2OFOA

Msreca-native
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
328
structure length
328
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 87
structure length 328
sequence length 328
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2ofoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofoA01
2C03A 3KB2A 4PC1A 4HLUA 1X3SA 3EARA 2YC4C 4NP6A 3QKRA 4AKGA 3AEZA 1T91A 2CBZA 5IT5A 1G16A 1U81A 2A5FA 2P3SA 5F2EA 1NSFA 3AVVA 2HT6A 4G0NA 4DSUA 3TR0A 1I4DD 2DFNA 3K8YA 4G5OA 1PJRA 2NZ8A 4PAQA 5AJYA 1OB2A 2H8KA 1NG1A 3OEEA 2UZIR 4ZI3A 5E7MA 2V1UA 1FUUA 1YZGA 4ZO4A 3MJHA 4A15A 1XXHB 2C9OA 4KLZA 4V0LA 2DBYA 2Q3FA 1WE2A 4LHYA 4B2PA 2J0SA 3H84A 2O0HA 3T1VA 1FUKA 2IYXA 2LCFA 3ZVLA 2ZSFA 3RSLA 3OIVA 4DUGA 3MWKA 1W36D 3B60A 4PXAA 5EXPA 2FSGA 2PZEA 1R8QA 1RKBA 1IOZA 1XWIA 2B92A 3EIEA 2CK3A 1N6NA 4JT2A 4B6EA 1AS2A 4F92B 2EFCB 1ZMXA 2FX3A 2IL1A 2DYKA 4G5RA 1WB9A 2JEOA 3C8UA 4D80A 3LAWA 3SJCA 4B76A 2CXXA 2ZRPA 1VDZA 3WYFA 4UXIA 1CJMA 4L5BA 4MQBA 3ZQ6A 2TMKA 1RRFA 2A9KA 2OLJA 3E70C 3THXB 1WP9A 1E2JA 1VPLA 1M8PA 1ZUIA 2EQBA 3GLGB 1N25A 4E22A 1XU4A 2J7PD 3BORA 2AR7A 1J90A 1TEVA 1OHHA 4P4UA 3OHMA 2ONJA 2DPXA 4M9XA 4GI7A 5JCPA 4MUBA 1CLUA 3QF4B 3AUXA 3TSWA 1KSJA 3V4RA 1XTQA 5EJEA 1KSHA 3BS4A 3ZVNA 4FWTA 1GNQA 1LB1B 2VP9A 1U0LA 2D62A 1G3MA 3FYHA 4W7SA 3CPHA 4BFZA 3HU1A 2IS4A 1KNXA 3W8RA 2BKUA 2QU8A 3R8FA 2VP2A 5JHGB 4DCTA 4DB2A 4MYUA 1MO4A 1J2JA 2QAGA 3LW7A 3BB4A 4Q4JA 4U00A 1SQ5A 1RRCA 1LY1A 2W2TA 2YC2C 4Z8YA 1DAKA 1MT0A 3D31A 4IDOA 1NMZA 2FSFA 2ORIA 2B8WA 1NRJB 4JIMA 1TUEA 2HJVA 4PZLA 4LJAA 4TL8A 3ASZA 4M1MA 2OT3B 4PAMA 4TN1A 4XVQA 3A4NA 3BOSA 1R5NA 4LX0A 4HAYA 4TMTA 3FHCB 1M6NA 3CNNA 5A5GA 1E9EA 1SXJC 2V4ZA 4QBIA 3ETLA 5FBVB 5LD2C 2OBLA 1FNMA 2ZJ5A 2WJVA 4JSYA 3VX4A 1YVDA 2ZI9A 4RD4A 1E9DA 3SOPA 4V03A 2GZAA 3IO5A 2IUSA 3EA0A 2ZRNA 2PCJA 3CX6A 4C9BA 3NWJA 1UADA 4IEIA 2YZ2A 4RVCA 2ZRFA 2G0NA 2O0KA 3WNDA 2FGJA 2QRNA 2ZRGA 2ZS7A 1OHHD 5BW8A 4R9UC 3KKQA 1P7CA 2Q6TA 3A8TA 4WAUA 4HB0A 5CJ2A 2XEXA 3KQUA 4DWJA 4Q1EA 1NJGA 3UK6A 3EPJA 2GTPA 2YV5A 3SBEA 3VNUA 1GRQA 5KDLA 1JEDA 1Q1EA 1X8JA 1KZGB 5A4JA 1GZSA 5KDOA 1UDXA 1QDEA 2WMNB 4RZ3A 3KJEA 1W7AA 3DDCA 4V02A 2CLSA 4HLUC 4ZI2A 1W46A 2X1VA 2HLDD 2EFEB 5G3ZA 1OSNA 4AD8A 3RS0A 5DISB 3I32A 2QAJA 3NKVA 4KSCA 3GLFA 4AI6A 4MRSA 3MWLA 3JVVA 4BLPA 2OUKA 2ODNA 5FOWA 2YWFA 3GLFB 1YZUA 4EKDA 4G5SA 4TYWA 4GPTA 3HWSA 4PQYA 5AUQA 4PSVA 4HZUB 1IN5A 2FFHA 3AF4A 1S4QA 2QE7A 3U3RA 1ZNWA 2G1JA 4FMBB 2G9NA 2O0JA 4TTPA 1ZIPA 1OFHA 3MAAC 4Q7JB 5EZ6B 4FMDF 2F3TA 3GJ0A 2WHXA 3UG6A 5AK0A 2JJ1A 3NEJA 1ZNYA 1SXJD 4CT5A 1P9NA 1VCNA 4QGGA 4UNPA 3WY9A 4QJ4A 1UBGA 2AFIE 4NYJQ 5KPJA 1P2VA 3A6PC 1TADA 3U3OA 2CJWA 2FMXA 5LBIA 4TYYA 3MUFA 1Z07A 2VP6A 4IOJA 1F5NA 4D0GA 3ZD7A 4TZ0A 4Q9LA 1YHNA 4C0HA 5KO2A 3U3JA 4M1TA 2ZRKA 1CIPA 1G4UR 3LBIA 4V0OA 4LYFA 4O0MA 5JI3E 2XZOA 1CR1A 2CNWD 2HEIA 4HATA 2EFHB 1XCPA 4A92A 1XEFA 2ZUBA 3UG7A 4BFYA 4V0KA 3GFPA 5C1BA 1KKMA 1GNPA 4LRWA 2UKDA 2WJYA 1KJWA 4D81A 1CKEA 5G3YA 2Q9BA 3L43A 1JALA 1OXTA 1SVIA 3MLEA 3SFVA 1XFAA 5EE5B 2WJJA 5FUVA 4GP7A 1P60A 1HURA 1XMIA 2VBCA 2N1BA 2JLQA 2CK3D 3B1YA 1Z0FA 4KBFA 4KSBA 3I8SA 4FIDA 5HCIA 2GK6A 1D5CA 2KB0A 4PTLA 4B3DA 3AP2A 2QI9C 5HR5A 1MO3A 5JZVA 1OXVA 4YMSA 2RGNC 4GOKA 2HDNB 2IYLD 4Z51A 3SQWA 5JLJA 4JKYA 4EPXA 2ZS8A 2KWIA 3QVVA 3U4QA 4PSKA 4MKGA 4RD2A 4WIAA 3BC1A 5KSPA 1VYTA 3QVUA 1KK0A 4AYTA 4DHEA 2O8CB 2IT1A 2F1HA 4D82A 5FI1B 2GBLC 5HZHA 1ZNXA 4LBZA 3EZ7A 521PA 3E5HA 4LV6A 4PZYA 2PZGA 2CDNA 4RKFA 2F7SA 1VYVA 1WQ1R 3CO5A 1XCGB 4BUJA 2QPAA 1ESNA 2G6BA 4ABYA 1KKLA 1G20E 1KJZA 3ICQB 4LUCA 3B7GA 2DWOA 2FU5C 4BEBA 2XZLA 1P2SA 1UKVY 4MYCA 4QOSA 4Y0VA 3TQFA 4NPHA 2GWHA 4ON9A 1BH2A 1IQPA 1E2LA 1TQ2A 2GCNA 3B85A 5C4MA 4ZV4A 2OCAA 4FN5A 4BZXA 4NBSA 1Q20A 1F2UB 1IXZA 1CXZA 1TL7C 1NG9A 2G1KA 1EESA 4X8LA 1TU4A 3R20A 4M21A 2OO7A 1JPJA 1VCOA 3SN6A 2ZI7A 2WWIA 4TLEA 1E94E 1YE8A 2G3YA 5FPHA 4DIDA 1RFLA 1G8YA 3SDZA 1W4AA 5DYIA 2XOKA 3AVWA 2VA8A 2QT1A 3LV8A 2ERXA 3C7KA 1Z06A 1P9RA 2IUUA 1ONBA 2P6RA 2VLIA 1FQKA 3IHLA 2ZRIA 1Z5ZA 1JAIA 2H5EA 2R6FA 1CJVC 3P32A 3SHFA 1SVWA 3DVLA 4OI2A 1Y3AA 5BWMA 1E4VA 4XOIA 2VHJA 1HY3A 3DOEA 1ANKA 1E1QA 4O2RA 3DMDA 3NXSA 3C4JA 2ZANA 4R71A 1ZD8A 4PSAA 3F0TA 4KFRA 4PC2A 3TJZA 4Q7LA 1T9HA 5LPNA 1Z08A 4YC7A 3QKSA 4XH9B 3QF4A 3THYA 1J70A 1XTSA 4HB3A 2A3RA 4CEIA 1Y63A 2JLXA 3I4LA 4B3GA 3K0CC 1Z6YA 3CZPA 5F3WB 1N6PA 3B8HA 3UANA 1EG7A 3R7WA 4L9WA 3C41J 4DT1A 3JVUA 1U8ZA 3KZ1E 4RD3A 1E99A 4NONA 2OXCA 2AK2A 2ZE6A 3RHFA 2QAGC 1DAGA 3QXHA 5B57C 3QKTA 5IHPA 1P72A 3C16C 1KI6B 3AF1A 1SKYB 1KTVA 3A1UA 1E4YA 2HYDA 2ZSAA 4C2TA 1Z0DA 1YR7A 3H1TA 2IWRA 2C98A 2E1RA 4JZKA 3OFNA 3RS3A 4G01B 1OPXA 3TAHA 5JWOA 1GKUB 3FMIA 4P0TA 3PENA 4YXWD 4JYCA 4X8HA 5JSZA 3X2SA 1KO1A 1R7RA 2BMJA 1YRAA 2VP5A 2F9MA 4EPVA 1YZQA 2YOFA 5EXXA 1UEJA 3NHBA 3IEUA 3L0PA 2OCYC 3X1ZA 5DN6D 2FA9A 4B75A 3K09C 4G5QA 3IILA 2QRZA 3NG1A 5JJKA 2ZREA 1G3IA 4F4CA 1JBKA 1QG2A 3NC0C 4I99A 3QUSA 1E2GA 1LNZA 1QVAA 1G8FA 1WA5A 3RYTC 1KHTA 4LBVA 1NNEA 1R6BX 4YDHB 1KY2A 4M9SA 2HUPA 