2OF9A

Crystal structure of apo avr4 (d39a/c122s)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
b'KCSLTGKWTNNLGSIMTIRAVNSRGEFTGTYLTAVAANPGNITLSPLLGIQHKRASQPTFGFTVHWNFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDISYDWKATRVGYNNFTRLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin-related protein 4/5
publication title Critical importance of loop conformation to avidin-enhanced hydrolysis of an active biotin ester.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Ligand binding protein
total genus 26
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2of9A00
1SWEA 1SRFA 2IZIA 3MG5A 1VWNB 2CAMA 3EW2A 1STRB 1SWUA 3WYPA 1SLEB 3X00A 4BX6A 2RTOB 4CPHA 4Z28A 3PK2A 1SWFA 2RTLA 5IRAA 4U46A 4BX7A 1SWNA 3WZOA 5JD2A 1NBXA 2OF9A 1SWKA 1SWSA 4I60A 3RE5A 1HQQA 1KL4A 2RTMA 4GJVA 4BJ8A 1VWDB 2IZGB 4JO6A 2A8GA 1N9YA 1VWMB 1SWRA 1Y53X 2RTDB 1AVDA 1NQNA 1SWBA 3RY1A 2RTHB 1VWLB 2RTGB 2F01A 1LELA 4Y5DA 3WZNA 1SWAA 1VWCB 4BX5A 1SWJA 1N9MA 1SWOA 4GJSA 1VWGB 2BC3A 1VWJB 2A5CA 2C4IA 2OF8A 3T2XA 1SWTA 3EW1A 1VWAB 1RSTB 1SRJA 1RSUB 1SRIA 1KL5A 4IRWA 3SZHA 1VYOA 2IZFB 1SWDA 1I9HA 4JHQA 2IZCB 1VWIB 1SWLA 5B5GA 1IJ8A 5B5FA 1SWGA 1MK5A 4Z2PA 1VWKB 4GDAA 1SLDB 1SLGB 1KFFA 1RAVA 3WZPA 2IZBA 3RDOA 1RXKA 1HY2A 4BCSA 2IZKA 4CPFA 1VWEB 2G5LA 1SLFB 2WPUA 2ZSCA 4DNEA 4YVBA 1NQMA 1STSB 1SWPA 2QCBA 3WYQA 2GH7A 2MF6A 1MOYA 2Y3EA 2IZAA 3T6FA 2OFAA 3SZJA 1AVEA 1VWBB 1LCVA 5CSEA 2IZJA 2RTPB 1STPA 2RTFB 1HXZA 3T6LA 5L3YA 1LUQA 1SWQA 3RDUA 2RTQB 2OFBA 2Y3FA 3WZQA 1N43A 1DF8A 1VWHB 4EKVA 1VWRB 1SWHA 2RTNB 1N4JA 5CHKA 2C1QA 2IZEB 1LDOA 2C1SA 4Z2VA 4GGZA 3SZIA 2Y32A 4Z27A 1WBIA 1LCZA 2FHNX 2RTKA 3FDCA 3RDMA 3VHIA 4Z6JA 1MM9A 3RDXA 2A5BA 4Y59A 3VHHA 1NDJA 4BX5B 2RTJA 1SRGA 5IRUA 4JNJA 3VGWA 5K67A 1Y55X 2FHLA 2IZDB 4GGRA 2RTRB 1Y52X 1VWFB 1N7YA 3RY2A 4BX6B 2RTCB 1VWPB 4GD9A 1VWQB 2IZLB 2JGSA 4OKAA 3RE6A 4CPEA 4CPIA 3MM0A 4CPHB 1MEPA 1RXJA 2RTIB 4BX7B 1SREA 1SRHA 2IZHB 2UZ2A 2RTAA 3RDQA 1VWOB 1NC9A 5IRWA 1LDQA 1RXHA 3VHMA 4GGTA 4Z2OA 1KL3A 2AVIA 5K68A 1LCWA 2RTEB 1SWCA 5F2BA 1PTSA 4BBOA 3RDSA 1HXLA 3T2WA 2UYWA 2RTBB
chains in the Genus database with same CATH superfamily
2KTDA 1MVGA 4TJZA 3CKGA 3F6ZB 2FKGA 1OEJA 1GX9A 2BS6A 2JU8A 4WBKA 5H9AA 4OS3A 3WXQA 1BBPA 4MVKA 2CM4A 3PECA 1SLEB 4MVEA 3X00A 2ACOA 2RTOB 4Z28A 4PJ2A 4AYHA 1GX8A 1LFOA 4I3DA 4COTA 1AELA 2AKQA 2RTLA 5F1EA 5KICA 4WHIA 2OZQA 3KFHA 4L1NA 1X8NA 5JD2A 4Y0PA 2AT8X 1TXLA 2L68A 2OF9A 1EUOA 3STKA 1KGLA 1BSYA 4ZHDA 3WBGA 1W6FA 4Y0SA 2HLVA 3KZAA 4D6BA 5LJEA 2Q39A 4QNIA 1N9YA 4YMYA 1AVDA 1NQNA 1SWBA 2MO5A 3RY1A 5HZ5A 5D4AA 4PSQA 1UZ2X 4IB6A 1T8VA 1VWCB 3OBLA 4GH7A 1BWYA 1OPAA 3KVNA 4EEJA 3P6HA 5LJBA 4N7DA 1PEEA 3KFFA 3HWDA 4IBAA 1K24A 3MBTA 3EW1A 1VWAB 4CK4A 1FELA 1VPRA 4MIRA 4YDBA 5HWZA 2GTFX 1ERBA 3APVA 4IMNA 4TNNA 1QY1A 5EEDA 3TGBA 3UEVA 3MVFA 3I17A 3IA8A 3NX2A 4JHQA 4ZHFA 1VWIB 1FEMA 1SWLA 1IJ8A 5B5FA 5HZ9A 2VDFA 1SWGA 4GNWA 4XMHA 5B11O 4CDDA 2WUTA 1ICMA 2I5VO 3JSQA 3S60A 2X55A 1QWDA 4MVIA 5LJKA 1RAVA 4EQAC 3BLGA 1I4UA 2IZBA 3HPEA 4BCSA 2RA6A 1Y9TA 2P8GA 5BVTA 2OFRX 3TF6A 1SLFB 4DCBA 4BGFA 2OVSA 1I06A 1STSB 2QCBA 1IKEA 1O1UA 1JMXA 2MF6A 1HBPA 5B10O 3FYFA 3NPOA 3P6FA 3CQRA 1VWBB 1JQPA 1X8QA 2IFBA 4YGZA 2E4JA 3B2KA 1FDQA 1KXOA 5D45A 3S26A 4ZFXA 5IO6A 2NP1A 2LA7A 2W2FA 1JJUA 3CQNA 3P6GA 4ZGFA 1DZPA 1LUQA 1SWQA 3P6DA 