2OFOA

Msreca-native
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
328
structure length
328
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 87
structure length 328
sequence length 328
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2ofoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofoA01
4LX0A 2O8FA 1KI4A 3IHWA 4AD8A 3BBPA 4PSAA 3R9WA 4TN1A 4JJKA 2J7PA 1MO5A 2NO1A 4WOPA 1P5ZB 2AX4A 2C77A 4KU4A 4P4UA 2OFOA 3PITA 4H9GA 3NC1C 1U81A 3D3QA 5JSZB 2FFQA 1Q1QA 2CL6X 2CL0X 4OHWA 2AWNA 1OFTA 3P20A 3KL4A 4US2R 1AGPA 1KIMA 2F7SA 1UBEA 4TL8A 2HT1A 1KMQA 2ODEA 5KNDA 2E87A 2VEDA 4MGZR 4Q7LA 4A2QA 2WWXA 2MSEB 2B6HA 4KITB 3FOZA 2KSQA 4IHQA 2EFGA 2YOHA 4JJZA 3TW4A 4F92B 1NJGA 1QG4A 3ZLJA 4GPTA 3E5HA 3L2OB 2XGJA 4R7ZA 4MQBA 5G53C 5CLQA 2BMDA 2R6GA 1F3OA 1VG9B 1DAIA 2JGNA 3ZIAA 1HQYE 2AKYA 4HDCA 1OB5A 1KK0A 3U4QA 3OZXA 3N2EA 5TXGA 4GFDA 4A8JB 4X8MA 1RKBA 4Q19A 5KHOC 3FB4A 1FMLA 2RGEA 3QG5A 3AQ4A 4V0NA 3KFVA 5L3QB 1NVWQ 1YZLA 2GJKA 4EJSB 4MRPA 5FBVB 4ZDWA 3FPAA 4NYIQ 3X1DA 1SVMA 1A5TA 2RB4A 2ANBA 3EAQA 4DDUA 1L4YA 4F38A 3T1TA 2XZOA 4NL4H 1A82A 4MUBA 4LPKA 3H2YA 1RC8A 3KTAA 4LV8B 1KDPA 2OG2A 1N2CE 1P4SA 3MGCA 1OHHA 2W6ID 3N5CA 3LBNA 4QJ3A 2A3RA 3A1WA 1XD2B 1H8ED 1LVGA 3T5GA 1UKVY 2ZI6A 3E70C 4XTRA 5JHHB 3LA6A 5KYKA 1SVSA 2D3WA 2HEIA 2YWEA 4RD4A 3KQNA 1KAOA 1CR4A 1W0KD 2QP3A 1UEJA 5EZ6B 1TPZA 2V9PA 5CIQA 4FIDA 3SE0A 2WICA 1DAEA 4M22A 1P75A 4HATA 1KKMA 5IT5A 1FTNA 4Z8XA 4ARZA 1MR3F 3V00A 2YYZA 2OBMA 2G1KA 2GXAA 1AN0A 3BB1A 2IA5A 2LKCA 2QRNA 4I1VA 4QOSA 3T61A 1E0AA 2NPFA 4NCKA 4MGKR 4G5RA 3OFND 4HDOB 2F55A 4XTCS 3JVUA 3FKSA 2VYFA 1J2JA 4WAUA 1KKLA 3LY5A 1VTKA 1D8TA 3IIJA 1DADA 4KCGA 3SZRA 2HLDA 4BFZA 1C4OA 4NDZA 3WMGA 3R9IA 1Z06A 4UXJA 4JT4A 1KO5A 3WYGA 2O8DB 3QKUA 3LBHA 1T0HB 4V0MA 4TT3A 5A0FA 4HB0A 4Q9LA 4LJ9A 2WOOA 3UMFA 2JLXA 4TL6A 2C04A 3HU3A 2VHQA 2R6DA 3P4YA 4ZI3A 5J4HA 3SR0A 4BLSA 1J99A 1YJ5A 5AUOB 1P9WA 4XIGS 3T1OA 2XSZA 1E2IA 5DO9A 5P21A 3EPLA 3KTAB 3CH4B 1K6MA 1IN8A 2IUSA 3OEED 4Q02A 3BB4A 3SU8A 1G64A 4IDOA 1KHTA 2C99A 1DELA 5JI3E 1Q57A 4RCYA 1GM5A 3BK7A 4A6XA 1CJTC 5DLQC 4C0AC 4HLUC 4QM7A 1US8B 1G7SA 1E4YA 1VMAA 1GL6A 1W2HA 1KNXA 1YU9A 3NG1A 3TIFA 1ZD8A 4MGIR 1SZPA 2WAXA 2GZHA 4X8LA 4MKFA 1TU4A 4DDTA 1WB9A 4MKHA 4A2PA 4CGZA 4OI4A 1SULA 4QBHA 3TR0A 2AWOA 1H8EA 2CCGA 1Q21A 2ZJ2A 3RS7A 1UBCA 1TADA 1ZCAA 2GK7A 4KHZA 1M7BA 2ZI5A 4TYQA 4OHZA 4OQLA 2OCBA 5JJKA 4TSFA 4XH9B 1XD2A 3NH6A 4WZBE 5TMPA 1OIVA 4FMDF 2Y8EA 4D4LA 4LC1A 3REGA 1XXHE 4OQFA 5KSYA 3BS4A 1U8AA 3WYAA 1MO4A 1XNJA 2RAPA 2IF2A 2WMNB 1N5KA 3SBDA 4PTLA 3U7FB 2WKQA 3T34A 1Z0DA 2R6AA 1OH7A 3CZPA 1Z0JA 5TV2A 1YKSA 4JLNA 3P27A 2QAJA 3OEHD 3K1JA 3LXRA 3U5ZB 1NN3A 1GG2A 1HA3A 1NBMD 2PMDA 2Z0MA 3E1SA 3CPJB 3GEIA 3ZS9A 3GLIA 5E95A 4P32A 1P2SA 4TLDA 4Q4AB 3PEVA 3QVUA 3AKCA 3MD0A 4LJAA 4Q4JB 1SKYE 4TMZA 2PBRA 2IW3A 3TAUA 2BKUA 3LVRE 4BZXA 4LYFA 4BFXA 3AVTA 4OBEA 1QRAA 4TLBA 3WHLA 1KI1A 2DCUA 2Q9AA 3LNCA 1CRQA 1Q1BA 3WXMA 4DT1A 1Q3HA 4HLDA 4TMWA 3GJ8A 1HYQA 4GZLA 1Z0FA 4TL9A 1JALA 1F2UB 2CVHA 2OHFA 1E9CA 4HUQA 4TMXA 1G6HA 2WJVA 3AF4A 2PL3A 2CCJA 4L15A 3MAAC 3U61B 4BLPA 1G17A 3GMTA 2OBLA 1XX6A 3PIRA 3CLVA 4HAYA 2MSCB 3ICQB 4IXNA 1P2VA 2KE5A 3B82A 4II7A 4JVLA 2MSDB 2ZE6A 4DRZA 1ZM9A 1ZUIA 2PX0A 4G5GA 1SXJC 1I2MA 2ZRKA 2A5FA 3RNLA 3RVBA 3BC1A 2GJ9A 1G4AE 1U0HC 1NMYA 1ESNA 1TF7A 1NI3A 1E0KA 2BDTA 4PQYA 3CWZA 3VKWA 2P6RA 3DOFA 1OH6A 2GCPA 5EXPA 2HJVA 4LJYA 1XTRA 4HUTA 4IDPA 1G16A 4EPWA 5DI9A 2BMEA 4WXRA 1KO8A 5IHPA 2IUUA 2BVNA 5FPKA 1RRGA 3AVXA 4GSYA 1ZINA 1E1QD 2ZETA 4U02A 3ICEA 1VCNA 2RGDA 3ONWA 1XZPA 4PSVA 4LUCA 1SXJB 3I72A 3NC0C 4OJKA 1KI6B 1RYHA 3GJXC 2NMVA 1XJCA 4G01B 3LXXA 4N3NA 1NG9A 1GDDA 4B2PA 5FUYA 1PZNA 2QU8A 2RGBA 2J9RA 1Q1ZA 2FZLA 4K8OA 3EG5A 1NF3A 4Y0AA 5EZ5A 2C9CA 2Q3FA 2PJRA 4LOAA 4NE2A 4GZMA 2ZE7A 1PLLA 4Q7MB 1Q0UA 4QL3A 1GRNA 4LHWA 2V7QD 2QPOA 5LD2B 2RHMA 3Q8XB 1YE8A 1G3MA 3W6NA 1QHSA 3W90A 2BJWA 3L43A 2F9MA 4GP6A 1EFRD 4JL6A 3VMFA 1X8LA 4XVUA 1OT3A 1KI7A 2CL7X 2FSFA 4NTZA 1NBMA 4MA4A 1IOZA 2AK2A 1SVLA 4LBYA 5BW8A 2P6NA 1Z6XA 1KK3A 5SZJA 4YONB 2A5DA 3C15C 1JPNA 3FFAA 2ZRNA 5FOWA 5AUPB 2VRWA 6Q21A 2EVWX 2QGNA 5KSPA 1E2QA 1QDEA 2RKOA 3QOFA 4G5SA 1GRRA 5ELXA 4OQNA 2O8CB 2HV8A 2CHVA 3NDPA 2QY9A 2PCLA 5JECA 3F5FA 3AVUA 2JIZA 5BWMA 2FX3A 4PPNA 4DCVA 4DT1B 4LBVA 4C7OA 4IDQA 1LTQA 2NO0A 5E7JA 2BMJA 1N3BA 2Q9CA 2EU8A 1II8A 1U9IA 1YR9A 1W4BA 3AVPA 3T1VA 1KZ7B 4M1KA 4BASA 5AWFC 3PUVA 2ZRMA 2O52A 1G9XA 1ZW6A 2OCAA 1XU4A 2F43A 5A5GA 2R6CA 3QIAA 3ZQJA 4MITA 4D26A 3UG7A 3NBYC 1NJFA 3PVSA 4GMDA 1Z2CA 3K53A 2A5JA 2ZS9A 2H8KA 1EWRA 1T8TA 1TX4B 1VKJA 2CEAA 4OQMA 4M1MA 3U2QA 1TQ4A 2A5GA 2GTPA 4JLVA 4F4JA 3GP8A 1ZBDA 3BXZA 4Q1FA 2VPPA 5BN5A 1TNDA 4OL0A 1RIFA 1Z8FA 1Z6GA 3H84A 5EE3A 4Q1CA 4KAXA 2XB2A 5G41A 3MCAA 3RSOA 2QTVB 3T06B 4ZCIA 1R0XA 1QHXA 3ADKA 4RD0A 4A0GA 5UKDA 2ZS7A 3RANA 2XNDA 5JSZA 1HEIA 4JLPA 4ZDIA 2R9VA 1G7TA 1N0UA 1S9DA 3SQXA 1LB1B 1LW7A 2ZYWX 3S1AB 3KXIA 4QGGA 421PA 4M9ZA 1E1QA 2JLYA 2A5YB 4JKYA 3BFXA 1UKZA 4ZIRB 2XSZD 3A4MA 3KXKA 