2OFNA

Solution structure of fk506-binding domain (fkbd)of fkbp35 from plasmodium falciparum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
135
structure length
135
Chain Sequence
MTTEQEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FK506 binding domain (FKBD) of Plasmodium falciparum FK506 binding protein 35 (PfFKBP35).
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords 70 kDa peptidylprolyl isomerase, putative
total genus 17
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ofnA01
4JFMA 3KCEA 1B6CA 2VN1A 4ODRA 1KT1A 2RUQA 2F2DA 4GIVA 4QT2A 2M1IA 1JNSA 5DIVA 3PRBA 4JFIA 4FAPA 2DG9A 3O5PA 1QPFA 5HT1A 2ZR4A 5HKGA 3UI5A 1EYMA 4W9QA 3WH0A 1FKTA 3JYMA 3KAFA 1FD9A 2XPAA 4DRKA 2LGOA 3IK8A 1Y0OA 1P5QA 3O5JA 1EQ3A 1FKSA 3IHZA 1ROTA 4R0XA 3KABA 3KACA 4W9PA 2MF9A 4QT3A 3FAPA 4DRHA 3EY6A 4ODMA 3TC5A 4DT4A 2XP6A 1F40A 5I98A 1NSGA 1Q6HA 4TW7A 1J4IA 2DG3A 4DIPA 4DH0A 1R9HA 4ODNA 1ZK6A 4QIBA 4DRQA 4U86A 1FKIA 4IQCA 3O5FA 4DZ2A 1NMWA 2MLZA 1C9HA 3MDYB 3O5GA 3CGNA 1N1AA 1D7JA 2PV1A 3IKGA 1BKFA 1HXVA 2KGJA 2ZR5A 1JVWA 4J4OA 2FAPA 4G2PA 4ODLA 4TNSA 1PBKA 3O5MA 4JFJA 1M5YA 4C02B 4DROA 5HUAA 4J4NA 3TDBA 2MNTA 2PV3A 2KE0A 4IPXA 1T11A 2F4EA 2VCDA 2XP9A 1PINA 2AWGA 2XP3A 3GPKA 3O5LA 2N87A 4ITZA 4DRNA 3UQBA 3O5OA 1A7XA 1QPLA 4DRMA 3KADA 4ODPA 3LUOA 2XPBA 3UI4A 2PV2A 3NTPA 4DRJA 4DRIA 3O5QA 1FKDA 2XP7A 3CGMA 2DG4A 4LAYA 4BF8A 3O5EA 3RGCA 2M2AA 5BXJA 3KAGA 3NI6A 1D7IA 1U79A 1TCOC 4FN2A 3JXVA 5HW8A 1F8AB 2KR7A 2Q5AA 3O5RA 4LAXA 1ZCNA 4ODOA 3VAWA 4MGVA 4TW6A 1FKLA 1L1PA 2KO7A 2ZQUA 5HW6A 5HW7A 2PPPA 2ZQSA 4LAVA 1FKFA 2F21A 3OOBA 4DRPA 1D6OA 5HWBA 1FKRA 1FKHA 3PA7A 1J4RA 2ITKA 1ROUA 5B8IC 2ZQTA 3JYJA 4U85A 2LJ4A 4MSPA 2FKEA 4W9OA 3O5DA 2L2SA 1FAPA 5DIUA 5HTGA 1FJDA 2IF4A 2RQSA 2RSEA 3UF8A 1FKKA 2JZVA 2XP5A 2MLXA 2Y78A 2PPNA 3I6CA 3UQAA 1Q1CA 2LPVA 4TX0A 2UZ5A 1J6YA 5GPGA 2RURA 1NMVA 3IKDA 2OFNA 2PBCA 4LAWA 4TYOA 2XP8A 3PRDA 4JFKA 3B7XA 1BL4A 4N19A 2K8IA 2M08A 4NNRA 1Q6IA 2ZQVA 3UQIA 3NRKA 2RUDA 5D75A 1J4HA 1JNTA 5DITA 2PPOA 2MLYA 4IQ2A 4JYSA 3H9RB 4JFLA 3KAHA 1KT0A 1D7HA 1Q6UA 3O5KA 2ZR6A 2MPHA 1QZ2A 3ODKA 1FKBA 2LKNA 4ODQA 3UI6A 4G50A 1FKJA 1W26A 5HWCA 4U84A 2D9FA 2RUCA 2XP4A 4O2TA 1YATA 1FKGA 2KI3A 3KZ7A 4TW8A 4GGQA 2KFWA 1YW5A 4ODKA 3O5IA 3KAIA 3RFWA 4DZ3A 5J6EA 3TCZA
chains in the Genus database with same CATH superfamily