5DIFA 4TYQA 4GBMA 2QGNA 5FI0B 3W5JA 3T5DA 2QA5A 3UIEA 5EXTA 4D4LA 5K8UA 1VG0B 2PLRA 5JS8A 2IYZA 4Q1BA 2RMKA 5CYPA 4OI0A 2A5JA 3K9GA 2ZRDA 1CJTC 2CCGA 3OE7D 1LW7A 4JLKA 1S9DA 1W2GA 2B21A 1F6BA 2PBRA 2ZU6A 1KSGA 5E95A 3GD7A 3MMPA 3M4YA 2J1LA 5CM9C 1W4RA 5KSZA 1TUIA 1SVSA 3OEHD 2WOJA 2GCPA 3LO5A 3R8CA 4BE7B 4MDFA 3SU8A 2QTHA 4CEHA 4PHGA 1KYIA 2ZAMA 1PZNA 1Q44A 2VYFA 4F4JA 4DDUA 4JS0A 3PJRA 4OK5A 3Q85A 1PLJA 2V1XA 4PO8A 4TMVA 1EXMA 3THWA 3OFND 3HPQA 1E9RA 2WKRA 4R7ZA 4PHHA 4G5GA 5J4VA 3TLXA 5SZIA 2PJRA 1F3OA 1P4SA 2V6IA 2VL7A 4UXHA 3LXRA 4EQ6B 4N0DA 5TV2A 1WXQA 1DO0A 421PA 3T5GA 3IEVA 2VF7A 3T12A 4AG5A 2FDCA 1R4AA 4QXAA 4P4SA 2Z4RA 2ZVPX 4C7OB 4PQFA 2IYSA 3ZGXA 4CEJA 4DRZA 1TQ6A 3ZS9A 3P26A 2CL0X 4LGMA 1W5TA 2W0MA 3U7EB 3ZZTA 5JS7A 1G18A 3B1VA 1VYUA 1KI9A 3M1IA 4DBLC 2PEYA 2RCNA 2NIPA 1G19A 4O2LA 2DFTA 1Q1QA 2R65A 2YWEA 1IN6A 2D06A 1NIJA 1JQJC 1W2HA 2FSIA 1G3RA 2JJ2D 2OFXA 4PC7A 3T06B 1F2TB 4Q03A 5KSYA 1XD8A 1NY6A 3SHWA 4D4KA 2JIZD 2VRWA 4P32A 1BMFA 1WMSA 1ZINA 2NGRA 2GVZC 1XEWX 2IHYA 2ZJBA 3BIFA 4F7WA 3CPJB 1IXSB 1I4LD 3KXKA 5HE8A 1ZRHA 4JBWA 4OBEA 1G7CA 1L4UA 2ZJOA 2AD5A 1AA3A 2FNAA 1DG3A 1HH4A 1KO8A 4MGIR 5EP4A 3K53A 1G5PA 3B6EA 4QBHA 5DN6A 4PC3A 3B9PA 3KUDA 2ZRJA 2REOA 4TL6A 5DHAA 1NN1A 4JLJA 4OHZA 1V5WA 4BFVA 2QNRA 2ZYWX 4CT4B 1NVVQ 1JEEA 2J5XA 2BOVA 5H70A 2XJ4A 1E79A 2V9PA 5IDVA 5FTLA 1G7TA 4PPQA 1CJUC 4TSFA 3WHLA 1NP6A 3SFZA 4LOAA 1OH7A 1UBCA 4XWKA 2P0EA 1S3GA 5B58C 1KI3A 3TUZC 3A4LA 3SQXA 2QBYB 2VHCA 1S2MA 2JASA 4D26A 3K0FB 5JEEA 1E69A 1P9WA 4Q19A 1OFUX 2CLCX 2C96A 2BM0A 3VMFA 2ONKA 2H92A 2H18A 1ZM7A 4EIWA 3M0EA 5KPDA 3PUVA 4B74A 3U3KA 5FPSA 1TPZA 2W0SA 3EW9A 3DZ8A 1AK2A 1R8SA 1M34E 1M1YE 3AVYA 2REXB 1BYUA 2B6HA 3AVOA 3PIRA 4Z1MA 1Z6XA 4JLPA 1GFIA 2C99A 1X1SA 4P31A 2O8DA 4KHZA 3KKPA 2WKPA 5CJPA 5JWRA 5AUPB 2ZS9A 5JCZA 1W36C 2KI5A 3RS7A 2P5TB 1N5LA 3S1AB 2ZR7A 3T1QA 3EX7C 1KAOA 1ZC3A 3EZFA 4NDZA 2JLUA 4QM6A 1Z22A 1KO4A 4O25A 2FSHA 2P6NA 2JJ1D 1JR3E 1N0VC 1P2UA 1FL9A 1I2MA 3RANA 4HUQB 2VHTA 4KBGA 4QHYA 1O3YA 4QG7A 2A7QA 1X1RA 4LPSA 4LBWA 1CP2A 3RLFA 2O52A 4YMUA 1NKSA 2FJUA 2ZE8A 2GCOB 1VG8A 3P1JA 5FPKA 3CR8A 3DL0A 2OM2A 3SYLA 2XXAB 1S0UA 3AP3A 4HSEA 3KQLA 1EWQA 1U9IA 2WICA 3CWQA 3FFAA 4BLSA 1VHTA 4GP6A 5LB2A 3ONWA 1R0WA 5C18A 2GJ8A 4RZUA 3QXXA 2JLZA 2X2EA 5DI3B 2IYVA 4BASA 2JLWA 3U5ZB 4EDHA 3KQHA 2OAQ1 3QXCA 1W1WA 3V9PA 2IX3A 3NBZC 3DZDA 1TF5A 2IC5A 2YOHA 3WBJA 3HYRA 3LBHA 3VR5A 4BFUA 5DI9A 3SJBA 4LK2A 3VR3A 2Q21A 1IN8A 1RRGA 1XD2A 1VIYA 4AKHA 1KJYA 4H9GA 4A9AA 5L3QB 2VSXA 1U94A 1NKTA 1P3JA 3K09A 3GEEA 4C0AC 3QG1A 5JEDA 2R2AA 5AUOB 5J4YA 2PT5A 2AFHE 2IUTA 2WKQA 4IVQA 2ZXUA 2FN4A 4BWYA 1TX4B 2CLDX 3Q8XB 2A5YB 2J7PA 3Q5EA 4Q4LA 5HKKA 4TQ9A 1E0KA 1T4GA 4RD1A 4TLDA 1LFDB 1VMAA 3PEVA 2CVFA 1ZM4A 4KYIB 4TL7A 2V7QA 5AUNB 2EU8A 3A1TA 4AK9A 5JMTA 1FPMA 2GAAA 3NVAA 4DLZA 2ZU0C 2QUZA 1FMLA 3T1TA 1OB5A 4LJ5A 4BLQA 4MITA 1Z3IX 2KBFA 3EWAA 1ZC4A 1O87A 2ZE5A 2XZPA 5GJCA 1GAJA 3VU9B 3U7HB 4JLMA 1X6VA 4DSNA 2MSDB 5DE3A 3A4MA 1UAAA 3CR7A 4C0KA 1T3SA 2BBSA 4QJ3A 1I4TD 3I62A 3RRMA 3B9QA 3AVPA 5ANRB 2AN9A 4LJ4A 4DVGA 2GILA 1JR3A 2NPFA 2FZ4A 2QSYA 3QEJA 2ECKA 2ERYA 4MKFA 1QHIA 4UQOA 3ADCA 2C9YA 3V00A 3EXAA 3GJXC 1E6CA 3MFYA 1FFHA 4BRWA 3BH0A 1A82A 5CITA 3NH6A 4A8JB 1E96A 1E2NA 4PPNA 3LVRE 3CRW1 5J4LA 4K46A 4Q21A 3FWYA 4M1KA 2ZSBA 4Q48A 1YR9A 2J87A 4NHOA 3TR5A 2IF2A 4AG6A 4C0SA 3LWNA 3I5XA 3OAAA 1OE0A 2X77A 3HJNA 2IS1A 1GL9B 1OV4A 2QTFA 4RFSB 5FPYA 3I72A 3CKLA 3RS2A 2H57A 1S8FA 2WZQA 3TVTA 4NE2A 1ZU5A 4AYWA 4E07A 3O8CA 1QHNA 2ZI5A 2HYIC 1TNDA 3SS8A 4A2WA 1FOEB 2VHQA 2VSOA 1XTIA 3PV0A 5D3MA 3V4FA 3OIUA 4EJSC 2KSQA 4QC2A 2AX4A 1IAQA 3EASA 1ZYUA 4WZ6A 2QMHA 4CW7A 4M22A 3G0HA 2ZIAA 1G6OA 4M1YA 1K5GA 2ANBA 1DAHA 1XMVA 1JECA 1R2QA 2VO1A 4TLAA 4WOPA 1C1YA 4WZBE 1E1QD 4QNRA 2R6AA 2FEOA 4H1UA 3ZJYA 4DCSA 5CB6A 1A2BA 1UKEA 3CNOA 4MGYR 5FOTA 3VKHA 2RHDA 4N3NA 4TL9A 3GPLA 2O5VA 1XCMA 3U6KA 1EFHA 4PO1A 2WWYA 1W5SA 1BYIA 3KXIA 4KFSA 3KFXA 4NCNA 2QM8A 1U99A 1B0UA 1NY5A 3IQXA 1NMXA 3FB4A 2F1IA 4LHWA 4YONB 4O3MA 1SXJB 1E3MA 5DHFA 2PZFA 5KTYA 4EPWA 4P3YA 1L7VC 2CEAA 4DDTA 3OESA 3VNVA 2C9CA 4EPRA 2D7DA 4CRWB 3AVXA 2QROA 2XJ9A 2IYQA 1NL3A 4GOJA 2O8EA 2JCSA 3LQRA 1T8TA 3L82B 5CK4A 2AWNA 4PHFA 1GNRA 1EGAA 3MD0A 4NH0A 1PLKA 3IIMA 5TVKA 2ZQ5A 4ESVA 4WVFA 1HUQA 1NVWQ 4DSOA 1QG4A 2BEKA 4L15A 3U3MA 3U44A 3FDIA 3GLIB 3QBTA 3VR4A 1NIPA 1ZD1A 2OCBA 3K0FA 4Q01A 2NPIA 3CNLA 3RS4A 4R98A 5BN5A 2ZJ2A 3REGA 3U7FB 2VPPA 1P61B 4CYMA 2PX3A 2AXPA 1RJ9B 4Q4HA 2E87A 3K70D 1E1RA 3KQKA 1P75A 3MWYW 5K8TA 5FUYA 3PEWA 4OKSA 3W5IA 1A5TA 3DEFA 1CJKC 3EZ6A 4KI0A 4BZQA 3AVTA 4PC6A 2OV2A 1HTWA 3KX2A 3B2EA 4M2LA 4B2LA 4B35A 1ZBDA 4GNKA 2FG5A 5TDHA 5L3RA 2P5SA 4OYHA 3THWB 4QHSA 2XTNA 3LDAA 2ATXA 4A2QA 1HEIA 2Z0MA 4K8OA 1JXOA 3BAFA 2IYTA 3KB1A 5IRCD 2PX0A 4XJXA 2C77A 1Q22A 1VKJA 1AGPA 4Q66C 2YYZA 3PITA 2ZRCA 4QL3A 5FOVA 2XB4A 3A37A 4L9SA 3AB3A 1YU9A 3FHOA 4JBYA 3G5UA 3FPAA 3O47A 821PA 3N5CA 2W83A 3IDQA 3M6AA 2IXGA 1Z6AA 4I81A 4CGZA 1WF3A 1DBSA 2QY9A 1SVMA 4HAWA 1XPUA 1G7RA 