2OF7A

Structural genomics, the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor a3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
191
structure length
191
Chain Sequence
GLRERKKTRTREAIRAATYGLIRQQGYEATTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLRKALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEVRIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 64
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2007-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2of7A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2of7A02
1TWHJ 5M5YJ 1A6IA 1POGA 5GPCA 5J3LA 3WHCA 2X9DA 4M3BA 1ZGWA 2ZOZA 1T56A 2YUSA 2K9SA 3IUVA 2NVXJ 1P7JA 5K58A 2DMTA 4A3DJ 2CJJA 4XIDA 4XICA 3ANPA 3HM5A 3S1QJ 1Z77A 3VP5A 1SGMA 2XDNA 4B4CA 3GEUA 1TWGJ 2HQ5A 3G1OA 1RKWA 2M34A 3KZ9A 3TEDA 2CRGA 1LE8B 4QIWN 5H9TA 3CMYA 2HOAA 2UXHA 3DEWA 3ZQFA 1ETVA 1IG7A 5F0CA 3EUPA 3NXCA 1B72B 5F08A 1IDYA 5K7ZA 4JNNA 3Q0VA 4D5CA 3GTMJ 4IHXA 1JKOC 3RD3A 1ORKA 1RETA 1UG2A 2AO9A 3F0CA 2W53A 4W97A 4YZEA 2DG7A 5JLXA 1E3OC 2XPVA 5FHPA 3BR3A 2UXUA 2Y9YA 3JRCA 2QKOA 5J1RA 1VF9A 4JX6A 3A03A 2JA6J 2QCOA 2R0QC 4V2GA 3JRHA 3JRGA 5IOYA 5M3FJ 2IBDA 4MK6A 3W6VA 4L5EA 3OSFA 2K40A 2CUFA 4A3FJ 2DA3A 4DW6A 3MKLA 2YU9J 3HKZN 1AKHB 2JWTA 2FD5A 3FK7A 2JMWA 1MBEA 3LSPA 3NRGA 4BBRJ 4XRSG 5IOZA 1MNMC 2WAQN 4GCKA 3HB9A 5BNGA 2R5YA 4BY7J 3BR5A 3QPSA 1W0TA 5C4YA 3JREA 3BTIA 2IU5A 3CCYA 3S1NJ 3G1LA 3TP0A 2M0CA 2XGCA 5EFYA 4DYQA 1QRYA 3MVPA 2LR8A 2D6YA 1B72A 3PPBA 2H1KA 3ANGA 3LJLA 4B3AA 3S1RJ 4PXIA 3GTQJ 5FLMJ 3VVZA 5E3LA 3HIMA 1ZK8A 4MO7A 1JUSA 5CW8A 3BQZA 3KKDA 5EGOA 3PO3J 2M2EA 1U78A 3HOVJ 4FCYA 3H3VK 2MGQA 1RKTA 1MH4A 2OPTA 1RESA 2XRLA 2ECBA 4Y7NJ 4ACIA 2I10A 5K7FA 2ID3A 3BT9A 4MFEA 2DA4A 5C44J 1UI6A 2LFBA 3ZQLA 1JTYA 2UXOA 4NN1A 3S1MJ 1AKHA 1B8IB 2WGBA 1WPKA 1LFBA 1Y1VJ 1Y1WJ 2VPRA 4RBOA 1HOMA 4ABZA 3T6NA 5DTDA 3VW0A 4GFBA 2DA5A 2VI6A 2JK3A 2WB1N 2NS8A 1IGNA 3IH2A 3Q0UA 3BCGA 2YS9A 1JGGA 2JJ7A 2QF7A 4J19A 3G7RA 4XRMA 3MN2A 3HOZJ 1QVUA 4IEJA 4LOCA 1MSEC 2F07A 3SFIA 4W1UA 4A3JJ 2HKUA 4C3HJ 3RZOJ 2EZIA 3AQTA 1GT0C 3JSJA 5IP6A 3D1NI 1LFUP 1ZQ3P 1FIAA 5IYBJ 3RKQA 2PZ9A 4JX4A 4I6ZA 2NOGA 4AC0A 1FEXA 3FRQA 3JRBA 1TC3C 1ETOA 1IV6A 2L0KA 1ZTRA 1TWAJ 5EF6A 2DMQA 2KT0A 5F1JA 1BJZA 1U9OA 2XB5A 4A3IJ 2HOSA 1BA5A 4KWAA 4DYRA 3S15J 1EF4A 2QTQA 3CWRA 4A3LJ 1I3QJ 1X2MA 4A93J 2PMZN 3A01B 2FBQA 3BHQA 2M9HA 4JX5A 3O8GA 2E2IJ 1JKQC 2X48A 4DZJA 1GV2A 1MH3A 2H8RA 2L9RA 3BTJA 3GTGJ 4A3MJ 2G0EA 5FKNA 1X2NA 3E7LA 2R93J 3PO2J 2G7GA 3OSGA 2HXOA 5M5XJ 3IH3A 2G7SA 3HTAA 1W0UA 1IDZA 2E2HJ 1XC5A 3B6AA 2EBIA 3EGQA 1JT6A 5FLVA 3GTKJ 5AQCA 5E3OA 3VW2A 2E2JJ 2LLKA 2O9LA 4M3DA 4X6AJ 2JA7J 3QQAA 9ANTA 5JLWA 4A3GJ 2LVSA 1GUUA 3P9TA 2ZOYA 3S2DJ 2ME6A 2GBYA 3JRFA 1JJ8C 1YRNB 4XK4A 4V2FA 1Q1VA 1BW6A 1MBGA 2MSYA 4JP0A 2IAIA 5HSZA 3TP3A 2LP0A 2ZCNA 3HTJA 4C3IJ 4MXMA 2OI8A 3BG5A 4S0HB 2G3BA 2HXIA 4ICHA 3RQIA 2EZHA 2UXPA 3KKCA 1WI3A 4M3GA 5CXIA 3HOYJ 3JRAA 2GFNA 2RASA 3A01A 3S5RA 2FJ1A 3K7AJ 2COBA 1OCPA 3HTHA 3JR9A 1LE8A 1FIPA 1K83J 3BR6A 1Z0XA 2VUMJ 4AC6A 1WH5A 4FE7A 1MBKA 3CJDA 2DMNA 2XGEA 5J1UA 5DS9A 1IC8A 2OERA 3LHQA 1GV5A 2TCTA 5DAJA 4AF5A 2MW8A 1ITYA 2L7ZA 2KDZA 5D1RA 1G2HA 2DJNA 4GCTA 3JRDA 4IHVA 3SDGA 3ON2A 4MIMA 4IHWA 5FKKA 2DA7A 4Y52J 4AUXA 3BG3A 1MSFC 1NK3P 2NX4A 2FX0A 2HI3A 4FISA 3RH2A 4B1RA 4BKXA 2ZCXA 3HEFA 3RZDJ 4M6VA 3O60A 2NVYJ 3CQZJ 4AYBN 1DU6A 2GENA 2GLOA 2W48A 5FJ8J 2Y0SN 4UDSA 1JT0A 2R92J 2QWTA 4G12A 1JKPC 1YRNA 1OFCX 2HDDA 3JRIA 3V78A 3ZQCA 1JKRC 1ETYA 1HCRA 2ELKA 4A3CJ 5E3MA 2DA1A 4BXXJ 2ZCMA 4C2MJ 1ETWA 2DA6A 4QSHA 5EZGA 1JJ6C 1XG1A 1ZR2A 1AHDP 2M8GX 1ZR4A 2V57A 5J1YA 4A69C 1RPWA 2LD5A 1QPIA 3BNIA 2ZB9A 5M3MJ 2DTZA 4EEFG 1OCTC 1FTTA 1RR7A 3B81A 3QPLA 5IP7J 2DMUA 5F0HA 2LK2A 1JUMA 2ME0A 3QKXA 1HLVA 3TW7A 1IJWC 2XPWA 5FMPA 3ZQIA 1ETQA 4MFDA 4JL3A 1WCMJ 2NVTJ 5C4JJ 3LSRA 2LY9A 5EEAA 5IYDJ 1A5JA 1P7IA 3A02A 3FISA 5K7HA 1APLC 2JA5J 1UI5A 1PUFB 5HBUA 3OOUA 5EG0B 4FE4A 1SFOJ 1U8BA 3VW1A 1U9NA 3BRUA 5F0FA 1WGXA 3FK6A 1JTXA 2FQ4A 3BR1A 3S17J 4JYKA 2LTPA 1R9TJ 1D5YA 3FKIJ 1JUPA 2O7OA 5E3NA 1ETXA 1VI0A 2XPUA 3GTJJ 2EQRA 4A3BJ 3DPJA 2ID6A 2HOTA 4D7MA 2CU7A 3IH4A 3BR0A 3ZQGA 2QIBA 4ME9A 5CXGA 1GVDA 1NTCA 4GFKA 1S7EA 3HE0A 1MBHA 4HNVA 1VFCA 1H88C 1B8IA 2HYJA 4GCLA 1K61A 5F27A 3BG9A 5D19A 5EYRA 4MLOA 3IV5A 3GTPJ 3NI7A 3FIWA 2R5YB 2TRTA 2LKXA 3PM1A 3COLA 1UHSA 2NVQJ 4BBSJ 2RHAA 4RDUA 5GPAA 1HDDC 2P81A 2X6OA 1XS9A 3M4OJ 3Q3SA 2Q24A 3LSGA 4IHYA 2D5VA 3M3YJ 1F43A 4CYCB 2GUHA 3PASA 4JKZA 2DN0A 1IUFA 1T33A 3B6CA 4UUSB 1WH7A 2WV1A 5IP9J 3NAUA 2Y31A 5HODA 3GTLJ 1ETKA 3L1PA 3HOUJ 1ZKGA 4D5FA 2MG4A 3BR2A 3S2HJ 1PUFA 2IEKA 2NS7A 5EG0A 2ECCA 3AQSA 3NPIA 5FKMA 1I50J 4DYCA 5EGOB 1FJLA 1MBFA 3TW6A 2R5ZB 4NELA 2DA2A 1TWCJ 1BW5A 1UMQA 5FKOA 1HF0A 2XB0X 4M3EA 2NP5A 5D18A 2NP3A 3E7QA 3S14J 5IYCJ 1X58A 3GBGA 1OJLA 5FKLA 2JA8J 5F04A 3SJMA 2QOPA 3LWJA 1MBJA 1F36A 3HTIA 4C3JJ 3HOWJ 5FGLA 5EDNA 4A3EJ 2L7MP 2EH3A 5EZHA 2OF7A 2EZKA 2CQXA 3CDLA 3LOCA 4I76A 3GZIA 4HKUA 3ZOBA 4BY1J 2G7LA 3VPRA 2N8GA 3V6GA 1HDPA 3BJBA 1VNDA 3O8HA 1TWFJ 4QTRA 4UUTA 1NK2P 3ZQHA 2WUIA 1IRZA 1DU0A 2REKA 3G1MA 2O8KA 2DMPA 3BTCA 3Q0WA 3I4MJ 2PBXA 3VVYA 2Y9ZA 1SANA 4A3KJ 2K9NA 2XGDA 2VKVA 2VKEA 3CRJA 3WHBA 2L7FP 3BTLA 3VIBA 1BL0A 3VVXA 3HGGA 4CYCA 3HOXJ 4FTHA 3H0GJ 3VOXA 3I4NJ 4UUSA 2O7TA 3UKGA 2Y2ZA 3F1BA 3NARA 2E1OA 2CQQA 5IPAA 4NDLA 5C4XJ 1CQTA 3HDDA 1O4XA 3S16J 2HYTA 2Y30A 4M3FA 3G56A 3ON4A 2R5ZA 3C07A 2RAEA 3BQYA 2UXIA 2EZLA 3GTOJ 2YVEA 4CGRA 1QVTA 2XSDC 3HGYA 3LNQA 3OIOA 1FTZA 2YVHA 5C3EJ 3DCFA 4XRSA 5GP9A 4L62A 2DG8A 3C2BA 2CUEA 3QBMA 1GDTA 1ENHA 2E19A 2JN6A 4DZPA 1I6HJ 2AHQA 5HAWA 2K9QA 4GFLA 3MNLA 2R7ZJ 2GM4A 3KNWA 2B63J 3K2AA 3LSJA 3VUQA 1H89C 1AU7A 4D7NA 3VOKA 3HBLA 1H8AC 3NNRA 4X1EA 5M5WJ
chains in the Genus database with same CATH superfamily
5M5YJ 5L3GA 1A6IA 4LLLA 2HR3A 3F9KA 2GXGA 2L7KA 3PNVA 4BEHB 4CCMA 4LFUA 1WWXA 1T56A 4CCNA 5D4SA 1S6LA 2K9SA 2XVCA 3E97A 2NVXJ 1P7JA 3IKVA 5K58A 3LSTA 2JSCA 2DMTA 4LG0B 1XCVA 3CCUI 3F6OA 3L2CA 2EB7A 3WTXC 1B9MA 1IRGA 3S1QJ 1KQ9A 2LKSA 2ZC2A 4IF4A 4BQNA 4BNCA 2RDPA 4AYBA 1TWGJ 3G1OA 4UVBA 4FX4A 4C2MA 2G7UA 3DF8A 2KDOA 3TEDA 2M0MA 4HV5A 3WTYC 2BY0A 3DEWA 5HS7A 4H0EA 5F0CA 2LDUA 3DPLC 2RNJA 1B72B 4Q47A 4F7ZA 2YX4A 2MA3A 3H9QA 2GOMA 4D5CA 1QA6A 2IGNA 1RETA 2AO9A 4Z6YA 3F0CA 2H6BA 4XRFA 3R60A 1SC7A 3G3ZA 5HDGA 1FBSA 2HPMA 1E3OC 1EH7A 1OYWA 2UXUA 2Y9YA 1GXPA 2LY1A 4A2UA 4HDUA 2GXAA 3ZQQA 1PYVA 5J1RA 2EV0A 2MC4A 2BW3A 3JRHA 3L2UA 2HKXA 3JRGA 2CW0F 1LEAA 3HSFA 1IN6A 1LNWA 3GCMA 3KFWX 4CCJA 2IRFG 2P5VA 5FRMA 4L5EA 3OSFA 3LSMA 1BI2A 4RGUA 1UFMA 1Z6TA 3K4JA 4F93B 3MKLA 1HSJA 1AKHB 2PBIA 1VQOI 4A12A 4IQJA 3LSPA 3NRGA 2JRMA 1O3QA 3DKWA 2P6TA 2GA2A 3HB9A 2HQRA 4LB6B 4BY7J 4OIPF 1W5TA 3BTIA 2M5WA 5FO5A 4P5OA 1EJ9A 2HVSA 2XGCA 1MZBA 1TT5B 3MVPA 3QODA 4JK1X 2D6YA 4ZZDA 3ASNH 2FA5A 3RKWA 4B3AA 3GTQJ 4XLAA 2FEZA 4KMUX 3HIMA 4MO7A 1JUSA 2Q8KA 2M7BA 3CUQA 2CUJA 1HQCA 3V7RA 1SAXA 3KKDA 2EK5A 5EGOA 1MW7A 5BPDA 2MGQA 2DFIA 3F8BA 3L2QA 1MH4A 4YELA 3CCLI 3VTIA 4UV9A 2HDWA 2OCCH 1IN4A 4EJUA 4E7LA 3BT9A 4G6QA 4BS9A 2JRTA 4AM3A 2KRFA 3WTZA 2FQ3A 1U8RA 4PJLA 2EIJH 2STWA 3LA7A 2F48A 2DW4A 3K6GA 2B3WA 4P9UA 4Y33A 3TDZC 1Y1VJ 3OR2C 1HOMA 3EETA 1A36A 2RV8A 4WF2A 3T6NA 2OD5A 5DTDA 1ZRFA 3VFZA 3CMAI 3VW0A 4A0YA 1G3WA 1O3SA 2MBFA 3IH2A 4OMZA 3GW2A 5E18F 3BCGA 2XV4S 4KNYA 2QF7A 5CVVA 4CZZA 4XKWA 2GWRA 1VQ8I 3ZRGA 4F91B 2XROA 1QVUA 4CO8A 1H0MA 2FRHA 4F52A 4IEJA 1YW9A 5L3EA 2HKUA 3I4PA 2DOEA 1VQ4I 2RQQA 3OYDA 2XF7A 4WCGA 2ZNYA 2F4IA 4BHBA 3RKQA 4IRIA 3OMYA 4UV8A 5HS9A 3HOSA 3CCSI 4I6ZA 2E1NA 2NOGA 1FEXA 5FFXA 4UB6C 4G7ZF 3BCBA 4MGRA 2XAGA 5EF6A 3D5SC 1BA5A 1U9OA 2DFHA 3DXJF 5E8GA 3CWRA 1EF4A 1SD7A 1EA3A 1VQMI 3ABMH 1JI8A 1J0RA 2L4AA 1X2MA 3DFGA 3I9V2 3A01B 1I6XA 4A93J 2M9HA 3FXMA 5CVUA 1LPQA 2DTRA 1OCCH 2QKLB 4JX5A 4DZJA 2EV5A 4E70A 2KHMA 1MH3A 5JHFA 4LG3A 3KP5A 4A3MJ 4P1WA 3BG6A 4B48A 1ULYA 1V3FA 3QP5A 2HZDA 2R7DA 2G7GA 1B9NA 2OJED 2HXOA 2VE9A 5M5XJ 4J01A 2HQAA 3SZGA 3K8PC 3GLXA 3WGGA 2MYSA 5HLHA 2X1CA 3B6AA 1SD4A 4NQWA 1MMSA 3CJTB 3EGQA 3U9GA 3DLLF 5FLVA 3GFMA 4ZJZA 1R5GA 1Z9CA 1MDMB 3K4NA 4HX4A 3LWFA 1OCZH 2F4MB 5LEKA 1Y8RB 2NXNB 2ZO4A 3L9FA 1WJFA 3V4GA 3PUFA 4XSXF 4L9NA 4XK4A 2CG4A 1BW6A 1MBGA 2IAIA 1MNDA 2CV0A 2WBMA 3GFLA 1BOAA 4GGGA 4LG0A 3U1KA 4C3IJ 1HXDA 1ZG5A 4XLNF 3HTJA 5BPIA 2DXIA 2DK8A 3CCEI 3RKXA 1RC9A 2UXPA 4M3GA 3HOYJ 3JRAA 2KIMA 1Y0NA 1ZRDA 1OCPA 3HTSB 3JR9A 2F5FA 1QBJA 1K83J 1FIPA 3HTHA 1OLTA 2UZKA 1MBKA 5D4RA 4KMFA 2XGEA 5L3DA 2CMPA 3BG7A 1MMDA 1IC8A 4MQ9F 2OERA 1YIOA 5DAJA 2ICWG 4AF5A 1B59A 2BY1A 5D6FA 1U5TC 4CZCA 2KDZA 1G2HA 5D1RA 2X6WA 4CYDA 2BBYA 3JRDA 4KJZA 3SDGA 4MIMA 4MTEA 1H9TA 3ECHA 2E60A 3K4LA 2WAFA 2IS6A 5H6QA 3SWHA 1R23A 2NX4A 2FX0A 1V4RA 5E1WA 2BE5F 3VYUB 4B1RA 2IGMA 3O3KA 2A3SA 3P9KA 4XL9A 3RPUD 2ACJA 3LSIA 4S04A 2GLOA 5LD2C 4UDSA 1JT0A 2QWTA 1FYMA 4GO1A 1OFCX 1K4TA 1ON1A 1ZYRF 2BY3A 3C1DA 5JR3A 3V78A 1JKRC 1ETYA 5E3MA 2DA1A 1J75A 2W7NA 4BQAA 3IWFA 1XCBA 1ETWA 2DA6A 3NEUA 2QSHX 1G3TA 2VOOA 4M9SA 1R4MB 3J7ZI 1AHDP 1SVMA 3FHNA 5HDNA 5DCMB 2LD5A 1QPIA 3BNIA 2B7EA 1MNEA 2ZB9A 5M3MJ 1YS7A 3N05A 2IS2A 2KISA 4LK0F 4EVIA 5IP7J 2K9LA 2PX9A 3A4CA 3C3WA 2BVLA 2ME0A 2MD5A 2WY8Q 3KZYA 2XPWA 2V7FA 1J7KA 3ZQIA 4MFDA 2GQQA 3MZ8A 1W4MA 2VBZA 4MHGA 4FETA 2NVTJ 3LSRA 3GVAA 3CTAA 2O61A 5EEAA 5IYDJ 1PVEA 4HYEA 5K7HA 3CCVI 2LOOA 1UI5A 1PUFB 1U8BA 3BRUA 3E5QA 1R36A 4BACA 4CGZA 1JTXA 3WTTC 2L9VA 2E35A 3F72A 1Z7UA 3F8NA 3HSEA 3UNGC 4G6TB 2A69F 4D9JA 2OZUA 2O7OA 3KEQA 4GYGA 5E3NA 5FB2A 3IRQA 1VI0A 2H6CA 4A0XA 2EQRA 4A3BJ 2WV0A 3DPJA 3IH4A 2QIBA 3BR0A 1PDNC 1VQKI 5CXGA 2CFXA 3H36A 5EEHA 1SFEA 1S7EA 1QU3A 