2OFNA

Solution structure of fk506-binding domain (fkbd)of fkbp35 from plasmodium falciparum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
135
structure length
135
Chain Sequence
MTTEQEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FK506 binding domain (FKBD) of Plasmodium falciparum FK506 binding protein 35 (PfFKBP35).
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords 70 kDa peptidylprolyl isomerase, putative
total genus 17
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ofnA01
3UF8A 1KT0A 3IKGA 2ZR5A 4TW6A 2LJ4A 3O5LA 4W9QA 1HXVA 4DRHA 2MLZA 2K8IA 2PV3A 3FAPA 5DITA 3NI6A 5DIUA 4DZ3A 1T11A 2KE0A 3IKDA 4G50A 4GIVA 4O2TA 4QT2A 1A7XA 3O5QA 3TCZA 4DRJA 4DZ2A 5BXJA 3LUOA 1U79A 3JYMA 4J4NA 1N1AA 2XPBA 1FKBA 2FKEA 3ODKA 2N87A 5HWBA 1JNSA 1J4HA 3CGNA 2ITKA 1M5YA 4ODMA 1J6YA 1Y0OA 2L2SA 3H9RB 5HW6A 1BL4A 3KAGA 4JYSA 4FN2A 5D75A 4ODLA 4DRIA 2XP8A 3JXVA 4LAXA 4C02B 4DRNA 5HKGA 3B7XA 2M08A 3RFWA 1FKDA 1JVWA 2F4EA 3IK8A 4R0XA 2MPHA 4LAWA 2RUQA 5GPGA 3TDBA 4DRMA 1YATA 3WH0A 5HWCA 4TX0A 2ZR6A 3KZ7A 4ODOA 3KCEA 3JYJA 1D7JA 2MLYA 3PA7A 4TW7A 4BF8A 2M1IA 1FKTA 3GPKA 3UQIA 1Q6IA 3KACA 1EYMA 2OFNA 4IQ2A 3UQBA 1FKSA 1FKKA 2DG4A 3KADA 3KAFA 1FD9A 2VCDA 3KAIA 3O5DA 3O5GA 2PBCA 4GGQA 3UI4A 2ZR4A 4JFLA 2D9FA 2KO7A 2M2AA 3I6CA 3MDYB 2RSEA 3NTPA 3PRDA 4ODQA 3TC5A 2Q5AA 1FAPA 1NMVA 2LKNA 3NRKA 2XP9A 1FKLA 3OOBA 2XP7A 1Q6UA 4U84A 1Q6HA 4ODPA 2PPNA 4ODNA 4FAPA 1F8AB 4U86A 5HTGA 4JFJA 3O5IA 4DIPA 2F21A 2ZQTA 2ZQUA 3O5JA 2Y78A 1QZ2A 3O5OA 1FKRA 3KABA 2KR7A 2RURA 1FKHA 1B6CA 3UI6A 3CGMA 2MF9A 1ROTA 2MLXA 3O5PA 4DRKA 4MGVA 1C9HA 2KGJA 1ROUA 2MNTA 1YW5A 2UZ5A 2DG3A 4DRPA 5HW8A 5HW7A 1L1PA 4NNRA 2RQSA 1P5QA 2AWGA 5I98A 1FKJA 1FJDA 1ZK6A 4QT3A 1NMWA 1D6OA 2KI3A 4MSPA 1PINA 2XP5A 3O5EA 4TNSA 4DT4A 2RUDA 4JFKA 2IF4A 1QPLA 3UQAA 3O5KA 2PPPA 1EQ3A 2DG9A 2FAPA 4LAVA 4DH0A 5J6EA 2KFWA 3O5FA 4JFIA 2LPVA 2PPOA 4DRQA 1BKFA 2F2DA 1JNTA 3UI5A 1J4IA 2PV1A 4ITZA 5B8IC 1ZCNA 4J4OA 4TYOA 5DIVA 1FKGA 1D7HA 4TW8A 3O5MA 4LAYA 1D7IA 1F40A 3EY6A 4W9OA 1PBKA 1FKFA 3IHZA 1R9HA 1W26A 2XP6A 3RGCA 2XPAA 4ODKA 1FKIA 5HUAA 4W9PA 4QIBA 4DROA 1QPFA 2PV2A 5HT1A 1J4RA 2ZQVA 2LGOA 2ZQSA 3KAHA 3O5RA 2VN1A 1NSGA 4G2PA 1KT1A 4IQCA 1Q1CA 1TCOC 2XP3A 4IPXA 4JFMA 4ODRA 4U85A 2RUCA 4N19A 3VAWA 3PRBA 2JZVA 2XP4A
chains in the Genus database with same CATH superfamily
