2OFNA

Solution structure of fk506-binding domain (fkbd)of fkbp35 from plasmodium falciparum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
135
structure length
135
Chain Sequence
b'MTTEQEFEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 70 kDa peptidylprolyl isomerase, putative
publication title Solution structure of FK506 binding domain (FKBD) of Plasmodium falciparum FK506 binding protein 35 (PfFKBP35).
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 17
structure length 135
sequence length 135
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ofnA01
3PRDA 2PPOA 2PV1A 4TX0A 3PA7A 5HW7A 2XP9A 1ZCNA 4QT2A 3TCZA 1FKHA 4O2TA 2KO7A 1FKTA 4U84A 4DRNA 1Q6UA 2LJ4A 1U79A 2DG3A 4DRIA 1HXVA 3JXVA 2PV3A 4LAVA 2RUQA 2PPNA 3IKDA 1FKGA 2ZR4A 4ODMA 1J4HA 2XPAA 1M5YA 4QT3A 4FAPA 3IK8A 3KAGA 1Q6IA 2KI3A 3O5OA 2LPVA 3KACA 1F8AB 4ODLA 2K8IA 1ROUA 1NMWA 2XP8A 4ITZA 2RUCA 3JYJA 3UF8A 4DIPA 4LAYA 4G2PA 3B7XA 3TC5A 5DITA 3UI5A 3O5RA 2RUDA 3ODKA 4U85A 3UQBA 2PV2A 2KR7A 2AWGA 4JFIA 1A7XA 2M08A 3OOBA 3LUOA 5HW6A 4ODNA 1J4IA 2MLZA 1N1AA 2N87A 3O5MA 3CGNA 4ODRA 2XPBA 4QIBA 3VAWA 2ZR5A 2KE0A 3IKGA 4DRPA 4R0XA 2MLYA 2D9FA 3EY6A 4W9OA 1FKFA 3GPKA 4JFLA 5BXJA 1R9HA 3O5JA 1KT0A 2VN1A 1D6OA 1J4RA 3O5GA 4J4OA 4TNSA 5D75A 1Y0OA 4DH0A 4ODKA 2FKEA 3RFWA 4DROA 1NMVA 2MLXA 4DRQA 1FJDA 4W9PA 1ZK6A 4ODQA 5HW8A 1Q1CA 1PBKA 1ROTA 2KGJA 2LGOA 1FKKA 1P5QA 2MF9A 3CGMA 2F21A 1D7HA 2KFWA 2Y78A 4JYSA 2M1IA 1FD9A 4DZ2A 4LAXA 1BL4A 4IQ2A 3IHZA 1FAPA 3O5QA 3KCEA 3KAFA 2DG4A 5GPGA 5HWCA 1FKLA 2XP5A 5HTGA 1QZ2A 1FKJA 2XP7A 4J4NA 3TDBA 3KAIA 3O5IA 2VCDA 2IF4A 3KABA 2DG9A 3KZ7A 2MPHA 3PRBA 3O5KA 3UI6A 1QPFA 2UZ5A 3UI4A 1D7JA 4MSPA 1L1PA 1FKSA 4W9QA 2MNTA 2RURA 1JVWA 4TW8A 2ITKA 3H9RB 5HUAA 3MDYB 4ODOA 3O5EA 5I98A 2ZQVA 3FAPA 5J6EA 1EYMA 1FKBA 2ZQTA 3I6CA 2JZVA 5DIVA 2Q5AA 1YATA 2RQSA 3UQAA 2XP6A 4IQCA 2RSEA 4NNRA 2ZQSA 5DIUA 2L2SA 4DRJA 1J6YA 3KAHA 1BKFA 3NI6A 1KT1A 1JNTA 1C9HA 2XP4A 5B8IC 4U86A 4G50A 4JFJA 3RGCA 4MGVA 2XP3A 3O5FA 2PBCA 4FN2A 1D7IA 3JYMA 1JNSA 1TCOC 1B6CA 5HT1A 3O5DA 1W26A 4GIVA 2LKNA 1FKDA 1T11A 5HKGA 1Q6HA 4JFKA 4JFMA 1YW5A 3KADA 4TYOA 5HWBA 4DT4A 4TW6A 3O5PA 4DRMA 1FKIA 2M2AA 4GGQA 4DRHA 3NTPA 1NSGA 4ODPA 1QPLA 4LAWA 1EQ3A 4IPXA 3UQIA 4DZ3A 2F2DA 3O5LA 2OFNA 4DRKA 3NRKA 2PPPA 4BF8A 1PINA 2FAPA 1F40A 1FKRA 4TW7A 4N19A 3WH0A 2ZQUA 4C02B 2F4EA 2ZR6A
chains in the Genus database with same CATH superfamily