1BOBA 1YG2A 5KCMA 1X19A 3G6EI 2CO5A 2FUG2 1NG6A 2ZJRF 2LKXA 2PJPA 1FP1D 3COLA 1SEUA 3F21A 1R58A 2NVQJ 4N4OB 1FYLA 1T98A 4LIUA 2JUGA 2D1VA 2HTJA 4KA4A 3Q3SA 2Q24A 2VT3A 1RUNA 1USTA 2Z99A 2TDXA 4U9LA 3ZMZA 1LDJA 4HRIA 2DQLA 3RPQA 1ETKA 1SFKA 2E1CA 2HFHA 2X6YA 1I50J 2CUZA 5FKMA 2ZJPF 1FJLA 1U2WA 3RIRA 2VKHA 3BJ6A 1ACIA 3OS2A 2HS5A 3OIQA 2XB0X 4LIVA 2NP5A 5IT9K 3HUGB 4UUVA 5FKLA 1L0OC 3NQOA 3SJMA 2QOPA 3HTIA 4A3EJ 2V79A 3EUAA 5EZHA 3CMEI 5J4YA 4BQOA 3CDLA 1V5FA 2IW5A 3LOCA 4I76A 1USSA 2W82A 2HKOA 4RB2C 2MFZA 4HKUA 2P6SA 4XNFA 3L2RA 2IA0A 3RPUA 1Z3YA 5HDKA 3O6BB 2ZMEB 2WUIA 3TOAA 1MDMA 1TZLA 3ML6A 3DKYA 2O8KA 3ZGKA 4KDPA 4WXDA 1D1CA 2Y9ZA 3M7GA 2VJIA 2VKVA 2EFQA 3VVXA 1BL0A 3HGGA 1RZ4A 2EA2A 4FTHA 4XLHA 3N4MA 4UUSA 2ZXJA 3M1CA 3VOEA 4U0VA 3Q9VA 3F1BA 4E7IA 2E1OA 3HZJA 2CQQA 5IPAA 2NRAC 2UXXA 1CQTA 3HDDA 2GA1A 1D1BA 3S16J 2HYTA 4E7ZA 3I59B 2DI3A 2XSJC 2MC3A 3G56A 1I1GA 5FROA 2X6XA 3BQYA 2EZLA 1XGSA 4UVAA 4F55A 2EV6A 4WWCA 3GTOJ 1Y39A 1QVTA 2XSDC 1QHHD 2KMUA 3HGYA 4RAGA 5H20A 3OYBA 2UUZA 4M9ZA 4YRVA 1S3JA 2OC6A 1FTZA 1EH6A 5C3EJ 4C30A 2K85A 4L62A 5GTIC 3SFZA 3FKJA 2CSOA 1GDTA 3FMQA 4RGRA 1I6HJ 5ICCA 3VSLA 2W1OA 4PSWA 2K9QA 4GFLA 4CA0A 4YG2F 1STZA 2B63J 1BR2A 3IL2A 4IVNA 2NNNA 2I8DA 3CP8A 3FHZA 1G8XA 2RNGA 3I56I 3VOKA 3OYIA 4O5VA 3NNRA 2H94A 4NC8A 2KIQA 2ETHA 4ZH4F 1KU2A 1KU7A 2JSPA 1T39A 3KX2A 3V8KA 2HYGD 3ABLH 4L9VA 3WHCA 2X9DA 3AG1H 3QYFA 2KJBA 3OV8A 3ERED 2X85A 1ZG3A 4OAYA 3IUVA 3AL0B 5ED4A 3CF2A 1U0JA 4UB8C 4A3DJ 3H9JA 4MEXF 1D3YA 2IA1A 2QQ9A 4RGSA 4IHTA 5AIPA 5E1ZB 1XPXA 1FZPB 3GEUA 2HQ5A 4RB3C 2R7QA 3KZIC 2MABA 2Y0SA 5ICEA 4B8XA 3KZ9A 4YIIA 2CRGA 1LE8B 4QIWN 3GUDA 2HOAA 1WI9A 3BZ6A 3S3NA 2D45A 2W57A 3EUPA 1MD0A 2FMLA 3OWTA 1YFHA 1VQ5I 2EIMH 4L5IA 3O2PE 4KIFA 4GYIA 5K7ZA 4JNNA 4EM1A 3BWGA 3RD3A 1JKOC 3CUQB 4M6YA 5HLGA 2DG7A 2M30A 4U87A 1P9QC 2MH9A 2VQCA 2XPVA 2R7WA 2A07F 3JRCA 2DODA 2UWMA 1VF9A 4JX6A 3K4BA 3DLAA 4FQGA 2JA6J 2HZTA 4V2GA 3JTHA 1V55H 5DD4A 4QLCU 3K9TA 3IAM2 2M4GA 5H2FC 2DT6A 2QWWA 1VQ9I 4KUMA 4MK6A 2XGXA 3E3VA 3SYTA 4A3FJ 2DA3A 4DW6A 1YW8A 5DUIA 1FT9A 1LKXA 4HV6A 2HNHA 3HKZN 3BPVA 3NWTA 3WGIA 1KU9A 2E5NA 2Z3YA 2DT7B 1MNMC 5IT9Z 3MZYA 2WAQN 4GCKA 5BNGA 4G7HF 1T0FC 3BR5A 3E6CC 4BXUA 2QKMB 1W0TA 5C4YA 3R4KA 1O3RA 2W25A 1Z21A 4FHTA 3W2WA 5BS6A 2IU5A 1YHQI 4JBAA 3ZMVA 4Q48A 2M0CA 1SMTA 1QRYA 1XD7A 2LR8A 4OIQF 4I02A 3PPBA 1ZGAA 2H1KA 3C2HA 1QGPA 5FLMJ 2O8XA 4M71A 2L3DA 3AG4H 3CO7C 5CW8A 3BQZA 3QU3A 3PO3J 3GFJA 2F4OB 3H3VK 2XF6A 4RMNA 1RESA 1VQNI 2QEXI 4U7DA 1KGSA 2XRLA 4OD5A 1K79A 2XAFA 4ACIA 1U6GA 1S72I 3SEQA 2DA4A 3TO7A 2HGCA 5CVJA 1F4KA 3OY9A 4OIRF 3FXOA 3FM3A 5JFRA 4HSTA 1XGNA 2BVMA 4IOAF 1B8IB 2KIFA 1WPKA 1OYIA 1TW3A 4RBOA 2M45A 5LHGA 3AAFA 3OL3A 1JGSA 2ADUA 4XORA 2BY2A 2XAHA 4BDYA 4NQWB 4RM3A 2NS8A 4I0AA 1JHHA 3Q0UA 4BUPA 1FMVA 2P4WA 5CLSA 4XRMA 4M9XA 3MN2A 1P2FA 2AXLA 1FPQA 2AQFA 2BEOA 3BLYA 4LOCA 1MSEC 3EUKL 3RCOA 3SFIA 4A3JJ 4C3HJ 3AQTA 4RS8A 3FXUA 5IP6A 2YVXA 1YOVB 2D1HA 3D1NI 1FIAA 5LRRA 1ONVA 2GXBA 4U7BA 4JX4A 3VSKA 5KNLA 2PLYA 1IUYA 2M7AA 1ZTRA 2W84A 1TWAJ 3I59A 1RUOA 3LA2A 4G9YA 1BJZA 4A3IJ 4YIRX 4KWAA 4DYRA 2VXZA 2QTQA 2NNYA 2Z33A 2FBQA 1LDKB 1R71A 4KT6A 2E2IJ 2J5PA 2H8RA 2BXZA 3DV8A 2L9RA 2A6HF 4U0WA 1F1ZA 2IPQX 3L2WA 1X2NA 4PDKA 3ERMA 2LG4A 3WTUC 1HA8A 2K86A 3IH3A 4IRGA 2BOLA 3RTRA 3LSHA 2PFVA 3MWMA 3GTKJ 1ZAOA 1OR7C 3F8CA 5E3OA 5AQCA 2FF4A 3BJAA 2QM3A 1FNNA 1DUXC 1UJ8A 4P96A 2PFBA 4ASNA 1A35A 4PK4A 5JLWA 4A3GJ 1GUUA 2OTJI 3H35A 2EFPA 1BN5A 3QYEA 2GBYA 2K3FA 4E7SA 3PIOF 1JJ8C 2CQNA 1SVLA 3PSFA 3K70C 4A0ZA 2O03A 2MSYA 4JP0A 2LSOA 4HG2A 2LP0A 2IA2A 4IHSA 2V26A 2ZSIB 1WJEA 4S0HB 2G3BA 3ZN0A 1VQ7I 3RQIA 5F1RA 2I5UA 1WI3A 3AKZA 5CXIA 3S3OA 1SFUA 4OD4A 2VQLA 2A6EF 1X3ZB 1LE8A 5L3BA 3CESA 2VUMJ 4HF1A 4ANJA 4PJ0C 4PUSA 2F6CA 2MLKA 2PG4A 4Y17A 4BGDA 3WTWC 3KP4A 1GV5A 3DKXA 1JHFA 4LK1F 2MW8A 3V8LA 2QGUA 2CQ7A 1ZLJA 2P5LC 2L7ZA 1ITYA 1Y0UA 1BR1A 3WE3A 3IWZA 5LRSA 4IRHA 4M6XA 5FFZA 5B1BH 3MEXA 1IXSB 3KZZA 2NOJB 4QPOA 3ON2A 3ECOA 4A6EA 2ZJQF 4IKFA 5IY5H 4RAFA 5FKKA 1J2XA 2DA7A 2YX7A 2O3FA 3FMSA 1FWZA 1I5ZA 2XKOA 1NK3P 3JAMZ 2HI3A 3FBIB 2DK5A 2XAQA 1IO2A 4KIBA 3HEFA 3RZDJ 4M6VA 3O60A 1DU6A 4AYBN 5J6XA 2EPFA 1KYWA 3IRRA 2R92J 1JKPC 2OUMA 3U2RA 3JTGA 1XN7A 5DD8A 3TO9A 3JRIA 3GZ6A 4A3CJ 1O57A 1HCRA 5JI6A 2ZCMA 4KITB 3MKWB 2OQGA 4QSHA 5L3CA 1P92A 5EZGA 3H1CA 1JJ6C 1BIBA 1XG1A 2L9SA 3DPTA 2ZSHB 1V54H 1T8IA 5DV5A 1LFPA 1RPWA 4PZJA 2WC2A 3ZR8X 1D0XA 1LJ9A 2DTZA 5LGNA 2Y69H 2LKPA 2R7FA 1I1SA 4AVZA 2V9KA 2DMUA 5K5QA 2LK2A 2O5RA 4PGGA 4ZDLA 2VONA 3CC2I 3QKXA 3P9IA 1HLVA 2OTLI 3IAS2 1XB4A 4JL3A 3PL8A 2KZGA 4GRIA 3FXKA 1E2XA 5C4JJ 2ZXHA 1UZCA 2R7SA 3QPTA 4ON0A 4YFXF 4IPAA 1BC7C 1DGWY 3VODA 1WGXA 4X0GA 3ULQB 4GCVA 3CP2A 3SDBA 4ENKA 1VQLI 3S17J 3DTEA 2NAZA 4K2EA 1QZEA 4QPQA 3SZTA 1R9TJ 1D5YA 3FKIJ 1BI3A 1JUPA 4KT5C 2XPUA 4KN7X 2B0LA 2HOTA 4ME9A 1GLNA 3ZQGA 5GAGJ 1GVDA 4DVYP 1NTCA 2QQAA 4LLGF 1W36C 1MBHA 4HNVA 2KKOA 4IL6C 1B8IA 1BM9A 2L02A 3BDDA 4GCLA 5F27A 1Q1HA 3I5UA 1G4DA 3F8FA 3GTPJ 1XDUA 2R5YB 5TISC 1BR4A 2TRTA 3DBRB 1HW2A 1KQ8A 3WE2A 2BYVE 3CUOA 3MCZA 2HYFA 2RHAA 4DBRA 3M8EA 4HSRA 5GPAA 1HDDC 4ZYGA 2GZWA 3M4OJ 4RGXA 2QUFA 4IHYA 2FNAA 3M3YJ 2ZNZA 1Z6RA 2GUHA 4D1QA 1R5HA 5ICFA 3MKYB 4L18B 1IUFA 1UB9A 4UUSB 3OYLA 4EJOA 2A05A 5HODA 2O6GE 3KETA 2LMDA 1KYZA 4D5FA 3S2HJ 5EG0A 3NPIA 2K5CA 4NELA 3TW6A 3TDUC 4XLEA 3BCAA 3WODF 3WG9A 4B3XA 2AS5F 2RQPA 5D18A 4BJTA 1X58A 1XDSA 3GBGA 1OJLA 2JA8J 1LVKA 4UHTA 2FOWA 4WK8F 5IT3A 5F04A 1B6AA 3E5UA 3LWJA 3LQQA 3H5AA 1FX7A 5EDNA 4ESFA 2CQXA 1MIJA 4E7HA 5LGUA 3ZOBA 2PMZA 5DM7F 3GX4X 2K3PA 4Y3OA 3BJBA 2ESNA 4UUTA 1NK2P 1YLFA 3K1MA 4WXHA 1ZREA 1Z7LA 5E8IA 1QQIA 2PBXA 3Q0WA 1DGRM 2M1BA 1E17A 2CS3A 1TL8A 3CRJA 3VIBA 2L7FP 4CYCA 3VOXA 1PP8F 1BC8C 4XM3A 3EUHC 2Y2ZA 3KE2A 3NARA 3D5LA 4Y13A 1ZRCA 2B1EA 3RI4A 1O4XA 1FOKA 2PMUA 1Y6IA 1X3UA 2DPUA 2QSGX 1HW1A 2DJIA 3A0BC 5KVRA 2R5ZA 3ON4A 1ON2A 2RGVA 3RDIA 3C07A 1BBYA 4UNOA 1TQMA 2DPDA 1AA7A 1DP3A 2P0WA 1X1CA 3OIOA 5EJCA 3ZMSA 2ELJA 5CPRB 3SHFA 3TQNA 4KICA 5FLXK 2HWVA 3RQ4A 4OMYA 2DG8A 3GEZA 4HBLA 2FNPA 4N9IA 1G59A 1WKMA 2CYYA 2W00A 1FP2A 2LC2A 3K2AA 4NBQA 2DT5A 4D7NA 1H8AC 2HPIA 1HSTA 3DQVC 3L7WA 2CH0A 2R7RA 5M5WJ 3P9CA 2ISZA 1QO0D 2XDNA 1TWHJ 4WX9A 5BOXA 5GPCA 2IS1A 1JXSA 4XSZF 3F23A 4BE1A 1ZGWA 2ZOZA 2YUSA 1XTAA 3M8FA 2XHKA 2V6EA 2V1NA 2DYRH 1MMAA 2CJJA 1FBUA 2QYOA 5GTHC 1WJBA 5B66C 1SD5A 5CYVA 5JHUA 3VP5A 1LEBA 4B4CA 2VJJA 5J47A 2K02A 4V19K 4KIGA 5FD5A 4WXCA 3ZCOA 2M34A 3DTKA 4CXFA 4RM2A 3HJEA 3K10A 2E1MB 3D0SA 4G8XA 4AD9A 3CMYA 5H9TA 4XR6A 3ZQFA 3BJOA 2Q1ZB 1IG7A 1DP7P 3H9GA 3ZMUA 3OL4A 5F08A 3HXLA 2ISYA 2V6CA 4LGWA 3LFUA 4Z2YA 4JOMA 4NB5A 3Q0VA 5HNHA 1EV7A 2DU9A 3FMRA 3GTMJ 4IHXA 4BE2A 1NH3A 1UG2A 2FOKA 1SVOA 4WIBA 1IRFA 1LDDA 4W97A 2JA2A 3CCMI 4YZEA 2YU3A 2F5EA 3BR3A 3F8MA 5FHPA 2UV1A 3MKZA 1SMYF 3T5XA 5LLQA 3SQNA 1FC3A 3A03A 4C2UA 2QCOA 3IP4B 2R0QC 1DPUA 3WG7H 2CV1A 5IOYA 2STTA 4ZC3A 2IBDA 3MZHA 3W6VA 3NS4A 1HKQA 2VC0A 1FOXA 1TW2A 2CUFA 3HHGA 2OZ6A 3N97A 4CUGA 1XMKA 3E6DA 2JMWA 1MBEA 5TRDA 3A1YA 4BYYA 1YQAA 4BBRJ 5IOZA 3OYNA 3REOA 4P9FA 2BHYA 2NS0A 1YJNI 2R5YA 4PJMA 3AG3H 3QPSA 3HHHA 3SZPA 3JREA 1S9HA 2BHZA 3H5RA 4L0YB 2PEXA 1OKRA 3CCYA 1HBXG 3QWLA 4N0BA 2RVCA 1ZG1A 1WJCA 2B9SA 3U1DA 3R0AA 4DYQA 4NUBA 2COMA 1N25A 3OYAA 4YIFA 2A5WA 3LJLA 1YITI 4G94A 3TO6A 3S1RJ 4PXIA 4ENNA 3VVZA 4CCKA 1X1PA 4A5MA 4BAYA 5DM6F 3WU1B 3OIPA 2ZCWA 3GZ5A 2L2OA 2DCEA 2M2EA 1U78A 1M1EB 3WU0A 2L5QA 3H92A 4N4NB 4FCYA 2GAUA 2KRHA 4M72A 1XSVA 2OPTA 4YEJA 4Y7NJ 1XGMA 4RA2A 4PFPA 1HW5A 1DQUA 1TQIA 2PQ8A 3HPHA 2LFBA 3ZQLA 3KYDB 1HC8A 1QHGA 1JTYA 2QLZA 1R6RA 2JZYA 2V1XA 4RLFA 2EFWA 2DLLA 3QYBA 3V7SA 3S1MJ 4NN1A 1LFBA 5ERIA 1Y1WJ 2FXAA 2VOPA 4ABZA 4HOBA 2XKPA 2RREA 1MJ9A 1D5VA 2DA5A 2VI6A 1W5SA 2WB1N 2X4HA 5KAFC 1IRXA 2QQBA 5FLXZ 2YS9A 2JJ7A 4J19A 3PNTA 3G7RA 2R4GA 3TKYA 5J4VA 3NRVA 2A61A 4ETSA 1ZH5A 3HOZJ 4IQ4A 2FMYA 3S32A 4XQFA 2F07A 4L9JA 4W1UA 3RZOJ 2WAQA 2OCEA 1GT0C 2L54A 4EQQA 2OA4A 3P5JA 4I98B 4BE0A 2R7OA 3T0YA 3H5NA 4AC0A 3FRQA 5D5WB 4XOTA 1D0YA 1RR8C 1F9NA 2KT0A 2HOSA 4NHJA 2ZY9A 2LRDA 1OCRH 2EA4A 3K1NA 2XDVA 3PFIA 4EV0A 3B73A 4A3LJ 1I3QJ 3BHQA 1ZELA 2FE3A 4RB1A 4I2OA 1JKQC 2X48A 5ILSA 2XUBA 4ESJA 2VIXA 3SEZA 3GTGJ 5CQEA 5D5XB 2R93J 3OSGA 2A68F 4Q5SF 2V4JC 4KN4X 1CF7B 1EH8A 3MD2A 1X4PA 3DP7A 2G7SA 2K4BA 1W0UA 3E6MA 4U0YA 2IGOA 2EBIA 2VT2A 5HOOA 3QRFF 1N78A 1VQPI 1JT6A 3VW2A 4XKBA 3HL2A 2E2JJ 1UCRA 2LLKA 2O9LA 3CO6C 4X6AJ 5H6RA 5A2QK 3QQAA 4OIOF 1D8JA 4R8HA 4B09A 2Q2EB 3OR1C 4EJVA 3EYIA 1R49A 3I0TA 4PGHA 2ZOYA 1NHAA 2ME6A 3QU6A 3F22A 1WRJA 3B02A 1CGPA 1UELB 2R7TA 2X1DA 5HSZA 3TP3A 2ZCNA 5FD6A 1KONA 4LB5A 2OI8A 3RYPA 4FASD 1G6NA 4M74A 3RSNA 1B4AA 2DOFA 3RYRA 3BOQA 4ZYDA 3ZQ7A 3H0DA 2GFNA 5CJ9A 2RASA 3E5XA 2LBFA 3CD6I 2FJ1A 4LITA 1BIAA 1J5YA 3BR6A 1Z0XA 4AC6A 4HPQA 2EINH 3FWEA 3CZ6A 2WA0A 5J1UA 4XMYA 1IF1A 4AIJA 2LH9A 2TCTA 3JAMK 2WY7Q 2E36A 2ZMEC 5D8LB 5D5UB 4GXOA 4FX0A 2LREA 2DJNA 1D8KA 3WGHA 3VB2A 3IHUA 4IHVA 4IHWA 4HQEA 4Y52J 4AUXA 3BG3A 5HLIA 1MSFC 4HNUA 4FISA 5FRNA 1O3TA 2V9VA 5D5VB 3ABKH 2Y0MA 2L4MA 4BKXA 3OOPA 2JUCA 2ZCXA 1D1AA 3CQZJ 3CF5F 5GAEJ 2L01A 2GENA 5FJ8J 4O3MA 3W2AA 2Y0SN 3ZP5A 4G12A 1YRNA 2H1LA 2QBYB 1W7PD 4NNJA 4BXXJ 4CDGA 1Z67A 3MQ0A 3C18A 4KFCA 1I3AA 3G4SI 2E7WA 1ZR2A 1O7LA 2JTVA 2VQGA 2G9WA 2M8GX 1S5LC 3AG2H 3CCRI 1ZR4A 2V57A 4A69C 3LQRA 1ZGJA 3HIFA 1P4XA 4YFKF 2XC7A 1OCTC 4HA8A 1RR7A 1DPRA 4E4HA 3K70D 3TMOA 1H9GA 4JQFA 5F0HA 4R1HA 1JUMA 1T0FA 3TW7A 1QNTA 4HZFA 5FMPA 1ZN2A 4ENJA 3OYGA 3DTIA 5HLTA 1WCMJ 1E3HA 2LY9A 3LMMA 1IN5A 1A5JA 1P7IA 2QQ8A 5CVRA 1APLC 3A2KA 5HBUA 1TLHB 1SFOJ 2P8TA 5EG0B 2W85A 5DUKA 1U9NA 1XSXA 5J8CA 2HDCA 