1KT0A 1GUVA 4Z2HA 4HBOA 3NI6A 1LG2A 1XRVA 4MNKA 2KE0A 4G50A 3TCZA 1K9TA 3RM9A 3B9AA 3GTYX 1ZBVA 2FKEA 5HWBA 3CGNA 2ITKA 1M5YA 1J6YA 1Y0OA 2L2SA 2PI6A 4AY1A 1WB0A 4Q7NA 4WKAA 2DPEA 4R0XA 4LAWA 2RUQA 3WH0A 2ZR6A 4DWSA 3RM4A 2MLYA 2G8ZA 4TW7A 2M1IA 1FKTA 3RMEA 2ESCA 4HARA 4IQ2A 3UQBA 4S3KA 3KADA 4KR0B 3O5DA 2ETNA 3O5GA 5JH8A 4Q22A 2ZR4A 2KO7A 3B9EA 3NTPA 5HTGA 2O92A 4ODQA 1OWQA 1FAPA 1NMVA 3FY1A 3BMBA 3OOBA 2XP7A 4U84A 3WD3A 4ODPA 4W5UA 1F8AB 1ZU8A 2DT1A 3O5IA 2ZQUA 2PN0A 4NZCA 1E6RA 4MNMA 1NWSA 2KGJA 2MNTA 1ROUA 4DRPA 5HW7A 3WD0A 4R5EA 1NH6A 1D6OA 4MSPA 4Z2GA 4DT4A 3AS2A 2IF4A 1QPLA 2FAPA 4DH0A 3O5FA 3WQWA 1EDQA 2DSUA 1JNTA 3ARSA 4S3JA 5DIVA 1UR9A 4IT4A 2DSZA 1W26A 2XPAA 5HUAA 1NWTA 2ZQSA 3KAHA 4U85A 1Q1CA 3GU0A 1CTNA 4N19A 3VAWA 3WQVA 3WKZA 4WJXA 2ZR5A 1HXVA 3ARTA 4DRHA 3W4RA 1UR8A 1T11A 3O5QA 3ALFA 1OGGA 4Z2JA 1E15A 2XPBA 1FKBA 2N87A 1JNSA 3H9RB 5HW6A 1W1PA 3KAGA 4JYSA 3CHEA 4FN2A 3AROA 4ODLA 3JXVA 2F23A 4C02B 4DRNA 4DWSC 5HKGA 3RFWA 1FKDA 2F4EA 1YATA 1FFRA 4TX0A 4ODOA 3JYJA 4BF8A 2WM0A 3GPKA 4Z2LA 2G41A 2OFNA 3KAFA 4ZS6A 3CHCA 1X6NA 2VCDA 3PRDA 1E9LA 2LKNA 3NRKA 2XP9A 1FKLA 4P8UA 1Q6HA 3WIJA 1ITXA 2WLYA 1FFQA 4WKFA 4U86A 2B5UB 4HBEA 1WNOA 3QOKA 2KR7A 3PR9A 2MF9A 2MLXA 3O5PA 2OLHA 4MNLA 2WK2A 2DG3A 5HW8A 5DEZA 4NNRA 3B9DA 1XHGA 2RQSA 2AWGA 1ZK6A 4QT3A 1NMWA 2YBTA 1NWUA 3WL1A 1EQ3A 4NSBA 3ARZA 4URIA 2KFWA 2DT3A 2PPOA 4DRQA 1W1VA 4ITZA 5B8IC 4Z2KA 4MTVA 4TW8A 3O5MA 4ZPWR 4LAYA 3BXWA 4IT6A 4W9OA 3IHZA 4QZVB 1WAWA 4DROA 4MPKA 3AS3A 3O5RA 2DSVA 2ZQVA 4L3NA 4IQCA 1JNEA 1NSGA 2VN1A 4G2PA 4LAXA 2XP3A 4ODMA 1E6PA 2RUCA 4JFLA 3UF8A 3IKGA 1W1YA 4TW6A 4W9QA 2MLZA 2PV3A 3ARRA 5DIUA 4DZ3A 3IKDA 1A7XA 1OGBA 3LUOA 1U79A 1ZL1A 3JYMA 4J4NA 1N1AA 3ARVA 3ODKA 1J4HA 1HKKA 3WL0A 1BL4A 1GOIA 2XP8A 1E6ZA 2DT2A 2M08A 4ML4A 1JVWA 2QF8A 1W9PA 1ZB5A 1HJVA 1ZBKA 2MPHA 3CH9A 1HJWA 3IK8A 5GPGA 1NWRA 3TDBA 1IX5A 1D7JA 3PA7A 3UQIA 3KACA 1D2KA 4WKHA 1FKSA 1FKKA 2A3CA 2DG4A 3G6MA 1HJXA 2PBCA 2P4VA 1ZBWA 3MDYB 3TC5A 2RSEA 4DWSB 3ARWA 2DSWA 3CHDA 1Q6UA 3AS1A 2PPNA 4ODNA 4FAPA 4MNJA 4JFJA 2F21A 2Y78A 1QZ2A 1H0IA 2B31A 1FKRA 3KABA 1LL6A 1FKHA 1B6CA 3UI6A 3CGMA 1RD6A 4MGVA 1C9HA 2UZ5A 3ALGA 1L1PA 1E44A 5GPRA 1LJYA 3RM8A 2A3AA 5I98A 1FKJA 1FJDA 2WLZA 2KI3A 1EHNA 2XP5A 3O5EA 4TNSA 1JCHB 3WD1A 2DG9A 4LAVA 3AS0A 3CHFA 3FXYA 5J6EA 4MAVA 2LPVA 2F2DA 2PV1A 4J4OA 1LQ0A 3ARYA 1FKGA 1D7HA 2A3EA 1D7IA 4P8VA 3EY6A 4PTMA 1FKFA 1E6NA 1R9HA 1H0GA 1FKIA 1QPFA 2PV2A 1LL7A 5HT1A 4ODRA 1KT1A 1TCOC 1O6IA 3WD2A 2XP4A 4P8XA 2LJ4A 3O5LA 3FAPA 2K8IA 5DITA 4QT2A 4GIVA 4O2TA 4DRJA 2FDMA 5BXJA 4DZ2A 1EIBA 3WD4A 1TFVA 4Z2IA 4ZPVR 3G6LA 1ZBCA 1GPFA 4DRIA 4KQZA 3B7XA 4P8WA 4DRMA 5HWCA 3KZ7A 3KCEA 1Q6IA 1EYMA 5DF0A 1FD9A 3KAIA 4DWSD 3ARUA 4GGQA 3ARQA 4QIBA 3UI4A 2D9FA 2M2AA 3I6CA 2Q5AA 2YBUA 5GQBA 1HKJA 3PRAA 4L72B 1JNDA 2O9OA 4DIPA 2ZQTA 3O5JA 3O5OA 3OA5A 1SR0A 2RURA 2A3BA 1ROTA 3EIPA 5DO2A 4DRKA 1W9UA 4WK9A 1YW5A 3CZ8A 1X6LA 4XAKA 5HBFA 2EULA 1W1TA 1P5QA 3B8SA 1GRJA 1LL4A 1SYTA 1W9VA 1KFWA 1PINA 2RUDA 4JFKA 3UQAA 3O5KA 1LG1A 2PPPA 1HKIA 4WIWA 2AOSA 4JFIA 1BKFA 4UDMA 3UI5A 1J4IA 1ZCNA 1VF8A 4TYOA 2IUZA 4LGXA 1F40A 1HKMA 2DT0A 1PBKA 2XP6A 3RGCA 4ODKA 4W9PA 3AQUA 1J4RA 5D75A 2LGOA 3ARPA 4ZPTR 4IPXA 4JFMA 3ARXA 3PRBA 2JZVA