2YBTA 2PV1A 4TX0A 3PA7A 2XP9A 1FKHA 1HKJA 4Q7NA 1E6RA 4P8WA 1U79A 2DG3A 2PV3A 2RUQA 2XPAA 1M5YA 4FAPA 1Q6IA 3PRAA 1W9VA 1NH6A 3JYJA 3B9DA 4MNKA 3O5RA 2RUDA 4NSBA 3QOKA 2DT3A 2PV2A 3UQBA 3G6MA 3PR9A 3B8SA 4DWSA 2DSZA 4DWSD 3G6LA 1X6NA 2A3AA 4QIBA 4DRPA 2D9FA 1LL6A 3O5JA 2VN1A 1D6OA 4TNSA 4J4OA 4ODKA 4DROA 4NZCA 2YBUA 3AQUA 5HW8A 1Q1CA 1PBKA 2LGOA 3CGMA 4W9OA 3UF8A 4Z2HA 2F21A 1D7HA 4WIWA 2FDMA 4HARA 1FAPA 3KCEA 5GPGA 4P8XA 1VF8A 2DSUA 3O5IA 3WD1A 2IF4A 3KABA 3RM8A 5HBFA 1NWTA 3RM4A 2IUZA 4MSPA 1FKSA 4W9QA 1JVWA 3B9AA 3BMBA 3ARQA 3BXWA 5J6EA 1TFVA 3ARTA 1YATA 4IT6A 1SR0A 1J6YA 1BKFA 3WKZA 4MNLA 3WD3A 1HKIA 1WAWA 4JFJA 3GU0A 2XP3A 1JNSA 4PTMA 4P8VA 3RM9A 1W26A 2A3CA 2OLHA 5HKGA 3AROA 1YW5A 3ARXA 4TW6A 2ESCA 3ARRA 1ZBKA 4LAWA 3WD2A 3FXYA 3O5LA 1E6PA 1PINA 2ZQUA 2F4EA 2PPOA 5HW7A 1ZCNA 4ZPWR 5DF0A 1FKTA 1HJWA 1EHNA 4WKFA 2LJ4A 4DRIA 3JXVA 4LAVA 1JNEA 2WLYA 1W1YA 3KAGA 2DT2A 1GRJA 2LPVA 1F8AB 2K8IA 1ITXA 2WLZA 1W9PA 2XP8A 3EIPA 3B7XA 3WD0A 4ZPTR 3ODKA 4U85A 4JFIA 3LUOA 2F23A 1XRVA 1N1AA 2MLZA 3VAWA 3CGNA 4UDMA 4R0XA 4ZS6A 1NWSA 1FKFA 1R9HA 1WNOA 1J4RA 3CHEA 3ARVA 1Y0OA 4QZVB 2FKEA 3RFWA 2MLXA 5GPRA 4W9PA 3WQVA 4ODQA 2AOSA 1ROTA 2KGJA 3KAFA 1FKKA 2B5UB 2M1IA 1FD9A 4LAXA 1BL4A 2WK2A 3CZ8A 2DG4A 1FKLA 1E6NA 2PN0A 4J4NA 4Z2GA 3TDBA 1OGBA 3KZ7A 4IT4A 5JH8A 1D7JA 1L1PA 2MNTA 2RURA 4LGXA 4TW8A 1H0IA 2ITKA 1D2KA 4MTVA 4XAKA 2G8ZA 5I98A 3FAPA 3I6CA 1W9UA 3UQAA 4IQCA 2RSEA 4NNRA 1UR9A 3AS3A 3RMEA 1W1PA 4DRJA 4WKHA 1KT1A 5B8IC 4U86A 4G50A 1NWRA 4AY1A 1OGGA 3ARYA 1TCOC 3CHFA 1ZBWA 1GPFA 4Z2IA 4GIVA 2LKNA 1T11A 1ZL1A 4DT4A 1LG2A 1XHGA 2DSWA 4GGQA 3NTPA 4Z2KA 2DSVA 3AS0A 4ML4A 4ZPVR 1E44A 3WH0A 2ZR6A 4KQZA 1EDQA 3TCZA 4O2TA 1ZBVA 4MNMA 4DRNA 1Q6UA 1HXVA 1O6IA 3IKDA 2PPNA 1E6ZA 1FKGA 2ZR4A 4S3JA 1J4HA 1HKMA 1LJYA 3IK8A 1LL4A 2KI3A 4ODLA 3CHCA 1ROUA 2O92A 1NMWA 4ITZA 1OWQA 4DIPA 1JNDA 3ARPA 4MPKA 5DITA 4KR0B 2AWGA 3OOBA 5HW6A 4ODNA 1J4IA 1E9LA 2N87A 3ARSA 3O5MA 4W5UA 4ODRA 2XPBA 3EY6A 5D75A 1CTNA 1KT0A 3O5GA 4DH0A 1FJDA 1ZK6A 1FKRA 1H0GA 1P5QA 4JYSA 2Y78A 4DZ2A 5DO2A 4IQ2A 3IHZA 2XP5A 5HTGA 3KAIA 2VCDA 2DG9A 1FFRA 2MPHA 3O5KA 3UI6A 2O9OA 1WB0A 2UZ5A 3UI4A 2ETNA 3H9RB 5HUAA 1ZU8A 3O5EA 4DWSB 1EYMA 2A3BA 1UR8A 2RQSA 1HJVA 3AS1A 5DIUA 3NI6A 4L72B 1C9HA 3WL1A 2G41A 2WM0A 3RGCA 3O5FA 4FN2A 3WIJA 1D7IA 4R5EA 3B9EA 4S3KA 1B6CA 5HT1A 1Q6HA 4JFKA 4JFMA 4WKAA 4WJXA 1W1TA 3O5PA 4DRHA 3WL0A 1NSGA 1QPLA 2B31A 1EQ3A 3UQIA 2DT1A 2OFNA 3NRKA 3WQWA 4TW7A 1JCHB 4N19A 1IX5A 4MNJA 3PRDA 4Z2JA 4QT2A 2KO7A 1E15A 4U84A 4MAVA 3ARUA 3GTYX 4ODMA 4QT3A 3O5OA 3ARZA 1KFWA 3KACA 1GOIA 1W1VA 3AS2A 2RUCA 4LAYA 4G2PA 3TC5A 1SYTA 1HJXA 3UI5A 3ARWA 1GUVA 2KR7A 1A7XA 2M08A 1EIBA 2ZR5A 2KE0A 3IKGA 2MLYA 4WK9A 1K9TA 1NWUA 1LL7A 3GPKA 4JFLA 5BXJA 1RD6A 4L3NA 1LG1A 1NMVA 4DRQA 2MF9A 3OA5A 2KFWA 1ZBCA 1HKKA 4HBOA 3O5QA 4Z2LA 5HWCA 5DEZA 1QZ2A 1FKJA 2P4VA 2XP7A 1LQ0A 3PRBA 4HBEA 1QPFA 2A3EA 3CHDA 3CH9A 4P8UA 3MDYB 4ODOA 2PI6A 2DT0A 2QF8A 2ZQVA 1FKBA 2ZQTA 2JZVA 5DIVA 1FFQA 2Q5AA 2XP6A 2ZQSA 5GQBA 2L2SA 3KAHA 4DWSC 1JNTA 2XP4A 4Q22A 3FY1A 4MGVA 2PBCA 3JYMA 2DPEA 3WD4A 3O5DA 2EULA 1FKDA 1ZB5A 3ALGA 3KADA 4TYOA 5HWBA 3W4RA 4DRMA 1FKIA 2M2AA 3ALFA 4ODPA 4IPXA 4URIA 4DZ3A 2F2DA 1X6LA 4DRKA 2PPPA 4BF8A 2FAPA 1F40A 4C02B
