2OFNA

Solution structure of fk506-binding domain (fkbd)of fkbp35 from plasmodium falciparum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
135
structure length
135
Chain Sequence
MTTEQEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 70 kDa peptidylprolyl isomerase, putative
publication title Solution structure of FK506 binding domain (FKBD) of Plasmodium falciparum FK506 binding protein 35 (PfFKBP35).
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 17
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ofnA01
4W9OA 4G2PA 5HUAA 1QPFA 2XP7A 3KAFA 5HWCA 3UI5A 5HW7A 5HW6A 4DRJA 4TW6A 1FKGA 2AWGA 4ODKA 5DITA 2XP5A 1JNTA 5HTGA 2DG3A 5HWBA 1J4RA 3KADA 1Y0OA 2Y78A 2ZR6A 1Q1CA 2M2AA 3KAHA 4NNRA 4TX0A 4DRPA 1FKHA 1Q6UA 3GPKA 4R0XA 1B6CA 3O5IA 2LGOA 2ZQTA 3IK8A 4DROA 3EY6A 1Q6HA 4DRQA 4DRHA 2F4EA 2RUDA 3O5LA 4W9QA 2XP8A 5DIUA 2F21A 3KAIA 1BKFA 2MLXA 3KZ7A 3O5EA 3O5JA 4GGQA 4IQ2A 4TW7A 3RGCA 1L1PA 5HW8A 1EYMA 1ROUA 1KT0A 1D7HA 2MNTA 4GIVA 3TC5A 2PV1A 1NMVA 1TCOC 1FD9A 3KABA 2PPOA 4MGVA 4DH0A 1FKRA 1T11A 3KACA 1YW5A 2VCDA 2LKNA 3PRBA 1ZCNA 2Q5AA 1J6YA 3H9RB 2PBCA 4W9PA 3I6CA 2FKEA 4N19A 1J4HA 2ZQUA 3LUOA 1PINA 5HT1A 3JYMA 2KR7A 4JYSA 2FAPA 1ROTA 2RSEA 3O5RA 3WH0A 5DIVA 1FKKA 3UQAA 1W26A 4LAWA 2DG4A 4ODPA 1N1AA 1U79A 3UI4A 1FKIA 1JVWA 2ZQVA 2ZR5A 3O5MA 4J4NA 3NI6A 3B7XA 1C9HA 2KGJA 2K8IA 4IQCA 2DG9A 2XP4A 3PA7A 4G50A 3RFWA 1F40A 3JYJA 1JNSA 1NMWA 2N87A 3TCZA 4DZ2A 3UQBA 1HXVA 1EQ3A 1R9HA 4JFKA 4BF8A 3PRDA 1FAPA 4ODLA 4J4OA 2XP6A 2D9FA 2PPPA 4U85A 2RURA 4O2TA 4TW8A 1P5QA 2IF4A 2PV3A 4QT2A 2MPHA 3O5OA 4DIPA 2KFWA 4ODQA 2KO7A 5I98A 3OOBA 1KT1A 1ZK6A 2F2DA 5BXJA 2LPVA 4JFJA 5J6EA 4JFMA 2MLYA 4JFIA 2JZVA 1FKLA 2XP9A 3UF8A 4U84A 3O5GA 1QPLA 3UQIA 3CGNA 4LAYA 4ODRA 4ODOA 2UZ5A 2ZQSA 4QT3A 3O5PA 5GPGA 4DZ3A 4U86A 4C02B 2RUCA 2MF9A 3ODKA 1D7JA 1D6OA 1QZ2A 3IKGA 2LJ4A 3KAGA 3JXVA 3TDBA 1YATA 1BL4A 4MSPA 2RQSA 3CGMA 4DRKA 1FKSA 1J4IA 1FKJA 4FAPA 4LAVA 1M5YA 1FKTA 5HKGA 2PV2A 2M1IA 3IKDA 1FKDA 3FAPA 3MDYB 3O5DA 1FKBA 2ITKA 3NTPA 2XP3A 2KE0A 1D7IA 4ODNA 4TNSA 4DT4A 3NRKA 3KCEA 3O5KA 4FN2A 4ODMA 5D75A 2M08A 1PBKA 4ITZA 3O5QA 4DRIA 2PPNA 1NSGA 1F8AB 2KI3A 2VN1A 5B8IC 4IPXA 4LAXA 3VAWA 4DRMA 2MLZA 2ZR4A 1Q6IA 2L2SA 3UI6A 1FJDA 2RUQA 3IHZA 3O5FA 4QIBA 4TYOA 4DRNA 1A7XA 2OFNA 2XPAA 4JFLA 2XPBA 1FKFA
chains in the Genus database with same CATH superfamily