chains in the Genus database with same CATH topology
1KT0A 1GUVA 4Z2HA 4HBOA 3NI6A 1LG2A 1XRVA 4MNKA 2KE0A 4G50A 3TCZA 1K9TA 3RM9A 3B9AA 1ZBVA 2FKEA 5HWBA 3CGNA 2ITKA 1M5YA 1J6YA 1Y0OA 2L2SA 2PI6A 4AY1A 1WB0A 4Q7NA 4WKAA 2DPEA 4R0XA 4LAWA 2RUQA 3WH0A 2ZR6A 4DWSA 3RM4A 2MLYA 2G8ZA 4TW7A 2M1IA 1FKTA 3RMEA 2ESCA 4HARA 4IQ2A 3UQBA 4S3KA 3KADA 4KR0B 3O5DA 3O5GA 5JH8A 4Q22A 2ZR4A 2KO7A 3B9EA 3NTPA 5HTGA 2O92A 4ODQA 1OWQA 1FAPA 1NMVA 3FY1A 3OOBA 2XP7A 4U84A 3WD3A 4ODPA 4W5UA 1F8AB 1ZU8A 2DT1A 3O5IA 2ZQUA 4NZCA 1E6RA 4MNMA 1NWSA 2KGJA 2MNTA 1ROUA 4DRPA 5HW7A 3WD0A 4R5EA 1NH6A 1D6OA 4MSPA 4Z2GA 4DT4A 3AS2A 2IF4A 1QPLA 2FAPA 4DH0A 3O5FA 3WQWA 1EDQA 2DSUA 1JNTA 3ARSA 4S3JA 5DIVA 1UR9A 4IT4A 2DSZA 1W26A 2XPAA 5HUAA 1NWTA 2ZQSA 3KAHA 4U85A 1Q1CA 1CTNA 4N19A 3VAWA 3WQVA 3WKZA 4WJXA 2ZR5A 1HXVA 3ARTA 4DRHA 3W4RA 1UR8A 1T11A 3O5QA 3ALFA 1OGGA 4Z2JA 1E15A 2XPBA 1FKBA 2N87A 1JNSA 3H9RB 5HW6A 1W1PA 3KAGA 4JYSA 3CHEA 4FN2A 3AROA 4ODLA 3JXVA 4C02B 4DRNA 4DWSC 5HKGA 3RFWA 1FKDA 2F4EA 1YATA 1FFRA 4TX0A 4ODOA 3JYJA 4BF8A 2WM0A 3GPKA 4Z2LA 2G41A 2OFNA 3KAFA 4ZS6A 3CHCA 1X6NA 2VCDA 3PRDA 1E9LA 2LKNA 3NRKA 2XP9A 1FKLA 4P8UA 1Q6HA 3WIJA 1ITXA 2WLYA 1FFQA 4WKFA 4U86A 4HBEA 1WNOA 3QOKA 2KR7A 3PR9A 2MF9A 2MLXA 3O5PA 2OLHA 4MNLA 2WK2A 2DG3A 5HW8A 5DEZA 4NNRA 3B9DA 1XHGA 2RQSA 2AWGA 1ZK6A 4QT3A 1NMWA 2YBTA 1NWUA 3WL1A 1EQ3A 4NSBA 3ARZA 4URIA 2KFWA 2DT3A 2PPOA 4DRQA 1W1VA 4ITZA 5B8IC 4Z2KA 4MTVA 4TW8A 3O5MA 4ZPWR 4LAYA 3BXWA 4IT6A 4W9OA 3IHZA 4QZVB 1WAWA 4DROA 4MPKA 3AS3A 3O5RA 2DSVA 2ZQVA 4L3NA 4IQCA 1JNEA 1NSGA 2VN1A 4G2PA 4LAXA 2XP3A 4ODMA 1E6PA 2RUCA 4JFLA 3UF8A 3IKGA 1W1YA 4TW6A 4W9QA 2MLZA 2PV3A 3ARRA 5DIUA 4DZ3A 3IKDA 1A7XA 1OGBA 3LUOA 1U79A 1ZL1A 3JYMA 4J4NA 1N1AA 3ARVA 3ODKA 1J4HA 1HKKA 3WL0A 1BL4A 1GOIA 2XP8A 1E6ZA 2DT2A 2M08A 4ML4A 1JVWA 2QF8A 1W9PA 1ZB5A 1HJVA 1ZBKA 2MPHA 3CH9A 1HJWA 3IK8A 5GPGA 1NWRA 3TDBA 1IX5A 1D7JA 3PA7A 3UQIA 3KACA 1D2KA 4WKHA 1FKSA 1FKKA 2A3CA 2DG4A 3G6MA 1HJXA 2PBCA 1ZBWA 3MDYB 3TC5A 2RSEA 4DWSB 3ARWA 2DSWA 3CHDA 1Q6UA 3AS1A 2PPNA 4ODNA 4FAPA 4MNJA 4JFJA 2F21A 2Y78A 1QZ2A 1H0IA 2B31A 1FKRA 3KABA 1LL6A 1FKHA 1B6CA 3UI6A 3CGMA 1RD6A 4MGVA 1C9HA 2UZ5A 3ALGA 1L1PA 5GPRA 1LJYA 3RM8A 2A3AA 5I98A 1FKJA 1FJDA 2WLZA 2KI3A 1EHNA 2XP5A 3O5EA 4TNSA 3WD1A 2DG9A 4LAVA 3AS0A 3CHFA 3FXYA 5J6EA 4MAVA 2LPVA 2F2DA 2PV1A 4J4OA 1LQ0A 3ARYA 1FKGA 1D7HA 2A3EA 