chains in the Genus database with same CATH topology
2YBTA 2PV1A 4TX0A 3PA7A 2XP9A 1FKHA 1HKJA 4Q7NA 1E6RA 4P8WA 1U79A 2DG3A 2PV3A 2RUQA 2XPAA 1M5YA 4FAPA 1Q6IA 3PRAA 1W9VA 1NH6A 3JYJA 3B9DA 4MNKA 3O5RA 2RUDA 4NSBA 3QOKA 2DT3A 2PV2A 3UQBA 3G6MA 3PR9A 3B8SA 4DWSA 2DSZA 4DWSD 3G6LA 1X6NA 2A3AA 4QIBA 4DRPA 2D9FA 1LL6A 3O5JA 2VN1A 1D6OA 4TNSA 4J4OA 4ODKA 4DROA 4NZCA 2YBUA 3AQUA 5HW8A 1Q1CA 1PBKA 2LGOA 3CGMA 4W9OA 3UF8A 4Z2HA 2F21A 1D7HA 4WIWA 2FDMA 4HARA 1FAPA 3KCEA 5GPGA 4P8XA 1VF8A 2DSUA 3O5IA 3WD1A 2IF4A 3KABA 3RM8A 5HBFA 1NWTA 3RM4A 2IUZA 4MSPA 1FKSA 4W9QA 1JVWA 3B9AA 3ARQA 3BXWA 5J6EA 1TFVA 3ARTA 1YATA 4IT6A 1SR0A 1J6YA 1BKFA 3WKZA 4MNLA 3WD3A 1HKIA 1WAWA 4JFJA 2XP3A 1JNSA 4PTMA 4P8VA 3RM9A 1W26A 2A3CA 2OLHA 5HKGA 3AROA 1YW5A 3ARXA 4TW6A 2ESCA 3ARRA 1ZBKA 4LAWA 3WD2A 3FXYA 3O5LA 1E6PA 1PINA 2ZQUA 2F4EA 2PPOA 5HW7A 1ZCNA 4ZPWR 5DF0A 1FKTA 1HJWA 1EHNA 4WKFA 2LJ4A 4DRIA 3JXVA 4LAVA 1JNEA 2WLYA 1W1YA 3KAGA 2DT2A 2LPVA 1F8AB 2K8IA 1ITXA 2WLZA 1W9PA 2XP8A 3WD0A 3B7XA 4ZPTR 3ODKA 4U85A 4JFIA 3LUOA 1XRVA 1N1AA 2MLZA 3VAWA 3CGNA 4R0XA 4ZS6A 1NWSA 1FKFA 1R9HA 1WNOA 1J4RA 3CHEA 3ARVA 1Y0OA 4QZVB 2FKEA 3RFWA 2MLXA 5GPRA 4W9PA 3WQVA 4ODQA 2AOSA 1ROTA 2KGJA 3KAFA 1FKKA 2M1IA 1FD9A 4LAXA 1BL4A 2WK2A 3CZ8A 2DG4A 1FKLA 1E6NA 4J4NA 4Z2GA 3TDBA 1OGBA 3KZ7A 4IT4A 5JH8A 1D7JA 1L1PA 2MNTA 2RURA 4LGXA 4TW8A 1H0IA 2ITKA 1D2KA 4MTVA 4XAKA 2G8ZA 5I98A 3FAPA 3I6CA 1W9UA 3UQAA 4IQCA 2RSEA 4NNRA 1UR9A 3AS3A 3RMEA 1W1PA 4DRJA 4WKHA 1KT1A 5B8IC 4U86A 4G50A 1NWRA 4AY1A 1OGGA 3ARYA 1TCOC 3CHFA 1ZBWA 1GPFA 4Z2IA 4GIVA 2LKNA 1T11A 1ZL1A 4DT4A 1LG2A 1XHGA 2DSWA 4GGQA 3NTPA 4Z2KA 2DSVA 3AS0A 4ML4A 4ZPVR 3WH0A 2ZR6A 4KQZA 1EDQA 3TCZA 4O2TA 1ZBVA 4MNMA 4DRNA 1Q6UA 1HXVA 1O6IA 3IKDA 2PPNA 1E6ZA 1FKGA 2ZR4A 4S3JA 1J4HA 1HKMA 1LJYA 3IK8A 1LL4A 2KI3A 4ODLA 3CHCA 1ROUA 2O92A 1NMWA 4ITZA 1OWQA 4DIPA 1JNDA 3ARPA 4MPKA 5DITA 4KR0B 2AWGA 3OOBA 5HW6A 4ODNA 1J4IA 1E9LA 2N87A 3ARSA 3O5MA 4W5UA 4ODRA 2XPBA 3EY6A 5D75A 1CTNA 1KT0A 3O5GA 4DH0A 1FJDA 1ZK6A 1FKRA 1H0GA 1P5QA 4JYSA 2Y78A 4DZ2A 5DO2A 4IQ2A 3IHZA 2XP5A 5HTGA 3KAIA 2VCDA 2DG9A 1FFRA 2MPHA 3O5KA 3UI6A 2O9OA 1WB0A 2UZ5A 3UI4A 3H9RB 5HUAA 1ZU8A 3O5EA 4DWSB 1EYMA 2A3BA 1UR8A 2RQSA 1HJVA 3AS1A 5DIUA 3NI6A 4L72B 1C9HA 3WL1A 2G41A 2WM0A 3RGCA 3O5FA 4FN2A 3WIJA 1D7IA 4R5EA 3B9EA 4S3KA 1B6CA 5HT1A 