1KY3A 4LV5B 2W58A 1U8YA 4JLNA 5EE9A 3RSOA 1G1MA 4GRAA 2ATVA 1GKYA 4MRPA 4ASUD 1JPNA 2REBA 4WXRA 3CZQA 4D4MA 1R5OA 5DO9A 1WBBA 4LJYA 3CRQA 1K5DA 3RRZA 1OXXK 4RY2A 3T1OA 1US8B 4WXPA 2OEPA 1KIMA 4QHTA 4MA4A 1DG1G 2BBWA 4LYAA 4A8JC 1DELA 5JJLA 3PCRB 1Q3HA 3SC3A 3TKLA 4DLRA 4A0RA 4BQSA 1G8GA 1WCV1 1KI2A 4Q1CA 1VCMA 3NIBA 3LX8A 3IKJA 1E32A 3L8YA 3VHLB 4W5WA 4MYTA 1OKKD 3GEIA 4FMCF 2YKGA 3ZZUA 5JSZB 2ZJYA 3AVUA 5BXQC 4IW3B 1CRQA 3B5JA 2QPTA 4KITB 3ZS8A 4Q9HA 1N0UA 1EFRD 2WJGA 2D4HA 5C46F 3QXSA 2GXAA 4C0JA 1N3BA 3LY5A 5GJWC 2J0VA 4MGZR 3CPEA 2OXRA 2ZYVX 2RGDA 2J45A 2NZJA 3H4MA 1GP2A 4HAZA 2V3CC 5HCNA 3OAAD 5P21A 3FHTA 3GJ3A 1VIAA 2C5LA 4RZXA 4L4UA 3IBGA 1E9FA 3X1XA 2QEQA 1DAIA 2DCUA 1F2UA 1FQJA 5AWFC 1XXHA 3MGCA 3RAPR 1P62B 5J5CA 1DEKA 3ZH9B 1U8AA 2VH5R 4UNSA 3A1WA 1NVVR 2VP4A 4URYR 3BJIC 4RKEA 3SE0A 3NH9A 5CK5A 4Q5IA 3WXMA 4CDGA 2QQ0A 2GAOA 4Q1FA 3HPRA 1ODFA 1XEXB 2OSBA 1XD9A 1GL7A 2RGBA 4UNQA 2J0UB 4PX9A 2VF8A 1NVUQ 3IGFA 3HYTA 2XOKD 2X2FA 3U60B 2GF0A 1DTSA 1OF1A 2J0UA 2HF9A 1P5ZB 1LV7A 1XTJA 3QJYA 1IJEA 2XNSA 1AZSC 1Q12A 4AWXA 3Q7PA 4YMTA 2WWHA 3EG5A 2SHKA 2UZ3A 5KU1A 4DJTA 1EK0A 5K8LA 2BMEA 4CEJB 3T34A 4AIIA 4M53A 1JI0A 2JLRA 2ZJZA 4JYBA 2GESA 3THYB 4I1OA 1AM4D 2IBMA 1Z8FA 4MKHA 3GFOA 2ZJAA 1QHHB 1G5RA 3VR1A 3ZIAD 5H68A 4US2R 4A6XA 3HP1A 4A0FA 2VHUA 2WOOA 1HA3A 3K0AA 2W6IA 5JHHB 2QTVB 2WPDD 1UM8A 3GLHB 3P20A 1US8A 1XDBA 2OFWA 5JECA 2MMGA 4KXFB 1HYQA 2XTMA 2D7CA 4XSGA 4BZPA 4L8GA 1KK1A 4LHXA 5D3MB 3PXGA 3N70A 3T35A 1NLZA 4KCGA 1G291 2QMOA 3WYAA 3RC8A 2XNDA 1OYWA 1MO5A 1Z28A 3DMNA 5AJXA 4UNRA 1C4OA 2ORVA 2IA5A 2FFQA 4IDNA 3G82C 2ZE7A 4PZZA 5DNYB 3LX5A 5CM8B 2ZJ8A 3VHXA 3K9LA 3PUZA 3T61A 4B3CA 1G8HA 2OBMA 3KKOA 2DWPA 5H8WA 2I1VB 1KI4A 3BB1A 1JB1A 2CMKA 1LF5A 2Z4SA 1J8YF 1AQUA 3RVBA 1KDTA 1K6MA 4NMMA 5E3HA 2ZROA 5FTJA 1LTQA 2KE5A 3U2QA 1OT3A 2YJTD 1GVNB 4U02A 4LV8B 2JDID 2Q9AA 5DLQC 2YINC 2G88A 3PUYA 1DARA 3BBPA 5CB8A 2RH5A 1T6NA 2QSZA 3UXMA 3W3ZB 1T8UA 3DOFA 5EP1A 4ESHA 1AGRA 5SZJA 1CTQA 1PUIA 3R9IA 3I3SR 4GMDA 1F48A 4US1R 4NU0A 2O8EB 2OE2A 1KI1A 1X8KA 1DVRA 3BFKA 3Q72A 4URWR 4FXPA 4OI4A 4URVR 4I1UA 3AF0A 2MSCB 2PEZA 1KK2A 4NKRA 1XPOA 2D74A 1Z0IA 4NCHA 2IYUA 1XJCA 3OZXA 4UNNA 4A8JA 4DLYA 3R9XA 1N5JA 2GZDA 2W6JD 3N2EA 4CF7A 2WAXA 4HLCA 3EWSA 5JWHA 1N6KA 2CCJA 1II9A 3U6BA 1GOTA 1AN0A 2NO6A 2OILA 3T15A 4F93B 3BXZA 1XMSA 1CR2A 4P4SB 2ZRLA 1JJVA 5B2ZA 1OLOA 2RHMA 1AQYA 3SBDA 1IBRA 2H16A 1SVKA 3U7GA 3GLGA 1G64A 1YZNA 5D3QA 1VECA 4CIDA 4M1SA 2F9LA 3GLGE 4TQUS 5FL3A 1F60A 2EW1A 4M1WA 1NLFA 4JVSB 1E2FA 4M9QA 3F8TA 4TYPA 4DZZA 1E2IA 4PR0A 2A30A 3TVDA 1Z0AA 4MRRA 4JBXA 2ANCA 2GF9A 4IDPA 4D0LB 3KJGA 5J4KA 4AKEA 1S1CA 5CLQA 2YHSA 5GVSA 4AY2A 3TIFA 4DDWA 1G8PA 1RYFA 1T5IA 3O8BA 1SGWA 1LVGA 2I1QA 1GTVA 5HE9A 1RRPA 2ZAOA 1E0SA 4OJQA 3TNFA 1ZVQA 4LBYA 3D8BA 2OLKA 2NMVA 4UXJA 1E0AA 1TF7A 3AKDA 4POAA 2GEDA 2MMCA 4JJKA 4IFEA 621PA 5KYKA 1D2MA 1GITA 4G1UC 2ODBA 4XTRA 2WM9B 2O8CA 3X1DA 2O8FB 1OIVA 1A4RA 1ZCBA 4OHVA 4Z54A 3QF7A 3QNUA 4LC1A 4LZZA 3LNCA 4NYIR 2HT1A 2GXUA 4V0MA 3TGPA 2XGJA 3EZ2A 3IIJA 2RB4A 1NJFA 1VCIA 2AKYA 2H1LA 3Q3JB 5HPYB 4Z8XA 3W34A 4ZIRA 1BIFA 3FMOB 1B23P 2WWWA 4FCVA 4KLNA 5FL7D 4Q00A 1HQYE 1AA9A 2BBTA 4DLUA 5AJZA 3VU9A 2HJGA 3GFTA 1E2DA 4E5UA 3GJ5A 3WYGA 1D9XA 4M1OA 1YR8A 2QENA 2D3WA 3LQQA 2ZRMA 1AZTA 3TQCA 3W6PA 4LSGA 2C8VA 3K0EA 5BYKA 2G0TA 3DKPA 1NF3A 1N6HA 3AKYA 5EE0A 3VR6A 1RJ9A 2P65A 4NCIA 4BFTA 4C4PA 1MRNA 3CIOA 5F98A 3GQBA 2C95A 3FGNA 1N6LA 3WRXC 1W48A 1FX0B 1KK3A 5HTKA 2QMEA 1RVDA 2B8TA 1MH1A 1GUAA 3EA5A 4D2IA 2F55A 3TSOA 2EFGA 3THXA 1Q1BA 3I61A 1XMJA 2IK8A 3AP1A 2AKAB 1TU3A 1XZQA 1AIPA 4FI3C 4P4TA 3AQ4A 1Z29A 2YVUA 3LLUA 5FH9A 2GXQA 5TB5A 2CHQA 4QM7A 2A5DA 1TMKA 1XNJA 1KOFA 2XB2A 4Q1DA 3WP0A 1MABA 4GFDA 1XXHE 4LI0A 3QE0A 1DOAA 3E2IA 4EAQA 4KVAA 1W36B 2C78A 1JAHA 3EPKA 2V54A 4HI0E 2FF7A 2ZITA 1G5TA 1OXUA 3ZVRA 2FV8A 4RD6A 1XRJA 2Q3MA 4B2IA 1G17A 1KO7A 4DEXA 2W2XA 2GZHA 1COWD 2XSZD 3WHKA 3CRRA 3DO6A 3VQTA 1SVOA 2ORWA 4RJLA 1OH8A 4C3ZA 2X19A 1WRBA 2W6JA 1QZXA 4CEIB 2BIFA 2J46A 1ZCAA 2NO7A 3OEED 4NYIQ 2BCJQ 4LJ7A 1KGDA 1T0JB 2V6JA 4Z1MD 4Y0AA 1E9SA 1SHZA 1TQDA 5IF9A 5FOXA 5M04A 4B3XA 2CE2X 3AUYA 721PA 4Q9JA 1SXJA 2V8OA 4PANA 2DFKB 1KI7A 3F5FA 4LJ9A 2GK7A 1FTNA 2WWGA 1AKYA 1M7BA 2DFLA 2ZYTX 4OQMA 1J99A 4XWAA 2DHRA 2DR3A 3RABA 2XXAA 4NZYA 1DO2A 1ZAKA 3ADBA 1ZD9A 2NTYC 4QGFA 1GM5A 1IN7A 3OE7A 4FINA 3TAUA 3TW8B 3LRPA 2AWOA 3CF2A 4II7A 5EP2A 2NQ2C 3KQNA 1G7SA 4QJ5A 4A4DA 1IY1A 1FW6A 1W0JA 3PQCA 2R62A 4J0QA 4IOKA 1IJFA 2EVWX 4Q1AA 3VX3A 5FUWA 3C14C 3AH8A 2HXYA 3U44B 3AKEA 3B1ZA 5J47A 1NI3A 2MSEB 4U5XA 1CF4A 1W4CA 4HYYA 2ZI6A 2G83A 1D8TA 2J9RA 4R2IA 4TMZA 2IYWA 3BFVA 3UATA 2JA1A 1E2HA 4DUGD 3BWDD 3PG5A 2FGKA 1P2TA 4C0BA 2JIZA 1L8QA 1XJQA 4IDQA 2NG1A 4IEEA 5DH9A 1KNQA 2HCBA 3EPLA 1RPZA 1M7GA 1GRNA 3GJ8A 5IK2D 3I5YA 1HV8A 3LA6A 4TT3D 5TMPA 1JR3D 1BS1A 1U9IC 3NBFA 2B7CA 4DB4A 2QBYA 2GJ9A 3I73A 5AJVB 3L8ZA 3BD9A 4NYMR 3QPVA 2EWWA 3K0SA 2QL6A 4B43A 4PPFA 2Z6VA 2OG2A 3GJ4A 5A0FA 2JLYA 4ZCLA 2IHBA 4XD7A 3FKQA 1DAFA 