1D7IA 4P8VA 3EY6A 4PTMA 1FKFA 1E6NA 1R9HA 1H0GA 1FKIA 1QPFA 2PV2A 1LL7A 5HT1A 4ODRA 1KT1A 1TCOC 1O6IA 3WD2A 2XP4A 4P8XA 2LJ4A 3O5LA 3FAPA 2K8IA 5DITA 4QT2A 4GIVA 4O2TA 4DRJA 2FDMA 5BXJA 4DZ2A 1EIBA 3WD4A 1TFVA 4Z2IA 4ZPVR 3G6LA 1ZBCA 1GPFA 4DRIA 4KQZA 3B7XA 4P8WA 4DRMA 5HWCA 3KZ7A 3KCEA 1Q6IA 1EYMA 5DF0A 1FD9A 3KAIA 4DWSD 3ARUA 4GGQA 3ARQA 4QIBA 3UI4A 2D9FA 2M2AA 3I6CA 2Q5AA 2YBUA 5GQBA 1HKJA 3PRAA 4L72B 1JNDA 2O9OA 4DIPA 2ZQTA 3O5JA 3O5OA 3OA5A 1SR0A 2RURA 2A3BA 1ROTA 5DO2A 4DRKA 1W9UA 4WK9A 1YW5A 3CZ8A 1X6LA 4XAKA 5HBFA 1W1TA 1P5QA 3B8SA 1LL4A 1SYTA 1W9VA 1KFWA 1PINA 2RUDA 4JFKA 3UQAA 3O5KA 1LG1A 2PPPA 1HKIA 4WIWA 2AOSA 4JFIA 1BKFA 3UI5A 1J4IA 1ZCNA 1VF8A 4TYOA 2IUZA 4LGXA 1F40A 1HKMA 2DT0A 1PBKA 2XP6A 3RGCA 4ODKA 4W9PA 3AQUA 1J4RA 5D75A 2LGOA 3ARPA 4ZPTR 4IPXA 4JFMA 3ARXA 3PRBA 2JZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UF8 A;  1KT0 A;  3IKG A;  2ZR5 A;  4TW6 A;  2LJ4 A;  3O5L A;  4W9Q A;  1HXV A;  4DRH A;  2MLZ A;  2K8I A;  2PV3 A;  3FAP A;  5DIT A;  3NI6 A;  5DIU A;  4DZ3 A;  1T11 A;  2KE0 A;  3IKD A;  4G50 A;  4GIV A;  4O2T A;  4QT2 A;  1A7X A;  3O5Q A;  3TCZ A;  4DRJ A;  4DZ2 A;  5BXJ A;  3LUO A;  1U79 A;  3JYM A;  4J4N A;  1N1A A;  2XPB A;  1FKB A;  2FKE A;  3ODK A;  2N87 A;  5HWB A;  1JNS A;  1J4H A;  3CGN A;  2ITK A;  1M5Y A;  4ODM A;  1J6Y A;  1Y0O A;  2L2S A;  3H9R B;  5HW6 A;  1BL4 A;  3KAG A;  4JYS A;  4FN2 A;  5D75 A;  4ODL A;  4DRI A;  2XP8 A;  3JXV A;  4LAX A;  4C02 B;  4DRN A;  5HKG A;  3B7X A;  2M08 A;  3RFW A;  1FKD A;  1JVW A;  2F4E A;  3IK8 A;  4R0X A;  2MPH A;  4LAW A;  2RUQ A;  5GPG A;  3TDB A;  4DRM A;  1YAT A;  3WH0 A;  5HWC A;  4TX0 A;  2ZR6 A;  3KZ7 A;  4ODO A;  3KCE A;  3JYJ A;  1D7J A;  2MLY A;  3PA7 A;  4TW7 A;  4BF8 A;  2M1I A;  1FKT A;  3GPK A;  3UQI A;  1Q6I A;  3KAC A;  1EYM A;  2OFN A;  4IQ2 A;  3UQB A;  1FKS A;  1FKK A;  2DG4 A;  3KAD A;  3KAF A;  1FD9 A;  2VCD A;  3KAI A;  3O5D A;  3O5G A;  2PBC A;  4GGQ A;  3UI4 A;  2ZR4 A;  4JFL A;  2D9F A;  2KO7 A;  2M2A A;  3I6C A;  3MDY B;  2RSE A;  3NTP A;  3PRD A;  4ODQ A;  3TC5 A;  2Q5A A;  1FAP A;  1NMV A;  2LKN A;  3NRK A;  2XP9 A;  1FKL A;  3OOB A;  2XP7 A;  1Q6U A;  4U84 A;  1Q6H A;  4ODP A;  2PPN A;  4ODN A;  4FAP A;  1F8A B;  4U86 A;  5HTG A;  4JFJ A;  3O5I A;  4DIP A;  2F21 A;  2ZQT A;  2ZQU A;  3O5J A;  2Y78 A;  1QZ2 A;  3O5O A;  1FKR A;  3KAB A;  2KR7 A;  2RUR A;  1FKH A;  1B6C A;  3UI6 A;  3CGM A;  2MF9 A;  1ROT A;  2MLX A;  3O5P A;  4DRK A;  4MGV A;  1C9H A;  2KGJ A;  1ROU A;  2MNT A;  1YW5 A;  2UZ5 A;  2DG3 A;  4DRP A;  5HW8 A;  5HW7 A;  1L1P A;  4NNR A;  2RQS A;  1P5Q A;  2AWG A;  5I98 A;  1FKJ A;  