1Q6HA 4JFKA 4JFMA 4WKAA 4WJXA 1W1TA 3O5PA 4DRHA 3WL0A 1NSGA 1QPLA 2B31A 1EQ3A 3UQIA 2DT1A 2OFNA 3NRKA 3WQWA 4TW7A 4N19A 1IX5A 4MNJA 3PRDA 4Z2JA 4QT2A 2KO7A 1E15A 4U84A 4MAVA 3ARUA 4ODMA 4QT3A 3O5OA 3ARZA 1KFWA 3KACA 1GOIA 1W1VA 3AS2A 2RUCA 4LAYA 4G2PA 3TC5A 1SYTA 1HJXA 3UI5A 3ARWA 1GUVA 2KR7A 1A7XA 2M08A 1EIBA 2ZR5A 2KE0A 3IKGA 2MLYA 4WK9A 1K9TA 1NWUA 1LL7A 3GPKA 4JFLA 5BXJA 1RD6A 4L3NA 1LG1A 1NMVA 4DRQA 2MF9A 3OA5A 2KFWA 1ZBCA 1HKKA 4HBOA 3O5QA 4Z2LA 5HWCA 5DEZA 1QZ2A 1FKJA 2XP7A 1LQ0A 3PRBA 4HBEA 1QPFA 2A3EA 3CHDA 3CH9A 4P8UA 3MDYB 4ODOA 2PI6A 2DT0A 2QF8A 2ZQVA 1FKBA 2ZQTA 2JZVA 5DIVA 1FFQA 2Q5AA 2XP6A 2ZQSA 5GQBA 2L2SA 3KAHA 4DWSC 1JNTA 2XP4A 4Q22A 3FY1A 4MGVA 2PBCA 3JYMA 2DPEA 3WD4A 3O5DA 1FKDA 1ZB5A 3ALGA 3KADA 4TYOA 5HWBA 3W4RA 4DRMA 1FKIA 2M2AA 3ALFA 4ODPA 4IPXA 4URIA 4DZ3A 2F2DA 1X6LA 4DRKA 2PPPA 4BF8A 2FAPA 1F40A 4C02B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRD A;  2PPO A;  2PV1 A;  4TX0 A;  3PA7 A;  5HW7 A;  2XP9 A;  1ZCN A;  4QT2 A;  3TCZ A;  1FKH A;  4O2T A;  2KO7 A;  1FKT A;  4U84 A;  4DRN A;  1Q6U A;  2LJ4 A;  1U79 A;  2DG3 A;  4DRI A;  1HXV A;  3JXV A;  2PV3 A;  4LAV A;  2RUQ A;  2PPN A;  3IKD A;  1FKG A;  2ZR4 A;  4ODM A;  1J4H A;  2XPA A;  1M5Y A;  4QT3 A;  4FAP A;  3IK8 A;  3KAG A;  1Q6I A;  2KI3 A;  3O5O A;  2LPV A;  3KAC A;  1F8A B;  4ODL A;  2K8I A;  1ROU A;  1NMW A;  2XP8 A;  4ITZ A;  2RUC A;  3JYJ A;  3UF8 A;  4DIP A;  4LAY A;  4G2P A;  3B7X A;  3TC5 A;  5DIT A;  3UI5 A;  3O5R A;  2RUD A;  3ODK A;  4U85 A;  3UQB A;  2PV2 A;  2KR7 A;  2AWG A;  4JFI A;  1A7X A;  2M08 A;  3OOB A;  3LUO A;  5HW6 A;  4ODN A;  1J4I A;  2MLZ A;  1N1A A;  2N87 A;  3O5M A;  3CGN A;  4ODR A;  2XPB A;  4QIB A;  3VAW A;  2ZR5 A;  2KE0 A;  3IKG A;  4DRP A;  4R0X A;  2MLY A;  2D9F A;  3EY6 A;  4W9O A;  1FKF A;  3GPK A;  4JFL A;  5BXJ A;  1R9H A;  3O5J A;  1KT0 A;  2VN1 A;  1D6O A;  1J4R A;  3O5G A;  4J4O A;  4TNS A;  5D75 A;  1Y0O A;  4DH0 A;  4ODK A;  2FKE A;  3RFW A;  4DRO A;  1NMV A;  2MLX A;  4DRQ A;  1FJD A;  4W9P A;  1ZK6 A;  4ODQ A;  5HW8 A;  1Q1C A;  1PBK A;  1ROT A;  2KGJ A;  2LGO A;  1FKK A;  1P5Q A;  2MF9 A;  3CGM A;  2F21 A;  1D7H A;  2KFW A;  2Y78 A;  4JYS A;  2M1I A;  1FD9 A;  4DZ2 A;  4LAX A;  1BL4 A;  4IQ2 A;  3IHZ A;  1FAP A;  3O5Q A;  3KCE A;  3KAF A;  2DG4 A;  5GPG A;  5HWC A;  1FKL A;  2XP5 A;  5HTG A;  1QZ2 A;  1FKJ A;  2XP7 A;  4J4N A;  3TDB A;  3KAI A;  3O5I A;  2VCD A;  2IF4 A;  3KAB A;  2DG9 A;  3KZ7 A;  2MPH A;  3PRB A;  3O5K A;  3UI6 A;  1QPF A;  2UZ5 A;  3UI4 A;  1D7J A;  4MSP A;  1L1P A;  1FKS A;  4W9Q A;  2MNT A;  2RUR A;  1JVW A;  4TW8 A;  2ITK A;  3H9R B;  5HUA A;  3MDY B;  