5AEOA 5LJHA 1YWDA 3NQ9A 1YWBA 3FW4A 1KZWA 1DF8A 2RQ0A 3G7XA 1MX8A 1N4JA 1I78A 4YCEA 3RZYA 3FR4A 1LDOA 2HZRA 1S7DA 2HNXA 1KZXA 3EM0A 4AZMA 2MM3A 3BU1A 1MDCA 2RTKA 3FDCA 3JQOA 2NNEA 2ALLX 1ZNGA 4YGHA 1IKJA 4MEEA 5DG4A 2OVAA 2JU7A 5HTEA 3VE1A 3VHHA 2FR3A 2RTJA 3VGWA 2PI3O 4CDCA 3STNA 2IZDB 4GGRA 2JOZA 3WZOA 5HAEA 4BX6B 4HFOA 3F9DA 2W2BA 3SOTA 4AZOA 2L5PA 4CPHB 1EIIA 1DFVA 1MEPA 4OS8A 2RN4A 4BX7B 4O4OA 1PM1X 2QO6A 1OBUA 2RTAA 1VWOB 3CMPA 5IRWA 1VYGA 1BEBA 1KL3A 2AVIA 1LCWA 3APUA 4IB7A 4L3RA 5K68A 5F2BA 1SA8A 4XMGA 4ORRA 1YP6A 3ZW2A 4BBOA 4ORXA 2L67A 1SXXA 2RTBB 1SWEA 4FGIB 1Y9LA 2IZIA 4ID2A 3ZUOA 3WJCA 3BDRA 2R56A 3O2YA 4CDFA 1GX3A 2MHDA 4YFPA 3ZQ3A 4M6SA 4YCHA 3P6EA 3VG5A 1YUPA 5B27A 3ELZA 3QQ2A 1ZNDA 2FTBA 3FELA 3FR5A 1P6PA 3FA6A 2OYBO 1I04A 3FMZA 3WJDA 1SWSA 3LTWA 5H9KA 2A13A 4ZHHA 4FQBB 3P02A 3U03A 4Y0QA 5BVSA 1CBIA 2RTMA 4BJ8A 3UEXA 4GDZA 4FBRA 1XKIA 1EXSA 5L8NA 4JO6A 1BSOA 1ACDA 1E5PA 3SLTA 4YBPA 2A8GA 5KHPA 1VWMB 2RD7C 1UYOX 2ZAIA 1TOWA 4YKMA 2WR6A 1ZRYA 5KIDA 5BVQA 3WVMA 1QQSA 4GE1A 2GTLO 2RTHB 4IB9A 4ES7A 2RTGB 4OELA 3APXA 1ZNLA 5B2AO 3WZNA 4BX5A 3EC5A 4ZR2A 3BX7A 2GJ5A 1SY2A 1VWGB 1QABE 2BC3A 2BHVA 2X8SA 1NP4A 1ALBA 2OL8O 2OF8A 4YH0A 5LJGA 3HOEA 4YFRA 4NNTA 2KT4B 4NYQA 1RSTB 1SRJA 4CDEA 1KL5A 1Z24A 2FR2A 2BT9A 4TKJA 2IZFB 2RCTA 3PDFA 1UYNX 2X45A 5HZ8A 3HTYA 1I9HA 5FQ7E 1VYFA 1G7NA 1HMTA 1K3BA 1MX7A 2IZCB 2XKLA 3HWFA 1AB0A 1EQDA 1OBPA 4KC8A 4QRLA 4XMCA 5AJBA 4B55A 2OVEA 3VG6A 1MK5A 1U0XA 1EALA 4NP1A 4Z2PA 1VWKB 1X8UA 2CBSA 5FFHA 3AKNA 4ON1A 3BY0A 3SLJA 1SXYA 4HPCA 3RDOA 1WUBA 4NW4A 4LZVA 1CBSA 4U8UO 4CPFA 4NV7A 1VWEB 5CE4A 3ZW1B 1FTPA 4KCAA 3C76X 5B3MO 2QMIA 3N91A 3WYQA 4D6AA 1I05A 4O9SA 2OY7A 2Y3EA 2CZTA 2IZAA 4GKCA 4A1YA 2LBAA 4QZUA 4ORYA 5FAZA 1JBHA 3SZJA 1ICNA 4AZNA 2LB6A 1SMPI 2QO5A 3FIQA 1L6MA 4OMWA 4EFGA 3I0AA 1G85A 1GT4A 5CSEA 3VG3A 2A0AA 5F58A 3AEHA 3Q34A 2RTPB 5D47A 1NP1A 2RTFB 4OMXA 3PH6A 2QO4A 1UREA 1BM5A 4ALOA 1X8OA 1N43A 1KT7A 4YKOA 3UAQA 1VWRB 4JGLA 3IFBA 3RKGA 2FLJA 4EKVA 5CHKA 1IW2A 1SY3A 2AT0X 4QGXA 2FHNX 5F7GA 4O4SA 4GRJA 3RDXA 1N0SA 1B4MA 3V8UA 2A5BA 1LICA 1LKEA 4Y59A 1NDJA 3EBWA 2HZQA 4INNA 1SRGA 4U3QA 5IRUA 3VG2A 5HZ6A 5K67A 4CV7A 2X34A 2FHLA 4AZPA 3APWA 5BYPA 4TKBA 1Y52X 1ADLA 3RBYA 4O3ZA 1DZKA 1VWPB 2IZLB 1HBQA 2Q4NA 1GT5A 3GE2A 3RE6A 3MM0A 4BVMA 1RXJA 2HKDA 1GKAB 3LV4A 1SREA 5HA1A 3RDQA 1S44A 2X56A 1E06A 1RXHA 4O3XB 3VPJE 4Z2OA 4OEMA 1EW3A 5L8OA 2FGSA 4GUZA 3NBXX 1FENA 4NLIA 3MG5A 1B56A 2CAMA 3D96A 2NNQA 2AMMX 3D9WA 5IO5A 1SY1A 2X46A 3EW2A 1SWUA 3WYPA 3FEPA 4WFVA 4BX6A 2WEXA 3FA9A 3FA8A 4CPHA 3B2IA 2WQ9A 4ZCBA 1PMPA 4R0BA 1KOIA 1SWFA 2AT3X 4I95A 3FENA 1GGLA 1GT3A 1MUPA 1SWNA 1ZNEA 2MWHA 4U46A 5IRAA 4AZRA 1NBXA 2KW1A 1SWKA 3Q6LA 4I60A 1E2TA 1HQQA 1OBQA 2NNDA 3PQSA 4TKHA 4IABA 4GJVA 5FQ8E 3CR6A 1U18A 4LQZA 4AZQA 4IMOA 3P24A 3PEDA 5AJCA 1XCAA 1Y53X 2ACPX 2RTDB 1LF7A 4ZH6A 3WOVA 4HPDA 4DQ4A 1BJ7A 5L8IA 2YG2A 3U0DA 3BRNA 2F01A 1LELA 1SWAA 4I9SA 1SWJA 1N9MA 1KQWA 1LNMA 3FIDA 4XMDA 5H8TA 4A1HA 2A5CA 1GXAA 2A2UA 3K3LA 4DQ3A 4GK9A 2GTLM 1TOUA 4GZVA 3PQUA 2DJFA 4IAXA 1IFBA 1JYJA 1BSQA 3D4RA 2X8TA 2WQAE 3FEKA 2RCQA 2QOSC 1A18A 2CM9A 2X8FA 4GU8A 3SZHA 1A2DA 3NR3A 5LJDA 3ZZVA 4TQ2A 5LJCA 3U9PC 5B5GA 1KT4A 4ARHA 4NYRA 1HN2A 1U17A 4BQUA 2Q2MA 2FWVA 3S5VA 4GDAA 1SLDB 5EEEA 3OE3A 5FENA 5IXGA 3WZPA 1SY0A 1RXKA 1HY2A 1KT6A 5EZ2A 2M4LA 