2WJGA 2ZQ5A 4P4SB 3QVVA 5C4GB 1R4AA 4GI7A 1NY5A 5HCIA 1JJ7A 1RRFA 4LDJA 1KK2A 2QAGA 1BKDR 4XSHA 5CYPA 1ZM2A 4TT3D 3THYA 4M1YA 2AXNA 2O8EA 3A1TA 4FW9A 1QHHB 4C2UA 4GL2A 2AHOA 2J87A 1W46A 3K8YA 4RFSA 4BZQA 4BLOA 2AN9A 1AM4D 4KYUA 1OE0A 3VNUA 4E5UA 3DO6A 2BWJA 2FV8A 3A6PC 1Z63A 4CIDA 1SVKA 3KQUA 1KYIA 1WCV1 4C0BA 1SQ5A 2PT5A 4ZV4A 4XD7D 1DG3A 1IN6A 3UK6A 4N0EA 4AYWA 1Z6AA 1P6XA 2NIPA 1VCMA 5CK5A 2ZRGA 4YLGA 5CM9C 4M4SA 4AKEA 1IN4A 4IVRA 2YJTD 4BWYA 4E03A 1FNMA 1P7CA 3PUWA 1P60A 2BMFA 4YC7A 4F7WA 4LGMA 4PPGA 3I73A 2REXB 1FX0B 4YMTA 1KI2A 2FEMA 1NG1A 3SJZA 1XMIA 1Z22A 4O2LA 1E2GA 1XTQA 5AUNB 1CU1A 4QGAA 3CF0A 1NNEA 1DBSA 2AD1A 1UBGA 4EIWA 1BMFA 4RD1A 5H1YA 3QBTA 3RHFA 4RD3A 1T9HA 5FOTA 3GLHE 2QTHA 2DBYA 1T0JB 2DY1A 1QHIA 1GKUB 1W5SA 3K9GA 5DI3A 3CR8A 2PLRA 2OCPA 5FTNA 1MT0A 3ZH9B 2F1IA 1JR3A 2DWOA 2FDCA 1F6BA 3AP2A 4GRAA 4TZ6A 3W3ZB 4HAUA 5EE1A 4QHTA 2FWRA 1P3JA 4XJXA 1IJFA 1G5RA 1WBBA 3DZDA 3ND8A 1N6HA 1DTSA 2OAQ1 2VHUA 4UNPA 4JZKA 3PV0A 3TJZA 4C30A 5AK0A 3BAFA 2BM0A 2BHRA 4PC3A 3R7WA 3VQTA 2ZUCA 1TF2A 1S1CA 1XFAA 5E3HA 1J7KA 3A8TA 1RVDA 1T5LA 5DHFA 4JVMA 4Q1DA 4JLBA 2F6RA 3QEJA 2GRJA 2IS2A 1CR0A 1EFHA 2R65A 4H1VA 3A1SA 1QVRA 2FMXA 3NKVA 5C46F 4X8OA 1N5LA 5FPSA 3VR1A 3L0OA 2P3SA 3IPYA 3LBIA 4AIIA 1RRPA 4RZ2A 1UPTA 2EWWA 2Z43A 3EZ6A 3KZ1E 3AVOA 3K70B 2IS1A 1EWQA 2OE2A 1VYVA 5GJVC 3IIKA 3OE7D 4W5JA 4M1WA 3CF6R 2ZR9A 1BH2A 2XB4A 4OHXA 2V8OA 1U8YA 1VYUA 3RWMB 1RPZA 4TWZA 3RC3A 1AK2A 4Q03A 2H16A 3RS3A 3AKYA 3M4YA 5GADl 2YWFA 3X1ZA 2EYQA 1OYYA 1AKYA 1S3SA 2WOJA 2YWGA 3IUYA 3PJRA 3FHOA 5HTKA 1M6NA 2FPLA 2BC9A 1CEEA 2QI9C 4FCTA 4XVRA 3TKLA 2N1BA 1BYIA 4DSNA 4GBMA 1XMJA 1XEWX 1X3SA 4J0QA 2O8FB 5DI3B 1XPRA 5IDVA 1AQUA 2YV5A 5HR5A 1VCIA 3B60A 2XJ9A 3U7EB 4N1AA 1XJQA 1S3GA 1E9FA 3LX8A 2ZYTX 3SBEA 1RJ9A 2UKDA 4K81B 4KV9A 2V1UA 1E2KA 4ZKDA 4NP6A 3B9PA 1I4DD 3B13B 3CNLA 2WZQA 3EW9A 4QBFA 2W6JA 2CNWA 4L16A 4DHEA 1NN0A 4HB4A 4KBFA 4EFLA 1ZRHA 4DJTA 1W0KA 1ZNYA 2WIAA 4P0TA 4RCZA 3VHXA 4RFVA 5LB4A 1ANKA 2ZEJA 3SQWA 2REBA 5K8UA 1F5NA 4LHVA 1G7CA 2QM7A 4A9AA 4C3ZA 4MUAA 5FL7D 2GEUA 1HUQA 2Q3HA 2YNMA 4QXAA 1UKEA 4IOJA 1KAGA 2ZJ8A 4OK5A 5DISB 1EXMA 3I92A 1II0A 3G5UA 3MJRA 4LJ6A 4MYTA 1EFTA 4RKEA 1W49A 1X1RA 4HUQB 1QBKC 4I1OA 4AK9A 3THWB 3VU9A 3UPUA 3EASA 2ZRAA 2ZJYA 4W7SA 3X1YA 1XEXA 3EA5A 2B8TA 4PX9A 2J45A 2J7KA 3WBJA 2AR7A 1I4TD 2BBWA 2JAQA 1NMZA 3Q5DA 5BYKA 1U0LA 221PA 2X8AA 3AP1A 1ODFA 3KJEA 3QXXA 5CJPA 2BM1A 3B8HA 1E9BA 3TSWA 4Z51A 4JLOA 4MKIA 2GHIA 1OFIA 3GQBA 3I5YA 2V4ZA 3CNOA 3OIVA 4MRRA 1OKKD 2E9SA 2CBZA 3IKJA 4TYWA 3GLFB 3U7HB 2V6IA 3QPUA 4DSOA 3GLHA 3EC1A 3IGFA 4B71A 3W8NA 2XJ4A 1Q22A 3PG5A 1XP8A 3I32A 2ORIA 5CK4A 1CRPA 2JA1A 4Q1AA 2HDNB 2QROA 3EZ7A 2ANCA 3QXCA 2CHQA 1SXJA 4PR0A 2QMEA 3U7GA 4PO8A 3TK1A 2QMHA 2J0VA 4P3YA 2W2TA 4LZZA 4TMVA 2C78A 4ARZB 4C0KA 4A4DA 2GAOA 2HT6A 2QBYB 4C0QC 1L2TA 1IAQA 2ZI9A 3U3JA 2O8BA 4AI6A 3CRVA 2WV9A 621PA 5JCZA 3BFKA 1XTJA 2X2FA 3CWQA 3OAAD 3GJ6A 2IS6A 4EPRA 2EYUA 4POAA 4I4LA 4HZUB 2ZIAA 4M9XA 4ASUA 1E99A 3THXA 3SN6A 3GPLA 3A58B 4WXPA 3SYKA 5EE9A 3K0SA 3IPXA 3ZVMA 3AM1A 3WNCA 4NBSA 2D74A 1L4UA 4QNRA 2YINC 3KJHA 3FHCB 3C14C 4US0R 1R6BX 4TL7A 2I4IA 2XXAB 1YZQA 2IYZA 4CF7A 4CEIA 4KLNA 1G41A 2ZU0C 3PENA 4QHSA 3MSXA 4UJ3A 2QNRA 1FUUA 1Q3TA 5FUWA 2O8DA 1VYTA 5IF9A 4PXAA 3SYLA 5CITA 4IKEA 1U0JA 3QJYA 1FP6A 3B85A 1JR3D 1U8ZA 4DWJA 3CW2A 4DB4A 5B57C 1VCOA 4PC6A 4XVQA 2ODNA 4CEJA 3PEWA 2FSIA 4A36A 5SZKB 1ZC3A 3OHMA 2IYQA 1XCGB 2YOGA 2Q3MA 4NZYA 3SJCA 3WRYC 2HYIC 2QEQA 2ZYUX 3SHWA 1NN1A 1Y63A 4GMXA 3ZS8A 3MWLA 5HE8A 3KKNA 1US8A 1II9A 1SVWA 5GJCA 3AVYA 2EFCB 3Q9LA 4GOXA 3K0FA 2YC4C 3BGWA 2H18A 4GT1A 3UWKA 1RW4A 1OH8A 1CJVC 4LV5B 4G1UC 4G3XA 3F3YA 1N6PA 2CLSA 8OHMA 3JVVA 2D7DA 3QNUA 4HB2A 2NOAA 4WIAA 5K8LA 3QKSB 4LCBA 2JDID 2WJYA 2QPTA 2QL6A 3WP1B 4PO1A 3O47A 2DYKA 2OLJA 2GCOB 2VO1A 4OQXA 3D7MA 3TVTA 1NMXA 4PHFA 1SVOA 2WJIA 1LS1A 3B5JA 4LWZA 1ZYUA 4EPVA 3OE7A 4WBSA 1YZKA 3THXB 3LD9A 1VG1A 4FINA 3NWJA 5G3YA 1NN5A 1VECA 3BRWD 2AXPA 2ODBA 2X77A 3WNBA 1NVVR 2JJ2D 4MYCA 1KO7A 2I1QA 3ZD6A 1LF5A 1PJRA 1U90A 3M6AA 3SOPA 4DLWA 5SZIA 2O8BB 2IUTA 4EFNA 4M1TA 4URVR 5BN4A 3RAPR 2ZRIA 2GNOA 4UXIA 3ZDQA 2ZRHA 4KXFB 4NONA 3NBZC 1NIJA 2ZREA 2R6FA 4A0HA 4BGDA 3HU2A 2GBLC 1XB2A 4D81A 1MRSA 2QAGB 2ZRBA 4AC9A 3GJ0A 2CXXA 3I1FA 3Q85A 3BIFA 1NVUQ 3FMPB 1QHHA 1T4GA 2AL7A 3QPWA 1FFHA 2FOLA 2WSSD 1G8PA 2WWHA 4JBYA 4DCNA 3EPJA 4CEIB 3GLGE 2VLIA 2KI5A 1B23P 3MWYW 4M2LA 4URWR 2DWQA 4DLSA 2XX3A 5IK2A 4DLUA 1XTSA 2QMOA 4R2HA 2IYTA 3I4LA 3C41J 4RSGA 1K5GA 5FBLB 1JJVA 2FU5C 4YMSA 3U3RA 1JR3E 2C5LA 4BECA 5HKKD 2W58A 3QF4B 3KQKA 5EQTA 1GFIA 4FXPA 2QP4A 1H65A 4CEJB 3RC8A 2KJQA 1E2PA 3TH5A 1KK1A 3FKQA 2BKEA 1WMSA 2NZJA 5KSZA 4AURA 2RGNA 1IONA 1M2OB 2VP6A 4HLQB 1OIXA 5JWRA 4Q7JB 4OHYA 4G0NA 3GD7A 4U00A 4IDHA 4NHOA 4R98A 1DOAA 3ZQ6A 2OCYC 4HDQB 1UBFA 4ZI2A 2XEXA 1E79D 4D4JA 1GZSA 3VKGA 1F48A 1A2KC 3FE2A 4TTPA 5L3SB 1M8PA 3CF2A 5FH9A 5TVKA 4PC7A 4B75A 1WA5A 1G18A 1KI6A 1W36C 2J1LA 1W47A 3LV8A 4E09A 4TYNA 2PZFA 3Q7QA 4URZR 1WBDA 1OV4A 