4XOPA 2VJ5A 3BR1A 3GYHX 2KP6A 3H3UA 2ZFWA 1YTYA 2LTPA 3DU5A 3AL0C 2EWNA 3IKTA 2Y48A 3CJQB 5D8KB 1ETXA 2XASA 1OCOH 2YSRA 3M1EA 4PCQA 1K78A 4Y4RA 3HE0A 2M4KA 1VFCA 4B44A 2EIKH 1X3WB 2JT1A 2JPCA 3BG9A 3ZN1A 4BHPA 5D19A 2GIZA 5EYRA 2XRNA 3FIWA 1SFXA 2EFNA 2Z2SB 3PM1A 2QA4I 4BBSJ 5LHHA 1R1UA 4RDUA 2E5ZA 2FU4A 4IZZA 1X1BA 1XSDA 3OYFA 3CUQC 3ZPLA 2M8EA 5KHDA 2PN6A 1YJWI 1GHCA 2X0LA 1N77A 2D5VA 2IGKA 2IVMA 4CYCB 4JKZA 3PASA 3QOEA 2DN0A 3B6CA 2VBXA 5HNFA 1WH7A 6PAXA 2Y31A 1Y8QB 3W6KB 3FF5A 1G3YA 5AONA 1IXCA 2IT0A 3L1PA 1G3SA 1ZKGA 3D5RC 2MG4A 1Z05A 3DBHB 5A2QZ 3I71A 4HDVA 2IEKA 2NS7A 2P5KA 3ONQA 1X1AA 3GXOA 2R5ZB 3ABUA 1TWCJ 5F6FA 1TTYA 5FKOA 3FXLA 2ZKZA 1FOYA 3LA3A 3LSKA 2NP3A 3E7QA 4XKVA 2W24A 4TV7A 5IYCJ 2IXSA 2DFEA 2VBWA 3CJRB 3M07A 1MBJA 2LY2A 4U88A 2Z16A 4LJZF 4C3JJ 3HSRA 3RJPA 2E34A 2L7MP 4ZTFA 2OF7A 4PJNA 2EZKA 3KEYA 1FMWA 3LAJA 1CF7A 2LF7A 3GZIA 2R7UA 1PUEE 3VPRA 2A5YB 1LQ1A 3ROUA 2N8GA 4CICA 5FGMA 1HDPA 1RI7A 1LB2A 1VNDA 3O8HA 4QTRA 3ZQHA 1U5TB 2EJRA 1IRZA 1DU0A 3G1MA 3I4MJ 2DMPA 3KP7A 3UR3C 4ZYEA 2Q2EA 1IN7A 5E20A 2XGDA 1W36D 2GOXB 1W7PA 3GZNB 1X4OA 1OR7A 3DBLB 3WHBA 1PP7U 5B1AH 1AWCA 3H0GJ 5K1YA 3I4NJ 4AIDA 2O7TA 1U3EM 2QSFX 3UKGA 4MEYF 5ICGA 4ENMA 5DYMA 4NDLA 2HU9A 1R7JA 2JVHA 2VN2A 4M3FA 1ZLKA 1SD6A 1FLIA 2VXDA 4XONA 2DO7A 3K1PA 4HAMA 4DGWB 3K4CA 2UXIA 3ASOH 4DIQA 2YVEA 4CGRA 2QZ8A 4Y15A 1HKSA 1FYKA 4DBQA 3BC8A 4QWQA 1TBXA 3LNQA 1TNTA 4DOZA 4XRSA 2VKDA 1XX5A 5GP9A 1I39A 3V8JA 4I99C 1J9IA 3C2BA 2HVRA 3QBMA 4UY8I 4DZPA 5CVIA 1J59A 2H8WA 4BJ5C 3OYHA 5HVQC 1R00A 3I3LA 3MNLA 4HW0A 3V7CA 4IO9F 3CC7I 4B47A 1TP4A 1MJAA 3F3XA 3LSJA 1H89C 4I0BA 1ERDA 2KLOA 2PJRB 3HBLA 2VASA 2JQ7A 4X1EA 2CV2A 4G7OF 4XLCA 4IOCF 1POGA 4Q4ZF 4J00A 2AQEA 5B3SH 2R7XA 4P55A 5KAIC 5J3LA 4AIHA 5K5OA 4M3BA 4LD5A 3FX3A 2LNBA 3CDIA 3S8PA 2VJ4A 1YI2I 3V42A 3BROA 2HQNA 5LBQA 2R3SA 2QBYA 3GF2A 4XIDA 4XICA 4UXNA 4L9TA 3ANPA 2VL8A 1LUJB 5GAHJ 3CCJI 3HM5A 1Z77A 1SGMA 4BDZA 3BY6A 1YS6A 1GVJA 4FT8A 1TQPA 1RKWA 4RAZA 3L2VA 2UXHA 1W1WE 4F3QA 1ETVA 3NXCA 4I09A 3I55I 1WQ2A 1IDYA 3HPGA 1P6RA 2ESHA 2A2FX 3I64A 1V5GA 5LGTA 3S3MA 3H3ZA 1MKMA 5GADJ 4HF2A 2J5OA 1ORKA 1TNSA 2OBPA 2P7VB 3ZMTA 2W53A 1IAWA 3ZXSA 3L09A 2FBIA 5JLXA 5DCFA 3FZVA 1NG7A 2RKHA 3FM5A 2QKOA 5LHIA 4EATA 3VYRB 2RC4A 3OYJA 3R6SA 1RRJA 3WTSC 2WTEA 2Y75A 3OYKA 2AXTC 2FBHA 2BGCA 3U21A 3DEUA 1D0ZA 2ELHA 2IJLA 5M3FJ 4CHUA 4BEHA 2K40A 4PSXA 4BU2A 2ZBKA 2YU9J 3WU2C 5E17F 4OU0A 5TGTA 1EKEA 2JWTA 2FD5A 3FK7A 3CDHA 2Q0OA 1IN8A 4XRSG 1UG0A 2DAOA 2KFDA 4MNUA 2K9MA 1XMXA 3DU6A 3W3CA 3S1NJ 3G1LA 3TP0A 3QOPA 1F5TA 1FY7A 3FDYA 5EFYA 5ILVA 4DQ2A 1B72A 3KYCB 2P7CB 3ANGA 4HQMA 3OS1A 3K4MA 4BHCA 5E3LA 4KISA 1ZK8A 1OISA 1T95A 3PSIA 3T8RA 2CGPA 2NVUB 5DDGA 2K27A 1T08B 3HOVJ 1RKTA 3X2QH 2PI0A 3J81K 2ECBA 3CC4I 3BZKA 1OQYA 2I10A 1ZHFA 4EGZA 5K7FA 1XGOA 1WJDA 2ID3A 2F5DA 2ZXIA 4MFEA 1FSHA 5C44J 1UI6A 2F2EA 2K7LA 4NC6A 4AWXB 3HTUA 3J7AO 1L3LA 2UXOA 1AKHA 1REPC 2WGBA 2VPRA 4XBFA 5B5EC 1FSEA 2QENA 2VODA 3QAHA 4AVPA 4GFBA 2GIVA 2JK3A 1IGNA 1S29A 1X1DA 4IXAA 4EJTA 2HOEA 1U5TA 1JGGA 2JVGA 3CLOA 3AFHA 2FBKA 5AIQA 4NC7A 4C2TA 3DPUA 2EZIA 3ESWB 1VZ0A 3JSJA 2E7XA 2O0YA 1ODDA 3TL4X 1LFUP 1ZQ3P 2F5VA 5IYBJ 2PZ9A 4HX8A 2FJI1 3JRBA 3KCCA 1TC3C 1ETOA 3EYYA 1IV6A 2L0KA 1P4AA 4U9NA 1AOYA 2ZFUA 2DMQA 4E7KA 3HRUA 5F1JA 4II3A 2XB5A 2YR2A 3EUHA 4L0ZB 3S15J 4BXFA 1B1BA 3KPHA 3RKYA 4CH7A 4OAZA 4AIKA 2PMZN 3I58A 2LBFB 2DYSH 1QPMA 2VLAA 3S93A 3O8GA 1KA8A 4ZYHA 1GV2A 4BJ6C 4O6JA 3LAPA 1UAAA 1MGTA 4HNTA 3BTJA 3FBNB 4A5NA 2G0EA 5FKNA 5F64A 3E7LA 3C7JA 3PO2J 3NWSA 3J80K 3KLNA 4LLNA 3TBIA 3M9AA 3EQLF 1T38A 1YYVA 1UHWA 3HTAA 3HRMA 1UHMA 1IDZA 3I53A 2E2HJ 1XC5A 2Z1DA 3PFYA 1OMIA 4HEA2 3K69A 5J8FA 1SAUA 4M3DA 2JA7J 2PJRA 2ZJ2A 3IUOA 2BZTA 2Z5UA 9ANTA 1VQ6I 2LVSA 3BPXA 3GLLA 3P9TA 2K4JA 3T1BA 1DDNA 1WZ2A 1LVAA 3S2DJ 2D2WA 1IZ1A 3JRFA 1KQ0A 3IC7A 3SXYA 2JPBA 2YPRA 2WB1A 4OOIA 1YRNB 2L9NA 4V2FA 2WWYA 1Q1VA 3PJRA 5LFAA 1Y56A 4MQVA 1I27A 3HG9A 4ITVA 4PFOA 1FOWA 1QZZA 4MXMA 3MFKA 2VE8A 3BG5A 2XF5A 2DOAA 1JE8A 1A6QA 1Z3XA 2HXIA 4ICHA 2EZHA 2KRCA 3KKCA 1R1TA 3M8JA 2VBYA 3A01A 3ZMDA 3KP6A 3WTVC 4CSWA 5JVGF 2KQRA 3K7AJ 2COBA 3S5RA 1HKTA 2XAUA 1E3PA 3VYSB 1WH5A 4FE7A 3CJDA 2DMNA 3MAJA 2MD0A 5DS9A 3LHQA 4ZDPA 1YX3A 2DDAA 2ZXWH 2V1DA 1BI0A 1YJ9I 5TJJA 4IX7A 3PQKA 2F5CA 2HTSA 1O7FA 1BI1A 2LF8A 4GCTA 2CWEA 1QZYA 5CQGA 2HEOA 4DJAA 2Z9OA 3RH2A 3G2BA 2IP2A 3ABTA 1N75A 1MMNA 1KU3A 2DDBA 2NVYJ 1V5EA 2BV6A 2W48A 4IJAA 4N9HA 4A6DA 4H4KC 4EM0B 1K78B 3BP8A 2HDDA 1P4WA 3ZQCA 2MLGA 2ELKA 3QPHA 3J81Z 3F6VA 1WJAA 4C2MJ 3EPZA 3EDPA 4D0PA 4AU7A 5KK1A 5ILUA 5J1YA 2QVOA 3GMEA 5EEGA 4F92B 4HLXA 2CQKA 4XN3A 4EEFG 1FTTA 2VC1A 3J7YJ 3HKZA 3B81A 2V1UA 3QPLA 1IW7F 4BQQA 4YFNF 3W2VA 5BMZA 1IJWC 4MTDA 4HX7A 1ETQA 2R7VA 2WADA 1YO5C 2KL4A 3A02A 3FISA 3HOTA 2JA5J 3OOUA 1RIOH 4FE4A 3VW1A 1S7OA 2NYXA 3OYEA 5F0FA 3FK6A 3OS0A 2OU2A 2FQ4A 2BW3B 4EMSA 3FXRA 2DFFA 3A0HC 3CJNA 5DEQA 1YE9A 1PJRA 3KLOA 4JYKA 3W6JB 3CCQI 2RN7A 4HLYA 2UXNA 1OPCA 3ELKA 2DQRA 4BL0B 1R5ID 1RNLA 3E6BA 3GTJJ 2ID6A 1J09A 2OV7A 2CU7A 4D7MA 4LMYA 2KIUA 4XLPF 4GFKA 3QP6A 4M73A 4BH9A 2XIGA 2FSWA 1H88C 1Z1DA 3VDXA 1C0WA 2HYJA 1K61A 4MLOA 2E1MC 4G6DA 4UVCA 3IV5A 3NI7A 4HF0A 1WVRA 5LEJA 3I54A 3LFKA 4EJWA 1K7AA 2KJCA 1K4SA 1UHSA 4RAYA 5DCMA 2H09A 1A04A 4CCOA 2P81A 2X6OA 3J80Z 3BZCA 1XS9A 1WSUA 1K6YA 4CCLA 3LSGA 1W7PB 3K4KA 1F43A 2OQRA 1T33A 2BXYA 3R0JA 4IRVA 2KZVA 2WV1A 3KP2A 2G7HA 3NAUA 1R22A 5IP9J 3CMMA 3GTLJ 2VPLA 2PMHA 3HOUJ 1OYYA 2WAEA 5E1XA 4S05A 3BR2A 3HYIA 1PUFA 2LYCA 3AQSA 2ECCA 4PJJA 4GDFA 4DYCA 2EILH 1W5CC 5EGOB 3COAC 1MBFA 1BJAA 1R1VA 2DA2A 1WJ5A 3OYCA 1BW5A 1WFXA 1UMQA 4OINF 3J7AY 1HF0A 4M3EA 2C6YA 2CW7A 3S14J 3TGNA 4ZYAA 4XLFA 3KP3A 1K6OA 5HS8A 1VTNC 2MH2A 5JVTA 1S7AA 1WHUA 5BQTA 1F36A 3ISPA 3OYMA 3HOWJ 1T6SA 3PNYA 1KZHA 5FGLA 1ZARA 2EH3A 2X1EA 2HVQA 3GO5A 2M3AA 3PQJA 3MMYB 5K5RA 3TOBA 4BY1J 2G7LA 4EGYA 4XKCA 2OAZA 2X51A 3V6GA 1TWFJ 3FXQA 2REKA 3HRTA 3BTCA 3E0JB 3JSOA 3VVYA 2XAJA 1SANA 4A3KJ 2KPMA 1Z91A 2K9NA 3KEOA 3DWLE 2VKEA 3VEPA 1T2KA 3VWBA 3BTLA 3KIOA 4XN0A 3HOXJ 1TT0A 3HRSA 3DEEA 3GWZA 5J40A 2VQHA 3FXJA 5D6EA 5C4XJ 2W4SA 4RB0A 3VYTB 5CKTA 3KYLA 1YW7A 1MMGA 3Q9SA 3G71I 3CLQA 2Y30A 3G73A 2H27A 2EFOA 2RAEA 4OWRB 4EM2A 4II2A 4KYWA 1S8NA 3T8TA 4DNCA 2M87A 1XMAA 1FBQA 3HUGA 4R79A 3LL7A 1IXRC 3HC7A 2YVHA 3DCFA 4ZTJA 1MJBA 3P7NA 3S2WA 4E6KG 3JSPA 3Q5FA 2CUEA 3PIPF 1A31A 4B43A 1ENHA 2E19A 2JN6A 5E79C 2CFOA 2AHQA 1IV8A 3E1SA 3K0LA 4I01A 4L5JA 3K2ZA 5HAWA 3JW4A 2V9PA 2IS4A 3L00A 1YX5A 5L3FA 2R7ZJ 2CW8A 2GM4A 4RLQA 2A6TA 1E0EA 3JCUC 4I7HA 3KNWA 4ZDOA 3R61A 3PUBA 1R4NB 3C2GA 2VB6A 3GFIA 4E7JA 2ZMEA 3VUQA 2E71A 1GXQA 2DBBA 4ZZLA 1AU7A 1YIJI 4C9YA 4ESBA
chains in the Genus database with same CATH topology
1TWHJ 5M5YJ 1A6IA 1POGA 5GPCA 5J3LA 3WHCA 2X9DA 4M3BA 1ZGWA 2ZOZA 1T56A 2YUSA 2K9SA 3IUVA 2NVXJ 1P7JA 5K58A 2DMTA 4A3DJ 2CJJA 4XIDA 4XICA 3ANPA 3HM5A 3S1QJ 1Z77A 3VP5A 1SGMA 2XDNA 4B4CA 3GEUA 1TWGJ 2HQ5A 3G1OA 1RKWA 2M34A 3KZ9A 3TEDA 2CRGA 1LE8B 4QIWN 5H9TA 3CMYA 2HOAA 2UXHA 3DEWA 3ZQFA 1ETVA 1IG7A 5F0CA 3EUPA 3NXCA 1B72B 5F08A 1IDYA 5K7ZA 4JNNA 3Q0VA 4D5CA 3GTMJ 4IHXA 1JKOC 3RD3A 1ORKA 1RETA 1UG2A 2AO9A 3F0CA 2W53A 4W97A 4YZEA 2DG7A 5JLXA 1E3OC 2XPVA 5FHPA 3BR3A 2UXUA 2Y9YA 3JRCA 2QKOA 5J1RA 1VF9A 4JX6A 3A03A 2JA6J 2QCOA 2R0QC 4V2GA 3JRHA 3JRGA 5IOYA 5M3FJ 2IBDA 4MK6A 3W6VA 4L5EA 3OSFA 2K40A 2CUFA 4A3FJ 2DA3A 4DW6A 3MKLA 2YU9J 3HKZN 1AKHB 2JWTA 2FD5A 3FK7A 2JMWA 1MBEA 3LSPA 3NRGA 4BBRJ 4XRSG 5IOZA 1MNMC 2WAQN 4GCKA 3HB9A 5BNGA 2R5YA 4BY7J 3BR5A 3QPSA 1W0TA 5C4YA 3JREA 3BTIA 2IU5A 3CCYA 3S1NJ 3G1LA 3TP0A 2M0CA 2XGCA 5EFYA 4DYQA 1QRYA 3MVPA 2LR8A 2D6YA 1B72A 3PPBA 2H1KA 3ANGA 3LJLA 4B3AA 3S1RJ 4PXIA 3GTQJ 5FLMJ 3VVZA 5E3LA 3HIMA 1ZK8A 4MO7A 1JUSA 5CW8A 3BQZA 3KKDA 5EGOA 3PO3J 2M2EA 1U78A 3HOVJ 4FCYA 3H3VK 2MGQA 1RKTA 1MH4A 2OPTA 1RESA 2XRLA 2ECBA 4Y7NJ 4ACIA 2I10A 5K7FA 2ID3A 3BT9A 4MFEA 2DA4A 5C44J 1UI6A 2LFBA 3ZQLA 1JTYA 2UXOA 4NN1A 3S1MJ 1AKHA 1B8IB 2WGBA 1WPKA 1LFBA 1Y1VJ 1Y1WJ 2VPRA 4RBOA 1HOMA 4ABZA 3T6NA 5DTDA 3VW0A 4GFBA 2DA5A 2VI6A 2JK3A 2WB1N 2NS8A 1IGNA 3IH2A 3Q0UA 3BCGA 2YS9A 1JGGA 2JJ7A 2QF7A 4J19A 3G7RA 4XRMA 3MN2A 3HOZJ 1QVUA 4IEJA 4LOCA 1MSEC 2F07A 3SFIA 4W1UA 4A3JJ 2HKUA 4C3HJ 3RZOJ 2EZIA 3AQTA 1GT0C 3JSJA 5IP6A 3D1NI 1LFUP 1ZQ3P 1FIAA 5IYBJ 3RKQA 2PZ9A 4JX4A 4I6ZA 2NOGA 4AC0A 1FEXA 3FRQA 3JRBA 1TC3C 1ETOA 1IV6A 2L0KA 1ZTRA 1TWAJ 5EF6A 2DMQA 2KT0A 5F1JA 1BJZA 1U9OA 2XB5A 4A3IJ 2HOSA 1BA5A 4KWAA 4DYRA 3S15J 1EF4A 2QTQA 3CWRA 4A3LJ 1I3QJ 1X2MA 4A93J 2PMZN 3A01B 2FBQA 3BHQA 2M9HA 4JX5A 3O8GA 2E2IJ 1JKQC 2X48A 4DZJA 1GV2A 1MH3A 2H8RA 2L9RA 3BTJA 3GTGJ 4A3MJ 2G0EA 5FKNA 1X2NA 3E7LA 2R93J 3PO2J 2G7GA 3OSGA 2HXOA 5M5XJ 3IH3A 2G7SA 3HTAA 1W0UA 1IDZA 2E2HJ 1XC5A 3B6AA 2EBIA 3EGQA 1JT6A 5FLVA 3GTKJ 5AQCA 5E3OA 3VW2A 2E2JJ 2LLKA 2O9LA 4M3DA 4X6AJ 2JA7J 3QQAA 9ANTA 5JLWA 4A3GJ 2LVSA 1GUUA 3P9TA 2ZOYA 3S2DJ 2ME6A 2GBYA 3JRFA 1JJ8C 1YRNB 4XK4A 4V2FA 1Q1VA 1BW6A 1MBGA 2MSYA 4JP0A 2IAIA 5HSZA 3TP3A 2LP0A 2ZCNA 3HTJA 4C3IJ 4MXMA 2OI8A 3BG5A 4S0HB 2G3BA 2HXIA 4ICHA 3RQIA 2EZHA 2UXPA 3KKCA 1WI3A 4M3GA 5CXIA 3HOYJ 3JRAA 2GFNA 2RASA 3A01A 3S5RA 2FJ1A 3K7AJ 2COBA 1OCPA 3HTHA 3JR9A 1LE8A 1FIPA 1K83J 3BR6A 1Z0XA 2VUMJ 4AC6A 1WH5A 4FE7A 1MBKA 3CJDA 2DMNA 2XGEA 5J1UA 5DS9A 1IC8A 2OERA 3LHQA 1GV5A 2TCTA 5DAJA 4AF5A 2MW8A 1ITYA 2L7ZA 2KDZA 5D1RA 1G2HA 2DJNA 4GCTA 3JRDA 4IHVA 3SDGA 3ON2A 4MIMA 4IHWA 5FKKA 2DA7A 4Y52J 4AUXA 3BG3A 1MSFC 1NK3P 2NX4A 2FX0A 2HI3A 4FISA 3RH2A 4B1RA 4BKXA 2ZCXA 3HEFA 3RZDJ 4M6VA 3O60A 2NVYJ 3CQZJ 4AYBN 1DU6A 2GENA 2GLOA 2W48A 5FJ8J 2Y0SN 4UDSA 1JT0A 2R92J 2QWTA 4G12A 1JKPC 1YRNA 1OFCX 2HDDA 