1Y0GA 4C5PA 1KQXA 2ZSCA 4YVBA 1NQMA 2FRSA 2I5ZO 3EBKA 2GH7A 4Y0RA 1B8EA 3JS1A 1MOYA 4O4UA 3ZUIA 4MVLA 3ZW0B 3T6FA 2A2GA 2OFAA 4U8UM 4RUUA 2JN3A 3KQ0A 2MJIA 2HYSA 5H9LA 4GNYA 1DF3A 1LCVA 3T1DA 1IIUA 4A60A 2JW1A 1SXUA 3WJGA 5LKEA 5FQ6E 3TGCA 3VE2A 4QGWA 2BSZA 1HXZA 1LIEA 1H91A 1JYDA 1O8VA 5L3YA 4ALBA 2OY8A 2GTLN 2Y3FA 1AVGI 1GT1A 2F09A 3WZQA 1QFTA 1T68X 1VWHB 2W2AA 3PPTA 2OY5O 2OVDA 2C1QA 2IZEB 4I9RA 3ZW1A 1OSPO 2O62A 1T0VA 2Y32A 4Z27A 1LCZA 3FR2A 3OJYC 4HWMA 4QAEA 3RDMA 1MM9A 4FBVA 2Q9SA 4O4XA 2AT5X 4BX5B 2DJGA 3BSZE 4JNJA 2L9CA 3WJEA 3ZI8A 1D3SA 2OL7A 4KC7A 5C0NA 2RTRB 4LKPA 3VU1A 3RY2A 4A8ZA 1N7YA 1DV9A 2RTCB 4GD9A 2JGSA 3VG4A 4OKAA 4NNSA 4I3CA 2AL0X 4CPEA 2OY1O 4QQ1A 1YWAA 1SRHA 1JZUA 2UZ2A 1QFVA 3DTQA 1G5WA 1LDQA 1EPAA 3TGAA 4UU3A 1LIDA 4XMFA 3C78X 3E3CA 4ORWA 3KFIA 1SWCA 4U8UN 5H9NA 1PTSA 3RDSA 3RWXA 2Q2PA 1QY2A 2JU3A 1SRFA 4YBUA 1A57A 2ANSA 1EI5A 1VWNB 5D8JA 5F6BA 2OL6O 1DZJA 3FA7A 3FW5A 1BRPA 2KTSA 2WWPA 5DPQA 1STRB 3O19A 4O49A 4ODDA 2Z4IA 4QYPA 5F6ZA 3PK2A 4U9CA 2XSTA 1EIOA 1O1VA 1GKAA 4LZUA 2LFOA 1LIFA 5HBSA 2A3FX 5D48A 2VFCA 2FKJA 3RE5A 4TLJA 1KL4A 1RBPA 3UEWA 2BS5A 4LKTA 2G7BA 1VWDB 2IZGB 1AQBA 1PBYA 2AF5A 4NLJA 5HCEC 4ZJ0A 1SWRA 4WFUA 1D2UA 2WEWA 3VG7A 2ZAGA 2R73A 1VWLB 3D97A 2N93A 3BU9A 4Y5DA 5HCCC 1SXWA 2KD2A 5EDBA 1SWOA 1DZMA 1TVQA 1A3YA 2POAA 3BX8A 2JMBA 3DSZA 1HQPA 4GJSA 4QGVA 1VWJB 1ERXA 1S2PA 1X89A 2C4IA 1OEKA 3T2XA 4ZHCA 1SWTA 2OFMX 1JIWI 1ZNKA 3F8AA 2FT9A 4BX7A 4IAWA 3KFGA 1R0UA 3FLLA 1HMSA 2PY1A 1RSUB 1SRIA 2K23A 3GAQA 2X4MA 4IRWA 1VYOA 3AUMO 1EPBA 4N7CA 5HTDA 1KT3A 3B2LA 1SWDA 2CZUA 1LPJA 2X32A 4RUNA 2EU7X 1JJXA 1IFCA 3NADA 1G74A 1SLGB 3NQKA 5EDCA 1KFFA 2G8CO 3NX1A 1BRQA 4HPAA 1QG5A 1YWCA 2WSJA 2YMSA 3B2HA 1JV4A 3OD9A 4I6SA 4OS0A 4I3BA 2IZKA 2VFBA 3RSWA 2FS6A 3CKFA 3WJFA 2G5LA 2ASNX 4M7MA 3HWGA 2WPUA 4DNEA 2QM9A 5LKFA 3STMX 3CBCA 1SWPA 3P6CA 3PP6A 3SLOA 4ZGUA 2G79A 2K62A 3ELXA 4KT5A 4NV8A 1CJ5A 1CBRA 3AKMA 4IB8A 4QZTA 2AT6X 2LBVA 1E02A 1LIBA 2FS7A 3MX7A 4ORSA 1AVEA 5CYBA 5AQ6A 5K06A 3SAOA 3TZSA 1JJJA 1GM6A 1OEEA 2HMBA 3B2JA 3NQ3A 2IZJA 1BLRA 3HOLA 4BOEA 1CBQA 1STPA 4K19A 1FJ1E 2CBRA 3LHNA 4AW8A 3T6LA 5HCDC 3H3IA 3RDUA 2AH7X 1OPBA 2RTQB 2OFBA 2R74A 1E00A 1CRBA 1PBOA 2Z4HA 5EPQA 5IO7A 1FE3A 1SWHA 2RTNB 2DM5A 5B29A 3WJBA 3O22A 1QY0A 5HZQA 1W4TA 2C1SA 4O3WA 4ZH9A 4GGZA 4Z2VA 1TW4A 3SZIA 1WBIA 3NP1A 1KT5A 4ORUA 3CBSA 4YDAA 3VHIA 4Z6JA 3EMMA 1ML7A 3HK1A 3ZW0A 1X71A 2GC9A 1ZNHA 5HA0A 3CWKA 3D95A 2LKKA 3ZWEA 4EXZA 4CSBA 3QKGA 4FBOA 1Y55X 4ML7B 5JR8A 4YFQA 4QYNA 2F73A 4EDEA 4ZHGA 1VWFB 4YGGA 3EYCA 1VWQB 4UU2A 4MISA 2G78A 3C77X 1NGLA 4O3YA 4CPIA 1DC9A 2QOMA 1JMZA 1HMRA 2RTIB 4KIIA 4GETA 4KH8A 2IZHB 4HPBA 3PH5A 1NC9A 1B0OA 1YP7A 3UEUA 3VHMA 4GGTA 1YIVA 1RLBE 3L4RA 4XMEA 1W5RA 2RTEB 3S5XA 2BLGA 3HWEA 1X8PA 3BS2A 1HXLA 3T2WA 2UYWA
chains in the Genus database with same CATH topology