1NWSA 2VN1A 2F2DA 2YBTA 3PRBA 1K9TA 4DWSC 1ZB5A 2IUZA 5GPRA 3WKZA 1OGBA 3ALGA 4W9QA 1FKTA 3JYMA 3KAFA 1FD9A 3O5JA 1EQ3A 3AQUA 1HKKA 3FAPA 4DRHA 4DIPA 2DG3A 4MNMA 4Z2IA 4U86A 1FKIA 4ZS6A 4HBEA 1D7JA 2KGJA 3RMEA 4G2PA 4ODLA 4TNSA 1PBKA 4JFJA 2AOSA 1UR9A 2PV3A 1T11A 2XP9A 1LG1A 2N87A 4DRMA 4MTVA 1HKJA 4L3NA 3GTYX 2XP7A 2M2AA 3NI6A 4IT4A 3JXVA 1E6RA 1HJWA 3QOKA 4ODOA 3VAWA 4MGVA 1W1VA 4WK9A 1W9UA 1EHNA 1W9PA 2F21A 3OOBA 1D6OA 1FKRA 1ROUA 2O92A 1LL4A 2ZQTA 4MSPA 2FKEA 1FAPA 3PRAA 1GUVA 2RQSA 1FKKA 4L72B 2MLXA 2PPNA 2LPVA 4AY1A 1J6YA 1LJYA 3WQVA 3IKDA 4LAWA 1ZBCA 2DSWA 4NNRA 2M08A 2DT2A 2A3AA 2PPOA 4WIWA 4Z2GA 4NSBA 1KFWA 2ZR6A 2MPHA 3ARVA 4P8XA 4G50A 4P8WA 4TW8A 5HW7A 1FKGA 2KI3A 3KZ7A 3RFWA 2KFWA 1YW5A 1TFVA 3O5IA 4P8UA 4JFMA 1B6CA 4ODRA 4DWSA 1CTNA 1KT1A 1JNSA 4QZVB 3RM8A 4JFIA 1UR8A 5HT1A 1HKIA 5HKGA 1GRJA 1EYMA 3WH0A 3BXWA 3B9DA 4DRKA 1E44A 1Y0OA 1IX5A 3IHZA 2O9OA 2WM0A 2YBUA 4R0XA 3KABA 1O6IA 4DT4A 1NWUA 1J4IA 3WL0A 4QIBA 4IQCA 3O5GA 1N1AA 1HXVA 4J4OA 3G6LA 4Z2LA 4C02B 5HUAA 4WJXA 1E9LA 2MNTA 3AS2A 4ITZA 2AWGA 3GPKA 3O5LA 4MNLA 4DRNA 1QPLA 1JNEA 3ARZA 4URIA 4ML4A 2QF8A 2WLZA 1FKDA 4DWSD 2DG4A 2P4VA 3RM4A 4HARA 3RGCA 5BXJA 3KAGA 1D7IA 4S3JA 3AROA 3ARUA 2DT1A 3ARSA 3CHCA 4LGXA 2KO7A 2ZQUA 1ITXA 2DSUA 1H0GA 4DRPA 4IT6A 3PA7A 1J4RA 3WL1A 5DO2A 3JYJA 4U85A 2LJ4A 3O5DA 5HTGA 1FJDA 3B9EA 4Z2KA 4HBOA 4ZPWR 1HJXA 2OFNA 3ARTA 2XP8A 3B7XA 4Q22A 1NWTA 2K8IA 3UQIA 2RUDA 1J4HA 1JNTA 2MLYA 1OGGA 3H9RB 3KAHA 3O5KA 1QZ2A 4ODQA 1WB0A 1FKJA 4U84A 4DRQA 2XP4A 1YATA 4DZ3A 4ODKA 5J6EA 3TCZA 4KR0B 2RUQA 4GIVA 3CH9A 4QT2A 2M1IA 5GQBA 4FAPA 2A3CA 3O5PA 2ZR4A 3OA5A 2A3EA 2XPAA 2LGOA 1SYTA 1P5QA 1ZBWA 5I98A 4TW7A 1FFRA 1R9HA 1H0IA 1W1TA 4W5UA 1ZU8A 4DZ2A 1NMWA 2MLZA 1C9HA 3MDYB 3CGNA 1W9VA 1LG2A 2PV1A 1GOIA 2ZR5A 3WIJA 2FAPA 5DF0A 5HBFA 3B8SA 4MNKA 4DWSB 1NWRA 4J4NA 3CHDA 3ARRA 3TDBA 2KE0A 1GPFA 2DSZA 1VF8A 1PINA 2XP3A 2OLHA 3O5OA 3EIPA 3KADA 2XPBA 3NTPA 2B5UB 3ARWA 3G6MA 3O5QA 4DRIA 3CGMA 4Z2HA 4LAYA 4FN2A 3PR9A 1F8AB 2KR7A 2Q5AA 4LAXA 3WQWA 4TW6A 1XRVA 1FKLA 2G41A 1EDQA 5HW6A 1LQ0A 1OWQA 2PPPA 2ZQSA 4LAVA 5HWBA 1X6LA 1FKHA 2ITKA 4W9OA 2L2SA 1ZL1A 2A3BA 5DIUA 2ETNA 2IF4A 3UF8A 2RSEA 2JZVA 2XP5A 2Y78A 3I6CA 1LL7A 1Q1CA 3WD2A 3ARPA 1NMVA 4WKFA 2PBCA 4XAKA 3RM9A 1BL4A 3BMBA 2DT0A 1D2KA 5DITA 3WD4A 1JCHB 4JYSA 4JFLA 4NZCA 4ZPVR 1KT0A 2WLYA 3ODKA 5JH8A 3UI6A 4KQZA 4Q7NA 5B8IC 1F40A 4PTMA 3WD3A 3KAIA 1E6PA 2DPEA 1FFQA 3KCEA 2F23A 1E6NA 3WD1A 5DIVA 2DG9A 1QPFA 1X6NA 3UI5A 3IK8A 3FY1A 1FKSA 1ROTA 3CHEA 2DSVA 3KACA 2MF9A 4QT3A 3EY6A 4ODMA 3TC5A 2XP6A 1E15A 4Z2JA 1NSGA 1Q6HA 4UDMA 4DH0A 3CZ8A 4ODNA 1ZK6A 4ZPTR 3O5FA 1ZBVA 1LL6A 3GU0A 2WK2A 3IKGA 1BKFA 1SR0A 1JVWA 1WNOA 3O5MA 4MNJA 1M5YA 3B9AA 4DROA 1NH6A 4IPXA 4MPKA 2F4EA 2VCDA 3WD0A 3UQBA 1A7XA 4WKHA 3ARXA 4ODPA 1HKMA 3LUOA 3UI4A 4DRJA 2PV2A 2FDMA 3ALFA 4MAVA 4BF8A 3O5EA 1U79A 1RD6A 1TCOC 2DT3A 5HW8A 3O5RA 1ZCNA 1JNDA 2G8ZA 3AS1A 1FKFA 1W1PA 1WAWA 1HJVA 2PN0A 4R5EA 2B31A 2PI6A 2ESCA 1EIBA 1W1YA 3UQAA 4TX0A 2UZ5A 5GPGA 3AS0A 2RURA 1ZBKA 3ARQA 4TYOA 3PRDA 4JFKA 4N19A 4WKAA 1Q6IA 2ZQVA 3AS3A 3NRKA 5D75A 3FXYA 4IQ2A 4S3KA 1D7HA 1Q6UA 1XHGA 3CHFA 1FKBA 2LKNA 1W26A 5DEZA 5HWCA 3ARYA 4W9PA 2D9FA 2RUCA 4O2TA 4P8VA 1E6ZA 2EULA 4GGQA 1L1PA 3W4RA