3K09A 5EXXA 3CPHA 1L8QA 2ZANA 2CVFA 1FOEB 2DFLA 3VR5A 4Q9KA 2WJJA 3EIQA 4V0OA 1UF9A 3RYTC 1M74A 1IN7A 1ZUHA 3C8UA 3O8DA 4LYJA 3U3OA 2ZJ5A 1WRBA 4D0LB 2BEJA 1Z0IA 2VTKA 3AH8A 1UDWA 2AK3A 2F1JA 1ZIPA 3WHKA 4DDVA 4KFSA 1I4LD 3O8BA 4KFRA 4LJ4A 4LK2A 4NYIR 2GCNA 1KY2A 4LBZA 1TU3A 1PVOA 5JJIA 5FTLA 2V55B 3TRFA 3WMFA 4W5HA 3DM5A 2VQSA 1U2RA 2ASEA 3PQCA 3A1VA 4NMMA 2OBNA 2WSSA 3OIYA 4QGHA 1KMHA 4Q4JA 3P4XA 4A82A 4Q1EA 3OAAA 4EFMA 1G1MA 2ZJAA 3SS8A 2VF7A 1NRJB 1OXUA 3AF1A 1YVDA 3TAHA 4YMUA 5FBQB 5FUVA 3R8FA 2ZS8A 4R2IA 2DB3A 5JLJA 1K8RA 1NY6A 4JS0A 1RRCA 3WMEA 2ZR0A 1U9IC 5HKKA 5M04A 3SEAA 4A15A 2Q0HA 2GJSA 4S2EA 3C5HA 4DB2A 2HF9A 2Q21A 2VL7A 5DYGA 2JJ8A 5J5CA 1OKKA 2QSYA 2H1LA 4O0MA 2UVQA 4RZUA 4V03A 1XWIA 3SDZA 5L3SA 2B8WA 1XXHA 2ZI4A 5FBRB 3DOEA 4D82A 3CX7A 2RGXA 1D6JA 1XMSA 1QHGA 1G7RA 1GITA 5KU1A 4B33A 1HE8B 4JLJA 3V4RA 3UANA 2P65A 3FTQA 3G82C 4DLYA 3U44B 1O87A 2ZU6A 2ERYA 3QXJA 5CDFE 5FOXA 3QKRA 1YZNA 5FFMA 1OHHD 2A9KA 1QHNA 5DHAA 3B1YA 4FD2A 2ZVPX 1SXJE 3GJ3A 4I99A 3FFBA 1NKTA 5CIWA 3CRMA 1OFUX 1UJ2A 3QE0A 2JIZD 1PUJA 1FTSA 3IO5A 1W48A 4OI2A 3EZ2A 4ILEA 4U5XA 1P2UA 2EWVA 5E4FA 3TNFA 1KOFA 4M0LA 1KDOA 1PLJA 3EC2A 3AKEA 1AS2A 4FMDB 1TQ6A 1UFQA 3VR4A 1YZTA 3FMFA 5B30A 3TUZC 2WWYA 5E7IA 2DFNA 3PUZA 4QFMA 4F4CA 3W6PA 4S35A 2OFWA 1G21E 3CRW1 3AGQA 4TTQA 4DCTA 3X1XA 4F4IA 3UIEA 2JJ1A 4DIDA 4HZIA 3VR2A 2J7PD 4URYR 1XJ0A 2Q6TA 2OLKA 1X8KA 3THWA 1WDTA 3W3AA 1CKEA 1JEDA 5TARA 1E96A 2N46A 3KFXA 2WPDD 1MABB 2XTMA 2IT1A 2OXCA 4QKQA 1C1YA 1JB1A 2DR3A 4QRHA 2W2XA 1E32A 2MMCA 4XSGA 3DDCA 4ZCMA 2C9OA 2CLDX 4OHVA 1CTQA 4OJQA 3BH6A 3WY9A 4HEJA 2IS4A 4UXHA 4EQ6A 1XXHB 3L8YA 3NEYA 1FNNA 1UDXA 1U98A 3U6KA 3M1IA 2C8VA 2QENA 5LPNA 3N2IA 1WF3A 1OF1A 2FG5A 2XNDD 2BOVA 1E1RD 3EIHA 4IVQA 3LW7A 4RY2A 2Z6VA 1AZTA 2ZUBA 4Q7KA 2IYWA 1ZIOA 2CJWB 2IWRA 2EFHB 4C0JA 4AY2A 2IYRA 3F8TA 3EA0A 1Z6TA 3SC3A 3VFDA 1TF5A 4B3FX 1KSHA 2ZE5A 3UKDA 4KFUA 4LJ7A 4Z1MD 1ZU4A 2CK3A 5AJVB 1FQKA 2VSXA 1XD9A 1Z0AA 2YZ2A 3WP0A 5CLLA 1NIPA 2YVUA 3CZQA 4DUGA 5JCPA 3REFA 5KDDA 4JSTA 3VHLB 4ABYA 3RS5A 1G20E 2QA5A 4C9BA 1IN5A 4FMCB 4OI0A 4B48A 2VHJA 3IEUA 4B34A 2IF0A 3B78A 3LFUA 2IEZA 2QQ0A 2GK6A 3QY0A 4B3DA 3ADBA 1Z07A 4XWKA 1IHUA 1S0UA 2FSGA 2P5TB 1DVRA 4PQRA 4UNNA 3FWYA 3NBFA 4LYAA 3CONA 4F93B 2F9LA 1T5IA 3V9PA 1JPJA 3KKQA 4AG6A 4D0GA 3EPHA 1FPMA 4L8GA 5KSOA 2QG6A 1BOFA 5DNYB 5EP4A 4BUJA 3GLIE 2FFAA 4IDNA 1QF9A 2W0SA 3B2EA 5J4VA 2WWWA 4L9SA 4EKDA 3AVVA 1SVIA 1GL9B 3GFPA 5EUQB 2WVJA 4O3MA 1K5DA 3OEHA 2IYVA 2GESA 1GWNA 1F2TA 1V5WA 3UMRA 4B3BA 4BZPA 1WQ1R 2OESA 3U3KA 4BFTA 3VR6A 4RD6A 5AJWA 2PT7A 5L8VA 3IDQA 121PA 1COWA 3QQ5A 4CEHB 1OXSC 1F2UA 3RSLA 1WXQA 1Z29A 4KFTA 3W6OA 5KTYA 4GDFA 1ZNWA 1HT1E 3B1VA 3K0FB 3PEYA 1HQCA 4M53A 2CDNA 1XPUA 1XPOA 1DG1G 5FR2A 2F1RA 2CJWA 2IL1A 3HP1A 1ZCBA 2Z5FA 3R20A 2WTUA 2Z4RA 4FWIB 5KOYA 2W2VA 3QBVA 2WPDA 1E79A 2FZ4A 5D3MA 3PXGA 2QTFA 1MRNA 3K0AA 1W0JA 1DARA 2WAYA 2IWHA 3CB4A 5J40A 3UATA 3PR1A 1NLYA 2XITA 4OYHA 1CP2A 2HLDD 1OLOA 4D2IA 4DXAA 2BBOA 3L0PA 3OEEA 1RJ9B 4B73A 4XWAA 1KI8A 2ZSAA 2CK3D 3CPEA 2E1RA 2QP9X 4BLQA 4FCVA 2ZRPA 3FMOB 3DM9B 2GZAA 2P67A 2V1XA 2V6JA 1R10A 3DKVA 3AB3A 1XD8A 1LNZA 1RYFA 1A7JA 2GF0A 3H86A 2JASA 5DN6A 1FQJA 2X1VA 1E2NA 1GKIA 3MRSA 4P31A 3LW8A 4DEYA 5B2ZA 2OM2A 2QQEA 4B74A 1HH4A 3RABA 1E2LA 1Z08A 3CRQA 3LH5A 2YWHA 1FUKA 2GJ8A 5CB6A 1M34E 1EFCA 1ZUNB 1CF4A 2FFHA 2I3BA 3BD9A 2BCJQ 2JLSA 3VX4A 4DLZA 1OPXA 1E2EA 1NBME 4B3XA 2X2EA 4EPXA 5IRCD 2F3RA 1MO6A 3R7WB 3VR3A 3GLFE 3AV0B 4P33A 2F3TA 5JS8A 3AGPA 1ZJ6A 5G40A 1TQ2A 1PLKA 1OJLA 1E6CA 2V3CC 2WWIA 3X1WA 1YR6A 1T3HA 3QG1A 1MKYA 1GNRA 3WBKA 3WNDA 2FGKA 2FPKA 5BXQC 2W83A 1R8QA 2K5UA 4A6PA 3LO5A 1RFLA 1W4RA 4YMVA 2JLWA 4IEIA 1XRJA 3RRYA 4CDGA 4KSBA 5J4YA 4Q00A 5J47A 1G3UA 2ZE8A 4MGYR 3RS2A 3CX8A 4LHYA 4HI0E 4JLAA 3NXSA 4FWTA 4A8JA 2LCFA 3KXLA 4LPSA 3KQLA 2PX3A 2VF8A 5DH9A 1ETUA 1W4CA 3DKPA 3SJBA 1G3QA 2GF9A 4EJSA 2G1JA 1DAFA 1YZUA 3VTKA 2G0TA 2FN4A 2OT3B 4DEXA 1MOZA 2ECKA 3ZJYA 4M21A 1UKYA 2QE7D 1DPFA 4IW3B 3HJNA 3LDAA 2J59A 3TBKA 1E0SA 1U94A 1IJEA 4CZ2A 4C2TA 4NU0A 4V0LA 4YMWA 4BRUA 4UNQA 2D06A 2C2HA 4C0LA 2RGAA 1ZD9A 3I61A 1N0WA 1NLZA 2FJUA 1AKEA 1RE0A 3NH9A 1NSFA 5FL3A 3I62A 2AKAB 1R5NA 4Q48A 4W9MC 5CDFA 3QSYA 4KSCA 1HE1C 2L0XA 4BLRA 2B7CA 5DIFA 2NTYC 2ZJZA 4X8HA 2GVDC 3MJHA 3GFTA 4QBIA 3TW8B 4TMTA 4W5WA 3GLGB 4BFUA 3CO5A 2IK8A 3L82B 2IYLD 3FKSD 2PH1A 1FL9A 3CKLA 2VHTA 1YR8A 2FGJA 2ORWA 1JBKA 1IXSB 5JMTA 1GAJA 4Q4HB 1R0WA 2H7VA 4PFSA 4TQAA 2HCBA 4Z1MA 3R9XA 3LWNA 5F2EA 4B76A 5AJYA 3TUIC 5DYIA 3VAAA 4B47A 1N5JA 3TGPA 1TEXA 1OXXK 1N6RA 5HE9A 1EK0A 2DFTA 1CXZA 2JLVA 1VIAA 5FOUA 2W00A 1E1RA 5FOSA 1Z47A 4BEJA 2CHGA 3C7KA 821PA 4OI1A 2ERXA 2B92A 5FTJA 4EPYA 4GOKA 2ZVQX 3PEUA 1JAHA 5KDLA 1AQYA 4KI0A 1HV8A 4H1UA 2OAP1 2ORVA 4ZIRA 1Z3IX 3KUCA 4DLXA 1AA3A 5L3RA 2NZ8A 2QSZA 2RHDA 1E9DA 4YXWD 4FMCF 3ZZTA 1GILA 3HYTA 1DAKA 1KSJA 2JLZA 1HTWA 5B64A 1E3MA 2D62A 4JLDA 5IK2D 1JQLB 1E2HA 1NLFA 4PANA 3ZYCA 2BIFA 2G83A 5JHGB 3NHBA 2IEYA 4BEBA 2QUZA 3LLMA 5EP2A 1E2JA 1JXMA 1V43A 