1SWEA 1SRFA 2IZIA 3MG5A 1VWNB 2CAMA 3EW2A 1STRB 1SWUA 3WYPA 1SLEB 3X00A 4BX6A 2RTOB 4CPHA 4Z28A 3PK2A 1SWFA 2RTLA 5IRAA 4U46A 4BX7A 1SWNA 3WZOA 5JD2A 1NBXA 2OF9A 1SWKA 1SWSA 4I60A 3RE5A 1HQQA 1KL4A 2RTMA 4GJVA 4BJ8A 1VWDB 2IZGB 4JO6A 2A8GA 1N9YA 1VWMB 1SWRA 1Y53X 2RTDB 1AVDA 1NQNA 1SWBA 3RY1A 2RTHB 1VWLB 2RTGB 2F01A 1LELA 4Y5DA 3WZNA 1SWAA 1VWCB 4BX5A 1SWJA 1N9MA 1SWOA 4GJSA 1VWGB 2BC3A 1VWJB 2A5CA 2C4IA 2OF8A 3T2XA 1SWTA 3EW1A 1VWAB 1RSTB 1SRJA 1RSUB 1SRIA 1KL5A 4IRWA 3SZHA 1VYOA 2IZFB 1SWDA 1I9HA 4JHQA 2IZCB 1VWIB 1SWLA 5B5GA 1IJ8A 5B5FA 1SWGA 1MK5A 4Z2PA 1VWKB 4GDAA 1SLDB 1SLGB 1KFFA 1RAVA 3WZPA 2IZBA 3RDOA 1RXKA 1HY2A 4BCSA 2IZKA 4CPFA 1VWEB 2G5LA 1SLFB 2WPUA 2ZSCA 4DNEA 4YVBA 1NQMA 1STSB 1SWPA 2QCBA 3WYQA 2GH7A 2MF6A 1MOYA 2Y3EA 2IZAA 3T6FA 2OFAA 3SZJA 1AVEA 1VWBB 1LCVA 5CSEA 2IZJA 2RTPB 1STPA 2RTFB 1HXZA 3T6LA 5L3YA 1LUQA 1SWQA 3RDUA 2RTQB 2OFBA 2Y3FA 3WZQA 1N43A 1DF8A 1VWHB 4EKVA 1VWRB 1SWHA 2RTNB 1N4JA 5CHKA 2C1QA 2IZEB 1LDOA 2C1SA 4Z2VA 4GGZA 3SZIA 2Y32A 4Z27A 1WBIA 1LCZA 2FHNX 2RTKA 3FDCA 3RDMA 3VHIA 4Z6JA 1MM9A 3RDXA 2A5BA 4Y59A 3VHHA 1NDJA 4BX5B 2RTJA 1SRGA 5IRUA 4JNJA 3VGWA 5K67A 1Y55X 2FHLA 2IZDB 4GGRA 2RTRB 1Y52X 1VWFB 1N7YA 3RY2A 4BX6B 2RTCB 1VWPB 4GD9A 1VWQB 2IZLB 2JGSA 4OKAA 3RE6A 4CPEA 4CPIA 3MM0A 4CPHB 1MEPA 1RXJA 2RTIB 4BX7B 1SREA 1SRHA 2IZHB 2UZ2A 2RTAA 3RDQA 1VWOB 1NC9A 5IRWA 1LDQA 1RXHA 3VHMA 4GGTA 4Z2OA 1KL3A 2AVIA 5K68A 1LCWA 2RTEB 1SWCA 5F2BA 1PTSA 4BBOA 3RDSA 1HXLA 3T2WA 2UYWA 2RTBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWE A;  1SRF A;  2IZI A;  3MG5 A;  1VWN B;  2CAM A;  3EW2 A;  1STR B;  1SWU A;  3WYP A;  1SLE B;  3X00 A;  4BX6 A;  2RTO B;  4CPH A;  4Z28 A;  3PK2 A;  1SWF A;  2RTL A;  5IRA A;  4U46 A;  4BX7 A;  1SWN A;  3WZO A;  5JD2 A;  1NBX A;  2OF9 A;  1SWK A;  1SWS A;  4I60 A;  3RE5 A;  1HQQ A;  1KL4 A;  2RTM A;  4GJV A;  4BJ8 A;  1VWD B;  2IZG B;  4JO6 A;  2A8G A;  1N9Y A;  1VWM B;  1SWR A;  1Y53 X;  2RTD B;  1AVD A;  1NQN A;  1SWB A;  3RY1 A;  2RTH B;  1VWL B;  2RTG B;  2F01 A;  1LEL A;  4Y5D A;  3WZN A;  1SWA A;  1VWC B;  4BX5 A;  1SWJ A;  1N9M A;  1SWO A;  4GJS A;  1VWG B;  2BC3 A;  1VWJ B;  2A5C A;  2C4I A;  2OF8 A;  3T2X A;  1SWT A;  3EW1 A;  1VWA B;  1RST B;  1SRJ A;  1RSU B;  1SRI A;  1KL5 A;  4IRW A;  3SZH A;  1VYO A;  2IZF B;  1SWD A;  1I9H A;  4JHQ A;  2IZC B;  1VWI B;  1SWL A;  5B5G A;  1IJ8 A;  5B5F A;  1SWG A;  1MK5 A;  4Z2P A;  1VWK B;  4GDA A;  1SLD B;  1SLG B;  1KFF A;  1RAV A;  3WZP A;  2IZB A;  3RDO A;  1RXK A;  1HY2 A;  4BCS A;  2IZK A;  4CPF A;  1VWE B;  2G5L A;  1SLF B;  2WPU A;  2ZSC A;  4DNE A;  4YVB A;  1NQM A;  1STS B;  1SWP A;  2QCB A;  3WYQ A;  2GH7 A;  2MF6 A;  1MOY A;  2Y3E A;  2IZA A;  3T6F A;  2OFA A;  3SZJ A;  1AVE A;  1VWB B;  1LCV A;  5CSE A;  2IZJ A;  2RTP B;  1STP A;  2RTF B;  1HXZ A;  3T6L A;  5L3Y A;  1LUQ A;  1SWQ A;  3RDU A;  2RTQ B;  2OFB A;  2Y3F A;  3WZQ A;  1N43 A;  1DF8 A;  1VWH B;  4EKV A;  1VWR B;  1SWH A;  2RTN B;  1N4J A;  5CHK A;  2C1Q A;  2IZE B;  1LDO A;  2C1S A;  4Z2V A;  4GGZ A;  3SZI A;  2Y32 A;  4Z27 A;  1WBI A;  1LCZ A;  2FHN X;  2RTK A;  3FDC A;  3RDM A;  3VHI A;  4Z6J A;  1MM9 A;  3RDX A;  2A5B A;  4Y59 A;  3VHH A;  1NDJ A;  4BX5 B;  2RTJ A;  1SRG A;  5IRU A;  4JNJ A;  3VGW A;  5K67 A;  1Y55 X;  2FHL A;  2IZD B;  4GGR A;  2RTR B;  1Y52 X;  1VWF B;  1N7Y A;  3RY2 A;  4BX6 B;  2RTC B;  1VWP B;  4GD9 A;  1VWQ B;  2IZL B;  2JGS A;  4OKA A;  3RE6 A;  4CPE A;  4CPI A;  3MM0 A;  4CPH B;  1MEP A;  1RXJ A;  2RTI B;  4BX7 B;  1SRE A;  1SRH A;  2IZH B;  2UZ2 A;  2RTA A;  3RDQ A;  1VWO B;  1NC9 A;  5IRW A;  1LDQ A;  1RXH A;  3VHM A;  4GGT A;  4Z2O A;  1KL3 A;  2AVI A;  5K68 A;  1LCW A;  2RTE B;  1SWC A;  5F2B A;  1PTS A;  4BBO A;  3RDS A;  1HXL A;  3T2W A;  2UYW A;  2RTB B; 