chains in the Genus database with same CATH topology
1NWSA 2VN1A 2F2DA 2YBTA 3PRBA 1K9TA 4DWSC 1ZB5A 2IUZA 5GPRA 3WKZA 1OGBA 3ALGA 4W9QA 1FKTA 3JYMA 3KAFA 1FD9A 3O5JA 1EQ3A 3AQUA 1HKKA 3FAPA 4DRHA 4DIPA 2DG3A 4MNMA 4Z2IA 4U86A 1FKIA 4ZS6A 4HBEA 1D7JA 2KGJA 3RMEA 4G2PA 4ODLA 4TNSA 1PBKA 4JFJA 2AOSA 1UR9A 2PV3A 1T11A 2XP9A 1LG1A 2N87A 4DRMA 4MTVA 1HKJA 4L3NA 2XP7A 2M2AA 3NI6A 4IT4A 3JXVA 1E6RA 1HJWA 3QOKA 4ODOA 3VAWA 4MGVA 1W1VA 4WK9A 1W9UA 1EHNA 1W9PA 2F21A 3OOBA 1D6OA 1FKRA 1ROUA 2O92A 1LL4A 2ZQTA 4MSPA 2FKEA 1FAPA 3PRAA 1GUVA 2RQSA 1FKKA 4L72B 2MLXA 2PPNA 2LPVA 4AY1A 1J6YA 1LJYA 3WQVA 3IKDA 4LAWA 1ZBCA 2DSWA 4NNRA 2M08A 2DT2A 2A3AA 2PPOA 4WIWA 4Z2GA 4NSBA 1KFWA 2ZR6A 2MPHA 3ARVA 4P8XA 4G50A 4P8WA 4TW8A 5HW7A 1FKGA 2KI3A 3KZ7A 3RFWA 2KFWA 1YW5A 1TFVA 3O5IA 4P8UA 4JFMA 1B6CA 4ODRA 4DWSA 1CTNA 1KT1A 1JNSA 4QZVB 3RM8A 4JFIA 1UR8A 5HT1A 1HKIA 5HKGA 1EYMA 3WH0A 3BXWA 3B9DA 4DRKA 1Y0OA 1IX5A 3IHZA 2O9OA 2WM0A 2YBUA 4R0XA 3KABA 1O6IA 4DT4A 1NWUA 1J4IA 3WL0A 4QIBA 4IQCA 3O5GA 1N1AA 1HXVA 4J4OA 3G6LA 4Z2LA 4C02B 5HUAA 4WJXA 1E9LA 2MNTA 3AS2A 4ITZA 2AWGA 3GPKA 3O5LA 4MNLA 4DRNA 1QPLA 1JNEA 3ARZA 4URIA 4ML4A 2QF8A 2WLZA 1FKDA 4DWSD 2DG4A 3RM4A 4HARA 3RGCA 5BXJA 3KAGA 1D7IA 4S3JA 3AROA 3ARUA 2DT1A 3ARSA 3CHCA 4LGXA 2KO7A 2ZQUA 1ITXA 2DSUA 1H0GA 4DRPA 4IT6A 3PA7A 1J4RA 3WL1A 5DO2A 3JYJA 4U85A 2LJ4A 3O5DA 5HTGA 1FJDA 3B9EA 4Z2KA 4HBOA 4ZPWR 1HJXA 2OFNA 3ARTA 2XP8A 3B7XA 4Q22A 1NWTA 2K8IA 3UQIA 2RUDA 1J4HA 1JNTA 2MLYA 1OGGA 3H9RB 3KAHA 3O5KA 1QZ2A 4ODQA 1WB0A 1FKJA 4U84A 4DRQA 2XP4A 1YATA 4DZ3A 4ODKA 5J6EA 3TCZA 4KR0B 2RUQA 4GIVA 3CH9A 4QT2A 2M1IA 5GQBA 4FAPA 2A3CA 3O5PA 2ZR4A 3OA5A 2A3EA 2XPAA 2LGOA 1SYTA 1P5QA 1ZBWA 5I98A 4TW7A 1FFRA 1R9HA 1H0IA 1W1TA 4W5UA 1ZU8A 4DZ2A 1NMWA 2MLZA 1C9HA 3MDYB 3CGNA 1W9VA 1LG2A 2PV1A 1GOIA 2ZR5A 3WIJA 2FAPA 5DF0A 5HBFA 3B8SA 4MNKA 4DWSB 1NWRA 4J4NA 3CHDA 3ARRA 3TDBA 2KE0A 1GPFA 2DSZA 1VF8A 1PINA 2XP3A 2OLHA 3O5OA 3KADA 2XPBA 3NTPA 3ARWA 3G6MA 3O5QA 4DRIA 3CGMA 4Z2HA 4LAYA 4FN2A 3PR9A 1F8AB 2KR7A 2Q5AA 4LAXA 3WQWA 4TW6A 1XRVA 1FKLA 2G41A 1EDQA 5HW6A 1LQ0A 1OWQA 2PPPA 2ZQSA 4LAVA 5HWBA 1X6LA 1FKHA 2ITKA 4W9OA 2L2SA 1ZL1A 2A3BA 5DIUA 2IF4A 3UF8A 2RSEA 2JZVA 2XP5A 2Y78A 3I6CA 1LL7A 1Q1CA 3WD2A 3ARPA 1NMVA 4WKFA 2PBCA 4XAKA 3RM9A 1BL4A 2DT0A 1D2KA 5DITA 3WD4A 4JYSA 4JFLA 4NZCA 4ZPVR 1KT0A 2WLYA 3ODKA 5JH8A 3UI6A 4KQZA 