1ZL1A 3AROA 2XP7A 3KAFA 3WD2A 5HW7A 5HW6A 4KQZA 4ODKA 5HTGA 1FFQA 3KADA 4P8XA 5DF0A 4NNRA 4MTVA 3FY1A 3IK8A 3CHFA 1UR8A 2XP8A 1ZBWA 3RM8A 3RGCA 1L1PA 5HW8A 2O9OA 3TC5A 4DH0A 2PV1A 3KABA 1FKRA 4MGVA 3KACA 1YW5A 2AOSA 4P8WA 3W4RA 2A3BA 1W1VA 5GPRA 2DT2A 3LUOA 4JYSA 2FAPA 2QF8A 2RSEA 1FKKA 1W26A 4LAWA 4ODPA 1N1AA 2DSVA 4J4NA 2ZR5A 4NZCA 3NI6A 1HKJA 3B7XA 2K8IA 1WB0A 3PA7A 4DWSB 3JYJA 1NMWA 3RM4A 4JFKA 4BF8A 3B9AA 1XHGA 1NH6A 4O2TA 4TW8A 1P5QA 1HKKA 2MPHA 2PI6A 1KT1A 5J6EA 4JFMA 1ZU8A 4JFIA 1OGGA 4U84A 1GPFA 3CGNA 4DZ3A 3QOKA 3O5PA 3BMBA 3ODKA 3G6MA 1D6OA 1QZ2A 2DT1A 4MPKA 3KAGA 4W5UA 3TDBA 1UR9A 4MNKA 3MDYB 2ETNA 2XP3A 4Z2IA 4ODNA 4DT4A 4L72B 4ODMA 3ARUA 4Z2LA 4Z2KA 2M08A 4ITZA 4DRIA 2PPNA 2VN1A 1F8AB 2B31A 4QIBA 4JFLA 5HUAA 1QPFA 1CTNA 5HWCA 3UI5A 1O6IA 1FKGA 5HWBA 4P8UA 3BXWA 4NSBA 1Q1CA 2M2AA 1IX5A 4TX0A 1E15A 1FKHA 4QZVB 1E6NA 5DEZA 1X6LA 1B6CA 4R0XA 3WD3A 3EY6A 4DRQA 3ARZA 4DRHA 1HJVA 2F4EA 3O5LA 2ESCA 3B8SA 4WK9A 3O5EA 2WLZA 4IQ2A 4GGQA 4TW7A 1EYMA 4MAVA 1W9PA 4GIVA 4DWSA 1T11A 1NWRA 2LKNA 3PRBA 1ZCNA 3ARTA 3H9RB 4WKAA 2FKEA 4N19A 4Z2GA 1LL6A 1K9TA 1WNOA 1ROTA 3RMEA 1JNDA 2EULA 3UQAA 1JCHB 1JVWA 1C9HA 2KGJA 4G50A 2XP4A 1LG2A 3TCZA 4DZ2A 2A3CA 1HKIA 1EQ3A 3ARVA 3PRDA 1FAPA 4ODLA 2DSUA 2XP6A 1GUVA 1X6NA 2PPPA 1E44A 2IF4A 2PV3A 3AS1A 1NWSA 4ODQA 3WKZA 3OOBA 3ARRA 2XP9A 1D2KA 3UQIA 1KFWA 5GPGA 2UZ5A 2ZQSA 4QT3A 4U86A 1ZBCA 1YATA 3AS3A 3ARXA 4LAVA 1M5YA 1FKDA 4TNSA 3NRKA 1RD6A 2F23A 3KCEA 4HARA 5D75A 4DWSC 4KR0B 3VAWA 4DRMA 1Q6IA 2L2SA 4ML4A 2RUQA 3IHZA 1WAWA 3ALFA 4ZPWR 2DSZA 4UDMA 2XPBA 4DROA 4W9OA 3ALGA 4MNJA 4TW6A 5DITA 2AWGA 2XP5A 1JNTA 2DG3A 1J4RA 1Y0OA 2ZR6A 3KAHA 4P8VA 4WIWA 3WL1A 1W9UA 2YBUA 3O5IA 2LGOA 1LG1A 1W9VA 3PR9A 5GQBA 5DIUA 2G41A 2F21A 1NWTA 3AS0A 1D7HA 1KT0A 1ROUA 2WLYA 3OA5A 1NMVA 1TCOC 1FD9A 4ZPTR 3RM9A 3AQUA 1J6YA 4W9PA 3B9DA 2P4VA 2ZQUA 1E6RA 3JYMA 1SR0A 1ZBKA 1H0IA 3CHEA 2DG4A 1GRJA 1LQ0A 1U79A 2WM0A 1FKIA 3UI4A 1SYTA 1HKMA 1W1TA 2IUZA 2DPEA 3ARYA 3UQBA 1EHNA 2D9FA 3EIPA 4MNLA 4PTMA 1ZB5A 4QT2A 1ITXA 2DSWA 4DIPA 2KFWA 4DWSD 5BXJA 2LPVA 4JFJA 2MLYA 3UF8A 3O5GA 1QPLA 4LAYA 4ODOA 4C02B 2RUCA 1W1YA 3IKGA 3CHDA 1E6ZA 4MSPA 1ZBVA 4AY1A 4FAPA 2G8ZA 1FKTA 3WIJA 3IKDA 2WK2A 3O5DA 3NTPA 1D7IA 4R5EA 4URIA 3ARWA 4FN2A 4Q22A 1VF8A 4ZS6A 3AS2A 2ZR4A 3UI6A 4ZPVR 3O5FA 4TYOA 4DRNA 3WL0A 1A7XA 1E9LA 2XPAA 3CH9A 1OGBA 3GU0A 1FKFA 4G2PA 3FXYA 4DRJA 2A3EA 3ARSA 1H0GA 2Y78A 4WKHA 4DRPA 4IT4A 1TFVA 1Q6UA 3GPKA 3WD4A 1EIBA 2ZQTA 4LGXA 1Q6HA 2RUDA 4W9QA 2B5UB 3GTYX 3KAIA 1BKFA 2MLXA 3KZ7A 3O5JA 4IT6A 1GOIA 3ARQA 2MNTA 2PPOA 1XRVA 2VCDA 2Q5AA 1FFRA 2PBCA 3I6CA 1J4HA 1LJYA 1OWQA 5HT1A 1PINA 3B9EA 2KR7A 3O5RA 4L3NA 5DIVA 4WJXA 3WH0A 2ZQVA 1LL4A 3O5MA 4MNMA 4IQCA 2DT3A 2DG9A 4Q7NA 1LL7A 4WKFA 1HJXA 3RFWA 1F40A 4XAKA 1JNSA 1HJWA 2N87A 1HXVA 1R9HA 3PRAA 4J4OA 2YBTA 3CZ8A 2RURA 4U85A 3WD1A 4Z2HA 4S3KA 3O5OA 4HBEA 2KO7A 5I98A 5JH8A 2F2DA 1ZK6A 2FDMA 1NWUA 5DO2A 2OLHA 2JZVA 1FKLA 3ARPA 4ODRA 3CHCA 2PN0A 2MF9A 1D7JA 2LJ4A 3JXVA 2O92A 1BL4A 4DRKA 2RQSA 3CGMA 1FKSA 1J4IA 1FKJA 1JNEA 4S3JA 3WQVA 1W1PA 2A3AA 2PV2A 2M1IA 5HKGA 3FAPA 2DT0A 1FKBA 2ITKA 3WD0A 2KE0A 4HBOA 3O5KA 4Z2JA 1PBKA 3O5QA 5HBFA 1NSGA 5B8IC 2KI3A 1E6PA 4IPXA 4LAXA 3WQWA 2MLZA 1FJDA 1EDQA 2OFNA 3G6LA
