A;  2GEN A;  5K58 A;  4RBO A;  2K9S A;  3HTA A;  4L62 A;  3LOC A;  3LJL A;  2UXU A;  1QPI A;  2QTQ A;  3VVZ A;  4MXM A;  1RET A;  1ZR2 A;  3HDD A;  5EF6 A;  1B72 A;  1UI5 A;  2CRG A;  4JKZ A;  3RD3 A;  1Z77 A;  4UUS B;  4FCY A;  1IUF A;  4A3J J;  1HCR A;  5F0F A;  4A3G J;  3GTO J;  3VW0 A;  2HXI A;  2HI3 A;  1K61 A;  1FIA A;  2E2J J;  4B3A A;  1NTC A;  5CXI A;  4DW6 A;  2HDD A;  3IH2 A;  3WHC A;  4GFK A;  2K9N A;  4IHW A;  4BKX A;  2O7T A;  3BTC A;  2X48 A;  4V2F A;  1JJ8 C;  5IYC J;  2WB1 N;  3QPS A;  4L5E A;  4CYC B;  3G7R A;  4M3B A;  2LD5 A;  2WUI A;  1NK2 P;  1X58 A;  2I10 A;  2M34 A;  4Y7N J;  1MSE C;  1JKR C;  3QQA A;  3S17 J;  5F27 A;  4JP0 A;  1QVT A;  4QTR A;  3ZQL A;  3TP3 A;  3HOV J;  4FE4 A;  4FE7 A;  3ANG A;  5D18 A;  1ZKG A;  3I4M J;  4M3G A;  5FMP A;  1Y1V J;  2JN6 A;  1H88 C;  1XG1 A;  1FEX A;  3KZ9 A;  4NEL A;  5IP7 J;  2GFN A;  1TWC J;  3M3Y J;  1E3O C;  1T56 A;  3T6N A;  4D7N A;  1JTX A;  1OFC X;  5FKN A;  3MVP A;  3PO2 J;  3HTJ A;  3RZO J;  4GCK A;  1NK3 P;  5JLW A;  2PBX A;  3LWJ A;  4C2M J;  2DTZ A;  1MBF A;  2Y31 A;  4A3E J;  1U9N A;  1VND A;  1WCM J;  1ETX A;  4PXI A;  2D6Y A;  5FGL A;  3V78 A;  4GCL A;  2EH3 A;  2DJN A;  3BQY A;  2ZCN A;  2ECB A;  3GBG A;  3IH3 A;  2LLK A;  3CWR A;  1F36 A;  4RDU A;  1IG7 A;  5IPA A;  2G3B A;  3B6A A;  3CJD A;  3ZQF A;  4JL3 A;  3FIS A;  3G1M A;  5J1R A;  3Q3S A;  4W1U A;  1YRN A;  1MBK A;  1JKP C;  1B8I B;  3PPB A;  3NAU A;  4X6A J;  3BG5 A;  3O8G A;  2QCO A;  3AQS A;  3I4N J;  5D19 A;  3HEF A;  3RH2 A;  2GLO A;  2NVX J;  5FLV A;  1EF4 A;  5F0C A;  2LP0 A;  1PUF B;  2KT0 A;  2EZK A;  5EGO B;  3KNW A;  2YVH A;  3FK6 A;  3VOK A;  2UXH A;  2QF7 A;  3TW7 A;  1ETV A;  1OCP A;  1LE8 B;  2W53 A;  2LR8 A;  1POG A;  2WGB A;  3GEU A;  4ABZ A;  2DMP A;  1GUU A;  5IOZ A;  3F0C A;  5EZH A;  3CCY A;  5DAJ A;  1ETY A;  1IC8 A;  3VIB A;  2IAI A;  1AKH A;  3B81 A;  1HDP A;  4C3H J;  4B1R A;  2L7F P;  5J3L A;  3PAS A;  2VUM J;  2JA7 J;  3HOU J;  4DZP A;  3BNI A;  1X2N A;  1GVD A;  2ME6 A;  3JRH A;  3E7L A;  5GPA A;  5IYD J;  4NN1 A;  4S0H B;  2JWT A;  1BL0 A;  2H8R A;  2XDN A;  3HBL A;  5IYB J;  5FKM A;  2PMZ N;  1IV6 A;  3KKC A;  2M2E A;  4AC0 A;  1BA5 A;  1R9T J;  2DA3 A;  2G0E A;  1HLV A;  3GTK J;  3JSJ A;  2IU5 A;  1QRY A;  2MG4 A;  1AU7 A;  1AHD P;  1IDY A;  2XPW A;  5EDN A;  3LNQ A;  4JX6 A;  4B4C A;  2DN0 A;  3HOW J;  2OI8 A;  2R5Y A;  