4Q7NA 5B8IC 1F40A 4PTMA 3WD3A 3KAIA 1E6PA 2DPEA 1FFQA 3KCEA 1E6NA 3WD1A 5DIVA 2DG9A 1QPFA 1X6NA 3UI5A 3IK8A 3FY1A 1FKSA 1ROTA 3CHEA 2DSVA 3KACA 2MF9A 4QT3A 3EY6A 4ODMA 3TC5A 2XP6A 1E15A 4Z2JA 1NSGA 1Q6HA 4DH0A 3CZ8A 4ODNA 1ZK6A 4ZPTR 3O5FA 1ZBVA 1LL6A 2WK2A 3IKGA 1BKFA 1SR0A 1JVWA 1WNOA 3O5MA 4MNJA 1M5YA 3B9AA 4DROA 1NH6A 4IPXA 4MPKA 2F4EA 2VCDA 3WD0A 3UQBA 1A7XA 4WKHA 3ARXA 4ODPA 1HKMA 3LUOA 3UI4A 4DRJA 2PV2A 2FDMA 3ALFA 4MAVA 4BF8A 3O5EA 1U79A 1RD6A 1TCOC 2DT3A 5HW8A 3O5RA 1ZCNA 1JNDA 2G8ZA 3AS1A 1FKFA 1W1PA 1WAWA 1HJVA 4R5EA 2B31A 2PI6A 2ESCA 1EIBA 1W1YA 3UQAA 4TX0A 2UZ5A 5GPGA 3AS0A 2RURA 1ZBKA 3ARQA 4TYOA 3PRDA 4JFKA 4N19A 4WKAA 1Q6IA 2ZQVA 3AS3A 3NRKA 5D75A 3FXYA 4IQ2A 4S3KA 1D7HA 1Q6UA 1XHGA 3CHFA 1FKBA 2LKNA 1W26A 5DEZA 5HWCA 3ARYA 4W9PA 2D9FA 2RUCA 4O2TA 4P8VA 1E6ZA 4GGQA 1L1PA 3W4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  3KCE A;  1B6C A;  2VN1 A;  4ODR A;  1KT1 A;  2RUQ A;  2F2D A;  4GIV A;  4QT2 A;  2M1I A;  1JNS A;  5DIV A;  3PRB A;  4JFI A;  4FAP A;  2DG9 A;  3O5P A;  1QPF A;  5HT1 A;  2ZR4 A;  5HKG A;  3UI5 A;  1EYM A;  4W9Q A;  3WH0 A;  1FKT A;  3JYM A;  3KAF A;  1FD9 A;  2XPA A;  4DRK A;  2LGO A;  3IK8 A;  1Y0O A;  1P5Q A;  3O5J A;  1EQ3 A;  1FKS A;  3IHZ A;  1ROT A;  4R0X A;  3KAB A;  3KAC A;  4W9P A;  2MF9 A;  4QT3 A;  3FAP A;  4DRH A;  3EY6 A;  4ODM A;  3TC5 A;  4DT4 A;  2XP6 A;  1F40 A;  5I98 A;  1NSG A;  1Q6H A;  4TW7 A;  1J4I A;  2DG3 A;  4DIP A;  4DH0 A;  1R9H A;  4ODN A;  1ZK6 A;  4QIB A;  4DRQ A;  4U86 A;  1FKI A;  4IQC A;  3O5F A;  4DZ2 A;  1NMW A;  2MLZ A;  1C9H A;  3MDY B;  3O5G A;  3CGN A;  1N1A A;  1D7J A;  2PV1 A;  3IKG A;  1BKF A;  1HXV A;  2KGJ A;  2ZR5 A;  1JVW A;  4J4O A;  2FAP A;  4G2P A;  4ODL A;  4TNS A;  1PBK A;  3O5M A;  4JFJ A;  1M5Y A;  4C02 B;  4DRO A;  5HUA A;  4J4N A;  3TDB A;  2MNT A;  2PV3 A;  2KE0 A;  4IPX A;  1T11 A;  2F4E A;  2VCD A;  2XP9 A;  1PIN A;  2AWG A;  2XP3 A;  3GPK A;  3O5L A;  2N87 A;  4ITZ A;  4DRN A;  3UQB A;  3O5O A;  1A7X A;  1QPL A;  4DRM A;  3KAD A;  4ODP A;  3LUO A;  2XPB A;  3UI4 A;  2PV2 A;  3NTP A;  4DRJ A;  4DRI A;  3O5Q A;  1FKD A;  2XP7 A;  3CGM A;  2DG4 A;  4LAY A;  4BF8 A;  3O5E A;  3RGC A;  2M2A A;  5BXJ A;  3KAG A;  3NI6 A;  1D7I A;  1U79 A;  1TCO C;  4FN2 A;  3JXV A;  5HW8 A;  1F8A B;  2KR7 A;  2Q5A A;  3O5R A;  4LAX A;  1ZCN A;  4ODO A;  3VAW A;  4MGV A;  4TW6 A;  1FKL A;  1L1P A;  2KO7 A;  2ZQU A;  5HW6 A;  5HW7 A;  2PPP A;  2ZQS A;  4LAV A;  1FKF A;  2F21 A;  3OOB A;  4DRP A;  1D6O A;  5HWB A;  1FKR A;  1FKH A;  3PA7 A;  1J4R A;  2ITK A;  1ROU A;  5B8I C;  2ZQT A;  3JYJ A;  4U85 A;  2LJ4 A;  4MSP A;  2FKE