3JRIA 3V78A 3ZQCA 1JKRC 1ETYA 1HCRA 2ELKA 4A3CJ 5E3MA 2DA1A 4BXXJ 2ZCMA 4C2MJ 1ETWA 2DA6A 4QSHA 5EZGA 1JJ6C 1XG1A 1ZR2A 1AHDP 2M8GX 1ZR4A 2V57A 5J1YA 4A69C 1RPWA 2LD5A 1QPIA 3BNIA 2ZB9A 5M3MJ 2DTZA 4EEFG 1OCTC 1FTTA 1RR7A 3B81A 3QPLA 5IP7J 2DMUA 5F0HA 2LK2A 1JUMA 2ME0A 3QKXA 1HLVA 3TW7A 1IJWC 2XPWA 5FMPA 3ZQIA 1ETQA 4MFDA 4JL3A 1WCMJ 2NVTJ 5C4JJ 3LSRA 2LY9A 5EEAA 5IYDJ 1A5JA 1P7IA 3A02A 3FISA 5K7HA 1APLC 2JA5J 1UI5A 1PUFB 5HBUA 3OOUA 5EG0B 4FE4A 1SFOJ 1U8BA 3VW1A 1U9NA 3BRUA 5F0FA 1WGXA 3FK6A 1JTXA 2FQ4A 3BR1A 3S17J 4JYKA 2LTPA 1R9TJ 1D5YA 3FKIJ 1JUPA 2O7OA 5E3NA 1ETXA 1VI0A 2XPUA 3GTJJ 2EQRA 4A3BJ 3DPJA 2ID6A 2HOTA 4D7MA 2CU7A 3IH4A 3BR0A 3ZQGA 2QIBA 4ME9A 5CXGA 1GVDA 1NTCA 4GFKA 1S7EA 3HE0A 1MBHA 4HNVA 1VFCA 1H88C 1B8IA 2HYJA 4GCLA 1K61A 5F27A 3BG9A 5D19A 5EYRA 4MLOA 3IV5A 3GTPJ 3NI7A 3FIWA 2R5YB 2TRTA 2LKXA 3PM1A 3COLA 1UHSA 2NVQJ 4BBSJ 2RHAA 4RDUA 5GPAA 1HDDC 2P81A 2X6OA 1XS9A 3M4OJ 3Q3SA 2Q24A 3LSGA 4IHYA 2D5VA 3M3YJ 1F43A 4CYCB 2GUHA 3PASA 4JKZA 2DN0A 1IUFA 1T33A 3B6CA 4UUSB 1WH7A 2WV1A 5IP9J 3NAUA 2Y31A 5HODA 3GTLJ 1ETKA 3L1PA 3HOUJ 1ZKGA 4D5FA 2MG4A 3BR2A 3S2HJ 1PUFA 2IEKA 2NS7A 5EG0A 2ECCA 3AQSA 3NPIA 5FKMA 1I50J 4DYCA 5EGOB 1FJLA 1MBFA 3TW6A 2R5ZB 4NELA 2DA2A 1TWCJ 1BW5A 1UMQA 5FKOA 1HF0A 2XB0X 4M3EA 2NP5A 5D18A 2NP3A 3E7QA 3S14J 5IYCJ 1X58A 3GBGA 1OJLA 5FKLA 2JA8J 5F04A 3SJMA 2QOPA 3LWJA 1MBJA 1F36A 3HTIA 4C3JJ 3HOWJ 5FGLA 5EDNA 4A3EJ 2L7MP 2EH3A 5EZHA 2OF7A 2EZKA 2CQXA 3CDLA 3LOCA 4I76A 3GZIA 4HKUA 3ZOBA 4BY1J 2G7LA 3VPRA 2N8GA 3V6GA 1HDPA 3BJBA 1VNDA 3O8HA 1TWFJ 4QTRA 4UUTA 1NK2P 3ZQHA 2WUIA 1IRZA 1DU0A 2REKA 3G1MA 2O8KA 2DMPA 3BTCA 3Q0WA 3I4MJ 2PBXA 3VVYA 2Y9ZA 1SANA 4A3KJ 2K9NA 2XGDA 2VKVA 2VKEA 3CRJA 3WHBA 2L7FP 3BTLA 3VIBA 1BL0A 3VVXA 3HGGA 4CYCA 3HOXJ 4FTHA 3H0GJ 3VOXA 3I4NJ 4UUSA 2O7TA 3UKGA 2Y2ZA 3F1BA 3NARA 2E1OA 2CQQA 5IPAA 4NDLA 5C4XJ 1CQTA 3HDDA 1O4XA 3S16J 2HYTA 2Y30A 4M3FA 3G56A 3ON4A 2R5ZA 3C07A 2RAEA 3BQYA 2UXIA 2EZLA 3GTOJ 2YVEA 4CGRA 1QVTA 2XSDC 3HGYA 3LNQA 3OIOA 1FTZA 2YVHA 5C3EJ 3DCFA 4XRSA 5GP9A 4L62A 2DG8A 3C2BA 2CUEA 3QBMA 1GDTA 1ENHA 2E19A 2JN6A 4DZPA 1I6HJ 2AHQA 5HAWA 2K9QA 4GFLA 3MNLA 2R7ZJ 2GM4A 3KNWA 2B63J 3K2AA 3LSJA 3VUQA 1H89C 1AU7A 4D7NA 3VOKA 3HBLA 1H8AC 3NNRA 4X1EA 5M5WJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH J;  5M5Y J;  1A6I A;  1POG A;  5GPC A;  5J3L A;  3WHC A;  2X9D A;  4M3B A;  1ZGW A;  2ZOZ A;  1T56 A;  2YUS A;  2K9S A;  3IUV A;  2NVX J;  1P7J A;  5K58 A;  2DMT A;  4A3D J;  2CJJ A;  4XID A;  4XIC A;  3ANP A;  3HM5 A;  3S1Q J;  1Z77 A;  3VP5 A;  1SGM A;  2XDN A;  4B4C A;  3GEU A;  1TWG J;  2HQ5 A;  3G1O A;  1RKW A;  2M34 A;  3KZ9 A;  3TED A;  2CRG A;  1LE8 B;  4QIW N;  5H9T A;  3CMY A;  2HOA A;  2UXH A;  3DEW A;  3ZQF A;  1ETV A;  1IG7 A;  5F0C A;  3EUP A;  3NXC A;  1B72 B;  5F08 A;  1IDY A;  5K7Z A;  4JNN A;  3Q0V A;  4D5C A;  3GTM J;  4IHX A;  1JKO C;  3RD3 A;  1ORK A;  1RET A;  1UG2 A;  2AO9 A;  3F0C A;  2W53 A;  4W97 A;  4YZE A;  2DG7 A;  5JLX A;  1E3O C;  2XPV A;  5FHP A;  3BR3 A;  2UXU A;  2Y9Y A;  3JRC A;  2QKO A;  5J1R A;  1VF9 A;  4JX6 A;  3A03 A;  2JA6 J;  2QCO A;  2R0Q C;  4V2G A;  3JRH A;  3JRG A;  5IOY A;  5M3F J;  2IBD A;  4MK6 A;  3W6V A;  4L5E A;  3OSF A;  2K40 A;  2CUF A;  4A3F J;  2DA3 A;  4DW6 A;  3MKL A;  2YU9 J;  3HKZ N;  1AKH B;  2JWT A;  2FD5 A;  3FK7 A;  2JMW A;  1MBE A;  3LSP A;  3NRG A;  4BBR J;  4XRS G;  5IOZ A;  1MNM C;  2WAQ N;  4GCK A;  3HB9 A;  5BNG A;  2R5Y A;  4BY7 J;  3BR5 A;  3QPS A;  1W0T A;  5C4Y A;  3JRE A;  3BTI A;  2IU5 A;  3CCY A;  3S1N J;  3G1L A;  3TP0 A;  2M0C A;  2XGC A;  5EFY A;  4DYQ A;  1QRY A;  3MVP A;  2LR8 A;  2D6Y A;  1B72 A;  3PPB A;  2H1K A;  3ANG A;  3LJL A;  4B3A A;  3S1R J;  4PXI A;  3GTQ J;  5FLM J;  3VVZ A;  5E3L A;  3HIM A;  1ZK8 A;  4MO7 A;  1JUS A;  5CW8 A;  3BQZ A;  3KKD A;  5EGO A;  3PO3 J;  2M2E A;  1U78 A;  3HOV J;  4FCY A;  3H3V K;  2MGQ A;  1RKT A;  1MH4 A;  2OPT A;  1RES A;  2XRL A;  2ECB A;  4Y7N J;  4ACI A;  2I10 A;  5K7F A;  2ID3 A;  3BT9 A;  4MFE A;  2DA4 A;  5C44 J;  1UI6 A;  2LFB A;  3ZQL A;  1JTY A;  2UXO A;  4NN1 A;  3S1M J;  1AKH A;  1B8I B;  2WGB A;  1WPK A;  1LFB A;  1Y1V J;  1Y1W J;  2VPR A;  4RBO A;  1HOM A;  4ABZ A;  3T6N A;  5DTD A;  3VW0 A;  4GFB A;  2DA5 A;  2VI6 A;  2JK3 A;  2WB1 N;  2NS8 A;  1IGN A;  3IH2 A;  3Q0U A;  3BCG A;  2YS9 A;  1JGG A;  2JJ7 A;  2QF7 A;  4J19 A;  3G7R A;  4XRM A;  3MN2 A;  3HOZ J;  1QVU A;  4IEJ A;  4LOC A;  1MSE C;  2F07 A;  3SFI A;  4W1U A;  4A3J J;  2HKU A;  4C3H J;  3RZO J;  2EZI A;  3AQT A;  1GT0 C;  3JSJ A;  5IP6 A;  3D1N I;  1LFU P;  1ZQ3 P;  1FIA A;  5IYB J;  3RKQ A;  2PZ9 A;  4JX4 A;  4I6Z A;  2NOG A;  4AC0 A;  1FEX A;  3FRQ A;  3JRB A;  1TC3 C;  1ETO A;  1IV6 A;  2L0K A;  1ZTR A;  1TWA J;  5EF6 A;  2DMQ A;  2KT0 A;  5F1J A;  1BJZ A;  1U9O A;  2XB5 A;  4A3I J;  2HOS A;  1BA5 A;  4KWA A;  4DYR A;  3S15 J;  1EF4 A;  2QTQ A;  3CWR A;  4A3L J;  1I3Q J;  1X2M A;  4A93 J;  2PMZ N;  3A01 B;  2FBQ A;  3BHQ A;  2M9H A;  4JX5 A;  3O8G A;  2E2I J;  1JKQ C;  2X48 A;  4DZJ A;  1GV2 A;  1MH3 A;  2H8R A;  2L9R A;  3BTJ A;  3GTG J;  4A3M J;  2G0E A;  5FKN A;  1X2N A;  3E7L A;  2R93 J;  3PO2 J;  2G7G A;  3OSG A;  2HXO A;  5M5X J;  3IH3 A;  2G7S A;  3HTA A;  1W0U A;  1IDZ A;  2E2H J;  1XC5 A;  3B6A A;  2EBI A;  3EGQ A;  1JT6 A;  5FLV A;  3GTK J;  5AQC A;  5E3O A;  3VW2 A;  2E2J J;  2LLK A;  2O9L A;  4M3D A;  4X6A J;  2JA7 J;  3QQA A;  9ANT A;  5JLW A;  4A3G J;  2LVS A;  1GUU A;  3P9T A;  2ZOY A;  3S2D J;  2ME6 A;  2GBY A;  3JRF A;  1JJ8 C;  1YRN B;  4XK4 A;  4V2F A;  1Q1V A;  1BW6 A;  1MBG A;  2MSY A;  4JP0 A;  2IAI A;  5HSZ A;  3TP3 A;  2LP0 A;  2ZCN A;  3HTJ A;  4C3I J;  4MXM A;  2OI8 A;  3BG5 A;  4S0H B;  2G3B A;  2HXI A;  4ICH A;  3RQI A;  2EZH A;  2UXP A;  3KKC A;  1WI3 A;  4M3G A;  5CXI A;  3HOY J;  3JRA A;  2GFN A;  2RAS A;  3A01 A;  3S5R A;  2FJ1 A;  3K7A J;  2COB A;  1OCP A;  3HTH A;  3JR9 A;  1LE8 A;  1FIP A;  1K83 J;  3BR6 A;  1Z0X A;  2VUM J;  4AC6 A;  1WH5 A;  4FE7 A;  1MBK A;  3CJD A;  2DMN A;  2XGE A;  5J1U A;  5DS9 A;  1IC8 A;  2OER A;  3LHQ A;  1GV5 A;  2TCT A;  5DAJ A;  4AF5 A;  2MW8 A;  1ITY A;  2L7Z A;  2KDZ A;  5D1R A;  1G2H A;  2DJN A;  4GCT A;  3JRD A;  4IHV A;  3SDG A;  3ON2 A;  4MIM A;  4IHW A;  5FKK A;  2DA7 A;  4Y52 J;  4AUX A;  3BG3 A;  1MSF C;  1NK3 P;  2NX4 A;  2FX0 A;  2HI3 A;  4FIS A;  3RH2 A;  4B1R A;  4BKX A;  2ZCX A;  3HEF A;  3RZD J;  4M6V A;  3O60 A;  2NVY J;  3CQZ J;  4AYB N;  1DU6 A;  2GEN A;  2GLO A;  2W48 A;  5FJ8 J;  2Y0S N;  4UDS A;  1JT0 A;  2R92 J;  2QWT A;  4G12 A;  1JKP C;  1YRN A;  1OFC X;  2HDD A;  3JRI A;  3V78 A;  3ZQC A;  1JKR C;  1ETY A;  1HCR A;  2ELK A;  4A3C J;  5E3M A;  2DA1 A;  4BXX J;  2ZCM A;  4C2M J;  1ETW A;  2DA6 A;  4QSH A;  5EZG A;  1JJ6 C;  1XG1 A;  1ZR2 A;  1AHD P;  2M8G X;  1ZR4 A;  2V57 A;  5J1Y A;  4A69 C;  1RPW A;  2LD5 A;  1QPI A;  3BNI A;  2ZB9 A;  5M3M J;  2DTZ A;  4EEF G;  1OCT C;  1FTT A;  1RR7 A;  3B81 A;  3QPL A;  5IP7 J;  2DMU A;  5F0H A;  2LK2 A;  1JUM A;  2ME0 A;  3QKX A;  1HLV A;  3TW7 A;  1IJW C;  2XPW A;  5FMP A;  3ZQI A;  1ETQ A;  4MFD A;  4JL3 A;  1WCM J;  2NVT J;  5C4J J;  3LSR A;  2LY9 A;  5EEA A;  5IYD J;  1A5J A;  1P7I A;  3A02 A;  3FIS A;  5K7H A;  1APL C;  2JA5 J;  1UI5 A;  1PUF B;  5HBU A;  3OOU A;  5EG0 B;  4FE4 A;  1SFO J;  1U8B A;  3VW1 A;  1U9N A;  3BRU A;  5F0F A;  1WGX A;  3FK6 A;  1JTX A;  2FQ4 A;  3BR1 A;  3S17 J;  4JYK A;  2LTP A;  1R9T J;  1D5Y A;  3FKI J;  1JUP A;  2O7O A;  5E3N A;  1ETX A;  1VI0 A;  2XPU A;  3GTJ J;  2EQR A;  4A3B J;  3DPJ A;  2ID6 A;  2HOT A;  4D7M A;  2CU7 A;  3IH4 A;  3BR0 A;  3ZQG A;  2QIB A;  4ME9 A;  5CXG A;  1GVD A;  1NTC A;  4GFK A;  1S7E A;  3HE0 A;  1MBH A;  4HNV A;  1VFC A;  1H88 C;  1B8I A;  2HYJ A;  4GCL A;  1K61 A;  5F27 A;  3BG9 A;  5D19 A;  5EYR A;  4MLO A;  3IV5 A;  3GTP J;  3NI7 A;  3FIW A;  2R5Y B;  2TRT A;  2LKX A;  3PM1 A;  3COL A;  1UHS A;  2NVQ J;  4BBS J;  2RHA A;  4RDU A;  5GPA A;  1HDD C;  2P81 A;  2X6O A;  1XS9 A;  3M4O J;  3Q3S A;  2Q24 A;  3LSG A;  4IHY A;  2D5V A;  3M3Y J;  1F43 A;  4CYC B;  2GUH A;  3PAS A;  4JKZ A;  2DN0 A;  1IUF A;  1T33 A;  3B6C A;  4UUS B;  1WH7 A;  2WV1 A;  5IP9 J;  3NAU A;  2Y31 A;  5HOD A;  3GTL J;  1ETK A;  3L1P A;  3HOU J;  1ZKG A;  4D5F A;  2MG4 A;  3BR2 A;  3S2H J;  1PUF A;  2IEK A;  2NS7 A;  5EG0 A;  2ECC A;  3AQS A;  3NPI A;  5FKM A;  1I50 J;  4DYC A;  5EGO B;  1FJL A;  1MBF A;  3TW6 A;  2R5Z B;  4NEL A;  2DA2 A;  1TWC J;  1BW5 A;  1UMQ A;  5FKO A;  1HF0 A;  2XB0 X;  4M3E A;  2NP5 A;  5D18 A;  2NP3 A;  3E7Q A;  3S14 J;  5IYC J;  1X58 A;  3GBG A;  1OJL A;  5FKL A;  2JA8 J;  5F04 A;  3SJM A;  2QOP A;  3LWJ A;  1MBJ A;  1F36 A;  3HTI A;  4C3J J;  3HOW J;  5FGL A;  5EDN A;  4A3E J;  2L7M P;  2EH3 A;  5EZH A;  2OF7 A;  2EZK A;  2CQX A;  3CDL A;  3LOC A;  4I76 A;  3GZI A;  4HKU A;  3ZOB A;  4BY1 J;  2G7L A;  3VPR A;  2N8G A;  3V6G A;  1HDP A;  3BJB A;  1VND A;  3O8H A;  1TWF J;  4QTR A;  4UUT A;  1NK2 P;  3ZQH A;  2WUI A;  1IRZ A;  1DU0 A;  2REK A;  3G1M A;  2O8K A;  2DMP A;  3BTC A;  3Q0W A;  3I4M J;  2PBX A;  3VVY A;  2Y9Z A;  1SAN A;  4A3K J;  2K9N A;  2XGD A;  2VKV A;  2VKE A;  3CRJ A;  3WHB A;  2L7F P;  3BTL A;  3VIB A;  1BL0 A;  3VVX A;  3HGG A;  4CYC A;  3HOX J;  4FTH A;  3H0G J;  3VOX A;  3I4N J;  4UUS A;  2O7T A;  3UKG A;  2Y2Z A;  3F1B A;  3NAR A;  2E1O A;  2CQQ A;  5IPA A;  4NDL A;  5C4X J;  1CQT A;  3HDD A;  1O4X A;  3S16 J;  2HYT A;  2Y30 A;  4M3F A;  3G56 A;  3ON4 A;  2R5Z A;  3C07 A;  2RAE A;  3BQY A;  2UXI A;  2EZL A;  3GTO J;  2YVE A;  4CGR A;  1QVT A;  2XSD C;  3HGY A;  3LNQ A;  3OIO A;  1FTZ A;  2YVH A;  5C3E J;  3DCF A;  4XRS A;  5GP9 A;  4L62 A;  2DG8 A;  3C2B A;  2CUE A;  3QBM A;  1GDT A;  1ENH A;  2E19 A;  2JN6 A;  4DZP A;  1I6H J;  2AHQ A;  5HAW A;  2K9Q A;  4GFL A;  3MNL A;  2R7Z J;  2GM4 A;  3KNW A;  2B63 J;  3K2A A;  3LSJ A;  3VUQ A;  1H89 C;  1AU7 A;  4D7N A;  3VOK A;  3HBL A;  1H8A C;  3NNR A;  4X1E A;  5M5W J; 