chains in the Genus database with same CATH topology
1ZL1A 3AROA 2XP7A 3KAFA 3WD2A 5HW7A 5HW6A 4KQZA 4ODKA 5HTGA 1FFQA 3KADA 4P8XA 5DF0A 4NNRA 4MTVA 3FY1A 3IK8A 3CHFA 1UR8A 2XP8A 1ZBWA 3RM8A 3RGCA 1L1PA 5HW8A 2O9OA 3TC5A 4DH0A 2PV1A 3KABA 1FKRA 4MGVA 3KACA 1YW5A 2AOSA 4P8WA 3W4RA 2A3BA 1W1VA 5GPRA 2DT2A 3LUOA 4JYSA 2FAPA 2QF8A 2RSEA 1FKKA 1W26A 4LAWA 4ODPA 1N1AA 2DSVA 4J4NA 2ZR5A 4NZCA 3NI6A 1HKJA 3B7XA 2K8IA 1WB0A 3PA7A 4DWSB 3JYJA 1NMWA 3RM4A 4JFKA 4BF8A 3B9AA 1XHGA 1NH6A 4O2TA 4TW8A 1P5QA 1HKKA 2MPHA 2PI6A 1KT1A 5J6EA 4JFMA 1ZU8A 4JFIA 1OGGA 4U84A 1GPFA 3CGNA 4DZ3A 3QOKA 3O5PA 3ODKA 3G6MA 1D6OA 1QZ2A 2DT1A 4MPKA 3KAGA 4W5UA 3TDBA 1UR9A 4MNKA 3MDYB 2XP3A 4Z2IA 4ODNA 4DT4A 4L72B 4ODMA 3ARUA 4Z2LA 4Z2KA 2M08A 4ITZA 4DRIA 2PPNA 2VN1A 1F8AB 2B31A 4QIBA 4JFLA 5HUAA 1QPFA 1CTNA 5HWCA 3UI5A 1O6IA 1FKGA 5HWBA 4P8UA 3BXWA 4NSBA 1Q1CA 2M2AA 1IX5A 4TX0A 1E15A 1FKHA 4QZVB 1E6NA 5DEZA 1X6LA 1B6CA 4R0XA 3WD3A 3EY6A 4DRQA 3ARZA 4DRHA 1HJVA 2F4EA 3O5LA 2ESCA 3B8SA 4WK9A 3O5EA 2WLZA 4IQ2A 4GGQA 4TW7A 1EYMA 4MAVA 1W9PA 4GIVA 4DWSA 1T11A 1NWRA 2LKNA 3PRBA 1ZCNA 3ARTA 3H9RB 4WKAA 2FKEA 4N19A 4Z2GA 1LL6A 1K9TA 1WNOA 1ROTA 3RMEA 1JNDA 3UQAA 1JVWA 1C9HA 2KGJA 4G50A 2XP4A 1LG2A 3TCZA 4DZ2A 2A3CA 1HKIA 1EQ3A 3ARVA 3PRDA 1FAPA 4ODLA 2DSUA 2XP6A 1GUVA 1X6NA 2PPPA 2IF4A 2PV3A 3AS1A 1NWSA 4ODQA 3WKZA 3OOBA 3ARRA 2XP9A 1D2KA 3UQIA 1KFWA 5GPGA 2UZ5A 2ZQSA 4QT3A 4U86A 1ZBCA 1YATA 3AS3A 3ARXA 4LAVA 1M5YA 1FKDA 4TNSA 3NRKA 1RD6A 3KCEA 4HARA 5D75A 4DWSC 4KR0B 3VAWA 4DRMA 1Q6IA 2L2SA 4ML4A 2RUQA 3IHZA 1WAWA 3ALFA 4ZPWR 2DSZA 2XPBA 4DROA 4W9OA 3ALGA 4MNJA 4TW6A 5DITA 2AWGA 2XP5A 1JNTA 2DG3A 1J4RA 1Y0OA 2ZR6A 3KAHA 4P8VA 4WIWA 3WL1A 1W9UA 2YBUA 3O5IA 2LGOA 1LG1A 1W9VA 3PR9A 5GQBA 5DIUA 2G41A 2F21A 1NWTA 3AS0A 1D7HA 1KT0A 1ROUA 2WLYA 3OA5A 1NMVA 1TCOC 1FD9A 4ZPTR 3RM9A 3AQUA 1J6YA 4W9PA 3B9DA 2ZQUA 1E6RA 3JYMA 1SR0A 1ZBKA 1H0IA 3CHEA 2DG4A 2WM0A 1LQ0A 1U79A 3UI4A 1FKIA 1SYTA 1HKMA 1W1TA 2IUZA 2DPEA 3ARYA 3UQBA 1EHNA 2D9FA 4MNLA 4PTMA 1ZB5A 4QT2A 1ITXA 2DSWA 4DIPA 2KFWA 4DWSD 5BXJA 2LPVA 4JFJA 2MLYA 3UF8A 3O5GA 1QPLA 4LAYA 4ODOA 4C02B 2RUCA 1W1YA 3IKGA 3CHDA 1E6ZA 4MSPA 1ZBVA 4AY1A 4FAPA 2G8ZA 1FKTA 3WIJA 3IKDA 3O5DA 2WK2A 3NTPA 1D7IA 4R5EA 4URIA 3ARWA 4FN2A 4Q22A 1VF8A 4ZS6A 3AS2A 2ZR4A 3UI6A 4ZPVR 3O5FA 4TYOA 4DRNA 3WL0A 1A7XA 1E9LA 2XPAA 3CH9A 1OGBA 1FKFA 