1FJD A;  1ZK6 A;  4QT3 A;  1NMW A;  1D6O A;  2KI3 A;  4MSP A;  1PIN A;  2XP5 A;  3O5E A;  4TNS A;  4DT4 A;  2RUD A;  4JFK A;  2IF4 A;  1QPL A;  3UQA A;  3O5K A;  2PPP A;  1EQ3 A;  2DG9 A;  2FAP A;  4LAV A;  4DH0 A;  5J6E A;  2KFW A;  3O5F A;  4JFI A;  2LPV A;  2PPO A;  4DRQ A;  1BKF A;  2F2D A;  1JNT A;  3UI5 A;  1J4I A;  2PV1 A;  4ITZ A;  5B8I C;  1ZCN A;  4J4O A;  4TYO A;  5DIV A;  1FKG A;  1D7H A;  4TW8 A;  3O5M A;  4LAY A;  1D7I A;  1F40 A;  3EY6 A;  4W9O A;  1PBK A;  1FKF A;  3IHZ A;  1R9H A;  1W26 A;  2XP6 A;  3RGC A;  2XPA A;  4ODK A;  1FKI A;  5HUA A;  4W9P A;  4QIB A;  4DRO A;  1QPF A;  2PV2 A;  5HT1 A;  1J4R A;  2ZQV A;  2LGO A;  2ZQS A;  3KAH A;  3O5R A;  2VN1 A;  1NSG A;  4G2P A;  1KT1 A;  4IQC A;  1Q1C A;  1TCO C;  2XP3 A;  4IPX A;  4JFM A;  4ODR A;  4U85 A;  2RUC A;  4N19 A;  3VAW A;  3PRB A;  2JZV A;  2XP4 A; 
#chains in the Genus database with same CATH topology
 1KT0 A;  1GUV A;  4Z2H A;  4HBO A;  3NI6 A;  1LG2 A;  1XRV A;  4MNK A;  2KE0 A;  4G50 A;  3TCZ A;  1K9T A;  3RM9 A;  3B9A A;  3GTY X;  1ZBV A;  2FKE A;  5HWB A;  3CGN A;  2ITK A;  1M5Y A;  1J6Y A;  1Y0O A;  2L2S A;  2PI6 A;  4AY1 A;  1WB0 A;  4Q7N A;  4WKA A;  2DPE A;  4R0X A;  4LAW A;  2RUQ A;  3WH0 A;  2ZR6 A;  4DWS A;  3RM4 A;  2MLY A;  2G8Z A;  4TW7 A;  2M1I A;  1FKT A;  3RME A;  2ESC A;  4HAR A;  4IQ2 A;  3UQB A;  4S3K A;  3KAD A;  4KR0 B;  3O5D A;  2ETN A;  3O5G A;  5JH8 A;  4Q22 A;  2ZR4 A;  2KO7 A;  3B9E A;  3NTP A;  5HTG A;  2O92 A;  4ODQ A;  1OWQ A;  1FAP A;  1NMV A;  3FY1 A;  3BMB A;  3OOB A;  2XP7 A;  4U84 A;  3WD3 A;  4ODP A;  4W5U A;  1F8A B;  1ZU8 A;  2DT1 A;  3O5I A;  2ZQU A;  2PN0 A;  4NZC A;  1E6R A;  4MNM A;  1NWS A;  2KGJ A;  2MNT A;  1ROU A;  4DRP A;  5HW7 A;  3WD0 A;  4R5E A;  1NH6 A;  1D6O A;  4MSP A;  4Z2G A;  4DT4 A;  3AS2 A;  2IF4 A;  1QPL A;  2FAP A;  4DH0 A;  3O5F A;  3WQW A;  1EDQ A;  2DSU A;  1JNT A;  3ARS A;  4S3J A;  5DIV A;  1UR9 A;  4IT4 A;  2DSZ A;  1W26 A;  2XPA A;  5HUA A;  1NWT A;  2ZQS A;  3KAH A;  4U85 A;  1Q1C A;  3GU0 A;  1CTN A;  4N19 A;  3VAW A;  3WQV A;  3WKZ A;  4WJX A;  2ZR5 A;  1HXV A;  3ART A;  4DRH A;  3W4R A;  1UR8 A;  1T11 A;  3O5Q A;  3ALF A;  1OGG A;  4Z2J A;  1E15 A;  2XPB A;  1FKB A;  2N87 A;  1JNS A;  3H9R B;  5HW6 A;  1W1P A;  3KAG A;  4JYS A;  3CHE A;  4FN2 A;  3ARO A;  4ODL A;  3JXV A;  2F23 A;  4C02 B;  4DRN A;  4DWS C;  5HKG A;  3RFW A;  1FKD A;  2F4E A;  1YAT A;  1FFR A;  4TX0 A;  4ODO A;  3JYJ A;  4BF8 A;  2WM0 A;  3GPK A;  4Z2L A;  2G41 A;  2OFN A;  3KAF A;  4ZS6 A;  3CHC A;  1X6N A;  2VCD A;  3PRD A;  1E9L A;  2LKN A;  3NRK A;  2XP9 A;  1FKL A;  4P8U A;  1Q6H A;  