A;  4W9O A;  3O5D A;  2L2S A;  1FAP A;  5DIU A;  5HTG A;  1FJD A;  2IF4 A;  2RQS A;  2RSE A;  3UF8 A;  1FKK A;  2JZV A;  2XP5 A;  2MLX A;  2Y78 A;  2PPN A;  3I6C A;  3UQA A;  1Q1C A;  2LPV A;  4TX0 A;  2UZ5 A;  1J6Y A;  5GPG A;  2RUR A;  1NMV A;  3IKD A;  2OFN A;  2PBC A;  4LAW A;  4TYO A;  2XP8 A;  3PRD A;  4JFK A;  3B7X A;  1BL4 A;  4N19 A;  2K8I A;  2M08 A;  4NNR A;  1Q6I A;  2ZQV A;  3UQI A;  3NRK A;  2RUD A;  5D75 A;  1J4H A;  1JNT A;  5DIT A;  2PPO A;  2MLY A;  4IQ2 A;  4JYS A;  3H9R B;  4JFL A;  3KAH A;  1KT0 A;  1D7H A;  1Q6U A;  3O5K A;  2ZR6 A;  2MPH A;  1QZ2 A;  3ODK A;  1FKB A;  2LKN A;  4ODQ A;  3UI6 A;  4G50 A;  1FKJ A;  1W26 A;  5HWC A;  4U84 A;  2D9F A;  2RUC A;  2XP4 A;  4O2T A;  1YAT A;  1FKG A;  2KI3 A;  3KZ7 A;  4TW8 A;  4GGQ A;  2KFW A;  1YW5 A;  4ODK A;  3O5I A;  3KAI A;  3RFW A;  4DZ3 A;  5J6E A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 1NWS A;  2VN1 A;  2F2D A;  2YBT A;  3PRB A;  1K9T A;  4DWS C;  1ZB5 A;  2IUZ A;  5GPR A;  3WKZ A;  1OGB A;  3ALG A;  4W9Q A;  1FKT A;  3JYM A;  3KAF A;  1FD9 A;  3O5J A;  1EQ3 A;  3AQU A;  1HKK A;  3FAP A;  4DRH A;  4DIP A;  2DG3 A;  4MNM A;  4Z2I A;  4U86 A;  1FKI A;  4ZS6 A;  4HBE A;  1D7J A;  2KGJ A;  3RME A;  4G2P A;  4ODL A;  4TNS A;  1PBK A;  4JFJ A;  2AOS A;  1UR9 A;  2PV3 A;  1T11 A;  2XP9 A;  1LG1 A;  2N87 A;  4DRM A;  4MTV A;  1HKJ A;  4L3N A;  3GTY X;  2XP7 A;  2M2A A;  3NI6 A;  4IT4 A;  3JXV A;  1E6R A;  1HJW A;  3QOK A;  4ODO A;  3VAW A;  4MGV A;  1W1V A;  4WK9 A;  1W9U A;  1EHN A;  1W9P A;  2F21 A;  3OOB A;  1D6O A;  1FKR A;  1ROU A;  2O92 A;  1LL4 A;  2ZQT A;  4MSP A;  2FKE A;  1FAP A;  3PRA A;  1GUV A;  2RQS A;  1FKK A;  4L72 B;  2MLX A;  2PPN A;  2LPV A;  4AY1 A;  1J6Y A;  1LJY A;  3WQV A;  3IKD A;  4LAW A;  1ZBC A;  2DSW A;  4NNR A;  2M08 A;  2DT2 A;  2A3A A;  2PPO A;  4WIW A;  4Z2G A;  4NSB A;  1KFW A;  2ZR6 A;  2MPH A;  3ARV A;  4P8X A;  4G50 A;  4P8W A;  4TW8 A;  5HW7 A;  1FKG A;  2KI3 A;  3KZ7 A;  3RFW A;  2KFW A;  1YW5 A;  1TFV A;  3O5I A;  4P8U A;  4JFM A;  1B6C A;  4ODR A;  4DWS A;  1CTN A;  1KT1 A;  1JNS A;  4QZV B;  3RM8 A;  4JFI A;  1UR8 A;  5HT1 A;  1HKI A;  5HKG A;  1GRJ A;  1EYM A;  3WH0 A;  3BXW A;  3B9D A;  4DRK A;  1E44 A;  1Y0O A;  1IX5 A;  3IHZ A;  2O9O A;  2WM0 A;  2YBU A;  4R0X A;  3KAB A;  1O6I A;  4DT4 A;  1NWU A;  1J4I A;  3WL0 A;  4QIB A;  4IQC A;  3O5G A;  1N1A A;  1HXV A;  4J4O A;  3G6L A;  4Z2L A;  4C02 B;  5HUA A;  4WJX A;  1E9L A;  2MNT A;  3AS2 A;  4ITZ A;  2AWG A;  3GPK A;  3O5L A;  4MNL A;  4DRN A;  1QPL A;  1JNE A;  3ARZ A;  4URI A;  4ML4 A;  2QF8 A;  2WLZ A;  1FKD A;  4DWS D;  2DG4 A;  