#chains in the Genus database with same CATH topology
 5M5Y J;  5L3G A;  1A6I A;  4LLL A;  2HR3 A;  3F9K A;  2GXG A;  2L7K A;  3PNV A;  4BEH B;  4CCM A;  4LFU A;  1WWX A;  1T56 A;  4CCN A;  5D4S A;  1S6L A;  2K9S A;  2XVC A;  3E97 A;  2NVX J;  1P7J A;  3IKV A;  5K58 A;  3LST A;  2JSC A;  2DMT A;  4LG0 B;  1XCV A;  3CCU I;  3F6O A;  3L2C A;  2EB7 A;  3WTX C;  1B9M A;  1IRG A;  3S1Q J;  1KQ9 A;  2LKS A;  2ZC2 A;  4IF4 A;  4BQN A;  4BNC A;  2RDP A;  4AYB A;  1TWG J;  3G1O A;  4UVB A;  4FX4 A;  4C2M A;  2G7U A;  3DF8 A;  2KDO A;  3TED A;  2M0M A;  4HV5 A;  3WTY C;  2BY0 A;  3DEW A;  5HS7 A;  4H0E A;  5F0C A;  2LDU A;  3DPL C;  2RNJ A;  1B72 B;  4Q47 A;  4F7Z A;  2YX4 A;  2MA3 A;  3H9Q A;  2GOM A;  4D5C A;  1QA6 A;  2IGN A;  1RET A;  2AO9 A;  4Z6Y A;  3F0C A;  2H6B A;  4XRF A;  3R60 A;  1SC7 A;  3G3Z A;  5HDG A;  1FBS A;  2HPM A;  1E3O C;  1EH7 A;  1OYW A;  2UXU A;  2Y9Y A;  1GXP A;  2LY1 A;  4A2U A;  4HDU A;  2GXA A;  3ZQQ A;  1PYV A;  5J1R A;  2EV0 A;  2MC4 A;  2BW3 A;  3JRH A;  3L2U A;  2HKX A;  3JRG A;  2CW0 F;  1LEA A;  3HSF A;  1IN6 A;  1LNW A;  3GCM A;  3KFW X;  4CCJ A;  2IRF G;  2P5V A;  5FRM A;  4L5E A;  3OSF A;  3LSM A;  1BI2 A;  4RGU A;  1UFM A;  1Z6T A;  3K4J A;  4F93 B;  3MKL A;  1HSJ A;  1AKH B;  2PBI A;  1VQO I;  4A12 A;  4IQJ A;  3LSP A;  3NRG A;  2JRM A;  1O3Q A;  3DKW A;  2P6T A;  2GA2 A;  3HB9 A;  2HQR A;  4LB6 B;  4BY7 J;  4OIP F;  1W5T A;  3BTI A;  2M5W A;  5FO5 A;  4P5O A;  1EJ9 A;  2HVS A;  2XGC A;  1MZB A;  1TT5 B;  3MVP A;  3QOD A;  4JK1 X;  2D6Y A;  4ZZD A;  3ASN H;  2FA5 A;  3RKW A;  4B3A A;  3GTQ J;  4XLA A;  2FEZ A;  4KMU X;  3HIM A;  4MO7 A;  1JUS A;  2Q8K A;  2M7B A;  3CUQ A;  2CUJ A;  1HQC A;  3V7R A;  1SAX A;  3KKD A;  2EK5 A;  5EGO A;  1MW7 A;  5BPD A;  2MGQ A;  2DFI A;  3F8B A;  3L2Q A;  1MH4 A;  4YEL A;  3CCL I;  3VTI A;  4UV9 A;  2HDW A;  2OCC H;  1IN4 A;  4EJU A;  4E7L A;  3BT9 A;  4G6Q A;  4BS9 A;  2JRT A;  4AM3 A;  2KRF A;  3WTZ A;  2FQ3 A;  1U8R A;  4PJL A;  2EIJ H;  2STW A;  3LA7 A;  2F48 A;  2DW4 A;  3K6G A;  2B3W A;  4P9U A;  4Y33 A;  3TDZ C;  1Y1V J;  3OR2 C;  1HOM A;  3EET A;  1A36 A;  2RV8 A;  4WF2 A;  3T6N A;  2OD5 A;  5DTD A;  1ZRF A;  3VFZ A;  3CMA I;  3VW0 A;  4A0Y A;  1G3W A;  1O3S A;  2MBF A;  3IH2 A;  4OMZ A;  3GW2 A;  5E18 F;  3BCG A;  2XV4 S;  4KNY A;  2QF7 A;  5CVV A;  4CZZ A;  4XKW A;  2GWR A;  1VQ8 I;  3ZRG A;  4F91 B;  2XRO A;  1QVU A;  4CO8 A;  1H0M A;  2FRH A;  4F52 A;  4IEJ A;  1YW9 A;  5L3E A;  2HKU A;  3I4P A;  2DOE A;  1VQ4 I;  2RQQ A;  3OYD A;  2XF7 A;  4WCG A;  2ZNY A;  2F4I A;  4BHB A;  3RKQ A;  4IRI A;  3OMY A;  4UV8 A;  5HS9 A;  3HOS A;  3CCS I;  4I6Z A;  2E1N A;  2NOG A;  1FEX A;  5FFX A;  4UB6 C;  4G7Z F;  3BCB A;  4MGR A;  2XAG A;  5EF6 A;  3D5S C;  1BA5 A;  1U9O A;  2DFH A;  3DXJ F;  5E8G A;  3CWR A;  1EF4 A;  1SD7 A;  1EA3 A;  1VQM I;  3ABM H;  1JI8 A;  1J0R A;  2L4A A;  1X2M A;  3DFG A;  3I9V 2;  3A01 B;  1I6X A;  4A93 J;  2M9H A;  3FXM A;  5CVU A;  1LPQ A;  2DTR A;  1OCC H;  2QKL B;  4JX5 A;  4DZJ A;  2EV5 A;  4E70 A;  2KHM A;  1MH3 A;  5JHF A;  4LG3 A;  3KP5 A;  4A3M J;  4P1W A;  3BG6 A;  4B48 A;  1ULY A;  1V3F A;  3QP5 A;  2HZD A;  2R7D A;  2G7G A;  1B9N A;  2OJE D;  2HXO A;  2VE9 A;  5M5X J;  4J01 A;  2HQA A;  3SZG A;  3K8P C;  3GLX A;  3WGG A;  2MYS A;  5HLH A;  2X1C A;  3B6A A;  1SD4 A;  4NQW A;  1MMS A;  3CJT B;  3EGQ A;  3U9G A;  3DLL F;  5FLV A;  3GFM A;  4ZJZ A;  1R5G A;  1Z9C A;  1MDM B;  3K4N A;  4HX4 A;  3LWF A;  1OCZ H;  2F4M B;  5LEK A;  1Y8R B;  2NXN B;  2ZO4 A;  3L9F A;  1WJF A;  3V4G A;  3PUF A;  4XSX F;  4L9N A;  4XK4 A;  2CG4 A;  1BW6 A;  1MBG A;  2IAI A;  1MND A;  2CV0 A;  2WBM A;  3GFL A;  1BOA A;  4GGG A;  4LG0 A;  3U1K A;  4C3I J;  1HXD A;  1ZG5 A;  4XLN F;  3HTJ A;  5BPI A;  2DXI A;  2DK8 A;  3CCE I;  3RKX A;  1RC9 A;  2UXP A;  4M3G A;  3HOY J;  3JRA A;  2KIM A;  1Y0N A;  1ZRD A;  1OCP A;  3HTS B;  3JR9 A;  2F5F A;  1QBJ A;  1K83 J;  1FIP A;  3HTH A;  1OLT A;  2UZK A;  1MBK A;  5D4R A;  4KMF A;  2XGE A;  5L3D A;  2CMP A;  3BG7 A;  1MMD A;  1IC8 A;  4MQ9 F;  2OER A;  1YIO A;  5DAJ A;  2ICW G;  4AF5 A;  1B59 A;  2BY1 A;  5D6F A;  1U5T C;  4CZC A;  2KDZ A;  1G2H A;  5D1R A;  2X6W A;  4CYD A;  2BBY A;  3JRD A;  4KJZ A;  3SDG A;  4MIM A;  4MTE A;  1H9T A;  3ECH A;  2E60 A;  3K4L A;  2WAF A;  2IS6 A;  5H6Q A;  3SWH A;  1R23 A;  2NX4 A;  2FX0 A;  1V4R A;  5E1W A;  2BE5 F;  3VYU B;  4B1R A;  2IGM A;  3O3K A;  2A3S A;  3P9K A;  4XL9 A;  3RPU D;  2ACJ A;  3LSI A;  4S04 A;  2GLO A;  5LD2 C;  4UDS A;  1JT0 A;  2QWT A;  1FYM A;  4GO1 A;  1OFC X;  1K4T A;  1ON1 A;  1ZYR F;  2BY3 A;  3C1D A;  5JR3 A;  3V78 A;  1JKR C;  1ETY A;  5E3M A;  2DA1 A;  1J75 A;  2W7N A;  4BQA A;  3IWF A;  1XCB A;  1ETW A;  2DA6 A;  3NEU A;  2QSH X;  1G3T A;  2VOO A;  4M9S A;  1R4M B;  3J7Z I;  1AHD P;  1SVM A;  3FHN A;  5HDN A;  5DCM B;  2LD5 A;  1QPI A;  3BNI A;  2B7E A;  1MNE A;  2ZB9 A;  5M3M J;  1YS7 A;  3N05 A;  2IS2 A;  2KIS A;  4LK0 F;  4EVI A;  5IP7 J;  2K9L A;  2PX9 A;  3A4C A;  3C3W A;  2BVL A;  2ME0 A;  2MD5 A;  2WY8 Q;  3KZY A;  2XPW A;  2V7F A;  1J7K A;  3ZQI A;  4MFD A;  2GQQ A;  3MZ8 A;  1W4M A;  2VBZ A;  4MHG A;  4FET A;  2NVT J;  3LSR A;  3GVA A;  3CTA A;  2O61 A;  5EEA A;  5IYD J;  1PVE A;  4HYE A;  5K7H A;  3CCV I;  2LOO A;  1UI5 A;  1PUF B;  1U8B A;  3BRU A;  3E5Q A;  1R36 A;  4BAC A;  4CGZ A;  1JTX A;  3WTT C;  2L9V A;  2E35 A;  3F72 A;  1Z7U A;  3F8N A;  3HSE A;  3UNG C;  4G6T B;  2A69 F;  4D9J A;  2OZU A;  2O7O A;  3KEQ A;  4GYG A;  5E3N A;  5FB2 A;  3IRQ A;  1VI0 A;  2H6C A;  4A0X A;  2EQR A;  4A3B J;  2WV0 A;  3DPJ A;  3IH4 A;  2QIB A;  3BR0 A;  1PDN C;  1VQK I;  5CXG A;  2CFX A;  3H36 A;  5EEH A;  1SFE A;  1S7E A;  1QU3 A;  1BOB A;  1YG2 A;  5KCM A;  1X19 A;  3G6E I;  2CO5 A;  2FUG 2;  1NG6 A;  2ZJR F;  2LKX A;  2PJP A;  1FP1 D;  3COL A;  1SEU A;  3F21 A;  1R58 A;  2NVQ J;  4N4O B;  1FYL A;  1T98 A;  4LIU A;  2JUG A;  2D1V A;  2HTJ A;  4KA4 A;  3Q3S A;  2Q24 A;  2VT3 A;  1RUN A;  1UST A;  2Z99 A;  2TDX A;  4U9L A;  3ZMZ A;  1LDJ A;  4HRI A;  2DQL A;  3RPQ A;  1ETK A;  1SFK A;  2E1C A;  2HFH A;  2X6Y A;  1I50 J;  2CUZ A;  5FKM A;  2ZJP F;  1FJL A;  1U2W A;  3RIR A;  2VKH A;  3BJ6 A;  1ACI A;  3OS2 A;  2HS5 A;  3OIQ A;  2XB0 X;  4LIV A;  2NP5 A;  5IT9 K;  3HUG B;  4UUV A;  5FKL A;  1L0O C;  3NQO A;  3SJM A;  2QOP A;  3HTI A;  4A3E J;  2V79 A;  3EUA A;  5EZH A;  3CME I;  5J4Y A;  4BQO A;  3CDL A;  1V5F A;  2IW5 A;  3LOC A;  4I76 A;  1USS A;  2W82 A;  2HKO A;  4RB2 C;  2MFZ A;  4HKU A;  2P6S A;  4XNF A;  3L2R A;  2IA0 A;  3RPU A;  1Z3Y A;  5HDK A;  3O6B B;  2ZME B;  2WUI A;  3TOA A;  1MDM A;  1TZL A;  3ML6 A;  3DKY A;  2O8K A;  3ZGK A;  4KDP A;  4WXD A;  1D1C A;  2Y9Z A;  3M7G A;  2VJI A;  2VKV A;  2EFQ A;  3VVX A;  1BL0 A;  3HGG A;  1RZ4 A;  2EA2 A;  4FTH A;  4XLH A;  3N4M A;  4UUS A;  2ZXJ A;  3M1C A;  3VOE A;  4U0V A;  3Q9V A;  3F1B A;  4E7I A;  2E1O A;  3HZJ A;  2CQQ A;  5IPA A;  2NRA C;  2UXX A;  1CQT A;  3HDD A;  2GA1 A;  1D1B A;  3S16 J;  2HYT A;  4E7Z A;  3I59 B;  2DI3 A;  2XSJ C;  2MC3 A;  3G56 A;  1I1G A;  5FRO A;  2X6X A;  3BQY A;  2EZL A;  1XGS A;  4UVA A;  4F55 A;  2EV6 A;  4WWC A;  3GTO J;  1Y39 A;  1QVT A;  2XSD C;  1QHH D;  2KMU A;  3HGY A;  4RAG A;  5H20 A;  3OYB A;  2UUZ A;  4M9Z A;  4YRV A;  1S3J A;  2OC6 A;  1FTZ A;  1EH6 A;  5C3E J;  4C30 A;  2K85 A;  4L62 A;  5GTI C;  3SFZ A;  3FKJ A;  2CSO A;  1GDT A;  3FMQ A;  4RGR A;  1I6H J;  5ICC A;  3VSL A;  2W1O A;  4PSW A;  2K9Q A;  4GFL A;  4CA0 A;  4YG2 F;  1STZ A;  2B63 J;  1BR2 A;  3IL2 A;  4IVN A;  2NNN A;  2I8D A;  3CP8 A;  3FHZ A;  1G8X A;  2RNG A;  3I56 I;  3VOK A;  3OYI A;  4O5V A;  3NNR A;  2H94 A;  4NC8 A;  2KIQ A;  2ETH A;  4ZH4 F;  1KU2 A;  1KU7 A;  2JSP A;  1T39 A;  3KX2 A;  3V8K A;  2HYG D;  3ABL H;  4L9V A;  3WHC A;  2X9D A;  3AG1 H;  3QYF A;  2KJB A;  3OV8 A;  3ERE D;  2X85 A;  1ZG3 A;  4OAY A;  3IUV A;  3AL0 B;  5ED4 A;  3CF2 A;  1U0J A;  4UB8 C;  4A3D J;  3H9J A;  4MEX F;  1D3Y A;  2IA1 A;  2QQ9 A;  4RGS A;  4IHT A;  5AIP A;  5E1Z B;  1XPX A;  1FZP B;  3GEU A;  2HQ5 A;  4RB3 C;  2R7Q A;  3KZI C;  2MAB A;  2Y0S A;  5ICE A;  4B8X A;  3KZ9 A;  4YII A;  2CRG A;  1LE8 B;  4QIW N;  3GUD A;  2HOA A;  1WI9 A;  3BZ6 A;  3S3N A;  2D45 A;  2W57 A;  3EUP A;  1MD0 A;  2FML A;  3OWT A;  1YFH A;  1VQ5 I;  2EIM H;  4L5I A;  3O2P E;  4KIF A;  4GYI A;  5K7Z A;  4JNN A;  4EM1 A;  3BWG A;  3RD3 A;  1JKO C;  3CUQ B;  4M6Y A;  5HLG A;  2DG7 A;  2M30 A;  4U87 A;  1P9Q C;  2MH9 A;  2VQC A;  2XPV A;  2R7W A;  2A07 F;  3JRC A;  2DOD A;  2UWM A;  1VF9 A;  4JX6 A;  3K4B A;  3DLA A;  4FQG A;  2JA6 J;  2HZT A;  4V2G A;  3JTH A;  1V55 H;  5DD4 A;  4QLC U;  3K9T A;  3IAM 2;  2M4G A;  5H2F C;  2DT6 A;  2QWW A;  1VQ9 I;  4KUM A;  4MK6 A;  2XGX A;  3E3V A;  3SYT A;  4A3F J;  2DA3 A;  4DW6 A;  1YW8 A;  5DUI A;  1FT9 A;  1LKX A;  4HV6 A;  2HNH A;  3HKZ N;  3BPV A;  3NWT A;  3WGI A;  1KU9 A;  2E5N A;  2Z3Y A;  2DT7 B;  1MNM C;  5IT9 Z;  3MZY A;  2WAQ N;  4GCK A;  5BNG A;  4G7H F;  1T0F C;  3BR5 A;  3E6C C;  4BXU A;  2QKM B;  1W0T A;  5C4Y A;  3R4K A;  1O3R A;  2W25 A;  1Z21 A;  