1L4YA 4D4JA 1WDTA 3WMFA 2DY1A 4JLBA 3BK7A 3BE4A 2V7QD 3QI2A 2AL7A 3DPUA 4F4IA 2ZYUX 2GDJA 5HZKA 5G53C 2CVHA 3UPUA 1QHXA 3H2YA 4LYHA 4LYJA 4F91B 3BH6A 4PPGA 4JLAA 4OK3A 2Z83A 3AM1A 1ZNZA 2OAP1 3LBNA 5FOUA 2GBLA 4B34A 3DHWC 5G41A 1U90A 4DLSA 2BHRA 3S1AA 5EE1A 2QT0A 2IS2A 2WWFA 4C2UA 2C04A 3AV0B 4HAXA 2QG6A 4DXAA 2IXEA 3TSZA 1Q1ZA 2HV8A 4Q7KA 5KNBA 4NYJR 2RGXA 3GLFE 4B71A 4IVPA 4D0NA 2N42A 4EUNA 4DDVA 5FBRB 8OHMA 1AS3A 1ZP6A 2CJWB 1DAMA 2ZEJA 1G4AE 2NOAA 1UFQA 1RW4A 3CUEF 2XITA 1MRSA 4QNMA 1X86B 1KDRA 4RCZA 3SZRA 3AGPA 5EUQB 2WIAA 3O8RA 2XAUA 2Y8EA 1E2EA 5AJWA 4DT1B 4B6FA 4LCBA 5KNDA 3R9WA 2ZRHA 2F1RA 3GJ6A 4W5JA 5CDFE 1JNYA 5SZKB 2BC9A 5EP3A 2ZRAA 4FCTA 3CW2A 1Q3TA 4GZLA 4ZDJA 2EWVA 2WAYA 2N46A 4FWIB 1N5IA 1DADA 3CB4A 4IXMA 2GJSA 2NO9A 2RGCA 2ZETA 5KSOA 1YQTA 2AHOA 4Q4AA 4ERNA 4LY6A 4CZ2A 1UBEA 2BVNA 5GVRA 5KNCA 1AKEA 1UJ2A 4NCKA 3ZQJA 1XF9A 2J41A 4ZKEA 4KODA 2BMFA 3ZDQA 1EFRA 2PCLA 2EYUA 3ZD6A 4MGKR 4OQLA 2FOLA 4JVNA 4OQFA 1Z47A 4RD0A 2RGNA 1T3LA 4ZIRB 3KL4A 2ZTSA 3WMEA 2PH1A 1SKQA 2J59A 4Q47A 3THOA 1KDOA 4LJ8A 2X8AA 1V43A 1UPTA 2OESA 1E2QA 4I4LA 3QIAA 4OK6A 2DB3A 1NLYA 2L0XA 3F3YA 2JJ8A 3K9HA 3FKSD 1TEXA 5LDDC 1Z0KA 1A1VA 4W5HA 3KJHA 4DSTA 1OW3B 4S35A 3L0OA 1ZUNB 4EFLA 4NYMQ 4MRNA 2Q3HA 3ZIAA 3J81k 1Q21A 5CIWA 2IYRA 2IW3A 4EPTA 2P2LA 4A82A 4QRHA 2B7BA 4YDSA 1XX6A 1TF2A 3CLVA 1QHHA 1BO6A 4IJMA 1CS4C 4TSFD 4Q4JB 2GNOA 3QEOA 1U2RA 4HDQB 4JMPA 1Z83A 2GCOA 5H1YA 5C4GB 1Z2CA 3KKMA 1CRPA 4CVNA 5JFGA 4K81B 1AJEA 4BFSA 3SJAA 5LB4A 5FR2A 1J8MF 4E09A 1EX6A 3TW4A 1EWRA 1FP6A 4BRUA 4MKIA 2HF8A 5FTNA 1ESMA 2DWQA 3BB3A 2BJVA 3EC2A 4FMDB 4RFSA 4XVRA 3B13B 3K9NA 3B1XA 2ZUDA 4QGHA 3K70B 2QN6A 2RGGA 2BJWA 1ZM3A 3ND8A 2D2EA 3L2OB 3WP1B 4LHVA 3RRYA 5JRJA 5ELXA 4KFUA 3AVQA 1XBTA 2QMUA 1DE0A 5L3QA 3QXJA 3LXXA 4KVGA 4GZMA 3UMRA 4MUAA 5G40A 1W44A 3EAQA 3IIKA 1TTTA 5F9FA 2VIIA 3DM9B 1T0HB 5EE3A 1IM2A 2HCJB 5FR1A 4IDHA 5KDDA 2RGEA 3CONA 3X1YA 2JGNA 5BN4A 2HLDA 4KFTA 1Q0UA 1RYHA 4IRUB 3TH5A 2WV9A 1LS1A 1HT1E 5EXSA 3B1WA 4D25A 3CX7A 4S2EA 4B44A 2WJHA 3CF6R 1KDPA 2A78A 4DEYA 2O8BB 3CWZA 4FMCB 1Q57A 2IEZA 4FCWA 1DS6A 4DKXA 2YWHA 3GEHA 4W9MC 1CR0A 2PMDA 4MH0R 1DAEA 2CNWA 3SYKA 2ODEA 2FPLA 1NMYA 2OZEA 3NC1C 5K8IA 4XTCS 4C0QC 2JATA 3NDBB 3X1WA 2WJIA 1R0YA 3KDSE 1SKYE 3ND9A 4KV9A 4PHTA 2VSFA 3ADKA 1H8HA 4TQAA 4DLVA 4JJZA 1GRRA 4NL4H 3OIYA 4QBFA 1E9CA 5FOSA 2WTUA 4XWOA 3FFBA 5FBQB 4A1FA 3BFXA 4UJ3A 4V0ME 1W49A 2D2FA 2QGZA 3IHWA 3K1JA 3SYNA 1GG2A 1KMQA 1J7KA 1NBMD 1YR6A 1G3UA 4HEJA 2GEVA 3L0IB 1MOZA 1FZQA 1IN4A 4BFWA 4LC0A 1CR4A 3KKNA 1G21E 4JVLA 2PLFA 4OHWA 4DCUA 4BLRA 3RC3A 4HDCA 1U98A 3TUJC 4TMWA 2JDIA 3MWJA 5GADl 2QP3A 2CHVA 2YWGA 3GJ7A 1UF9A 4HAVA 3CF0A 1MR3F 1SVLA 2GJAA 3K0AB 2YNMA 1DPFA 2FPKA 4US0R 1IY0A 5CIQA 4TLBA 1UKYA 1T3HA 4YLGA 1NBME 3GP8A 4ZDWA 3R7WB 3K0CA 1E9AA 5L3VA 4C0LA 4TZ6A 1ZIOA 2FFBA 1QF9A 1GL6A 4N1AA 3PFIA 5FFMA 3AGQA 3UWOA 3LVQE 2GEUA 3FKSA 1Z63A 4WA7A 1M7HA 3C15C 3DKVA 4XSHA 4BFXA 4KU4A 3CM0A 4XVUA 1SULA 2F43B 4JKIA 1SHKA 3OF5A 4LHZA 2GA8A 3HU3A 5BQ5A 2VQSA 2CL7X 4IHQA 1VTKA 1EFCA 4LPKA 2JAQA 4ILEA 2O8FA 1Z6TA 4RCYA 5JBQA 4PO9A 1NN0A 1S96A 1XD2B 1C9KA 1HE1C 1E0JA 221PA 2GRJA 3I92A 5KUTA 1E2KA 1LS6A 4P33A 3OIWA 3PUWA 4HB4A 2LKCA 1PLLA 1ZM2A 4JSTA 3WNCA 4BLOA 1FNNA 4GL2A 3H86A 3QPWA 4YMVA 4DCVA 1QBKC 2NO1A 3SEAA 2C2HA 4ARZA 2W00A 3SNHA 2BCGY 4DC9A 4A0HA 4ACBA 5CDFA 4ZDKA 3QSYA 3IPYA 1OKKA 1G9XA 4JLVA 3RRNA 3NHAA 5L8VA 3BRWD 3D6TB 4HZIA 2WWXA 5TY0A 3FTQA 4TMKA 2IF0A 4AURA 3RS5A 2R44A 3EC1A 2QPOA 3FVQA 4G3XA 3PUXA 4GSYA 4LJ6A 3EIQA 2UVQA 2AXNA 4JL8A 1OIWA 2IYYA 4Q4HB 2BKEA 3K70C 2IXFA 5JJIA 1QHGA 2WSSD 5TARA 1YKSA 3FE2A 1I2DA 4I1VA 3EZ9A 1KO5A 4GOXA 5EZ5A 5EUMA 5FTMA 5GJVC 3VKGA 1ELOA 5C2JB 1ZUHA 3GLIA 1N6IA 3ZZ0A 3RWMB 1G6HA 2WMOB 3TBKA 3A36A 4JT4A 1ETUA 3D3QA 1PV4A 2V55B 3WMGA 4OI1A 1FX0A 2WBLC 5BN3A 3JZMA 5GJBA 4MDEA 3A1SA 2FWRA 3UMFA 1UBFA 1VG1A 3KUCA 1ZM9A 1COWA 3HR8A 4JLDA 4OQXA 3GLHE 2GJKA 4HDOB 4QFMA 5J40A 5B30A 2I3BA 3QG5A 3CH5A 1D6JA 3QBVA 2F6RA 1E2PA 2H7VA 4IKEA 4QBGB 1MV5A 3IO3A 1G3QA 2RKOA 3WNBA 2R6GA 4OHYA 4V0NA 4YMWA 3MRSA 4HUTA 4N0EA 4Q9IA 3UKDA 5BYJA 2O8DB 1QHYA 1ZU4A 2ZR9A 3GMTA 3P4XA 2RGAA 4TWZA 1EFTA 2BMDA 2EFDB 4TTRA 3I1FA 2F1JA 1OXSC 2QP9X 5UKDA 3LLMA 1OFIA 1HT2E 4TTQA 2J0QA 2IEYA 3VFDA 1II8A 4DCNA 1TAGA 3SJZA 4M0LA 1OYYA 5IK2A 1L2TA 3I8XA 1KI6A 3QKSB 2FH5B 2QQEA 1S9HA 1UKZA 3HDTA 2QAGB 3TUIC 3NBYC 1VG9B 2Q0HA 2FE4A 3B82A 1U0JA 5FUXA 2F43A 3AKCA 3VR2A 3C5CA 5J4HA 1FTSA 5E7IA 4RFVA 1GWNA 1T5LA 4ASUA 3NTUA 1XTRA 2R8RA 1N5KA 2BV3A 2E9SA 3Q5DA 1OFTA 3Q7QA 2QE7D 1R5BA 2H17A 1GDDA 3QKRB 2ZSEA 3FOZA 5E7JA 3A58B 3BGWA 1F2TA 1S1MA 1FMJA 1BOFA 2Q9CA 4A6PA 3ADDA 3PEYA 4GT1A 1E98A 2BEJA 3D7MA 3KJIA 4UJ5A 1E2MA 4TMXA 3IQWA 4DLXA 2VP0A 5LD2B 3MSXA 1OH5A 1CBUA 3FMPB 4Q4AB 4B3FX 2I4IA 4GMXA 4U7DA 4JL5A 1W0JD 3TRFA 2ZM5A 1W4BA 4URZR 4EPYA 1N0WA 3SI7A 5FBWB 3U61B 4Q7MB 4DLWA 2BWJA 2ZSDA 1HE8B 1KI8A 3GLIE 1UDWA 2ZPTX 2PMKA 4IOLA 1G41A 1D9ZA 3RWOA 1NSTA 4OHXA 1X8LA 2J7KA 2GHIA 1SXJE 1YRBA 1A2KC 1Z0JA 1XTKA 