#chains in the Genus database with same CATH topology
 2KTD A;  1MVG A;  4TJZ A;  3CKG A;  3F6Z B;  2FKG A;  1OEJ A;  1GX9 A;  2BS6 A;  2JU8 A;  4WBK A;  5H9A A;  4OS3 A;  3WXQ A;  1BBP A;  4MVK A;  2CM4 A;  3PEC A;  1SLE B;  4MVE A;  3X00 A;  2ACO A;  2RTO B;  4Z28 A;  4PJ2 A;  4AYH A;  1GX8 A;  1LFO A;  4I3D A;  4COT A;  1AEL A;  2AKQ A;  2RTL A;  5F1E A;  5KIC A;  4WHI A;  2OZQ A;  3KFH A;  4L1N A;  1X8N A;  5JD2 A;  4Y0P A;  2AT8 X;  1TXL A;  2L68 A;  2OF9 A;  1EUO A;  3STK A;  1KGL A;  1BSY A;  4ZHD A;  3WBG A;  1W6F A;  4Y0S A;  2HLV A;  3KZA A;  4D6B A;  5LJE A;  2Q39 A;  4QNI A;  1N9Y A;  4YMY A;  1AVD A;  1NQN A;  1SWB A;  2MO5 A;  3RY1 A;  5HZ5 A;  5D4A A;  4PSQ A;  1UZ2 X;  4IB6 A;  1T8V A;  1VWC B;  3OBL A;  4GH7 A;  1BWY A;  1OPA A;  3KVN A;  4EEJ A;  3P6H A;  5LJB A;  4N7D A;  1PEE A;  3KFF A;  3HWD A;  4IBA A;  1K24 A;  3MBT A;  3EW1 A;  1VWA B;  4CK4 A;  1FEL A;  1VPR A;  4MIR A;  4YDB A;  5HWZ A;  2GTF X;  1ERB A;  3APV A;  4IMN A;  4TNN A;  1QY1 A;  5EED A;  3TGB A;  3UEV A;  3MVF A;  3I17 A;  3IA8 A;  3NX2 A;  4JHQ A;  4ZHF A;  1VWI B;  1FEM A;  1SWL A;  1IJ8 A;  5B5F A;  5HZ9 A;  2VDF A;  1SWG A;  4GNW A;  4XMH A;  5B11 O;  4CDD A;  2WUT A;  1ICM A;  2I5V O;  3JSQ A;  3S60 A;  2X55 A;  1QWD A;  4MVI A;  5LJK A;  1RAV A;  4EQA C;  3BLG A;  1I4U A;  2IZB A;  3HPE A;  4BCS A;  2RA6 A;  1Y9T A;  2P8G A;  5BVT A;  2OFR X;  3TF6 A;  1SLF B;  4DCB A;  4BGF A;  2OVS A;  1I06 A;  1STS B;  2QCB A;  1IKE A;  1O1U A;  1JMX A;  2MF6 A;  1HBP A;  5B10 O;  3FYF A;  3NPO A;  3P6F A;  3CQR A;  1VWB B;  1JQP A;  1X8Q A;  2IFB A;  4YGZ A;  2E4J A;  3B2K A;  1FDQ A;  1KXO A;  5D45 A;  3S26 A;  4ZFX A;  5IO6 A;  2NP1 A;  2LA7 A;  2W2F A;  1JJU A;  3CQN A;  3P6G A;  4ZGF A;  1DZP A;  1LUQ A;  1SWQ A;  3P6D A;  5AEO A;  5LJH A;  1YWD A;  3NQ9 A;  1YWB A;  3FW4 A;  1KZW A;  1DF8 A;  2RQ0 A;  3G7X A;  1MX8 A;  1N4J A;  1I78 A;  4YCE A;  3RZY A;  3FR4 A;  1LDO A;  2HZR A;  1S7D A;  2HNX A;  1KZX A;  3EM0 A;  4AZM A;  2MM3 A;  3BU1 A;  1MDC A;  2RTK A;  3FDC A;  3JQO A;  2NNE A;  2ALL X;  1ZNG A;  4YGH A;  1IKJ A;  4MEE A;  5DG4 A;  2OVA A;  2JU7 A;  5HTE A;  3VE1 A;  3VHH A;  2FR3 A;  2RTJ A;  3VGW A;  2PI3 O;  4CDC A;  3STN A;  2IZD B;  4GGR A;  2JOZ A;  3WZO A;  5HAE A;  4BX6 B;  4HFO A;  3F9D A;  2W2B A;  3SOT A;  4AZO A;  2L5P A;  4CPH B;  1EII A;  1DFV A;  1MEP A;  4OS8 A;  2RN4 A;  4BX7 B;  4O4O A;  1PM1 X;  2QO6 A;  1OBU A;  2RTA A;  1VWO B;  3CMP A;  5IRW A;  1VYG A;  1BEB A;  1KL3 A;  2AVI A;  1LCW A;  3APU A;  4IB7 A;  4L3R A;  5K68 A;  5F2B A;  1SA8 A;  4XMG A;  4ORR A;  1YP6 A;  3ZW2 A;  4BBO A;  4ORX A;  2L67 A;  1SXX A;  2RTB B;  1SWE A;  4FGI B;  1Y9L A;  2IZI A;  4ID2 A;  3ZUO A;  3WJC A;  3BDR A;  2R56 A;  3O2Y A;  4CDF A;  1GX3 A;  2MHD A;  4YFP A;  3ZQ3 A;  4M6S A;  4YCH A;  3P6E A;  3VG5 A;  1YUP A;  5B27 A;  3ELZ A;  3QQ2 A;  1ZND A;  2FTB A;  3FEL A;  3FR5 A;  1P6P A;  3FA6 A;  2OYB O;  1I04 A;  3FMZ A;  3WJD A;  1SWS A;  3LTW A;  5H9K A;  2A13 A;  4ZHH A;  4FQB B;  3P02 A;  3U03 A;  4Y0Q A;  5BVS A;  1CBI A;  2RTM A;  4BJ8 A;  3UEX A;  4GDZ A;  4FBR A;  1XKI A;  1EXS A;  5L8N A;  4JO6 A;  1BSO A;  1ACD A;  1E5P A;  3SLT A;  4YBP A;  2A8G A;  5KHP A;  1VWM B;  2RD7 C;  1UYO X;  2ZAI A;  1TOW A;  4YKM A;  2WR6 A;  1ZRY A;  5KID A;  5BVQ A;  3WVM A;  1QQS