4G2PA 3FXYA 4DRJA 2A3EA 3ARSA 1H0GA 2Y78A 4WKHA 4DRPA 4IT4A 1TFVA 1Q6UA 3GPKA 3WD4A 1EIBA 2ZQTA 4LGXA 1Q6HA 2RUDA 4W9QA 3KAIA 1BKFA 2MLXA 3KZ7A 3O5JA 4IT6A 1GOIA 3ARQA 2MNTA 2PPOA 1XRVA 2VCDA 2Q5AA 1FFRA 2PBCA 3I6CA 1J4HA 1LJYA 1OWQA 5HT1A 1PINA 3B9EA 2KR7A 3O5RA 4L3NA 5DIVA 4WJXA 3WH0A 2ZQVA 1LL4A 3O5MA 4MNMA 4IQCA 2DT3A 2DG9A 4Q7NA 1LL7A 4WKFA 1HJXA 3RFWA 1F40A 4XAKA 1JNSA 1HJWA 2N87A 1HXVA 1R9HA 3PRAA 4J4OA 2YBTA 3CZ8A 2RURA 4U85A 3WD1A 4Z2HA 4S3KA 3O5OA 4HBEA 2KO7A 5I98A 5JH8A 2F2DA 1ZK6A 2FDMA 1NWUA 5DO2A 2OLHA 2JZVA 1FKLA 3ARPA 4ODRA 3CHCA 2MF9A 1D7JA 2LJ4A 3JXVA 2O92A 1BL4A 4DRKA 2RQSA 3CGMA 1FKSA 1J4IA 1FKJA 1JNEA 4S3JA 3WQVA 1W1PA 2A3AA 2PV2A 2M1IA 5HKGA 3FAPA 2DT0A 1FKBA 2ITKA 3WD0A 2KE0A 4HBOA 3O5KA 4Z2JA 1PBKA 3O5QA 5HBFA 1NSGA 5B8IC 2KI3A 1E6PA 4IPXA 4LAXA 3WQWA 2MLZA 1FJDA 1EDQA 2OFNA 3G6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9O A;  4G2P A;  5HUA A;  1QPF A;  2XP7 A;  3KAF A;  5HWC A;  3UI5 A;  5HW7 A;  5HW6 A;  4DRJ A;  4TW6 A;  1FKG A;  2AWG A;  4ODK A;  5DIT A;  2XP5 A;  1JNT A;  5HTG A;  2DG3 A;  5HWB A;  1J4R A;  3KAD A;  1Y0O A;  2Y78 A;  2ZR6 A;  1Q1C A;  2M2A A;  3KAH A;  4NNR A;  4TX0 A;  4DRP A;  1FKH A;  1Q6U A;  3GPK A;  4R0X A;  1B6C A;  3O5I A;  2LGO A;  2ZQT A;  3IK8 A;  4DRO A;  3EY6 A;  1Q6H A;  4DRQ A;  4DRH A;  2F4E A;  2RUD A;  3O5L A;  4W9Q A;  2XP8 A;  5DIU A;  2F21 A;  3KAI A;  1BKF A;  2MLX A;  3KZ7 A;  3O5E A;  3O5J A;  4GGQ A;  4IQ2 A;  4TW7 A;  3RGC A;  1L1P A;  5HW8 A;  1EYM A;  1ROU A;  1KT0 A;  1D7H A;  2MNT A;  4GIV A;  3TC5 A;  2PV1 A;  1NMV A;  1TCO C;  1FD9 A;  3KAB A;  2PPO A;  4MGV A;  4DH0 A;  1FKR A;  1T11 A;  3KAC A;  1YW5 A;  2VCD A;  2LKN A;  3PRB A;  1ZCN A;  2Q5A A;  1J6Y A;  3H9R B;  2PBC A;  4W9P A;  3I6C A;  2FKE A;  4N19 A;  1J4H A;  2ZQU A;  3LUO A;  1PIN A;  5HT1 A;  3JYM A;  2KR7 A;  4JYS A;  2FAP A;  1ROT A;  2RSE A;  3O5R A;  3WH0 A;  5DIV A;  1FKK A;  3UQA A;  1W26 A;  4LAW A;  2DG4 A;  4ODP A;  1N1A A;  1U79 A;  3UI4 A;  1FKI A;  1JVW A;  2ZQV A;  2ZR5 A;  3O5M A;  4J4N A;  3NI6 A;  3B7X A;  1C9H A;  2KGJ A;  2K8I A;  4IQC A;  2DG9 A;  2XP4 A;  3PA7 A;  4G50 A;  3RFW A;  1F40 A;  3JYJ A;  1JNS A;  1NMW A;  2N87 A;  3TCZ A;  4DZ2 A;  3UQB A;  1HXV A;  1EQ3 A;  1R9H A;  4JFK A;  4BF8 A;  3PRD A;  1FAP A;  4ODL A;  4J4O A;  2XP6 A;  2D9F A;  2PPP A;  4U85 A;  2RUR A;  4O2T A;  4TW8 A;  1P5Q A;  2IF4 A;  2PV3 A;  4QT2 A;  2MPH A;  3O5O A;  4DIP A;  2KFW A;  4ODQ A;  2KO7 A;  5I98 A;  3OOB A;  1KT1 A;  1ZK6 A;  2F2D A;  5BXJ A;  2LPV A;  4JFJ A;  5J6E A;  4JFM A;  2MLY A;  4JFI A;  2JZV A;  1FKL A;  2XP9 A;  3UF8 A;  4U84 A;  3O5G