2P67A 4WW0A 4YQFA 1UEIA 3VKWA 4BGDA 2ZR0A 3FMFA 3LH5A 3P27A 4QGAA 2WSSA 4A36A 1PVOA 2W2VA 1JQLB 1YJ5A 3N2IA 3W3AA 4B32A 4R2HA 3P4YA 1XEXA 4AC9A 1R0XA 4URXR 2XNDD 3W6NA 3KXLA 4EJSA 2R6DA 4ZKDA 1JJ7A 4URUR 1KMHB 2EYQA 4FW9A 1M74A 3C5HA 3B78A 1YZKA 3IPXA 4HLDA 1RE0A 4L16A 4CEHB 1E1RD 2ODWA 5FL7A 3VAAA 2A2ZA 2AD1A 4JL6A 4EFMA 1RZ3A 1GIAA 2WSMA 1NVXQ 1IXRC 1QVRA 4BEJA 3QOFA 4TYNA 4X8MA 2J3EA 1JXMA 1XJ0A 1W0KD 1Z2AA 4EFNA 3DM5A 4OL0A 4B47A 1ZW6A 1JR6A 1KSFX 1R0ZA 1E9BA 1OH6A 3W9YA 4XD7D 1D2EA 2PJZA 2VEDA 3MJRA 5B64A 2R6CA 5DYGA 3O8DA 2RAPA 5AR1A 4C7OA 3ZLJA 2Z5FA 3MG9A 5JRZA 4TT3A 3IBYA 4OJKA 4BECA 2JLSA 4YXWA 3E1SA 1MABB 4QKQA 1Z6GA 4KO8A 4JVMA 3W8NA 3REFA 4HUQA 1BKDR 2ASEA 1QHSA 2ZUCA 2XX3A 1QRAA 2GVDC 1CU1A 2BM1A 2QZ4A 3H0KA 4GDFA 1OJLA 1RC8A 2A5GA 2CHGA 5SZHB 1XP8A 4E03A 2LKDA 5EQTA 2BDTA 3QQ5A 4B3BA 1XEWY 4IOMA 3QENA 4ITRC 4M8NE 3JZAA 2ZI4A 3TE6A 1P6XA 4C30A 1XZPA 1P73A 3LFUA 3NBXX 4KAXA 2P6UA 3W6OA 2Z43A 1WBDA 1MKYA 4MRVA 1D2NA 4FD2A 1XB2A 3QKUA 2GXSA 5KOYA 4PQRA 121PA 2ZVQX 3UMSA 4ARZB 4AKIA 5FPTA 3ICEA 3EPHA 2XTZA 4Q9KA 4HAUA 4A2PA 3BH7A 2GETA 2OCPA 4KYUA 1YZLA 4F38A 4IVRA 1YZTA 4B48A 4HB2A 4A0GA 1CEEA 2CL6X 1H65A 2F3RA 4RSGA 1SZPA 3CBQA 2IWHA 1KZ7B 4Q02A 3TK1A 4LWZA 5DSZA 1PUJA 3ZVMA 4UKDA 2OBNA 4EJSB 2KBEA 3LW8A 1NN5A 1KMHA 3Q9LA 4H1VA 2YOGA 2JLVA 1BMFD 2FPMA 2BBOA 2CE7A 2WIBA 2ZI3A 5CLLA 1H8HD 3RNLA 1OIXA 1VHLA 4JLOA 4TLCA 2WVJA 4KJZA 3CRVA 2CCKA 4Q18A 2ZRBA 2PL3A 4WZAE 2QP4A 5E4FA 4ZDIA 2HXSA 3SR0A 4BPBA 2XSZA 1ZJ6A 4IXNA 1R10A 3PVSA 4B73A 3PEUA 4HZUA 1AS0A 1GILA 3AF3A 4OQNA 2GKSA 4LDJA 1GSIA 1FP7A 1TQ4A 2WPDA 1XPRA 1HQCA 3CH4B 1IY2A 1EX7A 4WBSA 4XIGS 1U0HC 1N6OA 1II0A 4M9ZA 3WBKA 3AF2A 1KAGA 1GKIA 2VTKA 2LWIA 4D6PA 3RDPA 4RZ2A 1NN3A 2IS6A 5FTKA 1N6RA 2QM7A 3LD9A 5HKKD 1A7JA 3QY0A 5CYOA 1E79D 3UWKA 3WRYC 5KHOC 2FZLA 3KTAA 3W90A 1H8ED 3PR1A 4EQ6A 5F9HA 3NEYA 1LF0A 4MYHA 3VTKA 3KTAB 2FEMA 4NTZA 2KJQA 2NO0A 2R9VA 2QORA 4ACAA 1IHUA 2G77B 3CX8A 2OFOA 3OEHA 3EIHA 4IFBA 4BLTA 1EFUA 2FFAA 4HLQB 4I1SA 1N2CE 2W6ID 1IONA 2OHFA 3HR7A 3CRMA 3IUYA 1K8RA 4ZCMA 4DIEA 3BERA 4X8OA 1M2OB 2AK3A 1W0KA 3NDPA 4PFSA 1S3SA 1H8EA 3ASYA 3MCAA 5FBLB 1II8B 4B33A 4NCJA 3ZYCA 5DGXA 5JI2E 2PT7A 2JJ2A 3ECCA 1RIFA 1W47A 4AYXA 2K5UA 4DLTA 5TXGA 3GLHA 3QPUA 1MO6A 3KFVA 4ZPXA 5DI3A 3L0SA 3A1VA 1CULC 3HU2A 5L3SA 4ZCIA 2O8BA 6Q21A 3GCGA 4PAOA 5L3SB 3U4QB 3TMKA 1NBMA 4M4SA
chains in the Genus database with same CATH superfamily
1PT6A 3L0BA 1X3SA 4AKGA 2DUMA 2O2YA 2VXCA 4JHXA 4RNCA 1L4MA 1GGJA 1SWVA 1L4EA 2A5FA 2RFLA 4FGLA 3ZE8A 4MKXA 3AVVA 3L4SO 4G0NA 4O1HA 4AICA 4XEUA 3QKIA 4FHCA 4G97A 3JY6A 2NZ8A 3M89A 1OB2A 1NG1A 5TQ2B 1Z4KA 1U9JA 3K6KA 4WESB 2HJSA 3PTAA 3BJEA 1TC2A 3PGJA 2FW6A 4QPJC 4D56A 2C9OA 4ZHQB 4KLZA 3FUVA 4LHYA 4YMLA 1WE2A 2YDXA 3T1VA 1HRKA 1FUKA 2IYXA 3K94A 3LK7A 2LCFA 4IV8A 3UUFA 3V8QA 5K8JB 2P2DA 3EXHB 1F2VA 2EHJA 4DUGA 1NFFA 2DKFA 2FSGA 5I7WA 5GONF 4Z4FA 2I65A 1SKBA 1P4RA 2XCRB 2IDJA 3EIEA 2CK3A 5KCZA 1T10A 2IU4A 4B6EA 1KERA 3UT5B 2EFCB 2DY0A 5H9WA 1T9BA 5K4AA 5EZYF 3E8MA 3H7AA 5LLSA 1WMAA 2GEJA 1IOWA 1LSJA 4JNKA 3RTGA 4D80A 5AIBA 4B76A 4KBYA 4DDKA 1WSBA 1OU4A 4A5SA 3ZQ6A 4EX6A 1A3CA 1C7EA 5YASA 2A9KA 2XT9A 1MB0A 4CFSA 3EMVA 3KUKA 2XNHA 3ZJ5A 1RXVA 1XQVA 3PQEA 4ZO8A 1ZUIA 3BX1A 4BNJA 3GLGB 2AJLI 1N25A 3GZJA 3ZHTA 5IAKA 4RBNA 1Z4MA 5FV4A 1LC0A 1OHHA 1QNLA 3FWZA 1YI1A 4YCJA 2XR1A 3KQPA 2DPXA 1CPYA 3BCSA 1E3SA 3JRXA 4JGIA 4LY0A 4E12A 2Q1UA 4M76B 1KSJA 3G5AA 3V4RA 1KSHA 4H7PA 1SD5A 1UPXA 5CA1A 3ZVNA 1GNQA 1TCVA 3LKDA 2L19A 2R79A 1J2UA 3K92A 4X1OA 4XR9A 1YHYA 2PMEA 3T7DA 3WQRA 1ENYA 2D62A 3DT8A 3ELUA 3FYHA 1JA0A 1N2HA 1WABA 3ORYA 4O8CA 4W7SA 2IS4A 1KNXA 1D4AA 3N39C 2QU8A 2X8JA 3M3PA 1Z5VA 4J2OA 3W8RA 4EB6B 4V1CB 5F73A 4DCTA 3H6HA 3T4UA 3GEBA 3FGPA 4RHTA 1QQ5A 1U5BB 1SQ5A 2YZKA 1N9GB 1J49A 4BO1A 3ES9A 1RRCA 1GYPA 3DE6X 3GI1A 4WWHA 4Z8YA 5IBCA 2IY8A 2LNDA 4G37A 4L8FA 5DKFA 4DZRA 2P3LA 2DQ4A 3ZV6A 4FEYA 4M88A 2B3DA 4OLJA 1F0NA 3BILA 1NVKA 3A2NA 4ATNA 5G1OA 4WZZA 1DIBA 2R1VB 2JCYA 2DQYA 1W9HA 3A4NA 2P77A 1XIVA 2O3JA 2JCVA 4I55B 4ZYYA 1R5NA 3KHTA 1FSPA 4QOGA 4BO7A 4Z5XA 2G17A 5HUHA 3M6VA 1SCJA 3HVIA 3CNNA 4XIJA 2V3WA 4ZPJA 2G4CA 5A5GA 2WMYA 1SXJC 4F84A 1R37A 2PIDA 2QPLA 4XGKA 2DPYA 5DBEX 2ZWVA 1EIZA 1FNMA 3KSDO 4YAOA 1SY7A 4TKVA 2J9ZB 2WJVA 3VX4A 5CNJA 1GT91 1Q7GA 1YVDA 4JX8A 5HHTA 2GPTA 3C98A 3O5AA 4EMUA 3FYDA 1JP7A 2VKQA 4V03A 5HIMA 3SOPA 3KEFA 2GZAA 3P9PA 2PCJA 4JOSA 4IZ6A 1QGYA 3STWA 3OZFA 3VPSA 3O2JA 2JFFA 1YQXA 1UADA 3IERA 2YZ2A 1LSSA 3N7UA 4NWIA 4RVCA 2QXTA 2ZRFA 2G0NA 4LOLA 3WNDA 3WFIA 1E58A 2FGJA 2I87A 5GIPE 3CMCO 2I4OA 3A32A 1OHHD 1Q95A 3PC3A 1EEXB 4R9UC 3ZY3A 1QQ7A 5CJ2A 2ID7A 5EMHA 1P8AA 1NNSA 1ZMTA 3RROA 1IEWA 3GCZA 2J3MA 2PXXA 4GLFA 3G0CA 1Y9DA 5BORA 1Y8QB 1EHYA 3IDSA 2PSHA 3O6VA 4TTJA 1GRQA 3VJMA 1JEDA 4M9CA 1WPXA 2H5IA 4U2GA 5ABPA 5KTPA 3FOEC 4XR4A 5I45A 3RYCA 2GZ2A 2JGIA 2VNJA 2Z4TA 3C3WA 2WMNB 2ZWPA 3DDCA 5BN5B 3Q8MA 3E03A 3TOZA 4ZI2A 2X1VA 4GXNA 2A33A 2EFEB 2HLDD 1C0IA 3H42B 4LYEA 1ULSA 3I32A 3JR7A 3EFOB 1MH9A 