4Q18A 5LDDC 3EZ9A 4Z8YA 4YQFA 3KKPA 521PA 4PSKA 1FX0A 1COWD 5EUMA 3TSOA 2IYXA 4KODA 2W0MA 2JLRA 1X6VA 5FPHA 1NL3A 1TUEA 1EX7A 2CE7A 3U3MA 3BE4A 1CBUA 4DCSA 4JBXA 5TB5A 4C0HA 2ZYVX 1XBTA 1S4QA 1TEVA 1NKSA 3OIUA 3LRPA 2ZM5A 4DLVA 3A4NA 1TAGA 3CUEF 4TZ0A 1KGDA 3ASZA 4D80A 1XZQA 1QZXA 4IOKA 4JL8A 1R8SA 2BBSA 1S8FA 3AVQA 2OZEA 2DWPA 2P6UA 3SJAA 2ZRLA 5FPTA 3I3SR 3SYNA 4AKIA 1EFRA 4Q9IA 2RGNC 4Q4HA 1VG0B 3AP3A 2J5XA 1KO1A 3RDPA 4QJ5A 2IC5A 3D8BA 4LJ5A 3J81k 2P5SA 3X2SA 1KJZA 2GVZC 3LQQA 4HAXA 2NPIA 3DEFA 1HT2E 2WBLC 3A37A 4JYBA 4QNMA 1UAAA 3A1UA 1EGAA 4HYYA 4FMBB 4RJLA 3RRNA 4PC2A 2ZRFA 4JYCA 5H70A 1IY0A 2BJVA 3B1WA 2OXRA 5AJXA 1YRAA 1MABA 1X8JA 2JLUA 4Q4AA 4NYMQ 5TDHA 2NO9A 3IHLA 4XOIA 1H8HD 4DSTA 5TY0A 1CR2A 1E9RA 3AVWA 3HR7A 5JJLA 2GBLA 2PEYA 2XTZA 3Q7PA 4A0RA 3IBYA 5KPJA 4B44A 1J90A 4KBGA 4WA7A 2OV2A 2XXAA 2CMKA 3JZMA 4QG7A 4NCHA 2GILA 4DKXA 4PC1A 2GETA 2GXSA 4YXWA 1YHNA 2J41A 1NP6A 1TUIA 4OKSA 2ATVA 5F3WB 1ZC4A 2JDIA 1ZM7A 1XTIA 1DO0A 1DAHA 2VP9A 2XTNA 3D6TB 2PLFA 1G5TA 1ONBA 4HSEA 3T1QA 4NPHA 3G0HA 2C03A 1TTTA 4PHGA 1D5CA 4MH0R 5DE3A 2ONJA 1E0JA 1G3IA 4I1SA 4R71A 4URXR 4Q21A 2O0KA 4BFVA 4UQOA 5AR1A 4JMPA 4DZZA 1AA9A 5EP3A 5C1BA 3K70C 1T3LA 3HPRA 5C18A 1W36B 3NDBB 5J4LA 2NG1A 4NYJR 3AEZA 1ZMXA 1Q1EA 4CYMA 2LWIA 1WP9A 5CM8B 2FSHA 2O0HA 2ZUDA 4NCNA 4PAMA 2G0NA 5K8TA 2H5EA 3GFOA 3UWOA 2ZJBA 3BH7A 4EAQA 2RCNA 3EPKA 1R0YA 4ZO4A 3CR7A 4XWOA 5JI2E 2IXEA 2J3EA 3IEVA 4LI0A 4IFEA 1FP7A 3CM0A 5GVRA 2D4HA 5EJEA 4TMKA 4EUNA 4HB3A 1PUIA 1KY3A 2ZSEA 3RWOA 4BFYA 3PUXA 1S2MA 3ZGXA 1KO4A 2OO7A 3O8RA 1OIWA 2UZ3A 1E9AA 1NVVQ 3I8SA 4US1R 2KB0A 5FI1B 1KI3A 1N5IA 2O0JA 1GUAA 3BJIC 4URUR 2SHKA 1MV5A 1OFHA 1XDBA 5A4JA 3Q3JB 4MRNA 4GOJA 1E94E 4JLMA 4LYHA 3CNNA 2QE7A 3VU9B 1GVNB 2AD5A 2VH5R 2GZDA 4LSGA 4B32A 1M7GA 2A78A 3P1JA 2P2LA 4UJ5A 2IHBA 3K0EA 4PZLA 2J0UA 2F43B 4TQUS 4OK6A 1AS3A 3LX5A 1P72A 1A4RA 1R2QA 4BQSA 3AF2A 2HJGA 3AF3A 1UADA 2GAAA 4A2WA 1FW6A 1W2GA 4TLCA 3KDSE 2ZROA 3K0AB 1II8B 4PHHA 5CB8A 4M8NE 3I8XA 1DS6A 2UZIR 4HAZA 4JSYA 4V0KA 1T91A 1OXVA 3DPUA 3NVAA 1XEXB 4JT2A 1Z83A 1G19A 1VHTA 3GLFA 3FGNA 1EESA 1W7AA 1E9EA 1P2TA 2GWHA 1LF0A 5L3QA 3QKTA 3QKRB 1EFUA 5EP1A 1CR1A 4D4MA 1P9RA 1BYUA 1E2MA 3HYRA 3H4MA 3H0KA 2CCKA 4YDSA 3B1ZA 2G88A 1AIPA 1ZP6A 5BQ5A 4U7DA 4B43A 2ZSBA 3EX7C 1IBRA 3BH0A 3KX2A 3TVDA 3B6EA 4IVPA 2FA9A 4KJZA 4NH0A 4IXMA 4ZCLA 1YRBA 3FYHA 4ZDJA 3I5XA 1XF9A 2EFEB 4QBGB 3TUJC 3RRZA 3ZD7A 2O5VA 2QT0A 4O2RA 2DHRA 1DAMA 3ZVNA 4QC2A 1R7RA 4TSFD 3WRXC 5ANRB 2H17A 4PO9A 1W5TA 2NQ2C 4JLKA 1W36D 2VP0A 1N25A 4Q01A 3C4JA 2FH5B 1M1YE 5JEEA 1E98A 5FUXA 5KNCA 1IY2A 1LV7A 2ODWA 4QM6A 4LV6A 3GEEA 1T3SA 3R8CA 4BRWA 3SNHA 4JBWA 1G8HA 2FPMA 3T35A 2VSFA 4DLRA 3GLIB 3AUXA 4CW7A 5BYJA 3ECCA 1Z2AA 3KJGA 4EPTA 2I1VB 4UNRA 2R44A 3BB3A 1PV4A 5AJZA 1Y3AA 2Z83A 5JRZA 4LY6A 3EWSA 3THYB 3C5CA 4PZZA 1TQDA 1P73A 4DC9A 2HUPA 4TLAA 3B7GA 2D2FA 4L5BA 3MWJA 2WSMA 1I2DA 4V02A 5JEDA 4ZKEA 1CJMA 2RH5A 5FL7A 2DFKB 1SKQA 4KVGA 3K0CC 1J8MF 4MYUA 4Q47A 3KQHA 1LFDB 1EX6A 4CVNA 4KYIB 3QENA 5KPDA 2VIIA 5H68A 4B6EA 3LLUA 2XZLA 2J0UB 1KMHB 4KO8A 3L8ZA 1IY1A 3N70A 5C2JB 1G4UR 1Q12A 1KJYA 3A4LA 3VX3A 2J0SA 4V0ME 5F9FA 3ASYA 4AKGA 4B3CA 3UMSA 2JCSA 3M0EA 4ESHA 3KKMA 2HXSA 2R2AA 2KBEA 4LBWA 1W1WA 3JZAA 4AKHA 4Z54A 5JWHA 4RD2A 2W6IA 3K09C 3FHTA 2FE4A 2R62A 4BLTA 3QXSA 4DVGA 3NIBA 2R8RA 4I1UA 1YZGA 1UM8A 2GDJA 5FTMA 4IRUB 2ZRJA 1KNQA 2WKPA 3KJIA 4WVFA 2PCJA 4BFSA 1KI9A 3WYFA 5HCNA 3VNVA 2QM8A 4PPFA 3LAWA 1GOTA 3B9QA 3MG9A 5C4MA 4LRWA 1N6KA 3QUSA 1OXTA 4B3GA 1LS6A 2GA8A 2ZJOA 1XEWY 2ZAMA 2OFXA 3FVQA 2PMKA 5KNBA 1S9HA 2BBTA 1VDZA 3OESA 2G77B 3EXAA 4ESVA 3O8CA 1O3YA 3BERA 1E9SA 2HXYA 3GEHA 3QEOA 2JJ2A 1NVXQ 5E7MA 3ND9A 1ZVQA 2QZ4A 2WIBA 4RZXA 4JVSB 4DDWA 2CE2X 2XOKA 2YC2C 2VHCA 1S1MA 1ZU5A 4QJ4A 5GJWC 2EFDB 3ZVLA 1H8HA 3TQCA 5FPYA 4ASUD 4N0DA 4CEHA 4AG5A 2ZRCA 1KSFX 2BV3A 4M9SA 3C16C 3SI7A 2KBFA 1GTVA 2Z4SA 2GKSA 1JNYA 5LB2A 5L3VA 3PCRB 4RKFA 2WMOB 2O8CA 1N6IA 3H1TA 3K9HA 1BIFA 1QG2A 2C9YA 2GEDA 4UNSA 2QAGC 1R5OA 2YKGA 4RVCA 4GP7A 1N6LA 1WE2A 1A2BA 4KVAA 2IXFA 1MO3A 5FR1A 4DCUA 4FN5A 4MDEA 3TR5A 3GJ7A 2AFIE 3UG6A 3CBQA 4IEEA 3ADDA 4PPQA 3BORA 3RLFA 5JRJA 3D31A 1HURA 2X19A 5J4KA 2Q9BA 1TMKA 4UKDA 1MH1A 4NCJA 1G291 4E07A 1DEKA 3BOSA 3EWAA 2G3YA 2B21A 4WZAE 3W9YA 2BEKA 4Q9HA 5EE5B 4NCIA 2GXQA 1IM2A 1JR6A 1N0VC 4NYJQ 4IOLA 1AS0A 3IQWA 5FTKA 2IXGA 3S1AA 1JXOA 5JZVA 2PZGA 2CNWD 1VPLA 2A7QA 5FBWB 3F0TA 1J70A 4ERNA 5LBIA 1DAGA 2OSBA 1FMJA 3Q72A 5BN3A 1BO6A 1Z0KA 4RZ3A 1C9KA 1Z6YA 3GCGA 4BPBA 1G8GA 4Q5IA 4YDHB 1D9ZA 2FNAA 4B2IA 3ETLA 3DVLA 3IILA 4CT4B 2JJ1D 2ZI3A 3QXHA 3U6BA 4DSUA 3U60B 1G5PA 1SHZA 2EW1A 5G3ZA 2IBMA 3K70D 4HAWA 4D0NA 4TYPA 5JWOA 3EARA 1P62B 2GXUA 4C4PA 3GJ4A 1ZD1A 3FDIA 3MMPA 1R5BA 5CJ2A 1ESMA 4RFSB 1DO2A 2F1HA 2FF7A 4PZYA 3W5IA 5K8IA 2C96A 4BFWA 3LQRA 1G8FA 1NSTA 1P61B 2XOKD 1CJKC 1XCMA 1OSNA 3SHFA 3NHAA 3HPQA 1S96A 5DN6D 2CLCX 2A30A 2QMUA 1AJEA 3K9NA 5HZKA 5JS7A 1ZAKA 3KUDA 4TLEA 2KWIA 2MMGA 4LHZA 3E2IA 4ACAA 1Z5ZA 5GVSA 2ONKA 4JL5A 3T12A 4Q1BA 