4FHT A;  3W2W A;  5BS6 A;  2IU5 A;  1YHQ I;  4JBA A;  3ZMV A;  4Q48 A;  2M0C A;  1SMT A;  1QRY A;  1XD7 A;  2LR8 A;  4OIQ F;  4I02 A;  3PPB A;  1ZGA A;  2H1K A;  3C2H A;  1QGP A;  5FLM J;  2O8X A;  4M71 A;  2L3D A;  3AG4 H;  3CO7 C;  5CW8 A;  3BQZ A;  3QU3 A;  3PO3 J;  3GFJ A;  2F4O B;  3H3V K;  2XF6 A;  4RMN A;  1RES A;  1VQN I;  2QEX I;  4U7D A;  1KGS A;  2XRL A;  4OD5 A;  1K79 A;  2XAF A;  4ACI A;  1U6G A;  1S72 I;  3SEQ A;  2DA4 A;  3TO7 A;  2HGC A;  5CVJ A;  1F4K A;  3OY9 A;  4OIR F;  3FXO A;  3FM3 A;  5JFR A;  4HST A;  1XGN A;  2BVM A;  4IOA F;  1B8I B;  2KIF A;  1WPK A;  1OYI A;  1TW3 A;  4RBO A;  2M45 A;  5LHG A;  3AAF A;  3OL3 A;  1JGS A;  2ADU A;  4XOR A;  2BY2 A;  2XAH A;  4BDY A;  4NQW B;  4RM3 A;  2NS8 A;  4I0A A;  1JHH A;  3Q0U A;  4BUP A;  1FMV A;  2P4W A;  5CLS A;  4XRM A;  4M9X A;  3MN2 A;  1P2F A;  2AXL A;  1FPQ A;  2AQF A;  2BEO A;  3BLY A;  4LOC A;  1MSE C;  3EUK L;  3RCO A;  3SFI A;  4A3J J;  4C3H J;  3AQT A;  4RS8 A;  3FXU A;  5IP6 A;  2YVX A;  1YOV B;  2D1H A;  3D1N I;  1FIA A;  5LRR A;  1ONV A;  2GXB A;  4U7B A;  4JX4 A;  3VSK A;  5KNL A;  2PLY A;  1IUY A;  2M7A A;  1ZTR A;  2W84 A;  1TWA J;  3I59 A;  1RUO A;  3LA2 A;  4G9Y A;  1BJZ A;  4A3I J;  4YIR X;  4KWA A;  4DYR A;  2VXZ A;  2QTQ A;  2NNY A;  2Z33 A;  2FBQ A;  1LDK B;  1R71 A;  4KT6 A;  2E2I J;  2J5P A;  2H8R A;  2BXZ A;  3DV8 A;  2L9R A;  2A6H F;  4U0W A;  1F1Z A;  2IPQ X;  3L2W A;  1X2N A;  4PDK A;  3ERM A;  2LG4 A;  3WTU C;  1HA8 A;  2K86 A;  3IH3 A;  4IRG A;  2BOL A;  3RTR A;  3LSH A;  2PFV A;  3MWM A;  3GTK J;  1ZAO A;  1OR7 C;  3F8C A;  5E3O A;  5AQC A;  2FF4 A;  3BJA A;  2QM3 A;  1FNN A;  1DUX C;  1UJ8 A;  4P96 A;  2PFB A;  4ASN A;  1A35 A;  4PK4 A;  5JLW A;  4A3G J;  1GUU A;  2OTJ I;  3H35 A;  2EFP A;  1BN5 A;  3QYE A;  2GBY A;  2K3F A;  4E7S A;  3PIO F;  1JJ8 C;  2CQN A;  1SVL A;  3PSF A;  3K70 C;  4A0Z A;  2O03 A;  2MSY A;  4JP0 A;  2LSO A;  4HG2 A;  2LP0 A;  2IA2 A;  4IHS A;  2V26 A;  2ZSI B;  1WJE A;  4S0H B;  2G3B A;  3ZN0 A;  1VQ7 I;  3RQI A;  5F1R A;  2I5U A;  1WI3 A;  3AKZ A;  5CXI A;  3S3O A;  1SFU A;  4OD4 A;  2VQL A;  2A6E F;  1X3Z B;  1LE8 A;  5L3B A;  3CES A;  2VUM J;  4HF1 A;  4ANJ A;  4PJ0 C;  4PUS A;  2F6C A;  2MLK A;  2PG4 A;  4Y17 A;  4BGD A;  3WTW C;  3KP4 A;  1GV5 A;  3DKX A;  1JHF A;  4LK1 F;  2MW8 A;  3V8L A;  2QGU A;  2CQ7 A;  1ZLJ A;  2P5L C;  2L7Z A;  1ITY A;  1Y0U A;  1BR1 A;  3WE3 A;  3IWZ A;  5LRS A;  4IRH A;  4M6X A;  5FFZ A;  5B1B H;  3MEX A;  1IXS B;  3KZZ A;  2NOJ B;  4QPO A;  3ON2 A;  3ECO A;  4A6E A;  2ZJQ F;  4IKF A;  5IY5 H;  4RAF A;  5FKK A;  1J2X A;  2DA7 A;  2YX7 A;  2O3F A;  3FMS A;  1FWZ A;  1I5Z A;  2XKO A;  1NK3 P;  3JAM Z;  2HI3 A;  3FBI B;  2DK5 A;  2XAQ A;  1IO2 A;  4KIB A;  3HEF A;  3RZD J;  4M6V A;  3O60 A;  1DU6 A;  4AYB N;  5J6X A;  2EPF A;  1KYW A;  3IRR A;  2R92 J;  1JKP C;  2OUM A;  3U2R A;  3JTG A;  1XN7 A;  5DD8 A;  3TO9 A;  3JRI A;  3GZ6 A;  4A3C J;  1O57 A;  1HCR A;  5JI6 A;  2ZCM A;  4KIT B;  3MKW B;  2OQG A;  4QSH A;  5L3C A;  1P92 A;  5EZG A;  3H1C A;  1JJ6 C;  1BIB A;  1XG1 A;  2L9S A;  3DPT A;  2ZSH B;  1V54 H;  1T8I A;  5DV5 A;  1LFP A;  1RPW A;  4PZJ A;  2WC2 A;  3ZR8 X;  1D0X A;  1LJ9 A;  2DTZ A;  5LGN A;  2Y69 H;  2LKP A;  2R7F A;  1I1S A;  4AVZ A;  2V9K A;  2DMU A;  5K5Q A;  2LK2 A;  2O5R A;  4PGG A;  4ZDL A;  2VON A;  3CC2 I;  3QKX A;  3P9I A;  1HLV A;  2OTL I;  3IAS 2;  1XB4 A;  4JL3 A;  3PL8 A;  2KZG A;  4GRI A;  3FXK A;  1E2X A;  5C4J J;  2ZXH A;  1UZC A;  2R7S A;  3QPT A;  4ON0 A;  4YFX F;  4IPA A;  1BC7 C;  1DGW Y;  3VOD A;  1WGX A;  4X0G A;  3ULQ B;  4GCV A;  3CP2 A;  3SDB A;  4ENK A;  1VQL I;  3S17 J;  3DTE A;  2NAZ A;  4K2E A;  1QZE A;  4QPQ A;  3SZT A;  1R9T J;  1D5Y A;  3FKI J;  1BI3 A;  1JUP A;  4KT5 C;  2XPU A;  4KN7 X;  2B0L A;  2HOT A;  4ME9 A;  1GLN A;  3ZQG A;  5GAG J;  1GVD A;  4DVY P;  1NTC A;  2QQA A;  4LLG F;  1W36 C;  1MBH A;  4HNV A;  2KKO A;  4IL6 C;  1B8I A;  1BM9 A;  2L02 A;  3BDD A;  4GCL A;  5F27 A;  1Q1H A;  3I5U A;  1G4D A;  3F8F A;  3GTP J;  1XDU A;  2R5Y B;  5TIS C;  1BR4 A;  2TRT A;  3DBR B;  1HW2 A;  1KQ8 A;  3WE2 A;  2BYV E;  3CUO A;  3MCZ A;  2HYF A;  2RHA A;  4DBR A;  3M8E A;  4HSR A;  5GPA A;  1HDD C;  4ZYG A;  2GZW A;  3M4O J;  4RGX A;  2QUF A;  4IHY A;  2FNA A;  3M3Y J;  2ZNZ A;  1Z6R A;  2GUH A;  4D1Q A;  1R5H A;  5ICF A;  3MKY B;  4L18 B;  1IUF A;  1UB9 A;  4UUS B;  3OYL A;  4EJO A;  2A05 A;  5HOD A;  2O6G E;  3KET A;  2LMD A;  1KYZ A;  4D5F A;  3S2H J;  5EG0 A;  3NPI A;  2K5C A;  4NEL A;  3TW6 A;  3TDU C;  4XLE A;  3BCA A;  3WOD F;  3WG9 A;  4B3X A;  2AS5 F;  2RQP A;  5D18 A;  4BJT A;  1X58 A;  1XDS A;  3GBG A;  1OJL A;  2JA8 J;  1LVK A;  4UHT A;  2FOW A;  4WK8 F;  5IT3 A;  5F04 A;  1B6A A;  3E5U A;  3LWJ A;  3LQQ A;  3H5A A;  1FX7 A;  5EDN A;  4ESF A;  2CQX A;  1MIJ A;  4E7H A;  5LGU A;  3ZOB A;  2PMZ A;  5DM7 F;  3GX4 X;  2K3P A;  4Y3O A;  3BJB A;  2ESN A;  4UUT A;  1NK2 P;  1YLF A;  3K1M A;  4WXH A;  1ZRE A;  1Z7L A;  5E8I A;  1QQI A;  2PBX A;  3Q0W A;  1DGR M;  2M1B A;  1E17 A;  2CS3 A;  1TL8 A;  3CRJ A;  3VIB A;  2L7F P;  4CYC A;  3VOX A;  1PP8 F;  1BC8 C;  4XM3 A;  3EUH C;  2Y2Z A;  3KE2 A;  3NAR A;  3D5L A;  4Y13 A;  1ZRC A;  2B1E A;  3RI4 A;  1O4X A;  1FOK A;  2PMU A;  1Y6I A;  1X3U A;  2DPU A;  2QSG X;  1HW1 A;  2DJI A;  3A0B C;  5KVR A;  2R5Z A;  3ON4 A;  1ON2 A;  2RGV A;  3RDI A;  3C07 A;  1BBY A;  4UNO A;  1TQM A;  2DPD A;  1AA7 A;  1DP3 A;  2P0W A;  1X1C A;  3OIO A;  5EJC A;  3ZMS A;  2ELJ A;  5CPR B;  3SHF A;  3TQN A;  4KIC A;  5FLX K;  2HWV A;  3RQ4 A;  4OMY A;  2DG8 A;  3GEZ A;  4HBL A;  2FNP A;  4N9I A;  1G59 A;  1WKM A;  2CYY A;  2W00 A;  1FP2 A;  2LC2 A;  3K2A A;  4NBQ A;  2DT5 A;  4D7N A;  1H8A C;  2HPI A;  1HST A;  3DQV C;  3L7W A;  2CH0 A;  2R7R A;  5M5W J;  3P9C A;  2ISZ A;  1QO0 D;  2XDN A;  1TWH J;  4WX9 A;  5BOX A;  5GPC A;  2IS1 A;  1JXS A;  4XSZ F;  3F23 A;  4BE1 A;  1ZGW A;  2ZOZ A;  2YUS A;  1XTA A;  3M8F A;  2XHK A;  2V6E A;  2V1N A;  2DYR H;  1MMA A;  2CJJ A;  1FBU A;  2QYO A;  5GTH C;  1WJB A;  5B66 C;  1SD5 A;  5CYV A;  5JHU A;  3VP5 A;  1LEB A;  4B4C A;  2VJJ A;  5J47 A;  2K02 A;  4V19 K;  4KIG A;  5FD5 A;  4WXC A;  3ZCO A;  2M34 A;  3DTK A;  4CXF A;  4RM2 A;  3HJE A;  3K10 A;  2E1M B;  3D0S A;  4G8X A;  4AD9 A;  3CMY A;  5H9T A;  4XR6 A;  3ZQF A;  3BJO A;  2Q1Z B;  1IG7 A;  1DP7 P;  3H9G A;  3ZMU A;  3OL4 A;  5F08 A;  3HXL A;  2ISY A;  2V6C A;  4LGW A;  3LFU A;  4Z2Y A;  4JOM A;  4NB5 A;  3Q0V A;  5HNH A;  1EV7 A;  2DU9 A;  3FMR A;  3GTM J;  4IHX A;  4BE2 A;  1NH3 A;  1UG2 A;  2FOK A;  1SVO A;  4WIB A;  1IRF A;  1LDD A;  4W97 A;  2JA2 A;  3CCM I;  4YZE A;  2YU3 A;  2F5E A;  3BR3 A;  3F8M A;  5FHP A;  2UV1 A;  3MKZ A;  1SMY F;  3T5X A;  5LLQ A;  3SQN A;  1FC3 A;  3A03 A;  4C2U A;  2QCO A;  3IP4 B;  2R0Q C;  1DPU A;  3WG7 H;  2CV1 A;  5IOY A;  2STT A;  4ZC3 A;  2IBD A;  3MZH A;  3W6V A;  3NS4 A;  1HKQ A;  2VC0 A;  1FOX A;  1TW2 A;  2CUF A;  3HHG A;  2OZ6 A;  3N97 A;  4CUG A;  1XMK A;  3E6D A;  2JMW A;  1MBE A;  5TRD A;  3A1Y A;  4BYY A;  1YQA A;  4BBR J;  5IOZ A;  3OYN A;  3REO A;  4P9F A;  2BHY A;  2NS0 A;  1YJN I;  2R5Y A;  4PJM A;  3AG3 H;  3QPS A;  3HHH A;  3SZP A;  3JRE A;  1S9H A;  2BHZ A;  3H5R A;  4L0Y B;  2PEX A;  1OKR A;  3CCY A;  1HBX G;  3QWL A;  4N0B A;  2RVC A;  1ZG1 A;  1WJC A;  2B9S A;  3U1D A;  3R0A A;  4DYQ A;  4NUB A;  2COM A;  1N25 A;  3OYA A;  4YIF A;  2A5W A;  3LJL A;  1YIT I;  4G94 A;  3TO6 A;  3S1R J;  4PXI A;  4ENN A;  3VVZ A;  4CCK A;  1X1P A;  4A5M A;  4BAY A;  5DM6 F;  3WU1 B;  3OIP A;  2ZCW A;  3GZ5 A;  2L2O A;  2DCE A;  2M2E A;  1U78 A;  1M1E B;  3WU0 A;  2L5Q A;  3H92 A;  4N4N B;  4FCY A;  2GAU A;  2KRH A;  4M72 A;  1XSV A;  2OPT A;  4YEJ A;  4Y7N J;  1XGM A;  4RA2 A;  4PFP A;  1HW5 A;  1DQU A;  1TQI A;  2PQ8 A;  3HPH A;  2LFB A;  3ZQL A;  3KYD B;  1HC8 A;  1QHG A;  1JTY A;  2QLZ A;  1R6R A;  2JZY A;  2V1X A;  4RLF A;  2EFW A;  2DLL A;  3QYB A;  3V7S A;  3S1M J;  4NN1 A;  1LFB A;  5ERI A;  1Y1W J;  2FXA A;  2VOP A;  4ABZ A;  4HOB A;  2XKP A;  2RRE A;  1MJ9 A;  1D5V A;  2DA5 A;  2VI6 A;  1W5S A;  2WB1 N;  2X4H A;  5KAF C;  1IRX A;  2QQB A;  5FLX Z;  2YS9 A;  2JJ7 A;  4J19 A;  3PNT A;  3G7R A;  2R4G A;  3TKY A;  5J4V A;  3NRV A;  2A61 A;  4ETS A;  1ZH5 A;  3HOZ J;  4IQ4 A;  2FMY A;  3S32 A;  4XQF A;  2F07 A;  4L9J A;  4W1U A;  3RZO J;  2WAQ A;  2OCE A;  1GT0 C;  2L54 A;  4EQQ A;  2OA4 A;  3P5J A;  4I98 B;  4BE0 A;  2R7O A;  3T0Y A;  3H5N A;  4AC0 A;  3FRQ A;  5D5W B;  4XOT A;  1D0Y A;  1RR8 C;  1F9N A;  2KT0 A;  2HOS A;  4NHJ A;  2ZY9 A;  2LRD A;  1OCR H;  2EA4 A;  3K1N A;  2XDV A;  3PFI A;  4EV0 A;  3B73 A;  4A3L J;  1I3Q J;  3BHQ A;  1ZEL A;  2FE3 A;  4RB1 A;  4I2O A;  1JKQ C;  2X48 A;  5ILS A;  2XUB A;  4ESJ A;  2VIX A;  3SEZ A;  3GTG J;  5CQE A;  5D5X B;  2R93 J;  3OSG A;  2A68 F;  4Q5S F;  2V4J C;  4KN4 X;  1CF7 B;  1EH8 A;  3MD2 A;  1X4P A;  3DP7 A;  2G7S A;  2K4B A;  1W0U A;  3E6M A;  4U0Y A;  2IGO A;  2EBI A;  2VT2 A;  5HOO A;  3QRF F;  1N78 A;  1VQP I;  1JT6 A;  3VW2 A;  4XKB A;  3HL2 A;  2E2J J;  1UCR A;  2LLK A;  2O9L A;  3CO6 C;  4X6A J;  5H6R A;  5A2Q K;  3QQA A;  4OIO F;  1D8J A;  4R8H A;  4B09 A;  2Q2E B;  3OR1 C;  4EJV A;  3EYI A;  1R49 A;  3I0T A;  4PGH A;  2ZOY A;  1NHA A;  2ME6 A;  3QU6 A;  3F22 A;  1WRJ A;  3B02 A;  1CGP A;  1UEL B;  2R7T A;  2X1D A;  5HSZ A;  3TP3 A;  2ZCN A;  5FD6 A;  1KON A;  4LB5 A;  2OI8 A;  3RYP A;  4FAS D;  1G6N A;  4M74 A;  3RSN A;  1B4A A;  2DOF A;  3RYR A;  3BOQ A;  4ZYD A;  3ZQ7 A;  3H0D