1WB4A 2E89A 3L7LA 3MWLA 3FTCA 1DIOB 2QVLA 3SXUA 3ZK9A 4JP5A 1FSSA 4EKDA 4A26A 3DMYA 4XASA 4YRQA 3C70A 4OATA 1J2YA 2VEOA 3HWSA 5TVGA 5CFLA 1XMOB 4HZUB 1WB5A 1IN5A 1GKLA 4PAGA 1QQBA 3KNZA 2OXEA 3CLKA 4OAOA 3V2IA 3U3RA 3FDZA 4FMBB 3AEXA 4LOIA 3ZHSA 2O0JA 4Q37A 4F71A 4TTPA 4Q6WA 4FMDF 3TO5A 3CLUC 5AK0A 3MWGA 2JJ1A 4BFCA 5LIRA 4KVFA 3ZDDA 4CT5A 4UNPA 3ZWXA 4AQ7A 4ENUA 1UBGA 4NYJQ 5KPJA 1P2VA 4PZEA 3ROMA 3NHZA 2XRMA 2FMXA 5AQ1A 1J39A 2DJIA 2GHTA 4I5GA 2VP6A 5ALQA 1SHTX 1AQJA 3OPQA 1AKMA 3H75A 2X4DA 3KXPA 4N9QA 3FMVA 3DEZA 5D7BA 4G0PA 2CNWD 2ZAGA 3R3SA 4JXJA 2OBBA 2WHPB 1J0EA 4MV4A 3QX8A 2EFHB 2AQIA 1BKSB 4CMIA 1FNDA 3GFPA 5ER6A 1XDGA 5C1BA 4CBVA 3T95A 1KKMA 4CMHA 1ABFA 2G72A 4D81A 2X6RA 5IKXA 2Q9BA 3L43A 4B5KA 1JALA 2Q5EA 7ADHA 1GGMA 2O2DA 3SFVA 2XUGA 5EE5B 3UQYS 5FUVA 4FC7A 4ZZ2A 1P60A 4P08A 3KJXA 1XMIA 4WY2A 5KTOA 3D3JA 1HRDA 2CK3D 2JLQA 4KBFA 2UAGA 4QT0A 1SUPA 3EVFA 3LUGA 1Y7TA 4YJFB 4PTLA 4B3DA 3WBFA 3S28A 1E60A 1K3FA 3QM1A 3A1FA 4DXDA 1U63A 1SZDA 1MO3A 3FIUA 2C8JA 1OVMA 3G1TA 3LLVA 2BTQA 4JKYA 4IJKA 3TEFA 4LRTB 4ZK2A 2EJBA 3UXYA 2QJFA 2Y1GA 3L6UA 2JKZA 1JKFA 4MKGA 2R25B 3TZ6A 4QYWA 3QVUA 4X6XA 2O8CB 1N1MA 2G76A 4O6VA 4P3PA 4M0UA 4EHJA 1Z0SA 4ENWA 1GPYA 5HZHA 1DLIA 4H4CA 3EZ7A 521PA 4MRMB 4UBOA 2PZGA 5KKNB 5AICA 4S2UA 1WQ1R 5EKXA 3T7JA 4LF6B 2P9TA 1J42A 4HADA 3GFQA 2G6BA 1KKLA 5AKKA 1G20E 3DTVB 1IM5A 1N3YA 3B7GA 4LUCA 2I66A 2DWOA 2FU5C 3AHHA 3JQAA 4V38A 1P2SA 4PLGA 4MYCA 5IC5A 3GZTB 2GWHA 4K9RA 1BH2A 3BT7A 1RM4A 3EVTA 1DJLA 1UC9A 5DHRA 2J0EA 3O1JC 4AF6A 3WGVA 1V11A 3AWIA 2VJBA 1KPHA 3A6DA 3IURA 1OXMA 3BSYA 2PPVA 1EGHA 3RSZA 4BZXA 1JKIA 2ORED 2PD6A 4HDNA 2PNJA 3SXPA 5JPIA 3FJ1A 4X8LA 1TU4A 2H07A 2JFGA 1YJAA 4POOA 1JPJA 3CX3A 3W0LB 4ZAWA 3BQ9A 4RV4A 1ZESA 1BA3A 1E94E 2NU7A 1J1IA 1T1RA 2H1VA 2RHGB 1Z17A 2VHWA 3JX9A 3LECA 2DQZA 1VIVA 1G8YA 2X9VA 4MV7A 1F51E 4QULA 4Y2VA 3SDZA 4BC0A 2PJUA 2X40A 5DYIA 5EJ2A 4BUCA 3RUDA 3CVWA 3PNSA 3LV8A 1VI2A 4P3NA 3C7KA 1LBEA 2GN0A 2DKNA 3KS9A 1ONBA 3HABA 4XA8A 2IUFA 1CUHA 3E1KA 2ZRIA 3IHLA 2AFVA 2R5FA 2ADFA 3TRIA 4DY4A 2R6FA 1AMUA 3K2IA 2AMJA 4LZNA 4NS4A 1VQ1A 3FOWA 2C92A 3TLAA 4OI2A 3RSQA 4I4NA 4LYDA 4UTVA 4PBTA 3EEIA 3R9KA 4K6FA 3UV6A 3DMDA 4INPA 3NXSA 3C4JA 3ORQA 4Z6KA 3WGKA 1BVUA 4URFA 1ZD8A 4PSAA 3TJZA 5KSWB 4C6RA 1XVLA 5EMMA 2QF7A 3GRFA 1H6BA 4CU5A 3ANNA 1IPHA 1BGXT 1UP7A 4ZAZA 4RTPA 1J70A 2QTZA 2QW0X 3FNQA 1XTSA 1QH8A 3HY3A 3TCNA 4AJJA 1BDIA 1Y63A 3Q3HA 2JLXA 1BH6A 4FSHA 3H8SA 1VE6A 1RJFA 3A3KA 1X7HA 3K0CC 4EHKA 1XWFA 1N6PA 3G2KA 4CTOA 2VZLA 3UANA 1DV2A 2NM0A 1QK3A 1C30A 2EJTA 1JIXA 3IDZA 4GYKA 4HL6A 5DU2A 1GNTA 5KYXA 2OXCA 1WIWA 3AJRA 3QXHA 3A04A 3QKTA 5DLPA 1MTZA 5B57C 1P72A 3VHQA 5BQ3A 3D6VA 1YL6A 4H6XA 2D5IA 3DZGA 3JWPA 3AF1A 5C31A 3PSAA 1EUDB 3L7CA 2WLSA 1Z4QA 1KTVA 3QE3A 4EF6A 1E4YA 3AEUB 1ONSA 4LXUA 1L5QA 2HF2A 1Z0DA 4FZRA 4IHJA 2X7HA 4QFBA 3SIWA 4ALJA 1BDHA 3T7SA 4NCBA 4Y1RA 3OFNA 3RS3A 3BTOA 2X8BA 3TAHA 1CY0A 5JATA 3KRTA 3TX6A 2Y1XA 5F7ZA 4R84A 1RWQA 4RHYA 3TDKA 5GY7A 3SYTA 3D6FA 4E4RA 1ZQ9A 3EQ7A 1KO1A 3GDWA 3OKFA 3G8DA 3D0RA 1A98A 1YZQA 5EXXA 2XMRA 4LDAA 4I0WB 1LDNA 3K5WA 4RA9B 4RABA 5KQSA 2A59A 4LJRA 3ASVA 3HJAA 3H6KA 3CUTA 1JMVA 3Q2IA 4O5OA 2VUHB 3K09C 2IP4A 4O4LA 3H99A 2O59A 2JNWA 4QUKA 2XE7A 2H06A 2J4FA 5EPEA 4H08A 3LP5A 2V6GA 4L6AA 1CJSA 1JBKA 4R2MA 4G81A 3TL6A 4CL8A 1KOGA 1E2GA 1G8FA 2RHBA 3IIEA 4G1BA 4M8SA 4UAVA 2H1CA 3GUZA 4RS3A 4YDHB 5F7OA 5K3BA 4D9CA 1BW9B 1GU0A 3M6LA 2RI1A 3B6IA 3K31A 2YYSA 2G7MC 4OQEA 4B3TB 3ER8A 3T5DA 5FWXB 3HGMA 2DT5A 1RFGE 3LOPA 3BSFA 1UWCA 4J7XA 2PLRA 4MWZA 2RMKA 2HA0A 4OI0A 4EJ6A 3LY9A 5KC9A 2A5JA 3FGZA 4HDMB 3EA4A 1ZKMA 3HZZA 4JLKA 3R0ZA 4C3UA 3F7MA 2B21A 4WHMA 2CZCA 2AQ8A 4ECAA 2YUIA 4LHEA 3BA1A 2H2IA 2J1LA 3AC0A 1HDEA 2FTKE 3B5EA 5CM9C 1W4RA 5AM4A 5LU9A 5KSZA 1TJPB 1CQIA 1SCUA 2BMWA 4L78A 3HO8A 5EL0A 1IMOA 1OYVA 2Z09A 3R8CA 2AX3A 3W9SA 2JARA 4P35A 3SU8A 3T5BA 2A94A 4FDLA 5ERXA 1P3DA 2N75A 2ZAMA 1H5NA 1PZNA 2VYFA 1MAUA 5ELMA 2V58A 1TE2A 2O5RA 2YCBA 2YMMA 4CUKA 5BVHB 2CMFA 4TMVA 1EXMA 1T5DX 3NU1A 4OHPA 3THWA 3U4CA 5THXA 1AKVA 2HIAA 3HPQA 5MHTA 1E9RA 5CDYA 2VAVA 4PHHA 4G5GA 4TS9A 1EDBA 2X8JB 4TV9B 1S3IA 4IMJB 4NV1A 5SZIA 3TLXA 3CVOA 4DJEC 3IVAA 4UXHA 4QDJA 1DO0A 1NBAA 1Z0UA 3EYWA 3ILXA 5FTWA 3VSBA 4OXYA 4TS4A 2HIGA 2X9NA 1MB9A 1O7JA 4P4SA 2ZVPX 1F20A 4PQFA 1T2NA 3O4JA 3PTLA 4DRZA 5KQLA 1PTJA 1QH1B 3RC9A 3Q0IA 1FU4A 1THGA 1RAEA 1V8DA 2W0MA 3AU9A 4G67A 1RPNA 4NBRA 3U7EB 3ZZTA 4J3FA 1VYUA 3E7DA 1ZKDA 4PAWA 4DBLC 4L0DA 2X1LA 2PEYA 3ETHA 4HEA1 4II3A 2F3PA 4C4TA 4XARA 1G19A 4BRZA 3A6EA 2IITA 3PC6A 1Q1QA 1D1PA 1NM5C 3F4LA 3Q7TA 1DDGA 1NIJA 4RWZA 1UK8A 2FSIA 1G3RA 2TMDA 4PC7A 4XGIA 1L3IA 4Q03A 3O31A 4YJKA 2JH3A 1MVOA 3HFSA 4ECEA 4D4KA 4Z0HO 4MPJA 5A9SA 3V9AA 4P32A 3LUCA 1Y7HA 2ZJBA 1BROA 2GVZC 1A4IA 1TO1E 3COWA 2R6HA 4RANA 3CPJB 4Q3NA 1KAMA 1I4LD 4MV8A 2DC1A 1KGSA 1ZRHA 2X86A 4JUIA 3UHOA 1EVZA 1A9QA 2AD5A 1AA3A 2WF7A 2FNAA 1WVMA 4NJMA 3WR5A 5FTLA 4RUKA 3U80A 3KLPX 1DBWA 5EP4A 4BBPA 4DR2B 2WDPA 3W5CA 5CVVA 5DN6A 1DJNA 4D9EA 