1OYWA 5D3MB 3RS0A 4GNKA 3KB1A 3IQXA 1T6NA 4XD7A 1GRQA 3K0CA 2IYYA 4O25A 1L7VC 1X1SA 2JLQA 3T15A 4AWXA 4A8JC 3PUYA 3TLXA 3NBXX 3ZIAD 2QT1A 3SFVA 2J0QA 5KUTA 4DUGD 2ZPTX 1VHLA 5H8WA 4HZUA 4M1OA 2G9NA 2ZXUA 3W8RA 4EJSC 5JBQA 3U44A 1N6OA 2J46A 1F60A 4ON9A 2P0EA 4FI3C 2HYDA 3HU1A 5KO2A 1FZQA 5EE0A 1ZNXA 4DIEA 3DL0A 1Q20A 2IHYA 2RGCA 2ZI7A 3K9LA 3RRMA 5JFGA 2QGZA 3ADCA 4TYYA 5HZHA 1E4VA 3Q5EA 2GJAA 1YQTA 4IJMA 1U99A 3DMDA 4IFBA 1VG8A 1GP2A 4TQ9A 2PJZA 1CLUA 1SKYB 3AUYA 1E2FA 2IX3A 4ITRC 4PAQA 3ZZ0A 5LD2C 2VBCA 4FCWA 3CH5A 2HF8A 4Q4LA 5DGXA 1G8YA 3HDTA 2W6JD 2D7CA 2AFHE 4WZ6A 1BS1A 1OH5A 4A0FA 2V7QA 4E22A 2VP5A 1IXRC 3W5JA 1G6OA 4HLUA 1CS4C 2WWFA 2PZEA 1D2NA 4OK3A 4M9QA 1GNPA 1GL7A 2ZRDA 1KZGB 3TQFA 4LHXA 5SZHB 1Q44A 4D4KA 3AF0A 1HY3A 5DSZA 4M1SA 4P4SA 4KLZA 4EDHA 4A1FA 3NTUA 2BCGY 3A36A 1GSIA 2ZR7A 2ZSDA 4BE7B 5B58C 1ZNZA 5GJBA 1W44A 2O8EB 1AGRA 4IOMA 3LVQE 1JECA 1DE0A 4Q9JA 3BWDD 2QRZA 5F98A 2GCOA 5EXTA 2ZAOA 3KKOA 2ZITA 2NO6A 1YR7A 1P9NA 3CX6A 3L0SA 4I81A 4LC0A 4TTRA 3MUFA 2VP4A 4B2LA 1KDTA 2NGRA 3DHWC 4D25A 2WHXA 2IYSA 2XZPA 3B1XA 4ZDKA 3KB2A 4Q66C 3MFYA 3EZFA 3UXMA 2QPAA 3QF7A 4WW0A 1OB2A 3P32A 3QPVA 2YOFA 3L0IB 2A2ZA 2QN6A 3QKSA 2HCJB 4EQ6B 4HAVA 1UEIA 5KDOA 2XNSA 4MKGA 3BFVA 1KSGA 4K46A 4A92A 5F9HA 4MRVA 1AZSC 3OFNA 4MDFA 2REOA 4AYXA 4CRWB 1JQJC 4NYMR 3P26A 3OF5A 2D2EA 1SXJD 4P4TA 1SHKA 1D2EA 2N42A 4QGFA 3PFIA 2VSOA 721PA 1KDRA 1QVAA 1ELOA 3VKHA 4DLTA 1RZ3A 4MYHA 4AYTA 5FOVA 2NO7A 3GJ5A 3OIWA 2H57A 2FEOA 2VP2A 1QHYA 1IXZA 2WKRA 1T8UA 4R9UC 3TE6A 3TSZA 2YHSA 2VA8A 1CJUC 4LJ8A 3DMNA 2RGGA 3HR8A 1D9XA 4G5QA 4JKIA 1TL7C 5CYOA 1R0ZA 2LKDA 3GLGA 1X86B 2ATXA 2FFBA 1IQPA 3IO3A 3DZ8A 4JIMA 1ZM4A 3RS4A 1N6NA 4L4UA 1OW3B 4B6FA 3CIOA 3FMIA 3QI2A 3U4QB 1D2MA 1KTVA 1M7HA 4G5OA 1GNQA 4F91B 3W34A 1E2DA 4QHYA 2ZTSA 3ZZUA 2GEVA 4CT5A 2C98A 1KJWA 4Y0VA 5AUQA 4D6PA 1XTKA 2OILA 2OUKA 5D3QA 3GLHB 2H92A 4JVNA 3QF4A 3MLEA 1G3RA 4MRSA 3SFZA 1CULC 3TMKA 1ZM3A 3AKDA 3HWSA 4ZPXA 1JI0A 1B0UA 1XEFA 3IBGA 1JAIA 1F2TB 2WJHA 4C0SA 2ZSFA 1CIPA 3CRRA 1LY1A 3EIEA 1JEEA 5FI0B 3V4FA 4B35A 4PQFA 4C7OB 2C95A 1Z28A 1XCPA 1J8YF 2G6BA 4HLCA 1BMFD 2JEOA 4L9WA 2QBYA 1GIAA 1SGWA 4NKRA 4ACBA 2B7BA 3NEJA 2WWGA 4DBLC 4PHTA 1EG7A 2RMKA 1XMVA 2IYUA 1VIYA 2XAUA 3ZVRA 1A1VA 2DPXA 2WM9B 2OEPA 1W4AA 3T5DA 2EQBA 2QORA 3IIMA 2JATA 1W0JD 2PEZA 5EXSA 3THOA 5HPYB 3MWKA 1E69A 2V54A 4PAOA 2TMKA 1GKYA
chains in the Genus database with same CATH superfamily
4WJKB 1LU9A 1Y1RA 4Y1RA 1UZNA 3FJOA 3A4IA 3WK8A 4PBSA 1DLIA 2AXEA 5JU6A 4ZOLA 3OPMA 1Y8RA 4IIEA 3WDKA 4NXNB 4NZMA 1VKNA 4AUEA 2QN3A 2OXTA 2X86A 2AX4A 5C80A 1MNAA 1A69A 2E4YA 1UK7A 1GPKA 1JDBB 1VJTA 4BS9A 4H9GA 3STTA 5KTOA 3NC1C 3G2HA 5JSZB 3C3XA 1BNCA 2FFQA 2QW8A 3ZWOA 5HF6A 3C85A 1XMOB 3SX2A 1OFTA 3P20A 1QU2A 2I8AA 4US2R 2RC5A 1T15A 1AXGA 1JE1A 3RC2A 1Y5RA 2O7RA 4YROA 2ODEA 2Q1UA 2Q6KA 2G40A 3H2KA 1KEEA 2WWXA 3RFFA 3COJA 4D1YA 3A1DA 1ZI6A 4JP3A 1H2AS 2RHLA 1BU5A 1FYWA 1ZPDA 3KSZO 3C8ZA 2YXEA 3PDUA 5ESWA 3TW4A 5AKGA 3T9DA 1GG9A 1KQ3A 1EFAA 3QIVA 5FXMA 4EG8A 4P3XA 3DONA 4AJ4A 2ZZKA 4WPGA 5CVEA 3M83A 4OHUA 1F3OA 1ODLA 1OREA 4Y98A 2JGNA 1XQVA 5AP9A 3RUPA 4DCOA 4ARBA 5HFNA 4J1TC 4NAUA 2X1LA 2VBIA 3O4HA 1CQIB 2H85A 2YN2A 3N2EA 3OZXA 4FEGA 4WXHA 2BSQA 5TXGA 5KHOC 3ESBA 1G2OA 2WE8A 3FB4A 3SYRA 1FMLA 2IYPA 2RGEA 1ACJA 2AN3A 1FQOA 3TRIA 1U3VA 2C2WA 3VAZA 4HGYA 4RK5A 1J07A 5FBVB 4EJSB 2D5CA 1T5TA 2O59A 4DCMA 3DFMA 3AESA 1O9BA 3VPCA 4QLBA 3MT0A 1SVMA 3X1DA 2RBKA 2ANBA 4DDUA 5I45A 5IJ0A 2H7XA 1L4YA 1PE0A 5H4GA 2XZOA 4AZVA 4JOCA 4TV8F 1TQHA 2D5AA 3B9BA 5SY4A 3OHSX 4LZOA 2JK1A 4JJ7A 4UZFA 3TLMA 3HH8A 2W6ID 2VQ3A 5HQ3A 1JEQB 1I14A 3M8KA 2ZI6A 5IH7A 3A1EA 4NJEA 2QX6A 4L3WA 4P35A 5KYKA 1KRXA 5H3LA 1YC5A 2D3WA 2HEIA 2C42A 4NBVA 4ND3A 4NOMA 1IRXA 3A0RB 1UEJA 3BKWA 1ZK3A 3BEOA 3HB5X 5EZ6B 5BO5A 1TPZA 4W1SA 3M5WA 4GE3A 4OX9B 1C7ZA 3H3FA 3D02A 3SE0A 2FDXA 1CRLA 1KKMA 2KX7A 3IEIA 5IT5A 4GEGA 2QVBA 4YA6A 1V8ZA 1ZD3A 3AM5A 1MR3F 5DOVA 3V48A 4DCJA 4I5GA 1ULTA 2YYZA 1SVNA 2X0KA 4YV1A 3I53A 2OBMA 3FMVA 5JXHA 4Z7OB 2GXAA 1JXQA 3WKEA 1TB4A 3HI4A 3CLTC 4KK3A 4MV4A 3K6KA 3T5PA 1E0AA 4J3FA 3ZQ4A 4DFDA 2DC1A 2R68A 4MGKR 1IJBA 5BUSA 5MDHA 5BWCA 5C51B 4O4JA 4XTCS 3UO8B 4FOSA 5EHIA 2VH1A 2NO4A 1EDZA 5I7OA 1J2JA 3TVYA 1BWPA 4D0SA 1XLVA 3M4JA 4X1OA 1PWEA 4P92A 5I4IA 2AYYA 2HY7A 4KCGA 1RWBA 2DX7A 3NTOA 2OC4A 1LPPA 3D4OA 3DCJA 4BX0A 10MHA 3J80A 2GAIA 1VLHA 3WMGA 4GMKA 1Z06A 5BUZA 4JT4A 3ZHUA 1KO5A 4OIMA 3A4YA 2O8DB 2ZUUA 1X74A 3I9OA 4Q9LA 4BNDB 4MLDA 4TKLA 2G82A 4MLPA 4Q3BA 4B4DA 2OHHA 5JNTA 5JYDA 2IU4A 5GV7A 3P4YA 2JLXA 2VHQA 3DKKA 2OSVA 4ZI3A 4X97A 2QLBA 4FT2A 4YHBA 1F1JA 2KMLA 1MHPA 1P9WA 4XIGS 5F78A 2XSZA 3QNWA 5DO9A 4GPZA 2DAPA 5P21A 3KTAB 3CH4B 2XIJA 3VNAA 3DWEX 1IN8A 4OHFA 1R15A 4NK5A 4JI7B 5JSYA 1B6SA 1GAEO 3E3MA 4EECA 2JH8A 4I4TA 2AE1A 2FB9A 3R0ZA 4Z0TA 4F8EA 1BJKA 4C0AC 1CJTC 2DEUA 4ZEVA 1NMQA 1NI5A 4M0PA 4IWXA 1VMAA 2F9FA 3NG1A 1ISPA 1KNXA 1BQ4A 2HSWA 2X9VA 1Z82A 3TIFA 1RJFA 1OFGA 3SP1A 3L4BC 4MKFA 3ZHRA 3VVMA 5G0TA 1VIDA 3SAJA 4XAQA 5BXYA 