4ODO A;  3O5E A;  5I98 A;  2ZQV A;  3FAP A;  5J6E A;  1EYM A;  1FKB A;  2ZQT A;  3I6C A;  2JZV A;  5DIV A;  2Q5A A;  1YAT A;  2RQS A;  3UQA A;  2XP6 A;  4IQC A;  2RSE A;  4NNR A;  2ZQS A;  5DIU A;  2L2S A;  4DRJ A;  1J6Y A;  3KAH A;  1BKF A;  3NI6 A;  1KT1 A;  1JNT A;  1C9H A;  2XP4 A;  5B8I C;  4U86 A;  4G50 A;  4JFJ A;  3RGC A;  4MGV A;  2XP3 A;  3O5F A;  2PBC A;  4FN2 A;  1D7I A;  3JYM A;  1JNS A;  1TCO C;  1B6C A;  5HT1 A;  3O5D A;  1W26 A;  4GIV A;  2LKN A;  1FKD A;  1T11 A;  5HKG A;  1Q6H A;  4JFK A;  4JFM A;  1YW5 A;  3KAD A;  4TYO A;  5HWB A;  4DT4 A;  4TW6 A;  3O5P A;  4DRM A;  1FKI A;  2M2A A;  4GGQ A;  4DRH A;  3NTP A;  1NSG A;  4ODP A;  1QPL A;  4LAW A;  1EQ3 A;  4IPX A;  3UQI A;  4DZ3 A;  2F2D A;  3O5L A;  2OFN A;  4DRK A;  3NRK A;  2PPP A;  4BF8 A;  1PIN A;  2FAP A;  1F40 A;  1FKR A;  4TW7 A;  4N19 A;  3WH0 A;  2ZQU A;  4C02 B;  2F4E A;  2ZR6 A; 
#chains in the Genus database with same CATH topology
 2YBT A;  2PV1 A;  4TX0 A;  3PA7 A;  2XP9 A;  1FKH A;  1HKJ A;  4Q7N A;  1E6R A;  4P8W A;  1U79 A;  2DG3 A;  2PV3 A;  2RUQ A;  2XPA A;  1M5Y A;  4FAP A;  1Q6I A;  3PRA A;  1W9V A;  1NH6 A;  3JYJ A;  3B9D A;  4MNK A;  3O5R A;  2RUD A;  4NSB A;  3QOK A;  2DT3 A;  2PV2 A;  3UQB A;  3G6M A;  3PR9 A;  3B8S A;  4DWS A;  2DSZ A;  4DWS D;  3G6L A;  1X6N A;  2A3A A;  4QIB A;  4DRP A;  2D9F A;  1LL6 A;  3O5J A;  2VN1 A;  1D6O A;  4TNS A;  4J4O A;  4ODK A;  4DRO A;  4NZC A;  2YBU A;  3AQU A;  5HW8 A;  1Q1C A;  1PBK A;  2LGO A;  3CGM A;  4W9O A;  3UF8 A;  4Z2H A;  2F21 A;  1D7H A;  4WIW A;  2FDM A;  4HAR A;  1FAP A;  3KCE A;  5GPG A;  4P8X A;  1VF8 A;  2DSU A;  3O5I A;  3WD1 A;  2IF4 A;  3KAB A;  3RM8 A;  5HBF A;  1NWT A;  3RM4 A;  2IUZ A;  4MSP A;  1FKS A;  4W9Q A;  1JVW A;  3B9A A;  3BMB A;  3ARQ A;  3BXW A;  5J6E A;  1TFV A;  3ART A;  1YAT A;  4IT6 A;  1SR0 A;  1J6Y A;  1BKF A;  3WKZ A;  4MNL A;  3WD3 A;  1HKI A;  1WAW A;  4JFJ A;  3GU0 A;  2XP3 A;  1JNS A;  4PTM A;  4P8V A;  3RM9 A;  1W26 A;  2A3C A;  2OLH A;  5HKG A;  3ARO A;  1YW5 A;  3ARX A;  4TW6 A;  2ESC A;  3ARR A;  1ZBK A;  4LAW A;  3WD2 A;  3FXY A;  3O5L A;  1E6P A;  1PIN A;  2ZQU A;  2F4E A;  2PPO A;  5HW7 A;  1ZCN A;  4ZPW R;  5DF0 A;  1FKT A;  1HJW A;  1EHN A;  4WKF A;  2LJ4 A;  4DRI A;  3JXV A;  4LAV A;  1JNE A;  2WLY A;  1W1Y A;  3KAG A;  2DT2 A;  1GRJ A;  2LPV A;  1F8A B;  2K8I A;  1ITX A;  2WLZ A;  1W9P A;  2XP8 A;  3EIP A;  3B7X A;  3WD0 A;  4ZPT R;  3ODK A;  4U85 A;  4JFI A;  3LUO A;  2F23 A;  1XRV A;  1N1A A;  2MLZ A;  3VAW A;  3CGN A;  4UDM A;  4R0X A;  4ZS6 A;  1NWS A;  1FKF A;  1R9H A;  1WNO A;  1J4R A;  3CHE A;  3ARV A;  1Y0O A;  4QZV B;  2FKE