2WU3A 1O5TA 1S2GA 1GO2A 4B4UA 1U2EA 5FKJA 2ZRJA 2BZ1A 3RTAA 5C35A 3VJRA 1Y4ZA 3HSKA 4YREA 4JLJA 3RB8A 4WKGA 1V5WA 4DJDC 1HTTA 2K7ZA 2QNRA 3BL5A 3GJTA 4KWCA 3T3HA 1NVVQ 2X7JA 4BVLA 4GXRA 2BOVA 4TS1A 3LNTA 1E79A 9LDBA 5ALYA 2HQOA 2VTDA 4MPTA 4C89A 1R66A 1AKRA 2Q6KA 4XWKA 4L9AA 1XC7A 4XDGA 3OEWA 5SYMA 2ZFUA 1Y48E 1IZ8A 2AEFA 1S3GA 3CMMA 4U1RA 3TLYA 3PVZA 1C14A 2XE4A 3FTEA 1EWTA 1YB5A 2UXCB 3A70A 3SQXA 1P0MA 5K0BA 2Y0EA 3A9CA 1AD2A 1FXSA 1L9KA 4HGRA 5JSKA 1UR5A 2X5JO 4M0CA 2IXBA 3MWDA 3F5QA 4MEBA 4XCXA 4H7HA 2Q7OE 3FZQA 3TZLA 3VMFA 1XJ5A 5DLYA 5CDUA 3M0EA 5HM6A 2CNLA 3EF1A 2MSLA 2XB8A 4RZSA 5A3RA 1TPZA 2W0SA 2WSIA 3AHDA 3JWIA 1I5EA 1AK2A 2EJWA 1M34E 1H6DA 1D1TA 5JNLA 4V0QA 2Q1XA 2B6HA 1IULA 3AVOA 4PE5B 4JLPA 3N2LA 5K0CA 1GFIA 1X1SA 3IVCA 4S1NA 5I9BA 4KHZA 5IJXA 3GDGA 3TTSA 3C5VA 4OJMX 5IARA 2YWXA 4Y30A 5DMXA 1JG6A 3CZ5A 3PJFA 4OXKA 4BJ1A 5BWNA 2BHNA 5JWRA 2UZ4A 1W36C 2R1ZA 1ADYA 1JJAA 2WQZA 4GZ6A 5BSTA 1UQTA 1GEEA 1Z4OA 3CVUA 4DV1B 3RQIA 3EZFA 1D6NA 4BQFA 2JLUA 3H5RA 5JYBA 3IPAA 1VOTA 4EGFA 3EMDA 3GA7A 1DC5A 1JQ5A 2JJ1D 2NX2A 1JR3E 1YB7A 2D5BA 3HFRA 3GAAA 3UBTA 1I2MA 4HUQB 4CT0A 5JG7A 4FYPA 4KBGA 2O3SA 3ZJ4A 3ACBA 2Z08A 4RWEA 4PGMA 5BQPA 5J63A 2J6BA 4HQRA 1FDIA 1KJQA 4RHCA 1C29B 5EIEA 5K45A 3SXJA 3CX4A 3HI6A 2RD2A 3AFMA 5INTA 5BO5A 1RYDA 3T99A 1NSYA 2O2EA 1VG8A 5HRAA 3P1JA 4F6CA 4YV7A 3UO8B 1QP7A 1KEEA 4PHCA 4AXBA 4TXJA 1S0UA 3AM4A 1L7EA 4MVJA 3AEYA 4OREX 2AMFA 3FFAA 3CWQA 5JZSA 5K01A 3PHHA 2HLHA 1T6ZA 3DHEA 2UUBB 2GJ8A 1DRVA 4UFNA 3L6RA 5DI3B 1AN9A 1HQDA 2O7QA 3U5ZB 1QK4A 2QTBA 4QLAA 3W3AD 1KVUA 1KEKA 4DIBA 5BRJA 4V0SA 1Y3BE 1AE1A 2YOHA 3ZU2A 4L85A 3VA7A 3D2CA 2AYYA 1RYMA 2WFLA 3KYBA 1IN8A 4J4HA 3KYDB 1RRGA 3P9ZA 2ZUEA 3WKDA 4H9GA 4AKHA 3KKZA 4FR2A 1A8PA 1OTYA 1C7RA 4P7FA 1D4OA 1GPAA 1YOBA 1QCYA 2VSXA 3EFHA 1W9MA 3KLMX 3N8IA 4NK5A 4WK2B 3U0VA 3GEEA 3GWZA 4RULA 3R7BA 1EFVA 5JEDA 1L4HA 2AFHE 2QE6A 2WKQA 4MP8A 1ARZA 5IN4A 5G0TA 1ESZA 4AZ0B 3BWYA 4JU8A 1SZCA 4QOIA 2O2GA 2JVJA 1YS9A 1W0CA 1ZWKA 3D8SA 3DV0B 3I76A 1DKOA 1V1MA 4I4TF 4Q4LA 5JDIC 4RF5A 4AU1A 3PE6A 1I0LA 4WCVA 1E0KA 3UHAA 3O4FA 3PTZA 2HQ1A 4IF6A 4OYLA 4DXHA 4TLDA 1GTMA 2QVGA 1VMAA 2JK0A 1H2HA 4KYIB 2B1JA 3NHMA 5E3IA 3EDOA 3EGVA 2FZCA 4WJKB 3WFZA 4KQXA 4KQHA 4MV0A 4FCCA 4CF5A 1HLPA 2JFHA 1YVPA 1ORWA 4YACA 3T1TA 5E6RB 5KOJB 4LJ5A 9ABPA 1PW7A 1ZC4A 2ZE5A 3ONVA 2IIVA 4R1NA 4DMLA 5KHLB 4JLMA 3VYTB 4DJJA 3KJZA 5DE3A 1UAAA 2WIGA 3A4MA 2E48A 2F00A 3T6KA 2RAUA 2NQ8A 1T3SA 4EUHA 4QJ3A 1LV8A 3FG9A 1VHDA 3SLGA 1T36A 1R0SA 3OQVA 3H8VA 5DNVA 2NPFA 2D1TA 1X1CA 1N1DA 3WO1A 4E5MA 1GTZA 2QSYA 2A67A 2ERYA 1W19A 3QEJA 2QLMA 3EVNA 4JSRA 4NZNA 5K0NA 3DL4A 2WQ6A 4CXMA 3QLEA 4FLFA 1DC8A 2VJLA 2JBAB 3V00A 3IAEA 4RXUA 2Z3ZA 2C00A 3FPSA 4RHFA 3AR8A 1IUKA 1A82A 2BZ0A 1VE7A 1H4QA 5LP6A 3EG9A 2J3KA 3A9SA 3B6KA 3DMGA 3FWYA 4K46A 2ZSBA 3GELA 4M1KA 4Q21A 2X5XA 3C7TA 4AG6A 3KQWA 5T6BA 4Z3OA 1B00A 4J0GA 6YASA 4KH1A 1OE0A 1TLTA 4NDNE 3OLCX 2V03A 1R6VA 3H4VA 4PSDA 4DCOA 3PCXA 3CCFA 3B38A 3T38A 1QGZA 3RS2A 3LC7O 1SC4A 3TVTA 1Z39A 1ZU5A 2FW0A 2QUAA 3JPYA 3V2HA 4AYWA 1CZLA 4COKA 1QP4A 5FF9A 1XNHA 1ORVA 1PR5A 2YHIB 5I7RA 3KKLA 1X9IA 4H3VA 3V4FA 3OVMA 4QUJA 3OX3A 2WD8A 4QC2A 4DG8A 2IV2X 3TLBA 2GRUA 5HF9A 3IOCA 4MMXB 2QMHA 1K2WA 4XUCA 1T9AA 4CW7A 1ZHHA 3EXEB 4QBKA 3KAPA 2RKBA 1JS1X 4KREA 1R2QA 2VO1A 1JECA 3GCDA 2VPXA 1UBTS 4DUPA 1BXRB 1D7AA 4NE7A 3W77A 1E1QD 4QNRA 2ZR8A 2R6AA 3DXXA 2IZZA 3OZGA 3ZJYA 4DCSA 5CB6A 3GHYA 1N34B 1AHIA 1CY6A 1SC6A 1TTPB 2DVMA 4TL9A 1U3VA 1K6IA 2O5VA 2D1YA 1TKCA 4PO1A 3RVPA 4CLXA 3U6KA 1ESDA 2ZOSA 1BYIA 3KXIA 4KFSA 2NYUA 1AGYA 1SRQA 3KFXA 2HM7A 3Q0EA 4X92A 8ATCA 3HJFA 4FDMA 3HI4A 2ACVA 1PFVA 4QOJA 4KQ9A 1EP3B 4YRPA 1VL8A 4LHWA 2Y93A 4LXGA 5KIAA 1MX1A 4LNAA 1SXJB 2DPMA 4PLZA 3IQFA 5CPBA 2WE7A 2ZJ0A 3QBEA 4H60A 4RX1A 3ZCPA 2B1GA 5DHFA 1JIJA 5FT9A 4AXXA 5E4TA 4ZYTA 5ITWA 4XRRA 3CBGA 3E5MA 1L7VC 4KLCA 1P1HA 4RCVA 4DDTA 2VDNB 3ER9A 3VNVA 2D7DA 3PZRA 3AIOA 5CFZA 2B34A 2IHZA 1NL3A 5JD5A 4DV0B 2O8EA 3AHGA 3ED5A 3ZXUB 4HH3C 2WUFA 4PHFA 2ZYGA 2OQIA 1EGAA 5C51B 1NW6A 4ESVA 3GOHA 4WVFA 3WTBA 1HUQA 4E51A 4NRDA 5ALGA 4L15A 3IPLA 2YMLA 3B36A 3QBTA 3E15A 1NIPA 1ZD1A 3RM3A 5IASA 5IUJC 4R98A 3D5QA 1YO6A 4MWTA 3CEMA 3PHGA 4FYIA 2VPPA 2P2YA 2AXPA 3OBIA 5CXQA 3GVIA 5DNAA 1PRYA 1E1RA 3BJZA 1P75A 4D9NA 2J3JA 2WEKA 4QELA 3HB5X 2D2XA 3IAM6 4FBLA 1I5OA 3MTGA 1BD3A 1E4EB 4OKSA 2OFFA 5DX8A 1K3UB 3EZ6A 3W5IA 2BF4A 3TN7A 1V16A 5I9IA 2PUJA 3OPMA 1VSTA 2EOAA 3AEQB 4PC6A 4DYHA 1Y8RB 3G88A 4LX8A 2OV2A 4RK1A 1VLHA 4PV7A 3FM9A 5LKRA 3QLJA 4B5LA 1P17A 2W93A 3OPVA 4M2LA 1UPBA 4B2LA 3COJA 1BZYA 1MG0A 2BONA 1X94A 3BFJA 4LK3A 3DLAA 2F3UA 4K9PA 5B2EA 2PBLA 3HG7A 5BUSA 1SD1A 3UHFA 2QTGA 3NAZA 3DDUA 2PS3A 1RXCA 3HKBB 2E0IA 1ORHA 5BV7A 1PP4A 3KB1A 5KHAA 2C77A 3OE4A 1ATIA 4O2AA 5GAJA 4WOBA 1O2DA 2YQ5A 2QTNA 2E21A 2QVXX 5FOVA 5ICCA 4BNGA 2QZSA 1GCGA 3MELA 4ZGGA 5JW6A 4BMOB 3KSBC 1A5ZA 1NNUA 1T0BA 1N8TA 1VPWA 3MS2A 4MUFA 5FO0A 4RM2A 3HO1A 2REQB 3N5CA 5KKCA 1MTOA 1AUQA 1IU9A 4I81A 4K6MA 1LDMA 2E6UX 5JDCA 1V96A 