5DXFA 4Q12A 1SULA 1K5PA 4QBHA 3WLTA 1KYTA 4V1CB 5CXSA 1UBCA 2W11A 1JHZA 4GSKA 5LZ8A 1DTEA 2FJ0A 4EFDA 4KHZA 1M7BA 3JD3A 4TYQA 2ON6A 3LHKA 2OCBA 3RTAA 1DBVO 4TSFA 1Q0TA 3OMXA 1OCEA 4LVCA 2HRDA 3CLUD 4MVJI 1QOZA 4WZBE 3PXAA 3SZ3A 2Y8EA 4E5DA 2C7RA 3L7OA 3REGA 1XXHE 3LDGA 5KSYA 1U8AA 2EEZA 1XNJA 5AM5A 1VL6A 5B4VA 2XNJA 5EVCA 2QRMA 2WKQA 1T9BA 1LNQA 1BOOA 2C7VA 1W94A 2R6AA 2V7UA 3W4JA 4M3NA 3BTVA 3DMYA 4K9QA 1ATZA 5SV2A 3QUAA 1XMQB 4JNCA 1YKSA 3DWFA 2OGZA 2KQUA 2QQGA 5B1YA 1SOVA 2BGJA 1NN3A 5DTQA 1GG2A 1HA3A 1NBMD 2PMDA 5FBHA 1WIWA 1VLZA 2Z0MA 3E1SA 4MSUA 4ANFA 4C7XA 1J9GA 3CPJB 5E95A 2WUDA 4P53A 1P2SA 4XARA 3WLMA 3PGXA 3AKCA 5DULA 2UXBB 1A77A 1SKYE 3D6MA 2PBRA 1MEOA 2BKUA 1M2KA 5HBRA 6NULA 4CKBB 5IPFA 3DTTA 4LYFA 4PG6A 2DULA 4MWOA 3RKRA 3SCZA 3WHLA 5EHXA 4ENUA 3LNCA 3T38A 3WXMA 3P9XA 4B3IA 4CLXA 5ARBA 4NCBA 2FAXA 3Q0EA 1Z25A 1CT9A 1KBZA 1T9DA 3D6UA 2CVHA 3BXHA 1G8SA 1E9CA 1ZOLA 4TMXA 2P90A 2W2QA 2NV6A 3HJTA 3AF4A 1F8GA 2ROQA 4JYMA 3I58A 2CCJA 3FZNA 4LZLA 2IOYA 4L15A 4TKVB 4WZBB 1L7QA 5KBYA 3D4BA 3U61B 3AUUA 4BLPA 1C1XB 1G17A 3GMTA 5ALEA 4II2A 4KOEC 1XX6A 3PEFA 1P7VA 3BCRA 1DQSA 3CLVA 4FOTA 4HAYA 1WD5A 1FYFA 5ALMA 1D5WA 3SSOA 4EHIA 1NV9A 3ICQB 1G2QA 4J6FA 2ZE6A 4DRZA 1U8FO 4G9EA 4HFMA 4ZHQB 4S12A 2HQBA 4G5GA 2Y1KA 2YH2A 1I2MA 3VC2A 4HGOA 3H2SA 4W82A 5IXSA 1KMNA 1QO0D 4ZMBA 3RNLA 2TMYA 4H3VA 1UPCA 1E63A 1KPIA 2HA6A 5TS2A 2PTGA 4NS4A 3BILA 5IJAA 1G4AE 1U0HC 1RYNA 1Y4DE 2OOSA 3NS7A 5SYNA 1ZHOA 3EXEA 1TF7A 4B6RA 2BDTA 1OZFA 3M1YA 5K0BA 1PG5A 1MBZA 3D8HA 1OH6A 5K8CA 4YWHA 2GKGA 3NVDA 1OILA 4IDPA 5CH8A 2FVYA 4EPWA 4FDVA 4KQWA 3U5TA 5IVHA 4DUYB 5IHPA 1G4HA 1QDLB 2I7CA 1FYXA 1ADBA 1RRGA 4YDRA 2PQ6A 1RU3A 1ZINA 4EF4A 1VGRA 4PCLA 3ONWA 1MIHA 4PSVA 1JL3A 3K4HA 4LCJA 4MV7A 3I09A 4DUPA 4BTEA 1L5RA 4V1CI 2XVMA 2OHOA 3L7AA 1PF7E 4YJ3A 2ZDHA 4EUKA 1K2WA 4GKVA 1I1NA 2J9RA 2NACA 3QKIA 1EYZA 2FZLA 2RGWA 4ZMSA 3V1LA 1IM5A 3EQZA 3FYCA 4LOAA 4B6GA 3UBMA 4LHWA 5LD2B 4JD5A 2RHMA 2BLLA 3Q8XB 4CMAA 1G3MA 2R7MA 3SM9A 1NBIA 3W90A 2RHHA 2F9MA 5BWOA 1DBIA 2H31A 3IT3A 1OT3A 3PVZA 1KI7A 1X7HA 4NTZA 4DYHA 5HQTA 1JRLA 4IJWA 1IOZA 4MNTA 4KQEA 4LBYA 1X13A 5LA6A 3HYNA 3ZWPA 1K7YA 4D46A 1KK3A 5SZJA 5BW8A 2Y1LA 4Y9DA 3A6DA 1JPNA 2NN3C 3FFAA 3UJ3X 1U2TA 1J0AA 3ZXYA 1HL7A 1VBMA 5JIBA 4HS4A 2QYTA 1E2QA 5IEJA 3PKIA 1O94C 3S27A 4JP5A 5KKAA 3FCUB 2RK6A 2RKOA 4G5SA 2C58A 1GRRA 3D5TA 3ZDYB 1I10A 1OX4A 1M5TA 3NDPA 3KV3O 2QY9A 1ZH4A 2PCLA 2VUUA 3DZKA 4QUAA 3SXPA 5JECA 1EGMB 4FMPA 3CVWA 2WD7A 4REOA 1P74A 2FX3A 3EBPA 2YUTA 4DT1B 2QG9A 4HZGA 4QUGA 3C3DA 3N7AA 1JDNA 5CDYA 2NO0A 2XF2A 2YJZA 2JFOA 3AR9A 1E1DA 1XZMA 2ZULA 5JE8A 3T1VA 4JP8A 3OURA 1NKVA 4O4LF 3FPSA 3PUVA 2A0UA 3D5EA 4PZAA 3ZU2A 2O52A 3R7BA 4V0RA 6REQA 4P9NA 2ISCA 3H2GA 4HMPA 5C7LO 5K2MA 5A5GA 3K31A 3KHUA 2VPWA 5CHYA 2ZS9A 2H8KA 5AVRA 2PD3A 1A5SB 3JQQA 1JB9A 1TQ4A 1GUDA 2GLTA 2VEOA 4NBTA 4ECAA 1QFJA 4U2FA 3IKLA 2LTAA 4OAPA 2I2WA 1HNWB 1JHMA 2GSWA 3QJ5A 3WLIA 1MC5A 3MCAA 4L7VA 5FD8A 1IWPB 2QTVB 3B1FA 3TD2A 4CKCA 5I01A 3OX4A 2PE5A 3R7DA 3ZUGA 3QYJA 4A0GA 2FP4A 4DE5A 3B48A 1N57A 1GNLA 5L4SA 1Z74A 3T41A 5EJ9A 4BE4A 1NHWA 1HEIA 3DCYA 1T6ZA 4U8GA 1CEXA 3SQXA 1B8PA 1C3VA 4XJTA 4YRTA 4MQUA 2LCIA 3FUTA 5FLEX 2X40A 1P45A 4OPMA 5E4YA 1KVUA 1ZISA 3BX1A 4UDOA 4J7XA 5DNEA 1E1QA 2JLYA 4JKYA 1ISSA 3BFXA 2QXTA 1WMFA 1QK5A 2B61A 1UKZA 2GGSA 1GGMA 3G7NA 4MWCA 3PQ3A 2XSZD 5TGZA 2XVYA 1T5BA 2W6PA 1YASA 5AVYA 3JYOA 1ZR4A 5C4GB 4GI7A 2V7TA 3W7AA 4OX9Y 1CETA 1RKXA 2C54A 1TKRA 3JQ7A 3EODA 3QTTA 4EY4A 1A8SA 2BDUA 3WLEA 1KK2A 4BBAA 3ZWNA 1BKDR 4C7VA 1JLMA 3OVMA 1QTIA 1MA3A 1TVKB 2XGSA 4X64B 1EDBA 1UT8A 1A9QA 1UC5B 4K9NA 4AZ0A 1OLSB 3QFCA 2AHOA 2YXLA 1RXSA 2J87A 4EF6A 3ABSB 1FSSA 1EAMA 1R8XA 2AN9A 2C4UA 1E18A 1M2VA 2V9CA 3JYLA 3I01A 4GPEA 3UC9A 3W2GA 4R8RA 4R0MA 5KYWA 4L5CA 2UZ1A 4GHWA 4E5UA 2D0IA 2PVSA 3DO6A 2BWJA 3CQ9A 2B1IA 2WU4A 4MQFB 3H2BA 1NM5C 2FV8A 4G0PA 5ALHA 3HB0A 1SVKA 3N28A 2HRQA 1KYIA 4CIDA 4QG3A 5C53B 3KQOA 1SCQA 1OU0A 3KR1A 2PT5A 5BSGA 2VRCA 1GG5A 4QOIA 5IAEA 4B0PA 4IGAA 1S2GA 4N0EA 4AYWA 1T1SA 4OXIA 4S3MA 4H7IA 3IBTA 5KWVA 5ALKA 3E7PA 4WY2A 5CK5A 1NVFA 2C5SA 2NU6A 4YLGA 3DQPA 5CM9C 1ND6A 4YRLA 1HLFA 2YJGA 4MCHA 4RU1A 5KC8A 4CT0A 2EX0A 2QR2A 5EMMA 1SA0B 3PUWA 1P60A 2PNJA 2RI1A 4UHHA 2W4IA 3DW1X 1ADFA 2C00A 2REXB 1FX0B 1A8HA 3X0DA 3V5NA 1DTWB 2D54A 1I7SB 1BDMA 3SJZA 3W05A 1Y3BE 5AUNB 5KS2A 2CEKA 1GYRA 4HGZA 3UTCA 3TFWA 4RL6A 3V4LA 4WKNA 4FB5A 3JVEA 2VTEA 1ZD4A 1UBGA 1I1QB 1BMFA 4Y2YA 5KCZA 1THTA 2AG6A 3RHFA 2RK4A 3TXAA 4HOYA 1OI3A 1Z34A 2NT3A 3P97A 3GLHE 5LJIA 1MJGA 1W5SA 1WTCA 3OC0A 2IPAB 1WEKA 5TT1A 4F60A 3ZBUA 3CR8A 3MJ4A 1TXGA 1RR6A 2OCPA 3ZH9B 2B5WA 5CFNA 4YMGA 2DOKA 2LBPA 5HKBA 1KZYC 1VKRA 4DRXA 5EEGA 4GRAA 4BHTA 3E5MA 5JOQA 4HAUA 2JAOA 3F4KA 1Z12A 4G0ZA 4PYOA 4F1WA 3NATA 3NDJA 1P3JA 1P7PA 3SNKA 1G5RA 1VHWA 3D8SA 1UUFA 2G9QA 4Y2HA 1DTSA 2OAQ1 3SC2A 2SCUB 4BIIA 3OX1A 5AHOA 1O54A 4JZKA 2RGUA 2QN1A 3TJZA 5FO1A 3W78A 4NFYA 1GYPA 2BHRA 5SYMA 3FLBA 5JARA 4RJ2A 2DTDA 3L4BA 3QVLA 1NVBA 4NJOA 2AJTA 4YUWA 