A;  4GE1 A;  2GTL O;  2RTH B;  4IB9 A;  4ES7 A;  2RTG B;  4OEL A;  3APX A;  1ZNL A;  5B2A O;  3WZN A;  4BX5 A;  3EC5 A;  4ZR2 A;  3BX7 A;  2GJ5 A;  1SY2 A;  1VWG B;  1QAB E;  2BC3 A;  2BHV A;  2X8S A;  1NP4 A;  1ALB A;  2OL8 O;  2OF8 A;  4YH0 A;  5LJG A;  3HOE A;  4YFR A;  4NNT A;  2KT4 B;  4NYQ A;  1RST B;  1SRJ A;  4CDE A;  1KL5 A;  1Z24 A;  2FR2 A;  2BT9 A;  4TKJ A;  2IZF B;  2RCT A;  3PDF A;  1UYN X;  2X45 A;  5HZ8 A;  3HTY A;  1I9H A;  5FQ7 E;  1VYF A;  1G7N A;  1HMT A;  1K3B A;  1MX7 A;  2IZC B;  2XKL A;  3HWF A;  1AB0 A;  1EQD A;  1OBP A;  4KC8 A;  4QRL A;  4XMC A;  5AJB A;  4B55 A;  2OVE A;  3VG6 A;  1MK5 A;  1U0X A;  1EAL A;  4NP1 A;  4Z2P A;  1VWK B;  1X8U A;  2CBS A;  5FFH A;  3AKN A;  4ON1 A;  3BY0 A;  3SLJ A;  1SXY A;  4HPC A;  3RDO A;  1WUB A;  4NW4 A;  4LZV A;  1CBS A;  4U8U O;  4CPF A;  4NV7 A;  1VWE B;  5CE4 A;  3ZW1 B;  1FTP A;  4KCA A;  3C76 X;  5B3M O;  2QMI A;  3N91 A;  3WYQ A;  4D6A A;  1I05 A;  4O9S A;  2OY7 A;  2Y3E A;  2CZT A;  2IZA A;  4GKC A;  4A1Y A;  2LBA A;  4QZU A;  4ORY A;  5FAZ A;  1JBH A;  3SZJ A;  1ICN A;  4AZN A;  2LB6 A;  1SMP I;  2QO5 A;  3FIQ A;  1L6M A;  4OMW A;  4EFG A;  3I0A A;  1G85 A;  1GT4 A;  5CSE A;  3VG3 A;  2A0A A;  5F58 A;  3AEH A;  3Q34 A;  2RTP B;  5D47 A;  1NP1 A;  2RTF B;  4OMX A;  3PH6 A;  2QO4 A;  1URE A;  1BM5 A;  4ALO A;  1X8O A;  1N43 A;  1KT7 A;  4YKO A;  3UAQ A;  1VWR B;  4JGL A;  3IFB A;  3RKG A;  2FLJ A;  4EKV A;  5CHK A;  1IW2 A;  1SY3 A;  2AT0 X;  4QGX A;  2FHN X;  5F7G A;  4O4S A;  4GRJ A;  3RDX A;  1N0S A;  1B4M A;  3V8U A;  2A5B A;  1LIC A;  1LKE A;  4Y59 A;  1NDJ A;  3EBW A;  2HZQ A;  4INN A;  1SRG A;  4U3Q A;  5IRU A;  3VG2 A;  5HZ6 A;  5K67 A;  4CV7 A;  2X34 A;  2FHL A;  4AZP A;  3APW A;  5BYP A;  4TKB A;  1Y52 X;  1ADL A;  3RBY A;  4O3Z A;  1DZK A;  1VWP B;  2IZL B;  1HBQ A;  2Q4N A;  1GT5 A;  3GE2 A;  3RE6 A;  3MM0 A;  4BVM A;  1RXJ A;  2HKD A;  1GKA B;  3LV4 A;  1SRE A;  5HA1 A;  3RDQ A;  1S44 A;  2X56 A;  1E06 A;  1RXH A;  4O3X B;  3VPJ E;  4Z2O A;  4OEM A;  1EW3 A;  5L8O A;  2FGS A;  4GUZ A;  3NBX X;  1FEN A;  4NLI A;  3MG5 A;  1B56 A;  2CAM A;  3D96 A;  2NNQ A;  2AMM X;  3D9W A;  5IO5 A;  1SY1 A;  2X46 A;  3EW2 A;  1SWU A;  3WYP A;  3FEP A;  4WFV A;  4BX6 A;  2WEX A;  3FA9 A;  3FA8 A;  4CPH A;  3B2I A;  2WQ9 A;  4ZCB A;  1PMP A;  4R0B A;  1KOI A;  1SWF A;  2AT3 X;  4I95 A;  3FEN A;  1GGL A;  1GT3 A;  1MUP A;  1SWN A;  1ZNE A;  2MWH A;  4U46 A;  5IRA A;  4AZR A;  1NBX A;  2KW1 A;  1SWK A;  3Q6L A;  4I60 A;  1E2T A;  1HQQ A;  1OBQ A;  2NND A;  3PQS A;  4TKH A;  4IAB A;  4GJV A;  5FQ8 E;  3CR6 A;  1U18 A;  4LQZ A;  4AZQ A;  4IMO A;  3P24 A;  3PED A;  5AJC A;  1XCA A;  1Y53 X;  2ACP X;  2RTD B;  1LF7 A;  4ZH6 A;  3WOV A;  4HPD A;  4DQ4 A;  1BJ7 A;  5L8I A;  2YG2 A;  3U0D A;  3BRN A;  2F01 A;  1LEL A;  1SWA A;  4I9S A;  1SWJ A;  1N9M A;  1KQW A;  1LNM A;  3FID A;  4XMD A;  5H8T A;  4A1H A;  2A5C A;  1GXA A;  2A2U A;  3K3L A;  4DQ3 A;  4GK9 A;  2GTL M;  1TOU A;  4GZV A;  3PQU A;  2DJF A;  4IAX A;  1IFB A;  1JYJ A;  1BSQ A;  3D4R A;  2X8T A;  2WQA E;  3FEK A;  2RCQ A;  2QOS C;  1A18 A;  2CM9 A;  2X8F A;  4GU8 A;  3SZH A;  1A2D A;  3NR3 A;  5LJD A;  3ZZV A;  4TQ2 A;  5LJC A;  3U9P C;  5B5G A;  1KT4 A;  4ARH A;  4NYR A;  1HN2 A;  1U17 A;  4BQU A;  2Q2M A;  2FWV A;  3S5V A;  4GDA