3WIJ A;  1ITX A;  2WLY A;  1FFQ A;  4WKF A;  4U86 A;  2B5U B;  4HBE A;  1WNO A;  3QOK A;  2KR7 A;  3PR9 A;  2MF9 A;  2MLX A;  3O5P A;  2OLH A;  4MNL A;  2WK2 A;  2DG3 A;  5HW8 A;  5DEZ A;  4NNR A;  3B9D A;  1XHG A;  2RQS A;  2AWG A;  1ZK6 A;  4QT3 A;  1NMW A;  2YBT A;  1NWU A;  3WL1 A;  1EQ3 A;  4NSB A;  3ARZ A;  4URI A;  2KFW A;  2DT3 A;  2PPO A;  4DRQ A;  1W1V A;  4ITZ A;  5B8I C;  4Z2K A;  4MTV A;  4TW8 A;  3O5M A;  4ZPW R;  4LAY A;  3BXW A;  4IT6 A;  4W9O A;  3IHZ A;  4QZV B;  1WAW A;  4DRO A;  4MPK A;  3AS3 A;  3O5R A;  2DSV A;  2ZQV A;  4L3N A;  4IQC A;  1JNE A;  1NSG A;  2VN1 A;  4G2P A;  4LAX A;  2XP3 A;  4ODM A;  1E6P A;  2RUC A;  4JFL A;  3UF8 A;  3IKG A;  1W1Y A;  4TW6 A;  4W9Q A;  2MLZ A;  2PV3 A;  3ARR A;  5DIU A;  4DZ3 A;  3IKD A;  1A7X A;  1OGB A;  3LUO A;  1U79 A;  1ZL1 A;  3JYM A;  4J4N A;  1N1A A;  3ARV A;  3ODK A;  1J4H A;  1HKK A;  3WL0 A;  1BL4 A;  1GOI A;  2XP8 A;  1E6Z A;  2DT2 A;  2M08 A;  4ML4 A;  1JVW A;  2QF8 A;  1W9P A;  1ZB5 A;  1HJV A;  1ZBK A;  2MPH A;  3CH9 A;  1HJW A;  3IK8 A;  5GPG A;  1NWR A;  3TDB A;  1IX5 A;  1D7J A;  3PA7 A;  3UQI A;  3KAC A;  1D2K A;  4WKH A;  1FKS A;  1FKK A;  2A3C A;  2DG4 A;  3G6M A;  1HJX A;  2PBC A;  2P4V A;  1ZBW A;  3MDY B;  3TC5 A;  2RSE A;  4DWS B;  3ARW A;  2DSW A;  3CHD A;  1Q6U A;  3AS1 A;  2PPN A;  4ODN A;  4FAP A;  4MNJ A;  4JFJ A;  2F21 A;  2Y78 A;  1QZ2 A;  1H0I A;  2B31 A;  1FKR A;  3KAB A;  1LL6 A;  1FKH A;  1B6C A;  3UI6 A;  3CGM A;  1RD6 A;  4MGV A;  1C9H A;  2UZ5 A;  3ALG A;  1L1P A;  1E44 A;  5GPR A;  1LJY A;  3RM8 A;  2A3A A;  5I98 A;  1FKJ A;  1FJD A;  2WLZ A;  2KI3 A;  1EHN A;  2XP5 A;  3O5E A;  4TNS A;  1JCH B;  3WD1 A;  2DG9 A;  4LAV A;  3AS0 A;  3CHF A;  3FXY A;  5J6E A;  4MAV A;  2LPV A;  2F2D A;  2PV1 A;  4J4O A;  1LQ0 A;  3ARY A;  1FKG A;  1D7H A;  2A3E A;  1D7I A;  4P8V A;  3EY6 A;  4PTM A;  1FKF A;  1E6N A;  1R9H A;  1H0G A;  1FKI A;  1QPF A;  2PV2 A;  1LL7 A;  5HT1 A;  4ODR A;  1KT1 A;  1TCO C;  1O6I A;  3WD2 A;  2XP4 A;  4P8X A;  2LJ4 A;  3O5L A;  3FAP A;  2K8I A;  5DIT A;  4QT2 A;  4GIV A;  4O2T A;  4DRJ A;  2FDM A;  5BXJ A;  4DZ2 A;  1EIB A;  3WD4 A;  1TFV A;  4Z2I A;  4ZPV R;  3G6L A;  1ZBC A;  1GPF A;  4DRI A;  4KQZ A;  3B7X A;  4P8W A;  4DRM A;  5HWC A;  3KZ7 A;  3KCE A;  1Q6I A;  1EYM A;  5DF0 A;  1FD9 A;  3KAI A;  4DWS D;  3ARU A;  4GGQ A;  3ARQ A;  4QIB A;  3UI4 A;  2D9F A;  2M2A A;  3I6C A;  2Q5A A;  2YBU A;  5GQB A;  1HKJ A;  3PRA A;  4L72 B;  1JND A;  2O9O A;  4DIP A;  2ZQT A;  3O5J A;  3O5O A;  3OA5 A;  1SR0 A;  2RUR A;  2A3B A;  1ROT A;  3EIP A;  5DO2 A;  4DRK A;  1W9U A;  4WK9 A;  1YW5 A;  3CZ8 A;  1X6L