4JJEA 4NEHB 3E18A 4FP9A 4F1JA 1PJQA 1QHEA 3OOEA 4UVIA 1T5LA 5DHFA 4JVMA 3PFBA 2F8MA 4ZVTA 4F11A 2GRJA 3G2IA 3IESA 1PJ2A 4Y2PA 2X58A 1IBCA 1EFHA 2AEFA 1DINA 1HDIA 1QVRA 3HDHA 3ME5A 1H93A 1Q3KA 3FNGA 4II3A 5LVAA 4OBWA 5ECYA 2VNHA 3JALB 2DUMA 1J56A 2GASA 4AIIA 1RRPA 3VUFA 1F0NA 3DXYA 1XVUA 3KZ1E 4K3UA 3AO0B 1PO7A 1EWQA 3E22A 2Z98A 1NQUA 2OE2A 4CF4A 4XQGA 1S3IA 4TV9F 3IIKA 4W5JA 1M2JA 2QU7A 3LP5A 3V6MA 3N9IA 2ZR9A 3F5MA 1EUCB 5K6AC 2NVUB 1U7DA 3A28A 1QP8A 3RC3A 3A1FA 2PLAA 1YRWA 2H16A 4G89A 3KUXA 1YJXA 5AKIA 3AKYA 3VZRA 4P86A 4XEHA 3DV0B 2EYQA 1GN8A 1U9YA 2PSFA 4XQ0A 1SCDA 2VJMB 3X1ZA 4BKMA 3GAFA 2MJLA 4WN9A 3WLOA 3W5AA 3WGNA 2PNFA 2WP0A 4C3OB 2PGIA 3TKLA 1FY2A 4Y6RA 3U4CA 2N1BA 1BHQ1 2X0JA 4GBMA 4IPTA 1X3SA 3G2KA 3BULA 1PG0A 4HVTA 4NG4A 5DI3B 5IDVA 1ZCJA 2FW8A 1JEJA 1RWPA 2D0PB 4NULA 4RFLA 1MW9X 3UHJA 5MGBA 1AQUA 4JEIA 3QVKA 1PZXA 5G2OA 3HYCA 5CURA 2X9QA 2OD2A 5K51A 1JTEA 4H6PA 4HJRA 2XA9A 3U7EB 3B2NA 1A5ZA 1XJQA 1S3GA 2R47A 4CV1A 4UOEA 4L4ZA 1W87A 1RJ9A 4K81B 2VDWB 4MIYA 4EGCB 2AIRA 2CNLA 3B5EA 3EFBA 2GR9A 3Q15C 4RSHA 4BDTA 2V1UA 2E4VA 1ISIA 3KSDO 4FPXA 4MTCA 3Q4GA 4A8TA 2WZQA 1NF8A 3I05A 4ZCQA 4YEDA 3I39X 2EZ4A 4HB4A 2GS9A 1W30A 3L6BA 1DBWA 5JD3A 4CNBA 5HW0A 2I33A 3U4AA 2PUJA 1U2SA 4PG5A 3C6YA 1CUUA 4UBOA 1UK6A 2CNBA 1N3YA 4XI9A 1O5TA 4J0HA 2OCGA 2HD4A 3E8SA 2FPIA 2XQIA 4AX4A 3WWZA 5H16A 1V26A 2EHDA 2O2HA 1F5NA 4REMA 1G7CA 4H59A 5EWLA 3F6CA 4MUAA 5FL7D 3RWBA 2YNMA 5DNWA 1UMCB 3RVKA 1UWKA 1KAGA 1OVMA 1XZ8A 2LD4A 2R7AA 2ZJ8A 4LDNA 4DOMA 4YRSA 5DISB 1EXMA 3HSYA 3KU1A 2BSAA 1RLIA 2Z5GA 4MS3A 3M9LA 4UHCA 5B3KA 2Z58A 1W49A 1AVTA 1E7MA 1R50A 1ZK0A 3BGIA 2IEIA 3N0WA 3GNSA 2NPOA 4JROA 4M49A 2II6A 3RK1A 4C4YA 4AK9A 2MR6A 2JEZA 4NENB 5B7GA 3HCDA 3IVAA 3RK4A 4IHJB 4KQMA 1VE9A 1T4BA 1VFNA 1UC4B 3LFTA 5KOIA 3ZWQA 2JVKA 2J45A 2J7KA 1DU4A 4HD8A 3WBJA 1I4TD 1VRCA 4EHBA 3KEQA 2WT8A 3PGJA 1LQUA 5K4HA 2YKOA 2AI2A 3J7TA 3PEEA 4WGFA 4HRYA 4FZ5A 2X8AA 2WYIA 3KJEA 7ABPA 2BM1A 2W71A 3FSGA 1E9BA 3I45A 2GNAA 3DL7A 5TT0A 2HA5A 1K7EB 1KFEB 5IM4A 1BWQA 3LK6A 1W88A 1JQ3A 3GIDA 3OIVA 1G6KA 3GUVA 5FIUA 1UPBA 4OQZA 4CKEB 1OKKD 1YQQA 3BMCA 3T0GA 1COZA 2V6IA 4BP8A 4PX3A 3QPUA 3RVJA 5TMEA 5BNWA 2FWJA 3IGFA 3OSUA 3A2NA 3F5SA 5DW0A 1EM6A 2XJ4A 3T3IA 3W8NA 3I32A 2GUWA 3NHJA 4HSGA 4J0EA 1R3DA 3BWBA 2ZZMA 2JA1A 4OB7A 4YAIA 2HDNB 2DMRA 3DKRA 4YHHB 4FBMA 3PDWA 3QXCA 5IYZF 2CHQA 1LKZA 2XE8A 5JFTA 4PR0A 3OQBA 1V1RA 4HWOA 3P9ZA 4NLLA 5LP6B 3DBVO 5EIHA 5BRNA 5HOEA 2ZUSA 2ZJ3A 1GV0A 2XCIA 4CMHA 1RLOA 3L5KA 4ARZB 4A4DA 2GAOA 3A26A 2O8BA 3QI7A 4XYBA 4ZU6X 4B8YA 5BSRA 4YY3B 2WV9A 2R5WA 1U3WA 2ONCA 3BJEA 1XHLA 3ZGOA 1AD2A 4NMXB 5IUJC 4HZUB 4REQA 4FGJA 4EY6A 1ABFA 2ADFA 3QPBA 3GPLA 3PPYA 4WXPA 5G02A 3DMTC 3JYQA 3K0SA 1GXSB 2ZT6A 3ZVMA 4NBSA 2VTBB 1NLMA 3LY8A 2J5QA 2YINC 4WL0A 5DJ5A 4UZEA 4US0R 3C14C 4XDZA 1R6BX 1Y80A 2EEPA 1A8QA 1R3UA 1YZQA 2IYZA 4MV0A 2G06A 4ZVMA 5KTPA 1EHIA 2ZU0C 3OD5A 3PENA 2ZB8A 3TZQA 5AOAA 4AF6A 2ASVA 1H1TA 1OAKA 1Q3TA 1XTTA 3I0MA 1VYTA 5GPBA 5FEMA 3L1KA 4PXAA 4OXXA 3K1ZA 3PU6A 4E33A 3SFTA 4IKEA 1Y37A 5K3AA 4EW3A 3OCVA 1B14A 4EY7A 4P1ZA 4DWJA 2PUFA 3MSCA 5JY6A 1T9CA 3UA3A 4YCNA 4GL4A 5L9AA 1PQPA 5HDBB 2UDPA 4CTOA 1QKKA 2IVFA 2VJDA 2ZG6A 3OHMA 3H42B 4B45A 2JHPA 2YOGA 3DEYX 4NZYA 2EQ5A 2XDQB 4FJ0A 3T5TA 3SMQA 4J7UA 3WFJA 5ALWA 1XZLA 2ZYUX 4ZVRA 4IHKA 5TMDA 1NP7A 3T9BA 5BR7A 1HKUA 1YD7A 7MHTA 3DJYA 2BFWA 4M36A 4UOQA 3DOCA 4MS4B 3GEBA 4C7MA 1DZ3A 1NXVA 1O94A 2PA0A 2R3SA 3HJAA 1RHRA 3LBAA 4LY9A 4AJKA 1LWNA 4GT1A 3DE3X 2E0IA 4XM2A 2XUFA 2C0CA 3AI3A 2ZCVA 4G3XA 3WYBA 1ZICA 2EKBA 2CLSA 4R5MA 2D7DA 1QYWA 4HB2A 4UDXX 3SIPA 2EL7A 2WJYA 3H9UA 3U81A 3MBKA 3WGJA 1SBYA 5IXJA 4PO1A 1JW9B 3DMRA 3D3EA 4DV2B 2VO1A 4MPPA 5CD1A 1Q6ZA 3TVTA 2FKNA 3DE5X 1SVOA 3PRJA 1WEHA 3N8HA 5HOQA 3KB8A 1CR6A 4COOA 4ZV9A 1JMYA 2W6MA 2WU0A 3UYLA 3AFGA 2IY9A 2N47A 2O23A 4P5EA 2AUNA 4WBSA 1YZKA 1K27A 3R3JA 4MO9A 1ADJA 1VHDA 3G9TA 4DANA 3NMUF 3UMVA 3BGVA 1VECA 4M7OA 4BMOB 3H5OA 1D2GA 2ODBA 3G2NA 4FONA 4MR7B 3VU8A 5A4KA 3ZD6A 2QJWA 1U90A 3A10A 5HF9A 5HIAA 2FZVA 3GCXA 4I1RA 5SZIA 1XVVA 4LVOA 3ZJTA 2CXRA 1G60A 4GC9A 1KYQA 3G6WA 5KQLA 5BN4A 5K5EA 1N1DA 1HZZA 2TS1A 5KOHA 3ZDQA 1VBKA 5ER9A 4NONA 2X8JB 4F2DA 1QS0A 2J4FA 1K1EA 3FWZA 1K6IA 3F6EX 4HN4B 4QXPA 4BQNA 2LE0A 1C8BA 2CLIB 2EBHX 3ZGYA 2LGJA 2AX3A 1C3LA 2IDMA 5LP6C 2XGMA 1IFXA 3GJ0A 2CXXA 3I1FA 4KQKA 2O2IA 3C3AA 3ZDEA 3ZTWA 3DO8A 3FMPB 1KF0A 3X3HA 1G8PA 4JI3B 4ETNA 3MN1A 2VLIA 4RHYA 1J4AA 1UWVA 2HQSA 4M2LA 5LA6F 3S7ZA 1X9GA 1XZDA 1NFQA 4UVDA 1D0IA 1J09A 2GPAA 3JWGA 3MIZA 3X1JA 1C3OB 5IK2A 2OM6A 3M6VA 3P2OA 3VH3A 3VI3B 4EDFA 3D4NA 5IBQA 3WLQA 4EMSA 3D4LA 1SCNE 2JFXA 3ONEA 1RM0A 4RSGA 1K5GA 4C1NA 5I9NA 5KVAA 3DVSX 3RSCA 2FU5C 3NDIA 5TJHA 4BECA 1KYVA 1CEYA 1TZJA 2W58A 3KK0A 3QF4B 2QP4A 2MTBA 4B87A 3RC8A 3OD1A 1O95D 2KJQA 2HKIA 1KK1A 4RHUA 4FYVA 3RUIA 3FKQA 3ENKA 1WMSA 2NZJA 5JADA 5KSZA 3GMIA 4AURA 1E5TA 2PK3A 1XLTC 3HVJA 3D7NA 1HYEA 2VP6A 1OIXA 3CISA 1V8BA 5KI6A 3UXYA 5CEFA 3W77A 2FI1A 1JKMA 4IDHA 3KP1A 4IIJA 4JB2A 3L6OO 1DOAA 