1MSF C;  2CQX A;  4M6V A;  1MBG A;  2FQ4 A;  1TWA J;  1HF0 A;  3ZQG A;  3BQZ A;  3M4O J;  5M5X J;  3HGY A;  3SDG A;  1RKW A;  1B8I A;  2DG8 A;  4LOC A;  1U9O A;  5C44 J;  1Z0X A;  1DU0 A;  3EUP A;  4A3F J;  4A69 C;  4X1E A;  1XC5 A;  2XPV A;  2ZOY A;  2JA8 J;  2NS7 A;  3S1Q J;  4DYQ A;  1LE8 A;  2UXO A;  1OCT C;  5FKK A;  3H0G J;  1T33 A;  3JRA A;  2NVQ J;  3PM1 A;  3IUV A;  2X9D A;  4JNN A;  2TCT A;  2HXO A;  2QWT A;  3KKD A;  2E2I J;  3B6C A;  2IEK A;  1CQT A;  3EGQ A;  5FKO A;  4MLO A;  4AF5 A;  2AO9 A;  1Y1W J;  1ZGW A;  4A93 J;  3MN2 A;  5EEA A;  2NP3 A;  2GM4 A;  1WI3 A;  3S16 J;  4C3J J;  3NRG A;  1Q1V A;  3JR9 A;  3GTG J;  1P7I A;  4UDS A;  1I3Q J;  2RHA A;  1LFU P;  1GT0 C;  3TW6 A;  4I76 A;  3V6G A;  2DG7 A;  5DS9 A;  3VP5 A;  3GTJ J;  2LFB A;  3OIO A;  3IV5 A;  2QKO A;  2MGQ A;  4AYB N;  5J1Y A;  3VUQ A;  2L7Z A;  3S1N J;  4D7M A;  2HOS A;  2L0K A;  2JK3 A;  2K9Q A;  2M9H A;  3CDL A;  4KWA A;  2XGE A;  4FIS A;  3S1R J;  1VF9 A;  3JRB A;  2RAS A;  2ZOZ A;  2YUS A;  3FRQ A;  2DA1 A;  4A3I J;  2HKU A;  5IP6 A;  1JT6 A;  1VFC A;  1A6I A;  2DMN A;  2CUF A;  4DYR A;  1HDD C;  2NOG A;  3RZD J;  2CQQ A;  2HQ5 A;  1GV5 A;  3RQI A;  2XPU A;  3K2A A;  4A3M J;  1MNM C;  2JMW A;  4CGR A;  5C3E J;  2HOA A;  2AHQ A;  2EZL A;  1W0U A;  1HOM A;  3LSR A;  5HOD A;  1VI0 A;  1B72 B;  5K7F A;  3L1P A;  3RKQ A;  2L9R A;  5M5Y J;  4J19 A;  2R5Z A;  5M3M J;  3FKI J;  1ETK A;  5F0H A;  1SAN A;  2R5Y B;  1O4X A;  5EFY A;  2NVY J;  2VKV A;  2DA6 A;  5EGO A;  1S7E A;  4A3C J;  1JUM A;  2EZI A;  4BXX J;  5CXG A;  4CYC A;  1H89 C;  3A01 B;  5E3M A;  3MKL A;  4A3D J;  3HIM A;  5M3F J;  1JKO C;  5FHP A;  4BBS J;  1OJL A;  2W48 A;  3F1B A;  3CRJ A;  1K83 J;  3HOZ J;  3MNL A;  1ZR4 A;  1APL C;  1WGX A;  1MBE A;  2CJJ A;  4V2G A;  5M5W J;  1YRN B;  3W6V A;  2QOP A;  2UXP A;  1UG2 A;  1LFB A;  2E19 A;  3NXC A;  3DCF A;  2G7G A;  3BR1 A;  5K7H A;  4IHX A;  4UUT A;  3PO3 J;  3GZI A;  5CW8 A;  4MK6 A;  4HNV A;  1W0T A;  1IRZ A;  3BR5 A;  2IBD A;  5JLX A;  3HTH A;  2XGD A;  3ZQH A;  5EG0 A;  3ANP A;  1JT0 A;  4M3E A;  5J1U A;  2KDZ A;  4UUS A;  4BY1 J;  3LHQ A;  3O60 A;  2R0Q C;  4A3L J;  1I50 J;  4GFB A;  3VVX A;  3G1O A;  2CU7 A;  3COL A;  4C3I J;  3SFI A;  3BCG A;  5H9T A;  4JYK A;  3JRE A;  5HBU A;  2LK2 A;  2DMQ A;  3BT9 A;  1JUP A;  2ECC A;  5EYR A;  3NPI A;  1GV2 A;  2O8K A;  3DPJ A;  1RPW A;  3ON2 A;  