A;  4XAK A;  5HBF A;  2EUL A;  1W1T A;  1P5Q A;  3B8S A;  1GRJ A;  1LL4 A;  1SYT A;  1W9V A;  1KFW A;  1PIN A;  2RUD A;  4JFK A;  3UQA A;  3O5K A;  1LG1 A;  2PPP A;  1HKI A;  4WIW A;  2AOS A;  4JFI A;  1BKF A;  4UDM A;  3UI5 A;  1J4I A;  1ZCN A;  1VF8 A;  4TYO A;  2IUZ A;  4LGX A;  1F40 A;  1HKM A;  2DT0 A;  1PBK A;  2XP6 A;  3RGC A;  4ODK A;  4W9P A;  3AQU A;  1J4R A;  5D75 A;  2LGO A;  3ARP A;  4ZPT R;  4IPX A;  4JFM A;  3ARX A;  3PRB A;  2JZV A; 
#chains in the Genus database with same CATH homology
 1KT0 A;  1GUV A;  4Z2H A;  4HBO A;  3NI6 A;  1LG2 A;  1XRV A;  4MNK A;  2KE0 A;  4G50 A;  3TCZ A;  1K9T A;  3RM9 A;  3B9A A;  1ZBV A;  2FKE A;  5HWB A;  3CGN A;  2ITK A;  1M5Y A;  1J6Y A;  1Y0O A;  2L2S A;  2PI6 A;  4AY1 A;  1WB0 A;  4Q7N A;  4WKA A;  2DPE A;  4R0X A;  4LAW A;  2RUQ A;  3WH0 A;  2ZR6 A;  4DWS A;  3RM4 A;  2MLY A;  2G8Z A;  4TW7 A;  2M1I A;  1FKT A;  3RME A;  2ESC A;  4HAR A;  4IQ2 A;  3UQB A;  4S3K A;  3KAD A;  4KR0 B;  3O5D A;  3O5G A;  5JH8 A;  4Q22 A;  2ZR4 A;  2KO7 A;  3B9E A;  3NTP A;  5HTG A;  2O92 A;  4ODQ A;  1OWQ A;  1FAP A;  1NMV A;  3FY1 A;  3OOB A;  2XP7 A;  4U84 A;  3WD3 A;  4ODP A;  4W5U A;  1F8A B;  1ZU8 A;  2DT1 A;  3O5I A;  2ZQU A;  4NZC A;  1E6R A;  4MNM A;  1NWS A;  2KGJ A;  2MNT A;  1ROU A;  4DRP A;  5HW7 A;  3WD0 A;  4R5E A;  1NH6 A;  1D6O A;  4MSP A;  4Z2G A;  4DT4 A;  3AS2 A;  2IF4 A;  1QPL A;  2FAP A;  4DH0 A;  3O5F A;  3WQW A;  1EDQ A;  2DSU A;  1JNT A;  3ARS A;  4S3J A;  5DIV A;  1UR9 A;  4IT4 A;  2DSZ A;  1W26 A;  2XPA A;  5HUA A;  1NWT A;  2ZQS A;  3KAH A;  4U85 A;  1Q1C A;  1CTN A;  4N19 A;  3VAW A;  3WQV A;  3WKZ A;  4WJX A;  2ZR5 A;  1HXV A;  3ART A;  4DRH A;  3W4R A;  1UR8 A;  1T11 A;  3O5Q A;  3ALF A;  1OGG A;  4Z2J A;  1E15 A;  2XPB A;  1FKB A;  2N87 A;  1JNS A;  3H9R B;  5HW6 A;  1W1P A;  3KAG A;  4JYS A;  3CHE A;  4FN2 A;  3ARO A;  4ODL A;  3JXV A;  4C02 B;  4DRN A;  4DWS C;  5HKG A;  3RFW A;  1FKD A;  2F4E A;  1YAT A;  1FFR A;  4TX0 A;  4ODO A;  3JYJ A;  4BF8 A;  2WM0 A;  3GPK A;  4Z2L A;  2G41 A;  2OFN A;  3KAF A;  4ZS6 A;  3CHC A;  1X6N A;  2VCD A;  3PRD A;  1E9L A;  2LKN A;  3NRK A;  2XP9 A;  1FKL A;  4P8U A;  1Q6H A;  3WIJ A;  1ITX A;  2WLY A;  1FFQ A;  4WKF A;  4U86 A;  4HBE A;  1WNO A;  3QOK A;  2KR7 A;  3PR9 A;  2MF9 A;  2MLX A;  3O5P A;  2OLH A;  4MNL A;  2WK2 A;  2DG3 A;  5HW8 A;  5DEZ A;  4NNR A;  3B9D A;  1XHG A;  2RQS A;  2AWG A;  1ZK6 A;  4QT3 A;  1NMW A;  2YBT A;  1NWU A;  3WL1 A;  1EQ3 A;  4NSB A;  3ARZ A;  4URI A;  2KFW A;  2DT3 A;  2PPO A;  4DRQ A;  1W1V A;  4ITZ A;  5B8I C;  4Z2K A;  4MTV A;  4TW8 A;  3O5M A;  4ZPW R;  4LAY A;  3BXW