4DQUA 2J5BA 4IV8A 3LPNA 4K5QA 4ZI2A 3X43A 1J9EA 3VKGA 1F48A 1A2KC 3D1JA 3OZSA 1P29A 3VI4B 3ZXSA 4IY1A 4TM8A 2I7VA 4TTPA 3ZTTA 2HJHA 1M8PA 1MRZA 2ZR8A 3PUKA 5C31A 3OM1A 3TZBA 1QYVA 4EI9A 3HV0A 4WCFB 5EJIA 2ZKLA 3HSKA 2FWPA 1JHOA 1W47A 2Q5JA 2VDRB 3VPAA 5G1OA 1WOMA 1WBDA 4XGRA 3TLGA 2OYSA 3K09A 5K0ZA 3H9JA 5J63A 3R74A 4H0FA 4WTOA 3V46A 5JZSA 2DFLA 2H5IA 1L7NA 1T5DX 3VR5A 2JI9A 5K4GA 3IQEA 4K6HA 5EWJB 1K3TA 2VNKA 2EWMA 4EQZA 1J25A 1P2FA 3G17A 1IN7A 1ZN7A 4EY3A 3BXOA 2VTKA 3RAFC 4NECA 3R0QA 1ZIPA 4GMGA 4BX8A 1DIHA 3L4SO 2GEKA 2GZ3A 3AUSA 4IJKA 4LJ4A 4AM8A 5I4BA 1AMUA 1QO0A 2JGFA 2HLHA 1GO2A 2IPXA 5G0UA 4LBZA 2ZUTA 1TU3A 2YJ6A 3OE4A 1LK5A 4C07A 5FTLA 3TRFA 4YCJA 3EVEA 2DWUA 7REQA 3HKDA 1NQVA 2QYOA 3WMFA 3OX2A 4W5HA 3FOEC 2OL4A 5EKUA 5EPUA 5LM3A 2Y93A 3OIYA 4Y6GB 2QK4A 2VAVA 4Q4JA 3GELA 2KYRA 4BZZA 4BVKA 3F5QA 2ZJAA 2QTCA 3LM8A 5IT4A 5A0TA 1NRJB 1UK8A 2OHJA 3KELA 2H07A 4RJIA 5U1PA 4ARAA 1O6BA 4PLYA 4U7PB 3ZXXA 4QU9A 1JSXA 3A3OA 3I3OA 3IEKA 5FUVA 3ULKA 5KNBH 3R8FA 1EFPB 3OLQA 1V9SA 3EEFA 3OCCA 3MELA 1TJPB 4E5SA 5DHSA 5M04A 1U7XA 2Q0HA 1SU7A 2C97A 5AI8A 4S2EA 5A7HA 3ZHVA 2Z6UA 3OIFA 4MKXA 2FUG6 1NNSA 3IAXA 5ALUA 1EXNA 2A88A 2QSYA 2ZCUA 2DR0A 3KV1A 1HDOA 4Q4DA 4XW2A 4RZUA 1GY8A 1HSZA 4V03A 3TAXA 1XQXA 2ZI4A 1F12A 1PX2A 2D4AA 3LPCA 1GA4A 5FBRB 5C7IO 5HRUA 2C2GA 4PZDA 3AEQB 2LV8A 3GU3A 5B1HA 1OZAA 4D82A 4I5EA 2QI9F 2QN7A 1D6JA 4DM7A 1ZD2P 2GMWA 1DX9A 3RGGA 3RSZA 3KSBC 4GXQA 2Q4RA 2QUHA 4B33A 4JLJA 3SBOA 4J8PA 5KU1A 3V4RA 4HXGA 2GM4A 1AT1A 1XGKA 3H19A 1B93A 3WWPA 1UBMS 5ES3A 3U44B 4JUAA 2HHLA 3ZNNA 1TK3A 3QXJA 4ZT2A 3NHRA 1B8OA 3AZOA 3QKRA 5J1TB 1OHHD 2PKQP 3K71B 2A9KA 5DHAA 1R4ZA 2W70A 3G8CA 3IIEA 5AK4A 4D3YA 4KWIA 1WKBA 2W8ZA 4IIBA 2AMVA 3FFBA 4KB5A 4INOA 5LYYA 4TPKA 5CIWA 1OFUX 3QE0A 3AB7A 3QA3E 3MWEA 3MS4A 1PUJA 4GYKA 2I1LA 3IO5A 3LNTA 4MUFA 1KEUA 4FUQA 4BATA 3LJKA 3TNFA 2YXBA 4M0LA 3VTFA 1YF3A 1PLJA 1U63A 2BFNA 5T4FA 2WZCA 3UHPA 4FMDB 1YDHA 1H22A 1TQ6A 4PIVA 1OI2A 2C84A 1FU8A 2BGTA 2XR1A 3BZBA 2OAEA 4RIGA 3AHIA 5EERA 3DGEC 3V7FA 4CM6A 1P8JA 3LF1A 2OFWA 2FSVC 3CRW1 1B7GO 3AGQA 3F6BX 3LE8A 1V3QE 2GZ1A 4V38A 4DIDA 4HZIA 4DNQA 3N8IA 4URYR 1JG1A 1HM5A 1Z0SA 2QRQA 3LZ6A 1E3DA 1RHMA 1MAHA 2KM1A 2PZAA 2VJNA 3FOBA 3L6EA 4UEQA 1X8KA 2HQ1A 1O03A 2FOIA 3KTOA 3S8YA 3W3AA 2XUJA 1EIWA 3RW9A 4DV7B 1TCAA 2N46A 2XNKA 5A3QA 2LXNA 1WB5A 1LCIA 4AU1A 1GHTA 2J09A 1JB1A 3CH6A 4CMEC 3OJOA 1TJYA 1P1JA 1M76A 2VDPB 1E32A 4QFBA 1N0HA 1CY1A 3DDCA 1NZFA 2C9OA 4IFTA 3NPAA 4ZWNA 1DRVA 1XNHA 4OJQA 1N75A 3BH6A 5K6TA 3I9KA 1PWHA 2J67A 3MB5A 4FK8A 4HEJA 4EQ6A 3L8YA 2Q1WA 3O5AA 3OHPA 3QVXA 1U98A 4N6GA 1QAOA 3D59A 4NQRA 3DZBA 3IRVA 2PQ0A 3PNLA 4I50B 4BAUA 3LKBA 5K45A 1WF3A 1TM1E 1IC6A 1OF1A 2V8BA 3HO6A 3Q0IA 5CT8A 5CVVA 1ORWA 2QL9A 4HKTA 2BOVA 4MUKA 1K7SN 1ML3A 2RKWA 3KVNA 4IVQA 3LW7A 3T54A 5ICMA 2ZUBA 2AOXA 3JRXA 4OJMX 3KYDA 1QF7A 2R8XA 4JP1A 3DHYA 1BA3A 3BMQA 4PGGA 4Q7KA 1A72A 4U0JA 2UYGA 3WBBA 4PGMA 5C8DA 5LQDA 4IXTA 2G6TA 3EA0A 1Z6TA 1Q0LA 2HFJA 3DF9A 3I9JA 4UHDA 4ABTA 1AF7A 5E9JA 4B3FX 3H18A 4KFUA 3RU9A 4QPJC 1RCUA 4Z1MD 3FVRA 4EHFA 1EUDB 2YYYA 4YJ3F 2PX6A 4I14A 4DUGA 3QELB 1TK2A 3V7WA 3KVOA 1NAHA 3HBMA 4JSTA 3KOXA 3VHLB 1OC2A 1O4WA 1JG6A 4KMSA 1QRTA 1EK1A 2P2YA 1O8BA 4EM6A 1MMFB 4WH0A 3T7RA 5LWHA 2JI4A 3C5WP 4GSLA 3AETB 1NZJA 3IEUA 4A8PA 1USKA 4INZA 1SOWA 4LYGA 3RHSA 3WGLA 3B78A 1EWKA 1Z62A 2AV6A 2QQ0A 4TQGA 5IYZA 3ADBA 1Z07A 1S0UA 1ZA1A 3VYSB 3DC2A 3IAEA 4PQRA 4P83A 4UNNA 3A6GA 1VKZA 5ECGC 5K0JA 4BOYA 5LZ5A 1WUJS 2PAFA 3H8WA 1ZGJA 5DVZA 4C6TA 3G5TA 5D51S 5ED4A 1MO2A 3I6MA 1I13A 3ZU5A 1JPJA 2HPHA 4AG6A 5LMCA 1GNVA 1W1UA 3F74A 1XL1A 5KSOA 2QG6A 2YQ4A 5DNYB 1B00A 3NALA 2OWDA 4IDNA 1VE5A 2W0SA 2ZYRA 5J4VA 2E6UX 1NT2A 2P2DA 1YE3A 2G9UA 2PT6A 4G37A 2UYYA 3FUCA 4JAVC 4HEHA 5JNSA 5EUQB 5IDWA 5D5PA 3RTDA 3II6X 3HNOA 4OQQA 4XYEA 3DAYA 1DFHA 4EX7A 4PYJA 5CDGA 2OESA 1SU6A 4RD6A 3WKBA 1NVAA 2JK0A 2PT7A 1NI4B 4LKOA 4D3SA 1V11A 3GWZA 1OXSC 1PRYA 3GFBA 5D1NA 1F2UA 3VH4A 4CEHB 4I8IA 3RSLA 1LDEA 1WXQA 3GXOA 3LSTA 2JCGA 3JAWB 4XIIA 4YFYA 1LGYA 1N2HA 3OTQA 2FDRA 3W9SA 3L06A 4B81A 5GIPE 1HQCA 3E4CA 1CSEE 1NP3A 1I33A 3LCJA 3JQ9A 1I8TA 3FYTA 1DG1G 5FR2A 4BLVA 1YQXA 4AZ3A 1YNOA 2IL1A 2Z5FA 1AKRA 2WLTA 1IJKA 1CUGA 2Z4RA 1PWZA 5BP7A 4UTXA 5AJTA 5D3MA 1T5OA 4KNWA 1QIKA 1T1IA 4GVPA 1SIWA 2XUZA 2WAYA 2IWHA 1Q0HA 4LRYA 3CB4A 3LQYA 4QZVA 1YQGA 3KR2A 3UATA 1IUKA 2W2NA 1FFSA 4RZHA 1U2PA 1CP2A 3A9UA 3N53A 2NXWA 2YWXA 3DTVB 4QREA 5KCMA 4DM3A 4FOOA 3L0PA 4B73A 1QE0A 3WWDA 3U9LA 4RH3A 5LQKA 2CK3D 1VL1A 3EISA 1DC8A 1MX5A 3NBKA 2TECE 2XE4A 3QMPA 4PNZA 1L8AA 4BLQA 1FDIA 3CS3A 2DR2A 3W1WA 3DM9B 2P67A 3F9IA 2BH2A 1R10A 3CR3C 2R86A 2X3UA 1XD8A 2C2MA 4PZCA 1RYFA 1A7JA 4X20B 2QW1A 3V42A 5IMSA 2O2EA 1VJ1A 1G21A 1ZH8A 2IZOA 2ZBUA 3H86A 1FQJA 2PN1A 3O4GA 1CUXA 1GKIA 4HDSB 4WI1A 3SSAA 2HA3A 3LW8A 1E5LA 2I62A 4DEYA 4EKGA 5JJ5A 1C30B 4WBXC 1SD1A 5LC1A 3R9XB 2JIRA 5HK8A 4YUAA 1NF9A 2Q1YA 3IBFA 4BB6A 3AY0A 4BP3A 5BPHA 2ZAIA 1SR8A 3P5SA 4KXNA 1FUKA 3Q0TA 3RLIA 4WBNB 3JQ6A 4LWOA 4DM4A 4WUTA