A;  1QPL A;  3UQI A;  3CGN A;  4LAY A;  4ODR A;  4ODO A;  2UZ5 A;  2ZQS A;  4QT3 A;  3O5P A;  5GPG A;  4DZ3 A;  4U86 A;  4C02 B;  2RUC A;  2MF9 A;  3ODK A;  1D7J A;  1D6O A;  1QZ2 A;  3IKG A;  2LJ4 A;  3KAG A;  3JXV A;  3TDB A;  1YAT A;  1BL4 A;  4MSP A;  2RQS A;  3CGM A;  4DRK A;  1FKS A;  1J4I A;  1FKJ A;  4FAP A;  4LAV A;  1M5Y A;  1FKT A;  5HKG A;  2PV2 A;  2M1I A;  3IKD A;  1FKD A;  3FAP A;  3MDY B;  3O5D A;  1FKB A;  2ITK A;  3NTP A;  2XP3 A;  2KE0 A;  1D7I A;  4ODN A;  4TNS A;  4DT4 A;  3NRK A;  3KCE A;  3O5K A;  4FN2 A;  4ODM A;  5D75 A;  2M08 A;  1PBK A;  4ITZ A;  3O5Q A;  4DRI A;  2PPN A;  1NSG A;  1F8A B;  2KI3 A;  2VN1 A;  5B8I C;  4IPX A;  4LAX A;  3VAW A;  4DRM A;  2MLZ A;  2ZR4 A;  1Q6I A;  2L2S A;  3UI6 A;  1FJD A;  2RUQ A;  3IHZ A;  3O5F A;  4QIB A;  4TYO A;  4DRN A;  1A7X A;  2OFN A;  2XPA A;  4JFL A;  2XPB A;  1FKF A; 
#chains in the Genus database with same CATH topology
 1ZL1 A;  3ARO A;  2XP7 A;  3KAF A;  3WD2 A;  5HW7 A;  5HW6 A;  4KQZ A;  4ODK A;  5HTG A;  1FFQ A;  3KAD A;  4P8X A;  5DF0 A;  4NNR A;  4MTV A;  3FY1 A;  3IK8 A;  3CHF A;  1UR8 A;  2XP8 A;  1ZBW A;  3RM8 A;  3RGC A;  1L1P A;  5HW8 A;  2O9O A;  3TC5 A;  4DH0 A;  2PV1 A;  3KAB A;  1FKR A;  4MGV A;  3KAC A;  1YW5 A;  2AOS A;  4P8W A;  3W4R A;  2A3B A;  1W1V A;  5GPR A;  2DT2 A;  3LUO A;  4JYS A;  2FAP A;  2QF8 A;  2RSE A;  1FKK A;  1W26 A;  4LAW A;  4ODP A;  1N1A A;  2DSV A;  4J4N A;  2ZR5 A;  4NZC A;  3NI6 A;  1HKJ A;  3B7X A;  2K8I A;  1WB0 A;  3PA7 A;  4DWS B;  3JYJ A;  1NMW A;  3RM4 A;  4JFK A;  4BF8 A;  3B9A A;  1XHG A;  1NH6 A;  4O2T A;  4TW8 A;  1P5Q A;  1HKK A;  2MPH A;  2PI6 A;  1KT1 A;  5J6E A;  4JFM A;  1ZU8 A;  4JFI A;  1OGG A;  4U84 A;  1GPF A;  3CGN A;  4DZ3 A;  3QOK A;  3O5P A;  3BMB A;  3ODK A;  3G6M A;  1D6O A;  1QZ2 A;  2DT1 A;  4MPK A;  3KAG A;  4W5U A;  3TDB A;  1UR9 A;  4MNK A;  3MDY B;  2ETN A;  2XP3 A;  4Z2I A;  4ODN A;  4DT4 A;  4L72 B;  4ODM A;  3ARU A;  4Z2L A;  4Z2K A;  2M08 A;  4ITZ A;  4DRI A;  2PPN A;  2VN1 A;  1F8A B;  2B31 A;  4QIB A;  4JFL A;  5HUA A;  1QPF A;  1CTN A;  5HWC A;  3UI5 A;  1O6I A;  1FKG A;  5HWB A;  4P8U A;  3BXW A;  4NSB A;  1Q1C A;  2M2A A;  1IX5 A;  4TX0 A;  1E15 A;  1FKH A;  4QZV B;  1E6N A;  5DEZ A;  1X6L A;  1B6C A;  4R0X A;  3WD3 A;  3EY6 A;  4DRQ A;  3ARZ A;  4DRH A;  1HJV A;  2F4E A;  3O5L A;  2ESC A;  3B8S A;  4WK9 A;  3O5E A;  2WLZ A;  4IQ2 A;  4GGQ A;  4TW7 A;  1EYM A;  4MAV A;  1W9P A;  4GIV A;  4DWS A;  1T11 A;  1NWR A;  2LKN A;  3PRB A;  1ZCN A;  3ART A;  3H9R B;  4WKA A;  2FKE A;  4N19 A;  4Z2G A;  1LL6 A;  1K9T A;  1WNO A;  1ROT A;  3RME A;  1JND A;  2EUL A;  