A;  3RFW A;  2MLX A;  5GPR A;  4W9P A;  3WQV A;  4ODQ A;  2AOS A;  1ROT A;  2KGJ A;  3KAF A;  1FKK A;  2B5U B;  2M1I A;  1FD9 A;  4LAX A;  1BL4 A;  2WK2 A;  3CZ8 A;  2DG4 A;  1FKL A;  1E6N A;  2PN0 A;  4J4N A;  4Z2G A;  3TDB A;  1OGB A;  3KZ7 A;  4IT4 A;  5JH8 A;  1D7J A;  1L1P A;  2MNT A;  2RUR A;  4LGX A;  4TW8 A;  1H0I A;  2ITK A;  1D2K A;  4MTV A;  4XAK A;  2G8Z A;  5I98 A;  3FAP A;  3I6C A;  1W9U A;  3UQA A;  4IQC A;  2RSE A;  4NNR A;  1UR9 A;  3AS3 A;  3RME A;  1W1P A;  4DRJ A;  4WKH A;  1KT1 A;  5B8I C;  4U86 A;  4G50 A;  1NWR A;  4AY1 A;  1OGG A;  3ARY A;  1TCO C;  3CHF A;  1ZBW A;  1GPF A;  4Z2I A;  4GIV A;  2LKN A;  1T11 A;  1ZL1 A;  4DT4 A;  1LG2 A;  1XHG A;  2DSW A;  4GGQ A;  3NTP A;  4Z2K A;  2DSV A;  3AS0 A;  4ML4 A;  4ZPV R;  1E44 A;  3WH0 A;  2ZR6 A;  4KQZ A;  1EDQ A;  3TCZ A;  4O2T A;  1ZBV A;  4MNM A;  4DRN A;  1Q6U A;  1HXV A;  1O6I A;  3IKD A;  2PPN A;  1E6Z A;  1FKG A;  2ZR4 A;  4S3J A;  1J4H A;  1HKM A;  1LJY A;  3IK8 A;  1LL4 A;  2KI3 A;  4ODL A;  3CHC A;  1ROU A;  2O92 A;  1NMW A;  4ITZ A;  1OWQ A;  4DIP A;  1JND A;  3ARP A;  4MPK A;  5DIT A;  4KR0 B;  2AWG A;  3OOB A;  5HW6 A;  4ODN A;  1J4I A;  1E9L A;  2N87 A;  3ARS A;  3O5M A;  4W5U A;  4ODR A;  2XPB A;  3EY6 A;  5D75 A;  1CTN A;  1KT0 A;  3O5G A;  4DH0 A;  1FJD A;  1ZK6 A;  1FKR A;  1H0G A;  1P5Q A;  4JYS A;  2Y78 A;  4DZ2 A;  5DO2 A;  4IQ2 A;  3IHZ A;  2XP5 A;  5HTG A;  3KAI A;  2VCD A;  2DG9 A;  1FFR A;  2MPH A;  3O5K A;  3UI6 A;  2O9O A;  1WB0 A;  2UZ5 A;  3UI4 A;  2ETN A;  3H9R B;  5HUA A;  1ZU8 A;  3O5E A;  4DWS B;  1EYM A;  2A3B A;  1UR8 A;  2RQS A;  1HJV A;  3AS1 A;  5DIU A;  3NI6 A;  4L72 B;  1C9H A;  3WL1 A;  2G41 A;  2WM0 A;  3RGC A;  3O5F A;  4FN2 A;  3WIJ A;  1D7I A;  4R5E A;  3B9E A;  4S3K A;  1B6C A;  5HT1 A;  1Q6H A;  4JFK A;  4JFM A;  4WKA A;  4WJX A;  1W1T A;  3O5P A;  4DRH A;  3WL0 A;  1NSG A;  1QPL A;  2B31 A;  1EQ3 A;  3UQI A;  2DT1 A;  2OFN A;  3NRK A;  3WQW A;  4TW7 A;  1JCH B;  4N19 A;  1IX5 A;  4MNJ A;  3PRD A;  4Z2J A;  4QT2 A;  2KO7 A;  1E15 A;  4U84 A;  4MAV A;  3ARU A;  3GTY X;  4ODM A;  4QT3 A;  3O5O A;  3ARZ A;  1KFW A;  3KAC A;  1GOI A;  1W1V A;  3AS2 A;  2RUC A;  4LAY A;  4G2P A;  3TC5 A;  1SYT A;  1HJX A;  3UI5 A;  3ARW A;  1GUV A;  2KR7 A;  1A7X A;  2M08 A;  1EIB A;  2ZR5 A;  2KE0 A;  3IKG A;  2MLY A;  4WK9 A;  1K9T A;  1NWU A;  1LL7 A;  3GPK A;  4JFL A;  5BXJ A;  1RD6 A;  4L3N A;  1LG1 A;  1NMV A;  4DRQ A;  2MF9 A;  3OA5 A;  2KFW A;  1ZBC A;  1HKK A;  4HBO A;  3O5Q A;  4Z2L A;  5HWC A;  5DEZ A;  1QZ2 A;  1FKJ A;  2P4V A;  2XP7 A;  1LQ0 A;  3PRB A;  4HBE A;  1QPF A;  2A3E A;  3CHD A;  3CH9 A;  4P8U