A;  4IT6 A;  4W9O A;  3IHZ A;  4QZV B;  1WAW A;  4DRO A;  4MPK A;  3AS3 A;  3O5R A;  2DSV A;  2ZQV A;  4L3N A;  4IQC A;  1JNE A;  1NSG A;  2VN1 A;  4G2P A;  4LAX A;  2XP3 A;  4ODM A;  1E6P A;  2RUC A;  4JFL A;  3UF8 A;  3IKG A;  1W1Y A;  4TW6 A;  4W9Q A;  2MLZ A;  2PV3 A;  3ARR A;  5DIU A;  4DZ3 A;  3IKD A;  1A7X A;  1OGB A;  3LUO A;  1U79 A;  1ZL1 A;  3JYM A;  4J4N A;  1N1A A;  3ARV A;  3ODK A;  1J4H A;  1HKK A;  3WL0 A;  1BL4 A;  1GOI A;  2XP8 A;  1E6Z A;  2DT2 A;  2M08 A;  4ML4 A;  1JVW A;  2QF8 A;  1W9P A;  1ZB5 A;  1HJV A;  1ZBK A;  2MPH A;  3CH9 A;  1HJW A;  3IK8 A;  5GPG A;  1NWR A;  3TDB A;  1IX5 A;  1D7J A;  3PA7 A;  3UQI A;  3KAC A;  1D2K A;  4WKH A;  1FKS A;  1FKK A;  2A3C A;  2DG4 A;  3G6M A;  1HJX A;  2PBC A;  1ZBW A;  3MDY B;  3TC5 A;  2RSE A;  4DWS B;  3ARW A;  2DSW A;  3CHD A;  1Q6U A;  3AS1 A;  2PPN A;  4ODN A;  4FAP A;  4MNJ A;  4JFJ A;  2F21 A;  2Y78 A;  1QZ2 A;  1H0I A;  2B31 A;  1FKR A;  3KAB A;  1LL6 A;  1FKH A;  1B6C A;  3UI6 A;  3CGM A;  1RD6 A;  4MGV A;  1C9H A;  2UZ5 A;  3ALG A;  1L1P A;  5GPR A;  1LJY A;  3RM8 A;  2A3A A;  5I98 A;  1FKJ A;  1FJD A;  2WLZ A;  2KI3 A;  1EHN A;  2XP5 A;  3O5E A;  4TNS A;  3WD1 A;  2DG9 A;  4LAV A;  3AS0 A;  3CHF A;  3FXY A;  5J6E A;  4MAV A;  2LPV A;  2F2D A;  2PV1 A;  4J4O A;  1LQ0 A;  3ARY A;  1FKG A;  1D7H A;  2A3E A;  1D7I A;  4P8V A;  3EY6 A;  4PTM A;  1FKF A;  1E6N A;  1R9H A;  1H0G A;  1FKI A;  1QPF A;  2PV2 A;  1LL7 A;  5HT1 A;  4ODR A;  1KT1 A;  1TCO C;  1O6I A;  3WD2 A;  2XP4 A;  4P8X A;  2LJ4 A;  3O5L A;  3FAP A;  2K8I A;  5DIT A;  4QT2 A;  4GIV A;  4O2T A;  4DRJ A;  2FDM A;  5BXJ A;  4DZ2 A;  1EIB A;  3WD4 A;  1TFV A;  4Z2I A;  4ZPV R;  3G6L A;  1ZBC A;  1GPF A;  4DRI A;  4KQZ A;  3B7X A;  4P8W A;  4DRM A;  5HWC A;  3KZ7 A;  3KCE A;  1Q6I A;  1EYM A;  5DF0 A;  1FD9 A;  3KAI A;  4DWS D;  3ARU A;  4GGQ A;  3ARQ A;  4QIB A;  3UI4 A;  2D9F A;  2M2A A;  3I6C A;  2Q5A A;  2YBU A;  5GQB A;  1HKJ A;  3PRA A;  4L72 B;  1JND A;  2O9O A;  4DIP A;  2ZQT A;  3O5J A;  3O5O A;  3OA5 A;  1SR0 A;  2RUR A;  2A3B A;  1ROT A;  5DO2 A;  4DRK A;  1W9U A;  4WK9 A;  1YW5 A;  3CZ8 A;  1X6L A;  4XAK A;  5HBF A;  1W1T A;  1P5Q A;  3B8S A;  1LL4 A;  1SYT A;  1W9V A;  1KFW A;  1PIN A;  2RUD A;  4JFK A;  3UQA A;  3O5K A;  1LG1 A;  2PPP A;  1HKI A;  4WIW A;  2AOS A;  4JFI A;  1BKF A;  3UI5 A;  1J4I A;  1ZCN A;  1VF8 A;  4TYO A;  2IUZ A;  4LGX A;  1F40 A;  1HKM A;  2DT0 A;  1PBK A;  2XP6 A;  3RGC A;  4ODK A;  4W9P A;  3AQU A;  1J4R A;  5D75 A;  2LGO A;  3ARP A;  4ZPT R;  4IPX A;  4JFM A;  3ARX A;  3PRB A;  2JZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...