3UQA A;  1JCH B;  1JVW A;  1C9H A;  2KGJ A;  4G50 A;  2XP4 A;  1LG2 A;  3TCZ A;  4DZ2 A;  2A3C A;  1HKI A;  1EQ3 A;  3ARV A;  3PRD A;  1FAP A;  4ODL A;  2DSU A;  2XP6 A;  1GUV A;  1X6N A;  2PPP A;  1E44 A;  2IF4 A;  2PV3 A;  3AS1 A;  1NWS A;  4ODQ A;  3WKZ A;  3OOB A;  3ARR A;  2XP9 A;  1D2K A;  3UQI A;  1KFW A;  5GPG A;  2UZ5 A;  2ZQS A;  4QT3 A;  4U86 A;  1ZBC A;  1YAT A;  3AS3 A;  3ARX A;  4LAV A;  1M5Y A;  1FKD A;  4TNS A;  3NRK A;  1RD6 A;  2F23 A;  3KCE A;  4HAR A;  5D75 A;  4DWS C;  4KR0 B;  3VAW A;  4DRM A;  1Q6I A;  2L2S A;  4ML4 A;  2RUQ A;  3IHZ A;  1WAW A;  3ALF A;  4ZPW R;  2DSZ A;  4UDM A;  2XPB A;  4DRO A;  4W9O A;  3ALG A;  4MNJ A;  4TW6 A;  5DIT A;  2AWG A;  2XP5 A;  1JNT A;  2DG3 A;  1J4R A;  1Y0O A;  2ZR6 A;  3KAH A;  4P8V A;  4WIW A;  3WL1 A;  1W9U A;  2YBU A;  3O5I A;  2LGO A;  1LG1 A;  1W9V A;  3PR9 A;  5GQB A;  5DIU A;  2G41 A;  2F21 A;  1NWT A;  3AS0 A;  1D7H A;  1KT0 A;  1ROU A;  2WLY A;  3OA5 A;  1NMV A;  1TCO C;  1FD9 A;  4ZPT R;  3RM9 A;  3AQU A;  1J6Y A;  4W9P A;  3B9D A;  2P4V A;  2ZQU A;  1E6R A;  3JYM A;  1SR0 A;  1ZBK A;  1H0I A;  3CHE A;  2DG4 A;  1GRJ A;  1LQ0 A;  1U79 A;  2WM0 A;  1FKI A;  3UI4 A;  1SYT A;  1HKM A;  1W1T A;  2IUZ A;  2DPE A;  3ARY A;  3UQB A;  1EHN A;  2D9F A;  3EIP A;  4MNL A;  4PTM A;  1ZB5 A;  4QT2 A;  1ITX A;  2DSW A;  4DIP A;  2KFW A;  4DWS D;  5BXJ A;  2LPV A;  4JFJ A;  2MLY A;  3UF8 A;  3O5G A;  1QPL A;  4LAY A;  4ODO A;  4C02 B;  2RUC A;  1W1Y A;  3IKG A;  3CHD A;  1E6Z A;  4MSP A;  1ZBV A;  4AY1 A;  4FAP A;  2G8Z A;  1FKT A;  3WIJ A;  3IKD A;  2WK2 A;  3O5D A;  3NTP A;  1D7I A;  4R5E A;  4URI A;  3ARW A;  4FN2 A;  4Q22 A;  1VF8 A;  4ZS6 A;  3AS2 A;  2ZR4 A;  3UI6 A;  4ZPV R;  3O5F A;  4TYO A;  4DRN A;  3WL0 A;  1A7X A;  1E9L A;  2XPA A;  3CH9 A;  1OGB A;  3GU0 A;  1FKF A;  4G2P A;  3FXY A;  4DRJ A;  2A3E A;  3ARS A;  1H0G A;  2Y78 A;  4WKH A;  4DRP A;  4IT4 A;  1TFV A;  1Q6U A;  3GPK A;  3WD4 A;  1EIB A;  2ZQT A;  4LGX A;  1Q6H A;  2RUD A;  4W9Q A;  2B5U B;  3GTY X;  3KAI A;  1BKF A;  2MLX A;  3KZ7 A;  3O5J A;  4IT6 A;  1GOI A;  3ARQ A;  2MNT A;  2PPO A;  1XRV A;  2VCD A;  2Q5A A;  1FFR A;  2PBC A;  3I6C A;  1J4H A;  1LJY A;  1OWQ A;  5HT1 A;  1PIN A;  3B9E A;  2KR7 A;  3O5R A;  4L3N A;  5DIV A;  4WJX A;  3WH0 A;  2ZQV A;  1LL4 A;  3O5M A;  4MNM A;  4IQC A;  2DT3 A;  2DG9 A;  4Q7N A;  1LL7 A;  4WKF A;  1HJX A;  3RFW A;  1F40 A;  4XAK A;  1JNS A;  1HJW A;  2N87 A;  1HXV A;  1R9H A;  3PRA A;  4J4O A;  2YBT A;  3CZ8 A;  2RUR A;  4U85 A;  3WD1 A;  4Z2H A;  4S3K A;  3O5O A;  4HBE A;  2KO7 A;  5I98 A;  5JH8 A;  2F2D A;  1ZK6 A;  2FDM A;  1NWU A;  5DO2 