A;  3MDY B;  4ODO A;  2PI6 A;  2DT0 A;  2QF8 A;  2ZQV A;  1FKB A;  2ZQT A;  2JZV A;  5DIV A;  1FFQ A;  2Q5A A;  2XP6 A;  2ZQS A;  5GQB A;  2L2S A;  3KAH A;  4DWS C;  1JNT A;  2XP4 A;  4Q22 A;  3FY1 A;  4MGV A;  2PBC A;  3JYM A;  2DPE A;  3WD4 A;  3O5D A;  2EUL A;  1FKD A;  1ZB5 A;  3ALG A;  3KAD A;  4TYO A;  5HWB A;  3W4R A;  4DRM A;  1FKI A;  2M2A A;  3ALF A;  4ODP A;  4IPX A;  4URI A;  4DZ3 A;  2F2D A;  1X6L A;  4DRK A;  2PPP A;  4BF8 A;  2FAP A;  1F40 A;  4C02 B; 
#chains in the Genus database with same CATH homology
 2YBT A;  2PV1 A;  4TX0 A;  3PA7 A;  2XP9 A;  1FKH A;  1HKJ A;  4Q7N A;  1E6R A;  4P8W A;  1U79 A;  2DG3 A;  2PV3 A;  2RUQ A;  2XPA A;  1M5Y A;  4FAP A;  1Q6I A;  3PRA A;  1W9V A;  1NH6 A;  3JYJ A;  3B9D A;  4MNK A;  3O5R A;  2RUD A;  4NSB A;  3QOK A;  2DT3 A;  2PV2 A;  3UQB A;  3G6M A;  3PR9 A;  3B8S A;  4DWS A;  2DSZ A;  4DWS D;  3G6L A;  1X6N A;  2A3A A;  4QIB A;  4DRP A;  2D9F A;  1LL6 A;  3O5J A;  2VN1 A;  1D6O A;  4TNS A;  4J4O A;  4ODK A;  4DRO A;  4NZC A;  2YBU A;  3AQU A;  5HW8 A;  1Q1C A;  1PBK A;  2LGO A;  3CGM A;  4W9O A;  3UF8 A;  4Z2H A;  2F21 A;  1D7H A;  4WIW A;  2FDM A;  4HAR A;  1FAP A;  3KCE A;  5GPG A;  4P8X A;  1VF8 A;  2DSU A;  3O5I A;  3WD1 A;  2IF4 A;  3KAB A;  3RM8 A;  5HBF A;  1NWT A;  3RM4 A;  2IUZ A;  4MSP A;  1FKS A;  4W9Q A;  1JVW A;  3B9A A;  3ARQ A;  3BXW A;  5J6E A;  1TFV A;  3ART A;  1YAT A;  4IT6 A;  1SR0 A;  1J6Y A;  1BKF A;  3WKZ A;  4MNL A;  3WD3 A;  1HKI A;  1WAW A;  4JFJ A;  2XP3 A;  1JNS A;  4PTM A;  4P8V A;  3RM9 A;  1W26 A;  2A3C A;  2OLH A;  5HKG A;  3ARO A;  1YW5 A;  3ARX A;  4TW6 A;  2ESC A;  3ARR A;  1ZBK A;  4LAW A;  3WD2 A;  3FXY A;  3O5L A;  1E6P A;  1PIN A;  2ZQU A;  2F4E A;  2PPO A;  5HW7 A;  1ZCN A;  4ZPW R;  5DF0 A;  1FKT A;  1HJW A;  1EHN A;  4WKF A;  2LJ4 A;  4DRI A;  3JXV A;  4LAV A;  1JNE A;  2WLY A;  1W1Y A;  3KAG A;  2DT2 A;  2LPV A;  1F8A B;  2K8I A;  1ITX A;  2WLZ A;  1W9P A;  2XP8 A;  3WD0 A;  3B7X A;  4ZPT R;  3ODK A;  4U85 A;  4JFI A;  3LUO A;  1XRV A;  1N1A A;  2MLZ A;  3VAW A;  3CGN A;  4R0X A;  4ZS6 A;  1NWS A;  1FKF A;  1R9H A;  1WNO A;  1J4R A;  3CHE A;  3ARV A;  1Y0O A;  4QZV B;  2FKE A;  3RFW A;  2MLX A;  5GPR A;  4W9P A;  3WQV A;  4ODQ A;  2AOS A;  1ROT A;  2KGJ A;  3KAF A;  1FKK A;  2M1I A;  1FD9 A;  4LAX A;  1BL4 A;  2WK2 A;  3CZ8 A;  2DG4 A;  1FKL A;  1E6N A;  4J4N A;  4Z2G A;  3TDB A;  1OGB A;  3KZ7 A;  4IT4 A;  5JH8 A;  1D7J A;  1L1P A;  2MNT A;  2RUR A;  4LGX A;  4TW8 A;  1H0I A;  2ITK A;  1D2K A;  4MTV A;  4XAK A;  2G8Z A;  5I98 A;  3FAP A;  3I6C A;  1W9U A;  3UQA A;  4IQC A;  2RSE A;  4NNR A;  1UR9 A;  3AS3 A;  3RME