A;  1SLD B;  5EEE A;  3OE3 A;  5FEN A;  5IXG A;  3WZP A;  1SY0 A;  1RXK A;  1HY2 A;  1KT6 A;  5EZ2 A;  2M4L A;  1Y0G A;  4C5P A;  1KQX A;  2ZSC A;  4YVB A;  1NQM A;  2FRS A;  2I5Z O;  3EBK A;  2GH7 A;  4Y0R A;  1B8E A;  3JS1 A;  1MOY A;  4O4U A;  3ZUI A;  4MVL A;  3ZW0 B;  3T6F A;  2A2G A;  2OFA A;  4U8U M;  4RUU A;  2JN3 A;  3KQ0 A;  2MJI A;  2HYS A;  5H9L A;  4GNY A;  1DF3 A;  1LCV A;  3T1D A;  1IIU A;  4A60 A;  2JW1 A;  1SXU A;  3WJG A;  5LKE A;  5FQ6 E;  3TGC A;  3VE2 A;  4QGW A;  2BSZ A;  1HXZ A;  1LIE A;  1H91 A;  1JYD A;  1O8V A;  5L3Y A;  4ALB A;  2OY8 A;  2GTL N;  2Y3F A;  1AVG I;  1GT1 A;  2F09 A;  3WZQ A;  1QFT A;  1T68 X;  1VWH B;  2W2A A;  3PPT A;  2OY5 O;  2OVD A;  2C1Q A;  2IZE B;  4I9R A;  3ZW1 A;  1OSP O;  2O62 A;  1T0V A;  2Y32 A;  4Z27 A;  1LCZ A;  3FR2 A;  3OJY C;  4HWM A;  4QAE A;  3RDM A;  1MM9 A;  4FBV A;  2Q9S A;  4O4X A;  2AT5 X;  4BX5 B;  2DJG A;  3BSZ E;  4JNJ A;  2L9C A;  3WJE A;  3ZI8 A;  1D3S A;  2OL7 A;  4KC7 A;  5C0N A;  2RTR B;  4LKP A;  3VU1 A;  3RY2 A;  4A8Z A;  1N7Y A;  1DV9 A;  2RTC B;  4GD9 A;  2JGS A;  3VG4 A;  4OKA A;  4NNS A;  4I3C A;  2AL0 X;  4CPE A;  2OY1 O;  4QQ1 A;  1YWA A;  1SRH A;  1JZU A;  2UZ2 A;  1QFV A;  3DTQ A;  1G5W A;  1LDQ A;  1EPA A;  3TGA A;  4UU3 A;  1LID A;  4XMF A;  3C78 X;  3E3C A;  4ORW A;  3KFI A;  1SWC A;  4U8U N;  5H9N A;  1PTS A;  3RDS A;  3RWX A;  2Q2P A;  1QY2 A;  2JU3 A;  1SRF A;  4YBU A;  1A57 A;  2ANS A;  1EI5 A;  1VWN B;  5D8J A;  5F6B A;  2OL6 O;  1DZJ A;  3FA7 A;  3FW5 A;  1BRP A;  2KTS A;  2WWP A;  5DPQ A;  1STR B;  3O19 A;  4O49 A;  4ODD A;  2Z4I A;  4QYP A;  5F6Z A;  3PK2 A;  4U9C A;  2XST A;  1EIO A;  1O1V A;  1GKA A;  4LZU A;  2LFO A;  1LIF A;  5HBS A;  2A3F X;  5D48 A;  2VFC A;  2FKJ A;  3RE5 A;  4TLJ A;  1KL4 A;  1RBP A;  3UEW A;  2BS5 A;  4LKT A;  2G7B A;  1VWD B;  2IZG B;  1AQB A;  1PBY A;  2AF5 A;  4NLJ A;  5HCE C;  4ZJ0 A;  1SWR A;  4WFU A;  1D2U A;  2WEW A;  3VG7 A;  2ZAG A;  2R73 A;  1VWL B;  3D97 A;  2N93 A;  3BU9 A;  4Y5D A;  5HCC C;  1SXW A;  2KD2 A;  5EDB A;  1SWO A;  1DZM A;  1TVQ A;  1A3Y A;  2POA A;  3BX8 A;  2JMB A;  3DSZ A;  1HQP A;  4GJS A;  4QGV A;  1VWJ B;  1ERX A;  1S2P A;  1X89 A;  2C4I A;  1OEK A;  3T2X A;  4ZHC A;  1SWT A;  2OFM X;  1JIW I;  1ZNK A;  3F8A A;  2FT9 A;  4BX7 A;  4IAW A;  3KFG A;  1R0U A;  3FLL A;  1HMS A;  2PY1 A;  1RSU B;  1SRI A;  2K23 A;  3GAQ A;  2X4M A;  4IRW A;  1VYO A;  3AUM O;  1EPB A;  4N7C A;  5HTD A;  1KT3 A;  3B2L A;  1SWD A;  2CZU A;  1LPJ A;  2X32 A;  4RUN A;  2EU7 X;  1JJX A;  1IFC A;  3NAD A;  1G74 A;  1SLG B;  3NQK A;  5EDC A;  1KFF A;  2G8C O;  3NX1 A;  1BRQ A;  4HPA A;  1QG5 A;  1YWC A;  2WSJ A;  2YMS A;  3B2H A;  1JV4 A;  3OD9 A;  4I6S A;  4OS0 A;  4I3B A;  2IZK A;  2VFB A;  3RSW A;  2FS6 A;  3CKF A;  3WJF A;  2G5L A;  2ASN X;  4M7M A;  3HWG A;  2WPU A;  4DNE A;  2QM9 A;  5LKF A;  3STM X;  3CBC A;  1SWP A;  3P6C A;  3PP6 A;  3SLO A;  4ZGU A;  2G79 A;  2K62 A;  3ELX A;  4KT5 A;  4NV8 A;  1CJ5 A;  1CBR A;  3AKM A;  4IB8 A;  4QZT A;  2AT6 X;  2LBV A;  1E02 A;  1LIB A;  2FS7 A;  3MX7 A;  4ORS A;  1AVE A;  5CYB A;  5AQ6 A;  5K06 A;  3SAO A;  3TZS A;  1JJJ A;  1GM6 A;  1OEE A;  2HMB A;  3B2J A;  3NQ3 A;  2IZJ A;  1BLR A;  3HOL A;  4BOE A;  1CBQ A;  1STP A;  4K19 A;  1FJ1 E;  2CBR A;  3LHN A;  4AW8 A;  3T6L A;  