A;  2OLH A;  2JZV A;  1FKL A;  3ARP A;  4ODR A;  3CHC A;  2PN0 A;  2MF9 A;  1D7J A;  2LJ4 A;  3JXV A;  2O92 A;  1BL4 A;  4DRK A;  2RQS A;  3CGM A;  1FKS A;  1J4I A;  1FKJ A;  1JNE A;  4S3J A;  3WQV A;  1W1P A;  2A3A A;  2PV2 A;  2M1I A;  5HKG A;  3FAP A;  2DT0 A;  1FKB A;  2ITK A;  3WD0 A;  2KE0 A;  4HBO A;  3O5K A;  4Z2J A;  1PBK A;  3O5Q A;  5HBF A;  1NSG A;  5B8I C;  2KI3 A;  1E6P A;  4IPX A;  4LAX A;  3WQW A;  2MLZ A;  1FJD A;  1EDQ A;  2OFN A;  3G6L A; 
#chains in the Genus database with same CATH homology
 1ZL1 A;  3ARO A;  2XP7 A;  3KAF A;  3WD2 A;  5HW7 A;  5HW6 A;  4KQZ A;  4ODK A;  5HTG A;  1FFQ A;  3KAD A;  4P8X A;  5DF0 A;  4NNR A;  4MTV A;  3FY1 A;  3IK8 A;  3CHF A;  1UR8 A;  2XP8 A;  1ZBW A;  3RM8 A;  3RGC A;  1L1P A;  5HW8 A;  2O9O A;  3TC5 A;  4DH0 A;  2PV1 A;  3KAB A;  1FKR A;  4MGV A;  3KAC A;  1YW5 A;  2AOS A;  4P8W A;  3W4R A;  2A3B A;  1W1V A;  5GPR A;  2DT2 A;  3LUO A;  4JYS A;  2FAP A;  2QF8 A;  2RSE A;  1FKK A;  1W26 A;  4LAW A;  4ODP A;  1N1A A;  2DSV A;  4J4N A;  2ZR5 A;  4NZC A;  3NI6 A;  1HKJ A;  3B7X A;  2K8I A;  1WB0 A;  3PA7 A;  4DWS B;  3JYJ A;  1NMW A;  3RM4 A;  4JFK A;  4BF8 A;  3B9A A;  1XHG A;  1NH6 A;  4O2T A;  4TW8 A;  1P5Q A;  1HKK A;  2MPH A;  2PI6 A;  1KT1 A;  5J6E A;  4JFM A;  1ZU8 A;  4JFI A;  1OGG A;  4U84 A;  1GPF A;  3CGN A;  4DZ3 A;  3QOK A;  3O5P A;  3ODK A;  3G6M A;  1D6O A;  1QZ2 A;  2DT1 A;  4MPK A;  3KAG A;  4W5U A;  3TDB A;  1UR9 A;  4MNK A;  3MDY B;  2XP3 A;  4Z2I A;  4ODN A;  4DT4 A;  4L72 B;  4ODM A;  3ARU A;  4Z2L A;  4Z2K A;  2M08 A;  4ITZ A;  4DRI A;  2PPN A;  2VN1 A;  1F8A B;  2B31 A;  4QIB A;  4JFL A;  5HUA A;  1QPF A;  1CTN A;  5HWC A;  3UI5 A;  1O6I A;  1FKG A;  5HWB A;  4P8U A;  3BXW A;  4NSB A;  1Q1C A;  2M2A A;  1IX5 A;  4TX0 A;  1E15 A;  1FKH A;  4QZV B;  1E6N A;  5DEZ A;  1X6L A;  1B6C A;  4R0X A;  3WD3 A;  3EY6 A;  4DRQ A;  3ARZ A;  4DRH A;  1HJV A;  2F4E A;  3O5L A;  2ESC A;  3B8S A;  4WK9 A;  3O5E A;  2WLZ A;  4IQ2 A;  4GGQ A;  4TW7 A;  1EYM A;  4MAV A;  1W9P A;  4GIV A;  4DWS A;  1T11 A;  1NWR A;  2LKN A;  3PRB A;  1ZCN A;  3ART A;  3H9R B;  4WKA A;  2FKE A;  4N19 A;  4Z2G A;  1LL6 A;  1K9T A;  1WNO A;  1ROT A;  3RME A;  1JND A;  3UQA A;  1JVW A;  1C9H A;  2KGJ A;  4G50 A;  2XP4 A;  1LG2 A;  3TCZ A;  4DZ2 A;  2A3C A;  1HKI A;  1EQ3 A;  3ARV A;  3PRD A;  1FAP A;  4ODL A;  2DSU A;  2XP6 A;  1GUV A;  1X6N A;  2PPP A;  2IF4 A;  2PV3 A;  3AS1 A;  1NWS A;  4ODQ A;  3WKZ A;  3OOB A;  3ARR A;  2XP9 A;  1D2K A;  3UQI A;  1KFW A;  5GPG A;  2UZ5 A;  2ZQS A;  4QT3 A;  4U86 A;  1ZBC A;  1YAT A;  3AS3 A;  3ARX A;  4LAV A;  1M5Y A;  1FKD A;  4TNS A;  