5H02A 1ULBA 5E9QA 3P2YA 4YP1A 1V3VA 5EE9A 2VDMB 2I2DA 1Z0ZA 3UUWA 1DKMA 1G1MA 1NF9A 1R9JA 3MTAA 4GRAA 4DJAA 5BPHA 4CMKA 1YD7A 4CI9A 3WIBA 4D57A 5K3SA 3O93A 4U63A 4UHCA 5E9JA 1C41A 1QGAA 5H83A 3H9UA 2ZBPA 4INOA 1DXHA 1SUIA 4WKNA 5CA0F 4OOEA 1GLNA 2PO7A 4LJYA 1K5DA 3EN0A 4GI1A 1TVCA 1UZMA 4WXPA 2OEPA 4FYMA 3ZE0B 3GRYA 2O20A 1CZRA 3ZHUA 4LYAA 1ZJ5A 5B3KA 4RQUA 3WVNA 3PSHA 5KJCA 3QWAA 2RSLA 2H1FA 3SC3A 3O8QB 3WI7A 1KXJA 5DEOA 4WEQA 3BMQA 1T2DA 1G8GA 4QTUB 4ALMA 5I01A 1P6QA 1KI2A 3WQHA 2GPBA 2MDTA 3RYHB 4ED9A 3UAVA 5KNDH 3DHYA 4DRXA 1VKHA 2RBEA 3L8YA 5AKEA 3RFUA 1QLHA 1CSEE 2E1PA 1J5PA 3DBRB 4FD3A 4EHAA 2VDPB 5KJ6A 2RG1A 2YKGA 1KH3A 1XNQB 4ZI7A 4MB6A 5F5XA 2W8BB 2Y27A 3EVEA 5I7FA 1S8OA 2AN5A 5FA6A 1N0UA 5EI5A 3HBLA 4EDFA 3COSA 2WF5A 1DX9A 3GT4A 3H16A 1N3BA 3NRCA 4RETA 2RI6A 4MGZR 1ABBA 3O4HA 1GCUA 1L5MA 2E4UA 4F3NA 1WJGA 3ESAA 4YCCA 1HE5A 4L4UA 4G0QA 3IBGA 4ZQBA 5JY1A 1DGQA 4W1QA 3E9QA 3H9EO 5K3AA 7REQB 3HADA 2QN9A 3FN4A 2C2ZA 3DBLA 4CCSA 3DOOA 2FPSA 4XYGA 5KC8A 4BVJA 2G82A 3A1WA 2OGTA 4Z0NA 5EWMB 5HFNA 2FWAA 4C4RA 3NR2A 5JSFA 1RRKA 4UMFA 3LVBA 1YJQA 1TECE 4H4DA 3BJIC 3KSZO 3EDRA 3UCXA 5KWVA 4V0RA 3W5DA 1TKBA 3NH9A 5DT2A 5AI6A 2JHFA 1NXPA 3W78A 3ROKA 2ESRA 3VYVA 3Q3VA 2I2CA 4Q5IA 1K4YA 4AJKA 1AHNA 4XI9A 5A7FA 4IZHA 3KSUA 2PUDA 3H9BA 1FYVA 2GAOA 4Q1FA 2R3SA 1C7IA 5HG0A 4ZI5A 1XD9A 1GL7A 3NHRA 2ON6A 4K6KA 1YB2A 1CV2A 3HYTA 5I4IA 2GF0A 1OQAA 4RKQA 1RAHA 2HF9A 1C3LA 2XEDA 1P5ZB 5M29A 2A0YA 1I51A 4V1CA 5A7HA 2B94A 3FX2A 4MS1A 1HE4A 1VRVA 3K9WA 4YMTA 5KZMB 2B4YA 3I23A 4UCWA 2UZ3A 3S3TA 2XVXA 5KU1A 1EK0A 1Z3CA 3RLIA 4KIFA 3YASA 1GDTA 1CC1S 1P0PA 1SMKA 3T34A 3SVLA 4GIBA 3WB9A 5NLLA 3ZX4A 4JYBA 3PGVA 1ONPA 3WKEA 1LPNA 2AT1A 3GN2A 3DV9A 4MKHA 5DSTA 1E18A 4IIUA 3IL2A 1DZIA 1SUSA 1XNGA 3VR1A 1RAFA 3H5TA 5H68A 2M1XA 3IT0A 4DAOA 2WOOA 3DFMA 4QTYA 1HA3A 2FPIB 5IF3A 2ZBQA 3FKJA 2R6ZA 2PWAA 4GVPA 4W8OA 2II6A 3GROA 2WPDD 2Q2WA 4DILA 2C2YA 1TYZA 1WUJS 1YT5A 2CLFB 2FUCA 3JATA 3HXMA 2HBZA 2EKLA 3FTDA 1QMPA 5CLHA 2HRCA 3DDNA 5SY9A 3ZD9A 1KK1A 4BZPA 4DL9A 3RFCA 3WGZA 3I1IA 3N70A 4MLCA 5FIUA 1NI5A 4O4JF 2XDYA 3KDPA 5ITVA 4ZXPA 5KVVA 1OX5A 4RPHA 1GRVA 1ZI6A 3L93A 2SECE 4PSUA 1MO5A 5AJXA 3ZBPA 4PLWA 1C4OA 1OWNA 2ISCA 4UNRA 2FFQA 4Y2UA 3A6JA 3EBOA 4MEJA 3G82C 1A9TA 3WX0A 4ZCQA 2VZ8A 4JC0A 4TKUA 1PZXA 1XUOA 4G8CA 3K9LA 1UP4A 3T61A 3ULKA 1E5QA 1HBJA 2G40A 5IVKA 3WQSB 3ZJTA 3K30A 3RYFA 5AI8A 4I3HA 3Q8LA 1ISSA 1H2YA 3H13A 3KKOA 2DWPA 4RTOA 1L1EA 1R4MB 4QEKA 3CE6A 3IPCA 4QDXA 4HZGA 1LWOA 5DLEA 1FZTA 1CUVA 1K6MA 3GFBA 2O6LA 4K28A 1FUIA 1R6UA 1W5FA 3ROPA 1MZVA 2ZAIA 4EG5A 3O1IC 2KE5A 5C8YB 2WUVA 1QE5A 1FU7A 5HIKA 4LV8B 4QPZA 5LQMA 1RKUA 5ALLA 2Q9AA 3BMCB 2O9JA 5DLQC 4D42A 1PAUA 4HTFB 5JCOC 1H66A 5K3OA 2K4MA 3Q5GA 3EQ9A 1T1JA 1T6NA 4P7GA 1LEHA 3OLXA 4ZHQF 3S27A 3MGBA 4JN6B 5EP1A 1WZEA 4IO0A 5KINB 3KAKA 5SZJA 1UC8A 3I3SR 3STUA 3G1UA 4US1R 1V45E 4D6YA 3GOQA 4FFWA 1KI1A 4RHUA 4AW9A 1GL3A 3T0IA 4P5DA 3URKA 3NT5A 4IY1A 5T57A 4FXPA 3SZ3A 1W94A 5DYYA 3V1LA 1QS0A 3VYSB 4Q0MA 3TGWA 3WJ7A 4E11A 1SBIA 3RCBA 1KK2A 1DEAA 1Z2OX 3RT7A 1XPOA 1V7PC 3MJVA 3TQHA 3SLKA 3UB3A 1XOIA 3OZXA 1MDFA 3G0GA 3FPBA 4UNNA 4FFVA 3EIUA 1V26A 4BVGA 4DLYA 1B8NA 1EFPA 1I32A 1NE2A 4LQLA 3ZUPA 3AETA 3PEFA 2OBFA 4YP7A 2WAXA 2VSYA 3PXBA 4CF7A 2NTVA 5JWHA 1NHWA 1N6KA 4NOMA 3Q1LA 2NO6A 3QVWA 4XB6B 3BXZA 1CR2A 1I5RA 1P2GA 5DM60 4P4SB 3G8BA 1YULA 3AIKA 5HFJA 1JJVA 4DGSA 1OLOA 1RQXA 1I80A 1SCUB 3QHPA 3SBDA 4A23A 3MWEB 5L4NA 4F11A 2C58A 5JUWA 3MN1A 3GLGE 3ABOB 2GM3A 1F60A 2B78A 3SX0A 1NVMB 4M1WA 1Q15A 2P2CA 4M9QA 2EDAA 4F3YA 1QP0A 1GPUA 5K3FA 4QQ8A 5KAPA 1E2IA 3RUFA 2C82A 2O2XA 1Q7TA 3R6WA 3TVDA 1GUDA 2D8AA 2JZCA 3JQBC 1XZJA 4IDPA 5CGZA 5A1TA 3WICA 4JNCA 3U62A 1V8FA 4AKEA 3FLEA 1S1CA 5KYGA 2QJOA 3W05A 4AY2A 2PGJA 1G8PA 1KEZA 1N7JA 5TRTA 3W5BA 1T5IA 1Z5PA 2NO5A 3O8BA 4YCAA 1JX6A 2MYPA 3N2ZB 1GTVA 1BQ3A 5CFQA 1QVVA 4GEKA 3W5SA 2UV8A 1IM8A 5JANA 5KX5A 3R6TA 4EGSA 4A6EA 4N48A 4HRYA 3VZBA 1CEQA 1ZVQA 1U2DA 3GG9A 2OLKA 4PU0A 4IQFA 5DYWA 2NU8B 1CUYA 4EB8A 2VTBA 1CLEA 2NMVA 3AKDA 1PTKA 4HFNA 2CFIA 4IFEA 621PA 1WW8A 3L7JA 4P8RA 5KYKA 5HBGA 4N8EA 2Q2NA 3X1DA 1U2DC 4XLLA 5JYDA 4HX9A 4ND7A 3U9LA 4EB0A 1MAVA 2HGZA 3GIDA 4FQ5A 3QNUA 4CMJA 2ATEA 2BFAA 4KXUA 4LZZA 3SDSA 4RA6B 2GXUA 2YIJA 5THKA 4DG9A 3IIJA 1QX3A 5LZ9A 5I48A 2XGJA 1VCIA 2AKYA 4DEVA 4YP5A 4D3ZA 3AUTA 5HPYB 3OCCA 4G4SO 4KC0A 3W34A 1DUSA 1KZ1A 3UICA 5HNKA 2WWWA 4OM7A 5E4JA 1G5IA 2I62A 3UJAA 5I7EA 4BMNA 3BHJA 3HVKA 1HQYE 2BBTA 2HWWA 4Q00A 4CM7A 1GLVA 1P5FA 1ZCJA 3GFTA 3JS5A 1MORA 3VOSA 5BYAA 3DLHA 1QU2A 2FCAA 1D9XA 5CIYA 1LJ8A 4X5OA 4M1OA 4C6SA 4JROA 2BGGA 2R1UA 1PVDA 1YR8A 1YDFA 1GA6A 1C3OB 2ZRMA 1AZTA 1RJEA 2C2KA 4WTOA 3WGLA 3LF2A 5BYKA 2G0TA 4HNRA 4AZ3B 1NF3A 2NUPB 5EE0A 5AESA 3PDJA 2QX8A 4L5AA 4DR6B 1RJ9A 2B1RA 4C4PA 5MDHA 1MRNA 3CIOA 4EQZA 1HKHA 3L5OA 2C95A 1YONA 5HBRA 5A3SA 1N6LA 1N7GA 4ZVLA 3WL3A 4DLNA 4F45A 4UU8A 4CG1A 3HXTA 3H1EA 4B3MB 2CUZA 1CQJB 5JBIA 3EIXA 4O0LA 1J09A 4N6NA 3TSOA 3THXA 3RSHA 4BQQA 5IWCA 3M81A 5IULC 2PKCA 3W5VA