A;  1W1P A;  4DRJ A;  4WKH A;  1KT1 A;  5B8I C;  4U86 A;  4G50 A;  1NWR A;  4AY1 A;  1OGG A;  3ARY A;  1TCO C;  3CHF A;  1ZBW A;  1GPF A;  4Z2I A;  4GIV A;  2LKN A;  1T11 A;  1ZL1 A;  4DT4 A;  1LG2 A;  1XHG A;  2DSW A;  4GGQ A;  3NTP A;  4Z2K A;  2DSV A;  3AS0 A;  4ML4 A;  4ZPV R;  3WH0 A;  2ZR6 A;  4KQZ A;  1EDQ A;  3TCZ A;  4O2T A;  1ZBV A;  4MNM A;  4DRN A;  1Q6U A;  1HXV A;  1O6I A;  3IKD A;  2PPN A;  1E6Z A;  1FKG A;  2ZR4 A;  4S3J A;  1J4H A;  1HKM A;  1LJY A;  3IK8 A;  1LL4 A;  2KI3 A;  4ODL A;  3CHC A;  1ROU A;  2O92 A;  1NMW A;  4ITZ A;  1OWQ A;  4DIP A;  1JND A;  3ARP A;  4MPK A;  5DIT A;  4KR0 B;  2AWG A;  3OOB A;  5HW6 A;  4ODN A;  1J4I A;  1E9L A;  2N87 A;  3ARS A;  3O5M A;  4W5U A;  4ODR A;  2XPB A;  3EY6 A;  5D75 A;  1CTN A;  1KT0 A;  3O5G A;  4DH0 A;  1FJD A;  1ZK6 A;  1FKR A;  1H0G A;  1P5Q A;  4JYS A;  2Y78 A;  4DZ2 A;  5DO2 A;  4IQ2 A;  3IHZ A;  2XP5 A;  5HTG A;  3KAI A;  2VCD A;  2DG9 A;  1FFR A;  2MPH A;  3O5K A;  3UI6 A;  2O9O A;  1WB0 A;  2UZ5 A;  3UI4 A;  3H9R B;  5HUA A;  1ZU8 A;  3O5E A;  4DWS B;  1EYM A;  2A3B A;  1UR8 A;  2RQS A;  1HJV A;  3AS1 A;  5DIU A;  3NI6 A;  4L72 B;  1C9H A;  3WL1 A;  2G41 A;  2WM0 A;  3RGC A;  3O5F A;  4FN2 A;  3WIJ A;  1D7I A;  4R5E A;  3B9E A;  4S3K A;  1B6C A;  5HT1 A;  1Q6H A;  4JFK A;  4JFM A;  4WKA A;  4WJX A;  1W1T A;  3O5P A;  4DRH A;  3WL0 A;  1NSG A;  1QPL A;  2B31 A;  1EQ3 A;  3UQI A;  2DT1 A;  2OFN A;  3NRK A;  3WQW A;  4TW7 A;  4N19 A;  1IX5 A;  4MNJ A;  3PRD A;  4Z2J A;  4QT2 A;  2KO7 A;  1E15 A;  4U84 A;  4MAV A;  3ARU A;  4ODM A;  4QT3 A;  3O5O A;  3ARZ A;  1KFW A;  3KAC A;  1GOI A;  1W1V A;  3AS2 A;  2RUC A;  4LAY A;  4G2P A;  3TC5 A;  1SYT A;  1HJX A;  3UI5 A;  3ARW A;  1GUV A;  2KR7 A;  1A7X A;  2M08 A;  1EIB A;  2ZR5 A;  2KE0 A;  3IKG A;  2MLY A;  4WK9 A;  1K9T A;  1NWU A;  1LL7 A;  3GPK A;  4JFL A;  5BXJ A;  1RD6 A;  4L3N A;  1LG1 A;  1NMV A;  4DRQ A;  2MF9 A;  3OA5 A;  2KFW A;  1ZBC A;  1HKK A;  4HBO A;  3O5Q A;  4Z2L A;  5HWC A;  5DEZ A;  1QZ2 A;  1FKJ A;  2XP7 A;  1LQ0 A;  3PRB A;  4HBE A;  1QPF A;  2A3E A;  3CHD A;  3CH9 A;  4P8U A;  3MDY B;  4ODO A;  2PI6 A;  2DT0 A;  2QF8 A;  2ZQV A;  1FKB A;  2ZQT A;  2JZV A;  5DIV A;  1FFQ A;  2Q5A A;  2XP6 A;  2ZQS A;  5GQB A;  2L2S A;  3KAH A;  4DWS C;  1JNT A;  2XP4 A;  4Q22 A;  3FY1 A;  4MGV A;  2PBC A;  3JYM A;  2DPE A;  3WD4 A;  3O5D A;  1FKD A;  1ZB5 A;  3ALG A;  3KAD A;  4TYO A;  5HWB A;  3W4R A;  4DRM A;  1FKI A;  2M2A A;  3ALF A;  4ODP A;  4IPX A;  4URI A;  4DZ3 A;  2F2D A;  1X6L A;  4DRK A;  2PPP A;  4BF8 A;  2FAP A;  1F40 A;  4C02 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...