1SGM A;  3HE0 A;  3D1N I;  3LSJ A;  2XB5 A;  3QBM A;  1FTT A;  2K40 A;  2YVE A;  2NS8 A;  1MH4 A;  2LKX A;  1D5Y A;  3BR3 A;  3FK7 A;  3CQZ J;  4XRM A;  3SJM A;  2HOT A;  1ZQ3 P;  5E3N A;  4Y52 J;  4MFE A;  2XB0 X;  5K7Z A;  2N8G A;  2M0C A;  3BTI A;  3S1M J;  2ID6 A;  2CUE A;  4MFD A;  1BW5 A;  1ETO A;  2FX0 A;  3ZOB A;  2RAE A;  3FIW A;  3VW1 A;  3JRC A;  1P7J A;  2NX4 A;  1ETW A;  5IP9 J;  2GUH A;  2OER A;  1WPK A;  2E1O A;  1TWG J;  1WH7 A;  4A3B J;  3BTL A;  2MSY A;  4MIM A;  5F1J A;  4BY7 J;  2REK A;  4D5F A;  5HAW A;  2JA5 J;  2WV1 A;  5EZG A;  4M3F A;  2FD5 A;  4IEJ A;  3CMY A;  5FLM J;  2YS9 A;  1UMQ A;  1AKH B;  4I6Z A;  2OF7 A;  1ENH A;  1BW6 A;  2DA7 A;  2Y30 A;  3BTJ A;  5GP9 A;  1ZTR A;  2FJ1 A;  3GTP J;  4GFL A;  3BJB A;  4GCT A;  2OPT A;  3ZQI A;  1H8A C;  2JA6 J;  5GPC A;  5IOY A;  2ZCX A;  1A5J A;  1FJL A;  3VPR A;  4JX4 A;  3GTL J;  2Y0S N;  3S2D J;  2ZB9 A;  1TWF J;  2WAQ N;  3QKX A;  1MH3 A;  2B63 J;  3LSP A;  5C4J J;  4ICH A;  4A3K J;  3JRF A;  3C2B A;  1F43 A;  2NP5 A;  3S14 J;  3JRG A;  2XSD C;  2L7M P;  2DA5 A;  1SFO J;  1JGG A;  1X2M A;  1WH5 A;  2M8G X;  4AUX A;  1JJ6 C;  3HTI A;  4MO7 A;  2R92 J;  5E3O A;  1JUS A;  1MBJ A;  3JRI A;  4ME9 A;  3NNR A;  1TWH J;  1U78 A;  1FIP A;  3Q0V A;  3C07 A;  1G2H A;  2Q24 A;  1IJW C;  3NAR A;  2ID3 A;  3Q0U A;  3VW2 A;  3OOU A;  3H3V K;  3OSG A;  4NDL A;  2D5V A;  2EZH A;  3IH4 A;  1JKQ C;  2DMU A;  2Y9Y A;  3HKZ N;  5D1R A;  1ETQ A;  3S15 J;  2F07 A;  2ELK A;  2QIB A;  4HKU A;  2X6O A;  3VVY A;  2HYT A;  2V57 A;  3JRD A;  1JTY A;  5F04 A;  4JX5 A;  5FJ8 J;  1UHS A;  5HSZ A;  2XGC A;  4DZJ A;  2EBI A;  5DTD A;  3BG3 A;  3VOX A;  3HOX J;  1RR7 A;  3ZQC A;  1TC3 C;  2O7O A;  4BBR J;  2R5Z B;  3BG9 A;  2DA2 A;  2GBY A;  3BR2 A;  2UXI A;  3HM5 A;  4IHY A;  4G12 A;  2HYJ A;  4W97 A;  1IGN A;  5BNG A;  2YU9 J;  1IDZ A;  1ORK A;  3S2H J;  3K7A J;  2VI6 A;  3WHB A;  4FTH A;  2DMT A;  1ZK8 A;  2H1K A;  2R93 J;  2DA4 A;  5AQC A;  1U8B A;  4IHV A;  4M3D A;  3DEW A;  4XIC A;  5FKL A;  3P9T A;  4XK4 A;  3OSF A;  2Y2Z A;  3A03 A;  1FTZ A;  1I6H J;  3A02 A;  3A01 A;  3O8H A;  2FBQ A;  4QSH A;  2MW8 A;  1PUF A;  5C4X J;  2TRT A;  1RKT A;  4DYC A;  3LSG A;  4AC6 A;  1GDT A;  3BRU A;  3AQT A;  3ON4 A;  2XRL A;  2NVT J;  3HOY J;  2Y9Z A;  3HGG A;  1XS9 A;  5F08 A;  1DU6 A;  5EG0 B;  3TP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...