5HCD C;  3H3I A;  3RDU A;  2AH7 X;  1OPB A;  2RTQ B;  2OFB A;  2R74 A;  1E00 A;  1CRB A;  1PBO A;  2Z4H A;  5EPQ A;  5IO7 A;  1FE3 A;  1SWH A;  2RTN B;  2DM5 A;  5B29 A;  3WJB A;  3O22 A;  1QY0 A;  5HZQ A;  1W4T A;  2C1S A;  4O3W A;  4ZH9 A;  4GGZ A;  4Z2V A;  1TW4 A;  3SZI A;  1WBI A;  3NP1 A;  1KT5 A;  4ORU A;  3CBS A;  4YDA A;  3VHI A;  4Z6J A;  3EMM A;  1ML7 A;  3HK1 A;  3ZW0 A;  1X71 A;  2GC9 A;  1ZNH A;  5HA0 A;  3CWK A;  3D95 A;  2LKK A;  3ZWE A;  4EXZ A;  4CSB A;  3QKG A;  4FBO A;  1Y55 X;  4ML7 B;  5JR8 A;  4YFQ A;  4QYN A;  2F73 A;  4EDE A;  4ZHG A;  1VWF B;  4YGG A;  3EYC A;  1VWQ B;  4UU2 A;  4MIS A;  2G78 A;  3C77 X;  1NGL A;  4O3Y A;  4CPI A;  1DC9 A;  2QOM A;  1JMZ A;  1HMR A;  2RTI B;  4KII A;  4GET A;  4KH8 A;  2IZH B;  4HPB A;  3PH5 A;  1NC9 A;  1B0O A;  1YP7 A;  3UEU A;  3VHM A;  4GGT A;  1YIV A;  1RLB E;  3L4R A;  4XME A;  1W5R A;  2RTE B;  3S5X A;  2BLG A;  3HWE A;  1X8P A;  3BS2 A;  1HXL A;  3T2W A;  2UYW A; 
#chains in the Genus database with same CATH homology
 1SWE A;  1SRF A;  2IZI A;  3MG5 A;  1VWN B;  2CAM A;  3EW2 A;  1STR B;  1SWU A;  3WYP A;  1SLE B;  3X00 A;  4BX6 A;  2RTO B;  4CPH A;  4Z28 A;  3PK2 A;  1SWF A;  2RTL A;  5IRA A;  4U46 A;  4BX7 A;  1SWN A;  3WZO A;  5JD2 A;  1NBX A;  2OF9 A;  1SWK A;  1SWS A;  4I60 A;  3RE5 A;  1HQQ A;  1KL4 A;  2RTM A;  4GJV A;  4BJ8 A;  1VWD B;  2IZG B;  4JO6 A;  2A8G A;  1N9Y A;  1VWM B;  1SWR A;  1Y53 X;  2RTD B;  1AVD A;  1NQN A;  1SWB A;  3RY1 A;  2RTH B;  1VWL B;  2RTG B;  2F01 A;  1LEL A;  4Y5D A;  3WZN A;  1SWA A;  1VWC B;  4BX5 A;  1SWJ A;  1N9M A;  1SWO A;  4GJS A;  1VWG B;  2BC3 A;  1VWJ B;  2A5C A;  2C4I A;  2OF8 A;  3T2X A;  1SWT A;  3EW1 A;  1VWA B;  1RST B;  1SRJ A;  1RSU B;  1SRI A;  1KL5 A;  4IRW A;  3SZH A;  1VYO A;  2IZF B;  1SWD A;  1I9H A;  4JHQ A;  2IZC B;  1VWI B;  1SWL A;  5B5G A;  1IJ8 A;  5B5F A;  1SWG A;  1MK5 A;  4Z2P A;  1VWK B;  4GDA A;  1SLD B;  1SLG B;  1KFF A;  1RAV A;  3WZP A;  2IZB A;  3RDO A;  1RXK A;  1HY2 A;  4BCS A;  2IZK A;  4CPF A;  1VWE B;  2G5L A;  1SLF B;  2WPU A;  2ZSC A;  4DNE A;  4YVB A;  1NQM A;  1STS B;  1SWP A;  2QCB A;  3WYQ A;  2GH7 A;  2MF6 A;  1MOY A;  2Y3E A;  2IZA A;  3T6F A;  2OFA A;  3SZJ A;  1AVE A;  1VWB B;  1LCV A;  5CSE A;  2IZJ A;  2RTP B;  1STP A;  2RTF B;  1HXZ A;  3T6L A;  5L3Y A;  1LUQ A;  1SWQ A;  3RDU A;  2RTQ B;  2OFB A;  2Y3F A;  3WZQ A;  1N43 A;  1DF8 A;  1VWH B;  4EKV A;  1VWR B;  1SWH A;  2RTN B;  1N4J A;  5CHK A;  2C1Q A;  2IZE B;  1LDO A;  2C1S A;  4Z2V A;  4GGZ A;  3SZI A;  2Y32 A;  4Z27 A;  1WBI A;  1LCZ A;  2FHN X;  2RTK A;  3FDC A;  3RDM A;  3VHI A;  4Z6J A;  1MM9 A;  3RDX A;  2A5B A;  4Y59 A;  3VHH A;  1NDJ A;  4BX5 B;  2RTJ A;  1SRG A;  5IRU A;  4JNJ A;  3VGW A;  5K67 A;  1Y55 X;  2FHL A;  2IZD B;  4GGR A;  2RTR B;  1Y52 X;  1VWF B;  1N7Y A;  3RY2 A;  4BX6 B;  2RTC B;  1VWP B;  4GD9 A;  1VWQ B;  2IZL B;  2JGS A;  4OKA A;  3RE6 A;  4CPE A;  4CPI A;  3MM0 A;  4CPH B;  1MEP A;  1RXJ A;  2RTI B;  4BX7 B;  1SRE A;  1SRH A;  2IZH B;  2UZ2 A;  2RTA A;  3RDQ A;  1VWO B;  1NC9 A;  5IRW A;  1LDQ A;  1RXH A;  3VHM A;  4GGT A;  4Z2O A;  1KL3 A;  2AVI A;  5K68 A;  1LCW A;  2RTE B;  1SWC A;  5F2B A;  1PTS A;  4BBO A;  3RDS A;  1HXL A;  3T2W A;  2UYW A;  2RTB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...