2P4V A;  3RM4 A;  4HAR A;  3RGC A;  5BXJ A;  3KAG A;  1D7I A;  4S3J A;  3ARO A;  3ARU A;  2DT1 A;  3ARS A;  3CHC A;  4LGX A;  2KO7 A;  2ZQU A;  1ITX A;  2DSU A;  1H0G A;  4DRP A;  4IT6 A;  3PA7 A;  1J4R A;  3WL1 A;  5DO2 A;  3JYJ A;  4U85 A;  2LJ4 A;  3O5D A;  5HTG A;  1FJD A;  3B9E A;  4Z2K A;  4HBO A;  4ZPW R;  1HJX A;  2OFN A;  3ART A;  2XP8 A;  3B7X A;  4Q22 A;  1NWT A;  2K8I A;  3UQI A;  2RUD A;  1J4H A;  1JNT A;  2MLY A;  1OGG A;  3H9R B;  3KAH A;  3O5K A;  1QZ2 A;  4ODQ A;  1WB0 A;  1FKJ A;  4U84 A;  4DRQ A;  2XP4 A;  1YAT A;  4DZ3 A;  4ODK A;  5J6E A;  3TCZ A;  4KR0 B;  2RUQ A;  4GIV A;  3CH9 A;  4QT2 A;  2M1I A;  5GQB A;  4FAP A;  2A3C A;  3O5P A;  2ZR4 A;  3OA5 A;  2A3E A;  2XPA A;  2LGO A;  1SYT A;  1P5Q A;  1ZBW A;  5I98 A;  4TW7 A;  1FFR A;  1R9H A;  1H0I A;  1W1T A;  4W5U A;  1ZU8 A;  4DZ2 A;  1NMW A;  2MLZ A;  1C9H A;  3MDY B;  3CGN A;  1W9V A;  1LG2 A;  2PV1 A;  1GOI A;  2ZR5 A;  3WIJ A;  2FAP A;  5DF0 A;  5HBF A;  3B8S A;  4MNK A;  4DWS B;  1NWR A;  4J4N A;  3CHD A;  3ARR A;  3TDB A;  2KE0 A;  1GPF A;  2DSZ A;  1VF8 A;  1PIN A;  2XP3 A;  2OLH A;  3O5O A;  3EIP A;  3KAD A;  2XPB A;  3NTP A;  2B5U B;  3ARW A;  3G6M A;  3O5Q A;  4DRI A;  3CGM A;  4Z2H A;  4LAY A;  4FN2 A;  3PR9 A;  1F8A B;  2KR7 A;  2Q5A A;  4LAX A;  3WQW A;  4TW6 A;  1XRV A;  1FKL A;  2G41 A;  1EDQ A;  5HW6 A;  1LQ0 A;  1OWQ A;  2PPP A;  2ZQS A;  4LAV A;  5HWB A;  1X6L A;  1FKH A;  2ITK A;  4W9O A;  2L2S A;  1ZL1 A;  2A3B A;  5DIU A;  2ETN A;  2IF4 A;  3UF8 A;  2RSE A;  2JZV A;  2XP5 A;  2Y78 A;  3I6C A;  1LL7 A;  1Q1C A;  3WD2 A;  3ARP A;  1NMV A;  4WKF A;  2PBC A;  4XAK A;  3RM9 A;  1BL4 A;  3BMB A;  2DT0 A;  1D2K A;  5DIT A;  3WD4 A;  1JCH B;  4JYS A;  4JFL A;  4NZC A;  4ZPV R;  1KT0 A;  2WLY A;  3ODK A;  5JH8 A;  3UI6 A;  4KQZ A;  4Q7N A;  5B8I C;  1F40 A;  4PTM A;  3WD3 A;  3KAI A;  1E6P A;  2DPE A;  1FFQ A;  3KCE A;  2F23 A;  1E6N A;  3WD1 A;  5DIV A;  2DG9 A;  1QPF A;  1X6N A;  3UI5 A;  3IK8 A;  3FY1 A;  1FKS A;  1ROT A;  3CHE A;  2DSV A;  3KAC A;  2MF9 A;  4QT3 A;  3EY6 A;  4ODM A;  3TC5 A;  2XP6 A;  1E15 A;  4Z2J A;  1NSG A;  1Q6H A;  4UDM A;  4DH0 A;  3CZ8 A;  4ODN A;  1ZK6 A;  4ZPT R;  3O5F A;  1ZBV A;  1LL6 A;  3GU0 A;  2WK2 A;  3IKG A;  1BKF A;  1SR0 A;  1JVW A;  1WNO A;  3O5M A;  4MNJ A;  1M5Y A;  3B9A A;  4DRO A;  1NH6 A;  4IPX A;  4MPK A;  2F4E A;  2VCD A;  3WD0 A;  3UQB A;  1A7X A;  4WKH A;  3ARX A;  4ODP A;  1HKM A;  3LUO A;  3UI4 A;  4DRJ A;  2PV2 A;  2FDM A;  3ALF A;  4MAV A;  4BF8 A;  3O5E A;  1U79 A;  1RD6 A;  1TCO C;  2DT3 A;  5HW8 A;  3O5R A;  1ZCN A;  1JND A;  2G8Z A;  3AS1 A;  1FKF A;  1W1P A;  