A;  2GFN A;  5CJ9 A;  2RAS A;  3E5X A;  2LBF A;  3CD6 I;  2FJ1 A;  4LIT A;  1BIA A;  1J5Y A;  3BR6 A;  1Z0X A;  4AC6 A;  4HPQ A;  2EIN H;  3FWE A;  3CZ6 A;  2WA0 A;  5J1U A;  4XMY A;  1IF1 A;  4AIJ A;  2LH9 A;  2TCT A;  3JAM K;  2WY7 Q;  2E36 A;  2ZME C;  5D8L B;  5D5U B;  4GXO A;  4FX0 A;  2LRE A;  2DJN A;  1D8K A;  3WGH A;  3VB2 A;  3IHU A;  4IHV A;  4IHW A;  4HQE A;  4Y52 J;  4AUX A;  3BG3 A;  5HLI A;  1MSF C;  4HNU A;  4FIS A;  5FRN A;  1O3T A;  2V9V A;  5D5V B;  3ABK H;  2Y0M A;  2L4M A;  4BKX A;  3OOP A;  2JUC A;  2ZCX A;  1D1A A;  3CQZ J;  3CF5 F;  5GAE J;  2L01 A;  2GEN A;  5FJ8 J;  4O3M A;  3W2A A;  2Y0S N;  3ZP5 A;  4G12 A;  1YRN A;  2H1L A;  2QBY B;  1W7P D;  4NNJ A;  4BXX J;  4CDG A;  1Z67 A;  3MQ0 A;  3C18 A;  4KFC A;  1I3A A;  3G4S I;  2E7W A;  1ZR2 A;  1O7L A;  2JTV A;  2VQG A;  2G9W A;  2M8G X;  1S5L C;  3AG2 H;  3CCR I;  1ZR4 A;  2V57 A;  4A69 C;  3LQR A;  1ZGJ A;  3HIF A;  1P4X A;  4YFK F;  2XC7 A;  1OCT C;  4HA8 A;  1RR7 A;  1DPR A;  4E4H A;  3K70 D;  3TMO A;  1H9G A;  4JQF A;  5F0H A;  4R1H A;  1JUM A;  1T0F A;  3TW7 A;  1QNT A;  4HZF A;  5FMP A;  1ZN2 A;  4ENJ A;  3OYG A;  3DTI A;  5HLT A;  1WCM J;  1E3H A;  2LY9 A;  3LMM A;  1IN5 A;  1A5J A;  1P7I A;  2QQ8 A;  5CVR A;  1APL C;  3A2K A;  5HBU A;  1TLH B;  1SFO J;  2P8T A;  5EG0 B;  2W85 A;  5DUK A;  1U9N A;  1XSX A;  5J8C A;  2HDC A;  4XOP A;  2VJ5 A;  3BR1 A;  3GYH X;  2KP6 A;  3H3U A;  2ZFW A;  1YTY A;  2LTP A;  3DU5 A;  3AL0 C;  2EWN A;  3IKT A;  2Y48 A;  3CJQ B;  5D8K B;  1ETX A;  2XAS A;  1OCO H;  2YSR A;  3M1E A;  4PCQ A;  1K78 A;  4Y4R A;  3HE0 A;  2M4K A;  1VFC A;  4B44 A;  2EIK H;  1X3W B;  2JT1 A;  2JPC A;  3BG9 A;  3ZN1 A;  4BHP A;  5D19 A;  2GIZ A;  5EYR A;  2XRN A;  3FIW A;  1SFX A;  2EFN A;  2Z2S B;  3PM1 A;  2QA4 I;  4BBS J;  5LHH A;  1R1U A;  4RDU A;  2E5Z A;  2FU4 A;  4IZZ A;  1X1B A;  1XSD A;  3OYF A;  3CUQ C;  3ZPL A;  2M8E A;  5KHD A;  2PN6 A;  1YJW I;  1GHC A;  2X0L A;  1N77 A;  2D5V A;  2IGK A;  2IVM A;  4CYC B;  4JKZ A;  3PAS A;  3QOE A;  2DN0 A;  3B6C A;  2VBX A;  5HNF A;  1WH7 A;  6PAX A;  2Y31 A;  1Y8Q B;  3W6K B;  3FF5 A;  1G3Y A;  5AON A;  1IXC A;  2IT0 A;  3L1P A;  1G3S A;  1ZKG A;  3D5R C;  2MG4 A;  1Z05 A;  3DBH B;  5A2Q Z;  3I71 A;  4HDV A;  2IEK A;  2NS7 A;  2P5K A;  3ONQ A;  1X1A A;  3GXO A;  2R5Z B;  3ABU A;  1TWC J;  5F6F A;  1TTY A;  5FKO A;  3FXL A;  2ZKZ A;  1FOY A;  3LA3 A;  3LSK A;  2NP3 A;  3E7Q A;  4XKV A;  2W24 A;  4TV7 A;  5IYC J;  2IXS A;  2DFE A;  2VBW A;  3CJR B;  3M07 A;  1MBJ A;  2LY2 A;  4U88 A;  2Z16 A;  4LJZ F;  4C3J J;  3HSR A;  3RJP A;  2E34 A;  2L7M P;  4ZTF A;  2OF7 A;  4PJN A;  2EZK A;  3KEY A;  1FMW A;  3LAJ A;  1CF7 A;  2LF7 A;  3GZI A;  2R7U A;  1PUE E;  3VPR A;  2A5Y B;  1LQ1 A;  3ROU A;  2N8G A;  4CIC A;  5FGM A;  1HDP A;  1RI7 A;  1LB2 A;  1VND A;  3O8H A;  4QTR A;  3ZQH A;  1U5T B;  2EJR A;  1IRZ A;  1DU0 A;  3G1M A;  3I4M J;  2DMP A;  3KP7 A;  3UR3 C;  4ZYE A;  2Q2E A;  1IN7 A;  5E20 A;  2XGD A;  1W36 D;  2GOX B;  1W7P A;  3GZN B;  1X4O A;  1OR7 A;  3DBL B;  3WHB A;  1PP7 U;  5B1A H;  1AWC A;  3H0G J;  5K1Y A;  3I4N J;  4AID A;  2O7T A;  1U3E M;  2QSF X;  3UKG A;  4MEY F;  5ICG A;  4ENM A;  5DYM A;  4NDL A;  2HU9 A;  1R7J A;  2JVH A;  2VN2 A;  4M3F A;  1ZLK A;  1SD6 A;  1FLI A;  2VXD A;  4XON A;  2DO7 A;  3K1P A;  4HAM A;  4DGW B;  3K4C A;  2UXI A;  3ASO H;  4DIQ A;  2YVE A;  4CGR A;  2QZ8 A;  4Y15 A;  1HKS A;  1FYK A;  4DBQ A;  3BC8 A;  4QWQ A;  1TBX A;  3LNQ A;  1TNT A;  4DOZ A;  4XRS A;  2VKD A;  1XX5 A;  5GP9 A;  1I39 A;  3V8J A;  4I99 C;  1J9I A;  3C2B A;  2HVR A;  3QBM A;  4UY8 I;  4DZP A;  5CVI A;  1J59 A;  2H8W A;  4BJ5 C;  3OYH A;  5HVQ C;  1R00 A;  3I3L A;  3MNL A;  4HW0 A;  3V7C A;  4IO9 F;  3CC7 I;  4B47 A;  1TP4 A;  1MJA A;  3F3X A;  3LSJ A;  1H89 C;  4I0B A;  1ERD A;  2KLO A;  2PJR B;  3HBL A;  2VAS A;  2JQ7 A;  4X1E A;  2CV2 A;  4G7O F;  4XLC A;  4IOC F;  1POG A;  4Q4Z F;  4J00 A;  2AQE A;  5B3S H;  2R7X A;  4P55 A;  5KAI C;  5J3L A;  4AIH A;  5K5O A;  4M3B A;  4LD5 A;  3FX3 A;  2LNB A;  3CDI A;  3S8P A;  2VJ4 A;  1YI2 I;  3V42 A;  3BRO A;  2HQN A;  5LBQ A;  2R3S A;  2QBY A;  3GF2 A;  4XID A;  4XIC A;  4UXN A;  4L9T A;  3ANP A;  2VL8 A;  1LUJ B;  5GAH J;  3CCJ I;  3HM5 A;  1Z77 A;  1SGM A;  4BDZ A;  3BY6 A;  1YS6 A;  1GVJ A;  4FT8 A;  1TQP A;  1RKW A;  4RAZ A;  3L2V A;  2UXH A;  1W1W E;  4F3Q A;  1ETV A;  3NXC A;  4I09 A;  3I55 I;  1WQ2 A;  1IDY A;  3HPG A;  1P6R A;  2ESH A;  2A2F X;  3I64 A;  1V5G A;  5LGT A;  3S3M A;  3H3Z A;  1MKM A;  5GAD J;  4HF2 A;  2J5O A;  1ORK A;  1TNS A;  2OBP A;  2P7V B;  3ZMT A;  2W53 A;  1IAW A;  3ZXS A;  3L09 A;  2FBI A;  5JLX A;  5DCF A;  3FZV A;  1NG7 A;  2RKH A;  3FM5 A;  2QKO A;  5LHI A;  4EAT A;  3VYR B;  2RC4 A;  3OYJ A;  3R6S A;  1RRJ A;  3WTS C;  2WTE A;  2Y75 A;  3OYK A;  2AXT C;  2FBH A;  2BGC A;  3U21 A;  3DEU A;  1D0Z A;  2ELH A;  2IJL A;  5M3F J;  4CHU A;  4BEH A;  2K40 A;  4PSX A;  4BU2 A;  2ZBK A;  2YU9 J;  3WU2 C;  5E17 F;  4OU0 A;  5TGT A;  1EKE A;  2JWT A;  2FD5 A;  3FK7 A;  3CDH A;  2Q0O A;  1IN8 A;  4XRS G;  1UG0 A;  2DAO A;  2KFD A;  4MNU A;  2K9M A;  1XMX A;  3DU6 A;  3W3C A;  3S1N J;  3G1L A;  3TP0 A;  3QOP A;  1F5T A;  1FY7 A;  3FDY A;  5EFY A;  5ILV A;  4DQ2 A;  1B72 A;  3KYC B;  2P7C B;  3ANG A;  4HQM A;  3OS1 A;  3K4M A;  4BHC A;  5E3L A;  4KIS A;  1ZK8 A;  1OIS A;  1T95 A;  3PSI A;  3T8R A;  2CGP A;  2NVU B;  5DDG A;  2K27 A;  1T08 B;  3HOV J;  1RKT A;  3X2Q H;  2PI0 A;  3J81 K;  2ECB A;  3CC4 I;  3BZK A;  1OQY A;  2I10 A;  1ZHF A;  4EGZ A;  5K7F A;  1XGO A;  1WJD A;  2ID3 A;  2F5D A;  2ZXI A;  4MFE A;  1FSH A;  5C44 J;  1UI6 A;  2F2E A;  2K7L A;  4NC6 A;  4AWX B;  3HTU A;  3J7A O;  1L3L A;  2UXO A;  1AKH A;  1REP C;  2WGB A;  2VPR A;  4XBF A;  5B5E C;  1FSE A;  2QEN A;  2VOD A;  3QAH A;  4AVP A;  4GFB A;  2GIV A;  2JK3 A;  1IGN A;  1S29 A;  1X1D A;  4IXA A;  4EJT A;  2HOE A;  1U5T A;  1JGG A;  2JVG A;  3CLO A;  3AFH A;  2FBK A;  5AIQ A;  4NC7 A;  4C2T A;  3DPU A;  2EZI A;  3ESW B;  1VZ0 A;  3JSJ A;  2E7X A;  2O0Y A;  1ODD A;  3TL4 X;  1LFU P;  1ZQ3 P;  2F5V A;  5IYB J;  2PZ9 A;  4HX8 A;  2FJI 1;  3JRB A;  3KCC A;  1TC3 C;  1ETO A;  3EYY A;  1IV6 A;  2L0K A;  1P4A A;  4U9N A;  1AOY A;  2ZFU A;  2DMQ A;  4E7K A;  3HRU A;  5F1J A;  4II3 A;  2XB5 A;  2YR2 A;  3EUH A;  4L0Z B;  3S15 J;  4BXF A;  1B1B A;  3KPH A;  3RKY A;  4CH7 A;  4OAZ A;  4AIK A;  2PMZ N;  3I58 A;  2LBF B;  2DYS H;  1QPM A;  2VLA A;  3S93 A;  3O8G A;  1KA8 A;  4ZYH A;  1GV2 A;  4BJ6 C;  4O6J A;  3LAP A;  1UAA A;  1MGT A;  4HNT A;  3BTJ A;  3FBN B;  4A5N A;  2G0E A;  5FKN A;  5F64 A;  3E7L A;  3C7J A;  3PO2 J;  3NWS A;  3J80 K;  3KLN A;  4LLN A;  3TBI A;  3M9A A;  3EQL F;  1T38 A;  1YYV A;  1UHW A;  3HTA A;  3HRM A;  1UHM A;  1IDZ A;  3I53 A;  2E2H J;  1XC5 A;  2Z1D A;  3PFY A;  1OMI A;  4HEA 2;  3K69 A;  5J8F A;  1SAU A;  4M3D A;  2JA7 J;  2PJR A;  2ZJ2 A;  3IUO A;  2BZT A;  2Z5U A;  9ANT A;  1VQ6 I;  2LVS A;  3BPX A;  3GLL A;  3P9T A;  2K4J A;  3T1B A;  1DDN A;  1WZ2 A;  1LVA A;  3S2D J;  2D2W A;  1IZ1 A;  3JRF A;  1KQ0 A;  3IC7 A;  3SXY A;  2JPB A;  2YPR A;  2WB1 A;  4OOI A;  1YRN B;  2L9N A;  4V2F A;  2WWY A;  1Q1V A;  3PJR A;  5LFA A;  1Y56 A;  4MQV A;  1I27 A;  3HG9 A;  4ITV A;  4PFO A;  1FOW A;  1QZZ A;  4MXM A;  3MFK A;  2VE8 A;  3BG5 A;  2XF5 A;  2DOA A;  1JE8 A;  1A6Q A;  1Z3X A;  2HXI A;  4ICH A;  2EZH A;  2KRC A;  3KKC A;  1R1T A;  3M8J A;  2VBY A;  3A01 A;  3ZMD A;  3KP6 A;  3WTV C;  4CSW A;  5JVG F;  2KQR A;  3K7A J;  2COB A;  3S5R A;  1HKT A;  2XAU A;  1E3P A;  3VYS B;  1WH5 A;  4FE7 A;  3CJD A;  2DMN A;  3MAJ A;  2MD0 A;  5DS9 A;  3LHQ A;  4ZDP A;  1YX3 A;  2DDA A;  2ZXW H;  2V1D A;  1BI0 A;  1YJ9 I;  5TJJ A;  4IX7 A;  3PQK A;  2F5C A;  2HTS A;  1O7F A;  1BI1 A;  2LF8 A;  4GCT A;  2CWE A;  1QZY A;  5CQG A;  2HEO A;  4DJA A;  2Z9O A;  3RH2 A;  3G2B A;  2IP2 A;  3ABT A;  1N75 A;  1MMN A;  1KU3 A;  2DDB A;  2NVY J;  1V5E A;  2BV6 A;  2W48 A;  4IJA A;  4N9H A;  4A6D A;  4H4K C;  4EM0 B;  1K78 B;  3BP8 A;  2HDD A;  1P4W A;  3ZQC A;  2MLG A;  2ELK A;  3QPH A;  3J81 Z;  3F6V A;  1WJA A;  4C2M J;  3EPZ A;  3EDP A;  4D0P A;  4AU7 A;  5KK1 A;  5ILU A;  5J1Y A;  2QVO A;  3GME A;  5EEG A;  4F92 B;  4HLX A;  2CQK A;  4XN3 A;  4EEF G;  1FTT A;  2VC1 A;  3J7Y J;  3HKZ A;  3B81 A;  2V1U A;  3QPL A;  1IW7 F;  4BQQ A;  4YFN F;  3W2V A;  5BMZ A;  1IJW C;  4MTD A;  4HX7 A;  1ETQ A;  2R7V A;  2WAD A;  1YO5 C;  2KL4 A;  3A02 A;  3FIS A;  3HOT A;  2JA5 J;  3OOU A;  1RIO H;  4FE4 A;  3VW1 A;  1S7O A;  2NYX A;  3OYE A;  5F0F A;  3FK6 A;  3OS0 A;  2OU2 A;  2FQ4 A;  2BW3 B;  4EMS A;  3FXR A;  2DFF A;  3A0H C;  3CJN A;  5DEQ A;  1YE9 A;  1PJR A;  3KLO A;  4JYK A;  3W6J B;  3CCQ I;  2RN7 A;  4HLY A;  2UXN A;  1OPC A;  3ELK A;  2DQR A;  4BL0 B;  1R5I D;  1RNL A;  3E6B A;  3GTJ J;  2ID6 A;  1J09 A;  2OV7 A;  2CU7 A;  4D7M A;  4LMY A;  2KIU A;  4XLP F;  4GFK A;  3QP6 A;  4M73 A;  4BH9 A;  2XIG A;  2FSW A;  1H88 C;  1Z1D A;  3VDX A;  1C0W A;  2HYJ A;  1K61 A;  4MLO A;  2E1M C;  4G6D A;  4UVC A;  3IV5 A;  3NI7 A;  4HF0 A;  1WVR A;  5LEJ A;  3I54 A;  3LFK A;  4EJW A;  1K7A A;  2KJC A;  1K4S A;  1UHS A;  4RAY A;  5DCM A;  2H09 A;  1A04 A;  4CCO A;  2P81 A;  2X6O A;  3J80 Z;  3BZC A;  1XS9 A;  1WSU A;  1K6Y A;  4CCL A;  3LSG A;  1W7P B;  3K4K A;  1F43 A;  2OQR A;  1T33 A;  2BXY A;  3R0J A;  4IRV A;  2KZV A;  2WV1 A;  3KP2 A;  2G7H A;  3NAU A;  1R22 A;  5IP9 J;  3CMM A;  3GTL J;  2VPL A;  2PMH A;  3HOU J;  1OYY A;  2WAE A;  5E1X A;  4S05 