3NRK A;  1RD6 A;  3KCE A;  4HAR A;  5D75 A;  4DWS C;  4KR0 B;  3VAW A;  4DRM A;  1Q6I A;  2L2S A;  4ML4 A;  2RUQ A;  3IHZ A;  1WAW A;  3ALF A;  4ZPW R;  2DSZ A;  2XPB A;  4DRO A;  4W9O A;  3ALG A;  4MNJ A;  4TW6 A;  5DIT A;  2AWG A;  2XP5 A;  1JNT A;  2DG3 A;  1J4R A;  1Y0O A;  2ZR6 A;  3KAH A;  4P8V A;  4WIW A;  3WL1 A;  1W9U A;  2YBU A;  3O5I A;  2LGO A;  1LG1 A;  1W9V A;  3PR9 A;  5GQB A;  5DIU A;  2G41 A;  2F21 A;  1NWT A;  3AS0 A;  1D7H A;  1KT0 A;  1ROU A;  2WLY A;  3OA5 A;  1NMV A;  1TCO C;  1FD9 A;  4ZPT R;  3RM9 A;  3AQU A;  1J6Y A;  4W9P A;  3B9D A;  2ZQU A;  1E6R A;  3JYM A;  1SR0 A;  1ZBK A;  1H0I A;  3CHE A;  2DG4 A;  2WM0 A;  1LQ0 A;  1U79 A;  3UI4 A;  1FKI A;  1SYT A;  1HKM A;  1W1T A;  2IUZ A;  2DPE A;  3ARY A;  3UQB A;  1EHN A;  2D9F A;  4MNL A;  4PTM A;  1ZB5 A;  4QT2 A;  1ITX A;  2DSW A;  4DIP A;  2KFW A;  4DWS D;  5BXJ A;  2LPV A;  4JFJ A;  2MLY A;  3UF8 A;  3O5G A;  1QPL A;  4LAY A;  4ODO A;  4C02 B;  2RUC A;  1W1Y A;  3IKG A;  3CHD A;  1E6Z A;  4MSP A;  1ZBV A;  4AY1 A;  4FAP A;  2G8Z A;  1FKT A;  3WIJ A;  3IKD A;  3O5D A;  2WK2 A;  3NTP A;  1D7I A;  4R5E A;  4URI A;  3ARW A;  4FN2 A;  4Q22 A;  1VF8 A;  4ZS6 A;  3AS2 A;  2ZR4 A;  3UI6 A;  4ZPV R;  3O5F A;  4TYO A;  4DRN A;  3WL0 A;  1A7X A;  1E9L A;  2XPA A;  3CH9 A;  1OGB A;  1FKF A;  4G2P A;  3FXY A;  4DRJ A;  2A3E A;  3ARS A;  1H0G A;  2Y78 A;  4WKH A;  4DRP A;  4IT4 A;  1TFV A;  1Q6U A;  3GPK A;  3WD4 A;  1EIB A;  2ZQT A;  4LGX A;  1Q6H A;  2RUD A;  4W9Q A;  3KAI A;  1BKF A;  2MLX A;  3KZ7 A;  3O5J A;  4IT6 A;  1GOI A;  3ARQ A;  2MNT A;  2PPO A;  1XRV A;  2VCD A;  2Q5A A;  1FFR A;  2PBC A;  3I6C A;  1J4H A;  1LJY A;  1OWQ A;  5HT1 A;  1PIN A;  3B9E A;  2KR7 A;  3O5R A;  4L3N A;  5DIV A;  4WJX A;  3WH0 A;  2ZQV A;  1LL4 A;  3O5M A;  4MNM A;  4IQC A;  2DT3 A;  2DG9 A;  4Q7N A;  1LL7 A;  4WKF A;  1HJX A;  3RFW A;  1F40 A;  4XAK A;  1JNS A;  1HJW A;  2N87 A;  1HXV A;  1R9H A;  3PRA A;  4J4O A;  2YBT A;  3CZ8 A;  2RUR A;  4U85 A;  3WD1 A;  4Z2H A;  4S3K A;  3O5O A;  4HBE A;  2KO7 A;  5I98 A;  5JH8 A;  2F2D A;  1ZK6 A;  2FDM A;  1NWU A;  5DO2 A;  2OLH A;  2JZV A;  1FKL A;  3ARP A;  4ODR A;  3CHC A;  2MF9 A;  1D7J A;  2LJ4 A;  3JXV A;  2O92 A;  1BL4 A;  4DRK A;  2RQS A;  3CGM A;  1FKS A;  1J4I A;  1FKJ A;  1JNE A;  4S3J A;  3WQV A;  1W1P A;  2A3A A;  2PV2 A;  2M1I A;  5HKG A;  3FAP A;  2DT0 A;  1FKB A;  2ITK A;  3WD0 A;  2KE0 A;  4HBO A;  3O5K A;  4Z2J A;  1PBK A;  3O5Q A;  5HBF A;  1NSG A;  5B8I C;  2KI3 A;  1E6P A;  4IPX A;  4LAX A;  3WQW A;  2MLZ A;  1FJD A;  1EDQ A;  2OFN A;  3G6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...