1WAW A;  1HJV A;  2PN0 A;  4R5E A;  2B31 A;  2PI6 A;  2ESC A;  1EIB A;  1W1Y A;  3UQA A;  4TX0 A;  2UZ5 A;  5GPG A;  3AS0 A;  2RUR A;  1ZBK A;  3ARQ A;  4TYO A;  3PRD A;  4JFK A;  4N19 A;  4WKA A;  1Q6I A;  2ZQV A;  3AS3 A;  3NRK A;  5D75 A;  3FXY A;  4IQ2 A;  4S3K A;  1D7H A;  1Q6U A;  1XHG A;  3CHF A;  1FKB A;  2LKN A;  1W26 A;  5DEZ A;  5HWC A;  3ARY A;  4W9P A;  2D9F A;  2RUC A;  4O2T A;  4P8V A;  1E6Z A;  2EUL A;  4GGQ A;  1L1P A;  3W4R A; 
#chains in the Genus database with same CATH homology
 1NWS A;  2VN1 A;  2F2D A;  2YBT A;  3PRB A;  1K9T A;  4DWS C;  1ZB5 A;  2IUZ A;  5GPR A;  3WKZ A;  1OGB A;  3ALG A;  4W9Q A;  1FKT A;  3JYM A;  3KAF A;  1FD9 A;  3O5J A;  1EQ3 A;  3AQU A;  1HKK A;  3FAP A;  4DRH A;  4DIP A;  2DG3 A;  4MNM A;  4Z2I A;  4U86 A;  1FKI A;  4ZS6 A;  4HBE A;  1D7J A;  2KGJ A;  3RME A;  4G2P A;  4ODL A;  4TNS A;  1PBK A;  4JFJ A;  2AOS A;  1UR9 A;  2PV3 A;  1T11 A;  2XP9 A;  1LG1 A;  2N87 A;  4DRM A;  4MTV A;  1HKJ A;  4L3N A;  2XP7 A;  2M2A A;  3NI6 A;  4IT4 A;  3JXV A;  1E6R A;  1HJW A;  3QOK A;  4ODO A;  3VAW A;  4MGV A;  1W1V A;  4WK9 A;  1W9U A;  1EHN A;  1W9P A;  2F21 A;  3OOB A;  1D6O A;  1FKR A;  1ROU A;  2O92 A;  1LL4 A;  2ZQT A;  4MSP A;  2FKE A;  1FAP A;  3PRA A;  1GUV A;  2RQS A;  1FKK A;  4L72 B;  2MLX A;  2PPN A;  2LPV A;  4AY1 A;  1J6Y A;  1LJY A;  3WQV A;  3IKD A;  4LAW A;  1ZBC A;  2DSW A;  4NNR A;  2M08 A;  2DT2 A;  2A3A A;  2PPO A;  4WIW A;  4Z2G A;  4NSB A;  1KFW A;  2ZR6 A;  2MPH A;  3ARV A;  4P8X A;  4G50 A;  4P8W A;  4TW8 A;  5HW7 A;  1FKG A;  2KI3 A;  3KZ7 A;  3RFW A;  2KFW A;  1YW5 A;  1TFV A;  3O5I A;  4P8U A;  4JFM A;  1B6C A;  4ODR A;  4DWS A;  1CTN A;  1KT1 A;  1JNS A;  4QZV B;  3RM8 A;  4JFI A;  1UR8 A;  5HT1 A;  1HKI A;  5HKG A;  1EYM A;  3WH0 A;  3BXW A;  3B9D A;  4DRK A;  1Y0O A;  1IX5 A;  3IHZ A;  2O9O A;  2WM0 A;  2YBU A;  4R0X A;  3KAB A;  1O6I A;  4DT4 A;  1NWU A;  1J4I A;  3WL0 A;  4QIB A;  4IQC A;  3O5G A;  1N1A A;  1HXV A;  4J4O A;  3G6L A;  4Z2L A;  4C02 B;  5HUA A;  4WJX A;  1E9L A;  2MNT A;  3AS2 A;  4ITZ A;  2AWG A;  3GPK A;  3O5L A;  4MNL A;  4DRN A;  1QPL A;  1JNE A;  3ARZ A;  4URI A;  4ML4 A;  2QF8 A;  2WLZ A;  1FKD A;  4DWS D;  2DG4 A;  3RM4 A;  4HAR A;  3RGC A;  5BXJ A;  3KAG A;  1D7I A;  4S3J A;  3ARO A;  3ARU A;  2DT1 A;  3ARS A;  3CHC A;  4LGX A;  2KO7 A;  2ZQU A;  1ITX A;  2DSU A;  1H0G A;  4DRP A;  4IT6 A;  3PA7 A;  1J4R A;  3WL1 A;  5DO2 A;  3JYJ A;  4U85 A;  2LJ4 A;  3O5D A;  5HTG A;  1FJD A;  3B9E A;  4Z2K A;  4HBO A;  4ZPW R;  1HJX A;  2OFN A;  3ART A;  2XP8 A;  3B7X A;  4Q22 A;  1NWT A;  2K8I A;  3UQI A;  2RUD A;  1J4H