A;  3BR2 A;  3HYI A;  1PUF A;  2LYC A;  3AQS A;  2ECC A;  4PJJ A;  4GDF A;  4DYC A;  2EIL H;  1W5C C;  5EGO B;  3COA C;  1MBF A;  1BJA A;  1R1V A;  2DA2 A;  1WJ5 A;  3OYC A;  1BW5 A;  1WFX A;  1UMQ A;  4OIN F;  3J7A Y;  1HF0 A;  4M3E A;  2C6Y A;  2CW7 A;  3S14 J;  3TGN A;  4ZYA A;  4XLF A;  3KP3 A;  1K6O A;  5HS8 A;  1VTN C;  2MH2 A;  5JVT A;  1S7A A;  1WHU A;  5BQT A;  1F36 A;  3ISP A;  3OYM A;  3HOW J;  1T6S A;  3PNY A;  1KZH A;  5FGL A;  1ZAR A;  2EH3 A;  2X1E A;  2HVQ A;  3GO5 A;  2M3A A;  3PQJ A;  3MMY B;  5K5R A;  3TOB A;  4BY1 J;  2G7L A;  4EGY A;  4XKC A;  2OAZ A;  2X51 A;  3V6G A;  1TWF J;  3FXQ A;  2REK A;  3HRT A;  3BTC A;  3E0J B;  3JSO A;  3VVY A;  2XAJ A;  1SAN A;  4A3K J;  2KPM A;  1Z91 A;  2K9N A;  3KEO A;  3DWL E;  2VKE A;  3VEP A;  1T2K A;  3VWB A;  3BTL A;  3KIO A;  4XN0 A;  3HOX J;  1TT0 A;  3HRS A;  3DEE A;  3GWZ A;  5J40 A;  2VQH A;  3FXJ A;  5D6E A;  5C4X J;  2W4S A;  4RB0 A;  3VYT B;  5CKT A;  3KYL A;  1YW7 A;  1MMG A;  3Q9S A;  3G71 I;  3CLQ A;  2Y30 A;  3G73 A;  2H27 A;  2EFO A;  2RAE A;  4OWR B;  4EM2 A;  4II2 A;  4KYW A;  1S8N A;  3T8T A;  4DNC A;  2M87 A;  1XMA A;  1FBQ A;  3HUG A;  4R79 A;  3LL7 A;  1IXR C;  3HC7 A;  2YVH A;  3DCF A;  4ZTJ A;  1MJB A;  3P7N A;  3S2W A;  4E6K G;  3JSP A;  3Q5F A;  2CUE A;  3PIP F;  1A31 A;  4B43 A;  1ENH A;  2E19 A;  2JN6 A;  5E79 C;  2CFO A;  2AHQ A;  1IV8 A;  3E1S A;  3K0L A;  4I01 A;  4L5J A;  3K2Z A;  5HAW A;  3JW4 A;  2V9P A;  2IS4 A;  3L00 A;  1YX5 A;  5L3F A;  2R7Z J;  2CW8 A;  2GM4 A;  4RLQ A;  2A6T A;  1E0E A;  3JCU C;  4I7H A;  3KNW A;  4ZDO A;  3R61 A;  3PUB A;  1R4N B;  3C2G A;  2VB6 A;  3GFI A;  4E7J A;  2ZME A;  3VUQ A;  2E71 A;  1GXQ A;  2DBB A;  4ZZL A;  1AU7 A;  1YIJ I;  4C9Y A;  4ESB A; 
#chains in the Genus database with same CATH homology
 1TWH J;  5M5Y J;  1A6I A;  1POG A;  5GPC A;  5J3L A;  3WHC A;  2X9D A;  4M3B A;  1ZGW A;  2ZOZ A;  1T56 A;  2YUS A;  2K9S A;  3IUV A;  2NVX J;  1P7J A;  5K58 A;  2DMT A;  4A3D J;  2CJJ A;  4XID A;  4XIC A;  3ANP A;  3HM5 A;  3S1Q J;  1Z77 A;  3VP5 A;  1SGM A;  2XDN A;  4B4C A;  3GEU A;  1TWG J;  2HQ5 A;  3G1O A;  1RKW A;  2M34 A;  3KZ9 A;  3TED A;  2CRG A;  1LE8 B;  4QIW N;  5H9T A;  3CMY A;  2HOA A;  2UXH A;  3DEW A;  3ZQF A;  1ETV A;  1IG7 A;  5F0C A;  3EUP A;  3NXC A;  1B72 B;  5F08 A;  1IDY A;  5K7Z A;  4JNN A;  3Q0V A;  4D5C A;  3GTM J;  4IHX A;  1JKO C;  3RD3 A;  1ORK A;  1RET A;  1UG2 A;  2AO9 A;  3F0C A;  2W53 A;  4W97 A;  4YZE A;  2DG7 A;  5JLX A;  1E3O C;  2XPV A;  5FHP A;  3BR3 A;  2UXU A;  2Y9Y A;  3JRC A;  2QKO A;  5J1R A;  1VF9 A;  4JX6 A;  3A03 A;  2JA6 J;  2QCO A;  2R0Q C;  4V2G A;  3JRH A;  3JRG A;  5IOY A;  5M3F J;  2IBD A;  4MK6 A;  3W6V A;  4L5E A;  3OSF A;  2K40 A;  2CUF A;  4A3F J;  2DA3 A;  4DW6 A;  3MKL A;  2YU9 J;  3HKZ N;  1AKH B;  2JWT A;  2FD5 A;  3FK7 A;  2JMW A;  1MBE A;  3LSP A;  3NRG A;  4BBR J;  4XRS G;  5IOZ A;  1MNM C;  2WAQ N;  4GCK A;  3HB9 A;  5BNG A;  2R5Y A;  4BY7 J;  3BR5 A;  3QPS A;  1W0T A;  5C4Y A;  3JRE A;  3BTI A;  2IU5 A;  3CCY A;  3S1N J;  3G1L A;  3TP0 A;  2M0C A;  2XGC A;  5EFY A;  4DYQ A;  1QRY A;  3MVP A;  2LR8 A;  2D6Y A;  1B72 A;  3PPB A;  2H1K A;  3ANG A;  3LJL A;  4B3A A;  3S1R J;  4PXI A;  3GTQ J;  5FLM J;  3VVZ A;  5E3L A;  3HIM A;  1ZK8 A;  4MO7 A;  1JUS A;  5CW8 A;  3BQZ A;  3KKD A;  5EGO A;  3PO3 J;  2M2E A;  1U78 A;  3HOV J;  4FCY A;  3H3V K;  2MGQ A;  1RKT A;  1MH4 A;  2OPT A;  1RES A;  2XRL A;  2ECB A;  4Y7N J;  4ACI A;  2I10 A;  5K7F A;  2ID3 A;  3BT9 A;  4MFE A;  2DA4 A;  5C44 J;  1UI6 A;  2LFB A;  3ZQL A;  1JTY A;  2UXO A;  4NN1 A;  3S1M J;  1AKH A;  1B8I B;  2WGB A;  1WPK A;  1LFB A;  1Y1V J;  1Y1W J;  2VPR A;  4RBO A;  1HOM A;  4ABZ A;  3T6N A;  5DTD A;  3VW0 A;  4GFB A;  2DA5 A;  2VI6 A;  2JK3 A;  2WB1 N;  2NS8 A;  1IGN A;  3IH2 A;  3Q0U A;  3BCG A;  2YS9 A;  1JGG A;  2JJ7 A;  2QF7 A;  4J19 A;  3G7R A;  4XRM A;  3MN2 A;  3HOZ J;  1QVU A;  4IEJ A;  4LOC A;  1MSE C;  2F07 A;  3SFI A;  4W1U A;  4A3J J;  2HKU A;  4C3H J;  3RZO J;  2EZI A;  3AQT A;  1GT0 C;  3JSJ A;  5IP6 A;  3D1N I;  1LFU P;  1ZQ3 P;  1FIA A;  5IYB J;  3RKQ A;  2PZ9 A;  4JX4 A;  4I6Z A;  2NOG A;  4AC0 A;  1FEX A;  3FRQ A;  3JRB A;  1TC3 C;  1ETO A;  1IV6 A;  2L0K A;  1ZTR A;  1TWA J;  5EF6 A;  2DMQ A;  2KT0 A;  5F1J A;  1BJZ A;  1U9O A;  2XB5 A;  4A3I J;  2HOS A;  1BA5 A;  4KWA A;  4DYR A;  3S15 J;  1EF4 A;  2QTQ A;  3CWR A;  4A3L J;  1I3Q J;  1X2M A;  4A93 J;  2PMZ N;  3A01 B;  2FBQ A;  3BHQ A;  2M9H A;  4JX5 A;  3O8G A;  2E2I J;  1JKQ C;  2X48 A;  4DZJ A;  1GV2 A;  1MH3 A;  2H8R A;  2L9R A;  3BTJ A;  3GTG J;  4A3M J;  2G0E A;  5FKN A;  1X2N A;  3E7L A;  2R93 J;  3PO2 J;  2G7G A;  3OSG A;  2HXO A;  5M5X J;  3IH3 A;  2G7S A;  3HTA A;  1W0U A;  1IDZ A;  2E2H J;  1XC5 A;  3B6A A;  2EBI A;  3EGQ A;  1JT6 A;  5FLV A;  3GTK J;  5AQC A;  5E3O A;  3VW2 A;  2E2J J;  2LLK A;  2O9L A;  4M3D A;  4X6A J;  2JA7 J;  3QQA A;  9ANT A;  5JLW A;  4A3G J;  2LVS A;  1GUU A;  3P9T A;  2ZOY A;  3S2D J;  2ME6 A;  2GBY A;  3JRF A;  1JJ8 C;  1YRN B;  4XK4 A;  4V2F A;  1Q1V A;  1BW6 A;  1MBG A;  2MSY A;  4JP0 A;  2IAI A;  5HSZ A;  3TP3 A;  2LP0 A;  2ZCN A;  3HTJ A;  4C3I J;  4MXM A;  2OI8 A;  3BG5 A;  4S0H B;  2G3B A;  2HXI A;  4ICH A;  3RQI A;  2EZH A;  2UXP A;  3KKC A;  1WI3 A;  4M3G A;  5CXI A;  3HOY J;  3JRA A;  2GFN A;  2RAS A;  3A01 A;  3S5R A;  2FJ1 A;  3K7A J;  2COB A;  1OCP A;  3HTH A;  3JR9 A;  1LE8 A;  1FIP A;  1K83 J;  3BR6 A;  1Z0X A;  2VUM J;  4AC6 A;  1WH5 A;  4FE7 A;  1MBK A;  3CJD A;  2DMN A;  2XGE A;  5J1U A;  5DS9 A;  1IC8 A;  2OER A;  3LHQ A;  1GV5 A;  2TCT A;  5DAJ A;  4AF5 A;  2MW8 A;  1ITY A;  2L7Z A;  2KDZ A;  5D1R A;  1G2H A;  2DJN A;  4GCT A;  3JRD A;  4IHV A;  3SDG A;  3ON2 A;  4MIM A;  4IHW A;  5FKK A;  2DA7 A;  4Y52 J;  4AUX A;  3BG3 A;  1MSF C;  1NK3 P;  2NX4 A;  2FX0 A;  2HI3 A;  4FIS A;  3RH2 A;  4B1R A;  4BKX A;  2ZCX A;  3HEF A;  3RZD J;  4M6V A;  3O60 A;  2NVY J;  3CQZ J;  4AYB N;  1DU6 A;  2GEN A;  2GLO A;  2W48 A;  5FJ8 J;  2Y0S N;  4UDS A;  1JT0 A;  2R92 J;  2QWT A;  4G12 A;  1JKP C;  1YRN A;  1OFC X;  2HDD A;  3JRI A;  3V78 A;  3ZQC A;  1JKR C;  1ETY A;  1HCR A;  2ELK A;  4A3C J;  5E3M A;  2DA1 A;  4BXX J;  2ZCM A;  4C2M J;  1ETW A;  2DA6 A;  4QSH A;  5EZG A;  1JJ6 C;  1XG1 A;  1ZR2 A;  1AHD P;  2M8G X;  1ZR4 A;  2V57 A;  5J1Y A;  4A69 C;  1RPW A;  2LD5 A;  1QPI A;  3BNI A;  2ZB9 A;  5M3M J;  2DTZ A;  4EEF G;  1OCT C;  1FTT A;  1RR7 A;  3B81 A;  3QPL A;  5IP7 J;  2DMU A;  5F0H A;  2LK2 A;  1JUM A;  2ME0 A;  3QKX A;  1HLV A;  3TW7 A;  1IJW C;  2XPW A;  5FMP A;  3ZQI A;  1ETQ A;  4MFD A;  4JL3 A;  1WCM J;  2NVT J;  5C4J J;  3LSR A;  2LY9 A;  5EEA A;  5IYD J;  1A5J A;  1P7I A;  3A02 A;  3FIS A;  5K7H A;  1APL C;  2JA5 J;  1UI5 A;  1PUF B;  5HBU A;  3OOU A;  5EG0 B;  4FE4 A;  1SFO J;  1U8B A;  3VW1 A;  1U9N A;  3BRU A;  5F0F A;  1WGX A;  3FK6 A;  1JTX A;  2FQ4 A;  3BR1 A;  3S17 J;  4JYK A;  2LTP A;  1R9T J;  1D5Y A;  3FKI J;  1JUP A;  2O7O A;  5E3N A;  1ETX A;  1VI0 A;  2XPU A;  3GTJ J;  2EQR A;  4A3B J;  3DPJ A;  2ID6 A;  2HOT A;  4D7M A;  2CU7 A;  3IH4 A;  3BR0 A;  3ZQG A;  2QIB A;  4ME9 A;  5CXG A;  1GVD A;  1NTC A;  4GFK A;  1S7E A;  3HE0 A;  1MBH A;  4HNV A;  1VFC A;  1H88 C;  1B8I A;  2HYJ A;  4GCL A;  1K61 A;  5F27 A;  3BG9 A;  5D19 A;  5EYR A;  4MLO A;  3IV5 A;  3GTP J;  3NI7 A;  3FIW A;  2R5Y B;  2TRT A;  2LKX A;  3PM1 A;  3COL A;  1UHS A;  2NVQ J;  4BBS J;  2RHA A;  4RDU A;  5GPA A;  1HDD C;  2P81 A;  2X6O A;  1XS9 A;  3M4O J;  3Q3S A;  2Q24 A;  3LSG A;  4IHY A;  2D5V A;  3M3Y J;  1F43 A;  4CYC B;  2GUH A;  3PAS A;  4JKZ A;  2DN0 A;  1IUF A;  1T33 A;  3B6C A;  4UUS B;  1WH7 A;  2WV1 A;  5IP9 J;  3NAU A;  2Y31 A;  5HOD A;  3GTL J;  1ETK A;  3L1P A;  3HOU J;  1ZKG A;  4D5F A;  2MG4 A;  3BR2 A;  3S2H J;  1PUF A;  2IEK A;  2NS7 A;  5EG0 A;  2ECC A;  3AQS A;  3NPI A;  5FKM A;  1I50 J;  4DYC A;  5EGO B;  1FJL A;  1MBF A;  3TW6 A;  2R5Z B;  4NEL A;  2DA2 A;  1TWC J;  1BW5 A;  1UMQ A;  5FKO A;  1HF0 A;  2XB0 X;  4M3E A;  2NP5 A;  5D18 A;  2NP3 A;  3E7Q A;  3S14 J;  5IYC J;  1X58 A;  3GBG A;  1OJL A;  5FKL A;  2JA8 J;  5F04 A;  3SJM A;  2QOP A;  3LWJ A;  1MBJ A;  1F36 A;  3HTI A;  4C3J J;  3HOW J;  5FGL A;  5EDN A;  4A3E J;  2L7M P;  2EH3 A;  5EZH A;  2OF7 A;  2EZK A;  2CQX A;  3CDL A;  3LOC A;  4I76 A;  3GZI A;  4HKU A;  3ZOB A;  4BY1 J;  2G7L A;  3VPR A;  2N8G A;  3V6G A;  1HDP A;  3BJB A;  1VND A;  3O8H A;  1TWF J;  4QTR A;  4UUT A;  1NK2 P;  3ZQH A;  2WUI A;  1IRZ A;  1DU0 A;  2REK A;  3G1M A;  2O8K A;  2DMP A;  3BTC A;  3Q0W A;  3I4M J;  2PBX A;  3VVY A;  2Y9Z A;  1SAN A;  4A3K J;  2K9N A;  2XGD A;  2VKV A;  2VKE A;  3CRJ A;  3WHB A;  2L7F P;  3BTL A;  3VIB A;  1BL0 A;  3VVX A;  3HGG A;  4CYC A;  3HOX J;  4FTH A;  3H0G J;  3VOX A;  3I4N J;  4UUS A;  2O7T A;  3UKG A;  2Y2Z A;  3F1B A;  3NAR A;  2E1O A;  2CQQ A;  5IPA A;  4NDL A;  5C4X J;  1CQT A;  3HDD A;  1O4X A;  3S16 J;  2HYT A;  2Y30 A;  4M3F A;  3G56 A;  3ON4 A;  2R5Z A;  3C07 A;  2RAE A;  3BQY A;  2UXI A;  2EZL A;  3GTO J;  2YVE A;  4CGR A;  1QVT A;  2XSD C;  3HGY A;  3LNQ A;  3OIO A;  1FTZ A;  2YVH A;  5C3E J;  3DCF A;  4XRS A;  5GP9 A;  4L62 A;  2DG8 A;  3C2B A;  2CUE A;  3QBM A;  1GDT A;  1ENH A;  2E19 A;  2JN6 A;  4DZP A;  1I6H J;  2AHQ A;  5HAW A;  2K9Q A;  4GFL A;  3MNL A;  2R7Z J;  2GM4 A;  3KNW A;  2B63 J;  3K2A A;  3LSJ A;  3VUQ A;  1H89 C;  1AU7 A;  4D7N A;  3VOK A;  3HBL A;  1H8A C;  3NNR A;  4X1E A;  5M5W J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...