A;  1JNT A;  2MLY A;  1OGG A;  3H9R B;  3KAH A;  3O5K A;  1QZ2 A;  4ODQ A;  1WB0 A;  1FKJ A;  4U84 A;  4DRQ A;  2XP4 A;  1YAT A;  4DZ3 A;  4ODK A;  5J6E A;  3TCZ A;  4KR0 B;  2RUQ A;  4GIV A;  3CH9 A;  4QT2 A;  2M1I A;  5GQB A;  4FAP A;  2A3C A;  3O5P A;  2ZR4 A;  3OA5 A;  2A3E A;  2XPA A;  2LGO A;  1SYT A;  1P5Q A;  1ZBW A;  5I98 A;  4TW7 A;  1FFR A;  1R9H A;  1H0I A;  1W1T A;  4W5U A;  1ZU8 A;  4DZ2 A;  1NMW A;  2MLZ A;  1C9H A;  3MDY B;  3CGN A;  1W9V A;  1LG2 A;  2PV1 A;  1GOI A;  2ZR5 A;  3WIJ A;  2FAP A;  5DF0 A;  5HBF A;  3B8S A;  4MNK A;  4DWS B;  1NWR A;  4J4N A;  3CHD A;  3ARR A;  3TDB A;  2KE0 A;  1GPF A;  2DSZ A;  1VF8 A;  1PIN A;  2XP3 A;  2OLH A;  3O5O A;  3KAD A;  2XPB A;  3NTP A;  3ARW A;  3G6M A;  3O5Q A;  4DRI A;  3CGM A;  4Z2H A;  4LAY A;  4FN2 A;  3PR9 A;  1F8A B;  2KR7 A;  2Q5A A;  4LAX A;  3WQW A;  4TW6 A;  1XRV A;  1FKL A;  2G41 A;  1EDQ A;  5HW6 A;  1LQ0 A;  1OWQ A;  2PPP A;  2ZQS A;  4LAV A;  5HWB A;  1X6L A;  1FKH A;  2ITK A;  4W9O A;  2L2S A;  1ZL1 A;  2A3B A;  5DIU A;  2IF4 A;  3UF8 A;  2RSE A;  2JZV A;  2XP5 A;  2Y78 A;  3I6C A;  1LL7 A;  1Q1C A;  3WD2 A;  3ARP A;  1NMV A;  4WKF A;  2PBC A;  4XAK A;  3RM9 A;  1BL4 A;  2DT0 A;  1D2K A;  5DIT A;  3WD4 A;  4JYS A;  4JFL A;  4NZC A;  4ZPV R;  1KT0 A;  2WLY A;  3ODK A;  5JH8 A;  3UI6 A;  4KQZ A;  4Q7N A;  5B8I C;  1F40 A;  4PTM A;  3WD3 A;  3KAI A;  1E6P A;  2DPE A;  1FFQ A;  3KCE A;  1E6N A;  3WD1 A;  5DIV A;  2DG9 A;  1QPF A;  1X6N A;  3UI5 A;  3IK8 A;  3FY1 A;  1FKS A;  1ROT A;  3CHE A;  2DSV A;  3KAC A;  2MF9 A;  4QT3 A;  3EY6 A;  4ODM A;  3TC5 A;  2XP6 A;  1E15 A;  4Z2J A;  1NSG A;  1Q6H A;  4DH0 A;  3CZ8 A;  4ODN A;  1ZK6 A;  4ZPT R;  3O5F A;  1ZBV A;  1LL6 A;  2WK2 A;  3IKG A;  1BKF A;  1SR0 A;  1JVW A;  1WNO A;  3O5M A;  4MNJ A;  1M5Y A;  3B9A A;  4DRO A;  1NH6 A;  4IPX A;  4MPK A;  2F4E A;  2VCD A;  3WD0 A;  3UQB A;  1A7X A;  4WKH A;  3ARX A;  4ODP A;  1HKM A;  3LUO A;  3UI4 A;  4DRJ A;  2PV2 A;  2FDM A;  3ALF A;  4MAV A;  4BF8 A;  3O5E A;  1U79 A;  1RD6 A;  1TCO C;  2DT3 A;  5HW8 A;  3O5R A;  1ZCN A;  1JND A;  2G8Z A;  3AS1 A;  1FKF A;  1W1P A;  1WAW A;  1HJV A;  4R5E A;  2B31 A;  2PI6 A;  2ESC A;  1EIB A;  1W1Y A;  3UQA A;  4TX0 A;  2UZ5 A;  5GPG A;  3AS0 A;  2RUR A;  1ZBK A;  3ARQ A;  4TYO A;  3PRD A;  4JFK A;  4N19 A;  4WKA A;  1Q6I A;  2ZQV A;  3AS3 A;  3NRK A;  5D75 A;  3FXY A;  4IQ2 A;  4S3K A;  1D7H A;  1Q6U A;  1XHG A;  3CHF A;  1FKB A;  2LKN A;  1W26 A;  5DEZ A;  5HWC A;  3ARY A;  4W9P A;  2D9F A;  2RUC A;  4O2T A;  4P8V A;  1E6Z A;  4GGQ A;  1L1P A;  3W4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...